(data stored in ACNUC7421 zone)

EMBL: CR628338

ID   CR628338; SV 1; linear; genomic DNA; STD; PRO; 131885 BP.
XX
AC   CR628338;
XX
PR   Project:PRJNA13127;
XX
DT   03-OCT-2004 (Rel. 81, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Legionella pneumophila str. Paris plasmid pLPP, complete sequence
XX
KW   complete genome.
XX
OS   Legionella pneumophila str. Paris
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales;
OC   Legionellaceae; Legionella.
OG   Plasmid pLPP
XX
RN   [1]
RC   (er) Nature Genetics online version available ahead of print (2004)
RX   DOI; 10.1038/ng1447.
RX   PUBMED; 15467720.
RA   Cazalet C., Rusniok C., Bruggemann H., Zidane N., Magnier A., Ma L.,
RA   Tichit M., Jarraud S., Bouchier C., Vandenesch F., Kunst F., Etienne J.,
RA   Glaser P., Buchrieser C.;
RT   "Evidence in the Legionella pneumophila genome for exploitation of host
RT   cell functions and high genome plasticity";
RL   Nat Genet 36(11):1165-1173(2004).
XX
RN   [2]
RA   Cazalet C., Rusniok C., Bruggemann H., Zidane N., Magnier A., Ma L.,
RA   Tichit M., Jarraud S., Bouchier C., Vandenesch F., Kunst F., Etienne J.,
RA   Glaser P., Buchrieser C.;
RT   ;
RL   Submitted (05-AUG-2004) to the INSDC.
RL   Buchrieser C., Institut Pasteur, Genomique des Microorganismes Pathogenes,
RL   25 rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL   cbuch@pasteur.fr Phone: (33-1)-45-68-83-72, Fax: (33-1)-45-68-87-86
XX
DR   MD5; 353ebd5c075f57a96c9b8d6fd77ce51b.
DR   BioSample; SAMEA3138252.
DR   EnsemblGenomes-Gn; plpp0110.
DR   EnsemblGenomes-Gn; plpp0141a.
DR   EnsemblGenomes-Gn; plpp0141b.
DR   EnsemblGenomes-Tr; plpp0110.
DR   EnsemblGenomes-Tr; plpp0141a.
DR   EnsemblGenomes-Tr; plpp0141b.
DR   EuropePMC; PMC2876543; 20351136.
DR   EuropePMC; PMC2888818; 19400772.
DR   EuropePMC; PMC3584888; 23319553.
DR   EuropePMC; PMC4672373; 25141909.
DR   EuropePMC; PMC5225317; 28074027.
DR   EuropePMC; PMC5338858; 28212376.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..131885
FT                   /organism="Legionella pneumophila str. Paris"
FT                   /plasmid="pLPP"
FT                   /strain="Paris"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:297246"
FT   CDS_pept        complement(66..941)
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="plpp0001"
FT                   /product="hypothetical protein"
FT                   /note="highly similar to partition protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17178"
FT                   /protein_id="CAH17178.1"
FT                   /translation="MSNIELKGLKLLRALDNSFQDGESIPSESITHLAVELLNSGKYQP
FT                   RQQFNESILDELANSIKVQGIIQPLIVRKITEERYEIIAGERRWRAAKKAGLTYVPVII
FT                   RNIDDNVALAFSLIENIQRENLNPIEEALALNRFREEFEMTHEDIAQMIGRSRVSVTNT
FT                   LRLLSLDSRVIEMLNEGKIDMGHARSLLKLSPEHQYQVACTVIEKQLNVRDTEVLANRL
FT                   KLSGNNERDKTFSFATRHDKCEEWSTYLSQQFTTNVSVKVNAEGKGKVIIEVNSASEVD
FT                   WLIKLMSERG"
FT   regulatory      complement(949..954)
FT                   /gene="parB"
FT                   /locus_tag="plpp0001"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1297..2505
FT                   /transl_table=11
FT                   /locus_tag="plpp0002"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to partition protein SopA/ParA"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17179"
FT                   /protein_id="CAH17179.1"
FT                   /translation="MLDPQIITYGTDHPEQLMDKFYQAGNEMLLTLRNFVINPEKRKKP
FT                   RTWGAIEAAKMVKVSDPTFRKLLESSDDIPGVVIEDSENGRKVKKYTLAAINALRDKAE
FT                   TRYKRPKGSKCLTIAVSNLKGGVGKTETTVDLGKKIAIEGLKVLLLDFDAQGTATLISS
FT                   GLIPDLELRYEDTITNVLISNPNNIKNVILKTHFDGLDIIPANLAIQDCDLILPNEKEN
FT                   NHERLGSPFIRLSESLKIIKNQYDVILIDCGPNLGLLTLNAIIACDGIIIPIPPSMNDY
FT                   SSFIMYTATLRNMFKELPSKKLEYLRILISKHSGSNEALQMENMMREQFGRYILTNHMC
FT                   ETVEVAKAANEIGTIYDVSKPRGSREAYRRALQHLDDVNLEIINNFKEIWEKQSKASFV
FT                   SGE"
FT   CDS_pept        2507..3514
FT                   /transl_table=11
FT                   /locus_tag="plpp0003"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical replication protein RepB"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17180"
FT                   /protein_id="CAH17180.1"
FT                   /translation="MDNSKRNVHNSGPLGMLMKSGQVKKIETAEEEVVLKQAAPKAPSY
FT                   FKTQSGIEFAEQELIYVNPEECEPWKYANRQEGELGDIDGLIDSIKSNKQLQPALVRNH
FT                   PNPHGKIKYEVIFGRRRHIACMRLGIPFLVIRKDIPNVQDAIASQDAENKLRNDVSNYS
FT                   NAMLYKRLLSDNVFKTEKELSEKLRISYSTFNELMAYSKIPEDIVDAIPDVHTLSKQLA
FT                   VTIVQLLNKSKSNYDKMLSIANQLGKTITSQAKLEKIFEEKTLLQKNETKTTSNAKSYI
FT                   SINGKKLFTFKSDYRGLPSIVLNKEIASFVNVEDMCKHVSNYLEQIVAESEYSD"
FT   CDS_pept        3552..4841
FT                   /transl_table=11
FT                   /locus_tag="plpp0004"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical replicative protein RepA"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17181"
FT                   /protein_id="CAH17181.1"
FT                   /translation="MEKRMGSVAINNKSLELKKHVNAIHCSNNLSLVQRKLFNALLFNA
FT                   YPDLPYKQQFEIRGKDLYQLIGYNSKDTAKLKEALIGLITIAIEWNVIDCSTGQEKKWK
FT                   ASSILASAELSNGICIYEYSQVMKDLMYQPEIYGQINIDLISKFKSGYGLALYENCIRY
FT                   KGLAQTPWFPIEIFRKLMGVFDGKYQVFKDFKKRVLDVGVNEVNTVSPIRIVPEIERVN
FT                   QKVTRVRFKLEKQVDESPIQLNNLSIDEELKQILINTFGFSTQMIDETYAKYDSEYIRE
FT                   KVEIITQSESFVAGKIRGLAGYLIEALKKDYKLSRSSKAVINERRKILEAKEKEKKEKL
FT                   EEQSERYKQYVNKKINTYLDKLTEHQKSDLNNDFEEFIKEQSSILKNWYKKHGLDHPAT
FT                   KASFHSFIKENKHNEIGTIISMEDYIELVQ"
FT   CDS_pept        4992..5558
FT                   /transl_table=11
FT                   /locus_tag="plpp0005"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17182"
FT                   /protein_id="CAH17182.1"
FT                   /translation="MKTICVYLGASSGSNPAFQKAVIKLAHEIVAHRLSLVYGGSSLGM
FT                   MGLLAKTVKELGGKVVGVITTHLLDKEKPLDILDELHIVSSMQERKRMLQQLADAFVVM
FT                   PGGLGTLEEAIETWNAIKVGELDKKIGFLNVDNYFIKLFSFIEHCNKSGFILAEQTAIP
FT                   SMQIEPKKLLRDLILLKYEEIDCVM"
FT   CDS_pept        5591..7045
FT                   /transl_table=11
FT                   /locus_tag="plpp0006"
FT                   /product="hypothetical protein"
FT                   /note="similar to major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17183"
FT                   /protein_id="CAH17183.1"
FT                   /translation="MHAVRGEKKGIVYLHWLNAVTTFSFAILFSSLSLYLTKNIGLTQM
FT                   QSNGVVGFFLASNFILHFVAGYIGDRFLSNRLLFAISTLIQTLGLIVLNFSESFVYLGL
FT                   SLFLIGCGLGSTCINCLITQQFTSNENELREKAFFYNYSAMNIGFLSGYVMSGFIDIND
FT                   RYDRLFEVSNLINLITVFFIIKSWRYFAKDNVNIREEIKRGQLGLVLIILIIPILLVGF
FT                   YYSWLANSLILFIGAAALLYITLLGRSLSPHNARKKIYSFVFLTGSSIVFWMLYFVGPM
FT                   GISQFLKYNVNIYMGSYYIPPQWLMNLNSIFVIIGSPIAVKLFDKLRKKQITISISKQF
FT                   MSSLLFIALSFLALTVGIENCGTDGLTSMSWIIVHYLLQAIGELLIAPVGYAMIGSLAP
FT                   EKLQGLMMGIWMMASGIAATISNYFSNLMTQSESLNPLISNEHYLGAFTQLGFYAILGA
FT                   LILWFCSKTIENSIQKNSTEAIKGMA"
FT   regulatory      5629..5646
FT                   /locus_tag="plpp0005"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(7047..8069)
FT                   /transl_table=11
FT                   /locus_tag="plpp0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17184"
FT                   /protein_id="CAH17184.1"
FT                   /translation="MNNSIYYLGFNKLLSLTKCSKEALLLDKIIFHHQGTLLKRDNRLW
FT                   FTRKIPDLAAELGFSESRIYIYLKSLEEEGLIIRKRFKYYGVPRSFIAITETLQNKLQL
FT                   IYKEPETIIEIKEKEITPEPDINERMDYLVSTDTINKEKNRVINNITFPNSDNKLPFTE
FT                   LNIVKGMLLNVQKQHGVKLSSPQKVFDEVVFSLNNQEQFQKIGTFQHKINIISQLLRTN
FT                   RWRTPKGFNKYSPEGKHYQEKQDQEKAARLQLKKEECTYSGLDEIATNNRLCNGYELAH
FT                   HPSTNKELQKSLQIQQSLINGIKKDIKTIKNRNILDNFLKILAQEETKLSKLQAELSLQ
FT                   "
FT   CDS_pept        complement(8091..8285)
FT                   /transl_table=11
FT                   /locus_tag="plpp0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17185"
FT                   /protein_id="CAH17185.1"
FT                   /translation="MTIDHVDNQIIKMIVSGCHVNDIAEDTKKSKRYILYRLSDLKTSF
FT                   NCKTTPQLIYMLTTSGLIK"
FT   regulatory      complement(8291..8296)
FT                   /locus_tag="plpp0008"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8469..9731
FT                   /transl_table=11
FT                   /locus_tag="plpp0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17186"
FT                   /protein_id="CAH17186.1"
FT                   /translation="MSELSWGKVKTDIARVNKRLYEVLETIDGIQNMLFTVLEYQYGQI
FT                   IADEHHFYLPNTGGRLSSVPFSMVLEKNLEMFIEFKGKSSTHQVYREGDFLSVSSLYNA
FT                   SNTHHPTDILQISSGARNTFLLCPVADARPHASLEKYFKADIPVPDDLGKHYLTFKSLC
FT                   DAANCNWRSRLLVFPSEIVTLIKENKLPTLLSLVMEFDSNQTGYYANLPFYNYLMAYVR
FT                   ANNPEISQNEFTNNAISQLITIGTGQVPGYGLAVGDDLLPLDFIVDLYRDIYKSKYTPF
FT                   VMEPVHFDKNKNDPVFYSILKEEMAFKPTSFSNKPQRCELIFDTYLQYAEHINKLGHFK
FT                   STPFFESATNLELTLFHEKNNQVTNNLFKLPRETIFSYDPRFLEVTDKLGYSVEQFPSK
FT                   TTFLVGCFGIKYNENKETVMH"
FT   regulatory      9677..9682
FT                   /locus_tag="plpp0010"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9688..10866
FT                   /transl_table=11
FT                   /locus_tag="plpp0010"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17187"
FT                   /protein_id="CAH17187.1"
FT                   /translation="MVLNIMKIKKLLCIDPLQDYELIDCDLLIQLGISPIFLIKDVSKF
FT                   VKDRENVLVSSFSFEDLLAICDSIRPDYIVCFSEDMFVDIAKVRENLNIAGMSLNTSML
FT                   LSHKDLMYQKLDGLFSYPKTTTLIESSNLKSIKEKIGVQEIFIKPINSSGSYETYHIKT
FT                   EEEFCNFLLNKKENEEKYIVQAYVADDLYHSELAVFDGNILFVEARKYTHPNHLMVSKN
FT                   LPIFSLNILDAHQRQLILDASIKVCQLLEFNNGVLHTEFFMSKDGYIQFIETNPRPPGI
FT                   GLNKLYQKKYSISLETILCCIVCGIEPPRLVKNKSYYVCGYFPTKNGVIKRINKPELSV
FT                   QNEWTLFVRPDDTSEQMAHMSKSALVICWDDSITEINQTGNFLAEQDIVEIY"
FT   regulatory      9781..9792
FT                   /locus_tag="plpp0009"
FT                   /regulatory_class="terminator"
FT   CDS_pept        11016..11267
FT                   /transl_table=11
FT                   /locus_tag="plpp0011"
FT                   /product="hypothetical protein"
FT                   /note="similar to molybdopterin converting factor 2
FT                   (subunit 1)"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17188"
FT                   /protein_id="CAH17188.1"
FT                   /translation="MHKYQLIEFNSDRKQIQLVSNKSNLQQVLAEFYKENFEKMFDDSG
FT                   CSKGYISVFVNSEQISSIKDITLKPNDEVCIVTSISGG"
FT   regulatory      11258..11263
FT                   /locus_tag="plpp0012"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11272..12294
FT                   /transl_table=11
FT                   /locus_tag="plpp0012"
FT                   /product="hypothetical protein"
FT                   /note="similar to molybdenum cofactor synthesis protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17189"
FT                   /protein_id="CAH17189.1"
FT                   /translation="MDRYKRQISVIGEQGQKLINNATIMIVGLGGIGSPVAQYLAAAGV
FT                   GKLILVDDDKVDLSNLHRQILFNESDIGFYKAEKARDVLSKVNKNVVIEAHTKRFDVDF
FT                   GYSLVSDIDLIIDGTDNFETRYLINDICVLKNKVFISCSILVNIIQLALFGTKHLCYRC
FT                   LYPNPPPIGVIPNCSEAGVLGTVTGIAGTMAANLALNYLLKIENEKVPQIRIIDTKNFN
FT                   ISSMPIKQNNNCFACKQRKISLRYLQNQNADYGISLEQLDRTKHFLVDIRQKEEREIAK
FT                   LDDDLFFPIKENTDYSFFLSYKDKKLVFYCASGYRSKLFVSELRTLGIDAYYLNERLSK
FT                   "
FT   CDS_pept        12291..13352
FT                   /transl_table=11
FT                   /locus_tag="plpp0013"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17190"
FT                   /protein_id="CAH17190.1"
FT                   /translation="MIFEHTETSLRARNYGETLSVLSHFKKLAGITRLADLTHLDYTAL
FT                   PVYTAIRPRAKSLTTSQGKGFTKEAAQCSALMESIEVYFAEELAPQLTNKSELELVQDK
FT                   AVFLPINHLSKSVHFSDSSRPMNWVQAELVFAEKTIFVPFSEYSLNSYLPEVLIYSPDT
FT                   TGLVGGNNYKEALLHGILEVIERQNAQQISEIAFVNGKMVKNITKKFDCHIYFHENIYE
FT                   IPSFEVLIKSKNPFENQILFKGGGCHLNKQIALNRALTEAIQSRVTTIAGSRDDLIHTK
FT                   YDFKTSEFPVVTDKKGFAELPNYSVETIDDALSVLFEKIKGKNQDILVYKYYDKEICIL
FT                   KVKLVSMDLISHA"
FT   CDS_pept        13345..14379
FT                   /transl_table=11
FT                   /locus_tag="plpp0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17191"
FT                   /protein_id="CAH17191.1"
FT                   /translation="MHETVVFLETSLTYQEAIHLLPHAMYLPSIKKGDVLKAIKAGYKR
FT                   IVIIDGNFSWVPSVWHKEILTALDYGIEVWGAASMGALRAAELDSFGMRGHGRIYEMYK
FT                   NEEVDGDDEVAIAYSKFNNVQTIPLINIRLTLERLNSINNETVLNSIRSIFYAERTWVK
FT                   IARHVSEDLYHLIKSNYIDAKKEDAKSLLLSLNQQHILSTVSDLNRKKREFTLFEKKLI
FT                   ESTLSSVWLRAPMHEQTECSASQQRAENILKLLSIPETKKNRIHYQYLLSLLDQQTYAI
FT                   TEYELIYQVEQFREEHNLLKGEDFFNWLKDMGLHESNLEQLFTDYVKLMKHLIITYDFN
FT                   SYFN"
FT   CDS_pept        14492..14677
FT                   /transl_table=11
FT                   /locus_tag="plpp0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17192"
FT                   /protein_id="CAH17192.1"
FT                   /translation="MTVEQEVFDILESCISCLQQAALNIGGFDFDKHAQAAIYAYSLLR
FT                   RQQLFLMYPIENETVH"
FT   CDS_pept        14712..14972
FT                   /transl_table=11
FT                   /locus_tag="plpp0016"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to carbon storage regulator CsrA"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17193"
FT                   /protein_id="CAH17193.1"
FT                   /translation="MLILTRRVGDTVVIGNEVFCTVLEQQHDGQIKLAFDAPKSIPIHR
FT                   FEIQKQIMQKIIEGTYTNDVAWNETVIERLTSQFNRVSHWN"
FT   CDS_pept        14997..15743
FT                   /transl_table=11
FT                   /locus_tag="plpp0017"
FT                   /product="hypothetical protein"
FT                   /note="Similar to E.coli TraT complement resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17194"
FT                   /protein_id="CAH17194.1"
FT                   /translation="MNAYIKSGLTQSLLVGAMIVLTGCAATHTVLEHGSLQVSTGQSDT
FT                   IFLHPVSSAQKTVYVSVRNTSDEEVTIQPQLKTALMNHGYKVLNNPDAAHYILQANILK
FT                   IGKMSASASQSALLGGYESAIAGAVVGTAAGSFTNSTAGMVAGGLGGGLIGMAADSLVK
FT                   DINYTMITDIQISEKVGKGIKVKEQVQSNLKNGSSTMISQKYSRDSKYQSYKTRVVSNA
FT                   NKMNLKFVDARPALEQGLVKTIAGIF"
FT   regulatory      15826..15831
FT                   /locus_tag="plpp0018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15837..16181
FT                   /transl_table=11
FT                   /locus_tag="plpp0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17195"
FT                   /protein_id="CAH17195.1"
FT                   /translation="MSAIKILMLSMTFLVGSGVAYAEPETGLENNVKLNQVLTANIPMN
FT                   EEQDVEYFKHIFTNGGLYEFLLALNTEVPELSKTAEYVALYKKLDLTNQVLSQILVELK
FT                   KNNQLLSQKE"
FT   CDS_pept        16301..16657
FT                   /transl_table=11
FT                   /locus_tag="plpp0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17196"
FT                   /protein_id="CAH17196.1"
FT                   /translation="MKQMKLKKSSVFLSTLLLSGAVFSASLDKEELASECQFLGASLSQ
FT                   LAKANLKEYCTIDVGYSGSMMEQSASLIRGERMELARDNLDFANRTFARVASNYNDCPY
FT                   FSVVAEYKLIPFAD"
FT   regulatory      16701..16706
FT                   /locus_tag="plpp0020"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16712..17758
FT                   /transl_table=11
FT                   /locus_tag="plpp0020"
FT                   /product="hypothetical protein"
FT                   /note="similar to transposase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17197"
FT                   /protein_id="CAH17197.1"
FT                   /translation="MIQLEESKMIHILYKQGYSKKAIARKLGMSINTVRKYLKSGSEPY
FT                   YKRRDKKPLKLDPYKAYIQKRLKDATPHWVPATVIYREIKLFGYDGCSSQLRAYMHTLR
FT                   SKKEDVIVRFETEPGQQMQVDWAQFRRGKDRLSAFIATMGYSRASYVEFVSDETLETLI
FT                   ACHKNAFEYFGGVPYTILYDNMKTVIIERNGYGLSQHRFQAGFWDFAKHTGFRPKVCQP
FT                   YRAQTKGKVERFIHYLKYSFYFPLVGQLKALGLSLDKETANMHVLKWLNEIANQRVHAT
FT                   TGAIPFERLLDEQAKLQPLSSTYSGKLFSHLENKEVHYFAFQLLDNTAMQHELSIYQKL
FT                   LERTEEAA"
FT   regulatory      17745..17750
FT                   /locus_tag="plpp0021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17755..18549
FT                   /transl_table=11
FT                   /locus_tag="plpp0021"
FT                   /product="hypothetical protein"
FT                   /note="similar to plasmid DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17198"
FT                   /protein_id="CAH17198.1"
FT                   /translation="MNIQHERILSLCERLNLSAIATNYSYLAQEAATHNQGFSDFLENV
FT                   LTVELQEKQYRSRTLLTKMAGFPMIKTIDDFDFKFASGVPKNKIRELTSLAFIERQENI
FT                   LLLGPSGLGKTHLAIALGYLAVQANIKTKFISAADLMLLLETAHRQGRYKDIMRRVINN
FT                   ARLLIIDEIGYLPMNRDQANHFFQVIANRYEKGSIIATSNLAFGQWDNTFAGDKVLTAA
FT                   MLDRLLHHAHVIQCRGDSYRLKDKFKAGLIQNQKEEQNNITD"
FT   regulatory      18702..18707
FT                   /locus_tag="plpp0022"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        18713..19036
FT                   /transl_table=11
FT                   /locus_tag="plpp0022"
FT                   /product="hypothetical protein"
FT                   /note="similar to fimbrial protein precursor (Pilin)"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17199"
FT                   /protein_id="CAH17199.1"
FT                   /translation="MNVSAVIRKSSIKLYEFMRWSLPLLVLSWLIVLCLTNIGYAEGQN
FT                   YLSGVKSDVSATFGKNSDLPGYLYAGETLVAGVTWMKTKSPWVFVGLPLLMIFTHWGLS
FT                   YVA"
FT   CDS_pept        19026..19316
FT                   /transl_table=11
FT                   /locus_tag="plpp0023"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to conjugative transfer protein TraL"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17200"
FT                   /protein_id="CAH17200.1"
FT                   /translation="MSHNYSTFMLSEEPRIAGIPLTTGLPVYLLTGIGLLIGYAPQLFV
FT                   IGAVLSLIMHVQFGGLPLRVLLGIIYWSLPHAITTLIFRSFPNSAHRIYVG"
FT   CDS_pept        19321..19878
FT                   /transl_table=11
FT                   /locus_tag="plpp0024"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to conjugative transfer protein TraE"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17201"
FT                   /protein_id="CAH17201.1"
FT                   /translation="MNSVFRDNVLSKNKVLLHLTLAWAVTSTIAVFILGGLCVHVVNNK
FT                   ETHWLPICTEDGYFLSNSFFSPSYIKDMTKKVIQLRLTYNPDTVAARFASLVHLIPASH
FT                   QEAFKTILDSESSVVKEKNISSVFYEKDIEIDESTLQAKVKGILNRTSHGLEVKPQSKV
FT                   YLVQFAHLNGMMWPKAIKEVHQ"
FT   regulatory      19862..19867
FT                   /locus_tag="plpp0025"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19875..20594
FT                   /transl_table=11
FT                   /locus_tag="plpp0025"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to conjugative transfer protein TraK"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17202"
FT                   /protein_id="CAH17202.1"
FT                   /translation="MKSLQILMLSSVLSTSLHAGNTAATLKFEEGERFALSLSSLNFNR
FT                   IDVEGERIVKVSFPEHSFIVEQSKETEDDLDGAVVLKPLAHIPLTVYFTTNLNHHFSAT
FT                   ISPIEDLGKTIKLVSKKLKGFDYAKVQEQSQYQQSDLMTALMEGTQPSGFQEVGIKPTT
FT                   FRLHKQLKVTLVKQYRGKESSGYVYRIENQSNKPMELTPTLFEHPKLVTMELSEKMLQP
FT                   SQTAYFYGIYREQSNMG"
FT   CDS_pept        20609..22063
FT                   /transl_table=11
FT                   /locus_tag="plpp0026"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to conjugative transfer protein TraB"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17203"
FT                   /protein_id="CAH17203.1"
FT                   /translation="MMKSFKKLIKKSKKANLNQSAKMEQLRNGLAFLLLGGLCYGFYLY
FT                   SSKPQSTLPTNKKPVFDGVLDSAFSKLSDEAVLEKQQRQIDALKALVEKNKKNTPNKSD
FT                   DLVSENQALLSAMQKQLEQLALENKEINGKLQVALLKNSQTSLAAVAPRPPTREEIEAR
FT                   HKQRILDEKAYYGKAGLETVHFNYRRQQKEERTPDNYVWAGTHAEGILLSGAKGDAGIN
FT                   GAKNMGTALIRLDSNGIMPNNRHSRLNGCLAIVSTYGDLSDDAVVMHLETLSCAKPNLS
FT                   FEQKVYGAVYDLDAMQDLRGTSILKTKPLLEYSAAAGILAGFGDGLKNLNTAQTINPGA
FT                   GTITTYGQASTLMQSAAGGAVSNPANKISDYIMKIADIYHPLVVARAGRRVSIMFTKGF
FT                   WIDRAHQSFESGKSIDNQSAQNEAAITTTISRAGGEGGESSSGESTAPQSTFQSDTQTA
FT                   QQFLNQNGMPNQPLFSTVNPTGDVHG"
FT   regulatory      22045..22050
FT                   /locus_tag="plpp0027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22056..22283
FT                   /transl_table=11
FT                   /locus_tag="plpp0027"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17204"
FT                   /protein_id="CAH17204.1"
FT                   /translation="MVKAWFVLFCCCSAVTLTGCSRSIFDHQDVRCPFVERGGCQSMEQ
FT                   VNRMVDARRFTPDGQYVQQEQCVGCSAYSK"
FT   CDS_pept        22313..24889
FT                   /transl_table=11
FT                   /locus_tag="plpp0028"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to conjugative transfer protein TraC"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17205"
FT                   /protein_id="CAH17205.1"
FT                   /translation="MFATLKKYVQGFRNSIDDYLVDGEESSSQNTLNVGDHQYPLFCKE
FT                   LPYQYYDEESHLFINRWNTGLLYRITPLTGANEKIAEQLDSILRTKVSDEFTLQLILVK
FT                   HNQVGHELDAFSNQFMTPDFEQLSVMGKSLRSFYGEAAVHGFKTNTNVNPRITQTECYV
FT                   VVDKIKGKNEEEVKACFAQFRIAFEASLMSAKIGFRTCNAEDLLRLLHFYLAHEPDNIY
FT                   PKSSSYDPTQLIKHQVVGRDFDVEVAKEGLLFSGVNNQGKAFETVGSVMTIDGLPSEYH
FT                   LWDNINNSANIFHPEQSIPCNHIISVTYLVDEQNKAQGRANRKTSDLDKKAKGDYALHV
FT                   AGTEKKAREWRHFRDDLASGKTRSCKMLYNVVLFSRRSEYARDVEAARTCFSYNGIKLA
FT                   LSRRMQSPYFLATLPFLFTNHLQKGFQLPTMMWPISSWNATQYMPILSDWSGTGSGILL
FT                   PTLRNQFSCIDPFSGKLGTNYNISVTGTSGGGKSFFIQMLMLNVLFNGGDLFIVDVGGS
FT                   YKKLCHTLGGVYLEYSNLAMNPFTHVTNIGKEIQHILSLFQLLACAKDGASDDDRGTLR
FT                   EAILQAFFEHQQATLIDHVQAKLLELHQNDREKYPTGKILAKNLDPYCTHSEHGTVFNA
FT                   PSKLAPDARIIVVDLKEIEDDEHIRAPVLLSILSQFQGRMFNSDRSRQKMCIIDEAWSL
FT                   FSGDQIAVNFINRGFRTGRRHNASFVTITQGIDDYYAFPEARAAWENSAIKLIFLQDGD
FT                   SLVKHQQEHNTFSDFEFKLLSSFPKAKDAGFSQVLIRADGISSFHRLFVDPFTRVLLSS
FT                   DGRDYQAVMNYIAQGRSYIHAAMLVANKHYGLSKNVLVEGGLADAA"
FT   regulatory      24865..24870
FT                   /locus_tag="plpp0029"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24879..25214
FT                   /transl_table=11
FT                   /locus_tag="plpp0029"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to TrbI protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17206"
FT                   /protein_id="CAH17206.1"
FT                   /translation="MLRNYKTQLLILAGLVLSGMVLWSMHKPAPLAVVDMQRLLNQPAV
FT                   LLSQSNLSEQEQKKVLKQYSSLLPQTLSQYGASHHVTLITATVISSGRFDVTDEVIAAT
FT                   LEQLGAL"
FT   CDS_pept        25211..25837
FT                   /transl_table=11
FT                   /locus_tag="plpp0030"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to conjugative transfer protein TraW"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17207"
FT                   /protein_id="CAH17207.1"
FT                   /translation="MKKVASLIAALLMNVAPIYAKNLGNYGQLFPVVEQDIRQVIMAKL
FT                   HRLEQSGALKQHQQQIVARVEEHVRRPKPLHLPTTNTPKTHELDPSIVVNQTLYTQDGT
FT                   IIAKKGVHLNPFERVSFSKTLFFFDADDPKQLAWAKAHYKHFDQVKFILTGGDVKEASE
FT                   VLGSVYFDLEGRLSRYFHLKHVPSVASQKGLVWRIQEIGQYELRK"
FT   regulatory      25836..25841
FT                   /locus_tag="plpp0031"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25849..26844
FT                   /transl_table=11
FT                   /locus_tag="plpp0031"
FT                   /product="hypothetical protein"
FT                   /note="similar to conjugative transfer protein TraU"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17208"
FT                   /protein_id="CAH17208.1"
FT                   /translation="MNKKTLITRFMVLFLLSSLNFIYASQCKGHFVNPITDVCWNCLFP
FT                   LTIGSSEVVKSSYPDTKNPGNPLCLCPTPIGERLGVTIGYWEPAALVDVTPKPWCMVNL
FT                   GVQLNVTKKGLGGSQMPETDGRGAFYYVHWYKYPLVYWLQVLTSLGCMETEDFDILYPS
FT                   ELDPTWNDSELAFVLNPEAVLFTSSSARASCAFDATKALAGTAVNSLFWCQGAQGSTYP
FT                   LTGFVAHQASPISTAALLAERVDFKLHRPPTPAIRDSIGQDWPAVCHTYASSIMPKDRY
FT                   RYQLVNTLPEAHRCHPFGQSVIGWEAGHTYPGDGDNFGFLIWKKRNCCFL"
FT   regulatory      26851..26856
FT                   /locus_tag="plpp0032"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26861..27523
FT                   /transl_table=11
FT                   /locus_tag="plpp0032"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to conjugative transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17209"
FT                   /protein_id="CAH17209.1"
FT                   /translation="MNAFGIFLSSLFLATASHANVNDFLNEASATGKAAHDSVSQDTLA
FT                   HWNATSNQSYAQNKTLIDQIIEQSRQGAPIAQKGQTVDGAVLFVSFSMPEPLLFSLSDE
FT                   AAAYKIPVVINGLIEGDFKKTITVFSKLHAKAKESKWAFNGVSIDPLWFEQFHITAVPA
FT                   LVVSKRPSSCGQQLICPEQTYDVVYGNASIKNSLQLIAQKGDSANEVAQALLENTHV"
FT   regulatory      27504..27509
FT                   /locus_tag="plpp0033"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        27516..29315
FT                   /transl_table=11
FT                   /locus_tag="plpp0033"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative conjugative transfer protein
FT                   TraN"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17210"
FT                   /protein_id="CAH17210.1"
FT                   /translation="MSKWVVLMALLSMGCFANQTGTDFNAFKNYAKSLNAQPKDAMHGF
FT                   DPHALFDQYSEHPAQEGYYQGIQKEQTDLSSQANAAIKNDPGAKTVIDHFGTNKFELNQ
FT                   ANSVLAQSQLIQDESYAITHGQSNDRVQCSNQKPTCTIKTHEEQCFSSRLLPDQTCTKY
FT                   LKVLVDSEKVVQRADFSFYVAKKWTGVITVNLVTGAITNAVGGSVPYPIRMKHSCDGMS
FT                   ATIHSIRNNGANAYWVQVIGTPTCANNGLLTFYINKGWGRIYPIQVALTVTAHSKPYIS
FT                   QEYWDNHCMSFENKGSLCRIKKEQCTDTQSPKVIDGLPVSRACWAKELTYSCSSAAADE
FT                   CITQKNKGCFQTASECARFDKQTCALYKQTYSCQENVCEAPIECIKDLFCADGDCTEHS
FT                   QTQNTDFGQSVSSLAVVGEAGHELSQQPNASLFGGKAVQCKIWPLDLIDCCHDKGWGKD
FT                   IDLLHCRDEDKALGRAKLNYVAHYLGEYCSEEVAGVCLEHKRSYCVFPSKMARIIQEAR
FT                   LTQVNGHGLGDAEHPTCAGMSVAELQKMDLGRVDFVTPIYPFGYGTPNKAAGIAGDLKI
FT                   KSQDPKKSIDEVTRRMQKKAGEL"
FT   CDS_pept        29312..30100
FT                   /transl_table=11
FT                   /locus_tag="plpp0034"
FT                   /product="hypothetical protein"
FT                   /function="putative pilus assembly and synthesis protein"
FT                   /note="Similar to putative conjugative transfer protein
FT                   TraF"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17211"
FT                   /protein_id="CAH17211.1"
FT                   /translation="MSRLLMLMVWGLFVTSLHADIVQEHAKGFHWYSVEEAPKPIKKTL
FT                   QPRPAPVVKSPYERLMDKRKETLNKLAEALIAPSFNATHEYMKAQMDYSKNNQQFVRYW
FT                   QQVLLVHPELDSTLNFPTDNSAIAVRNDAQKVLINKVIQESSVRYGFILFYRGTSSISQ
FT                   KMVMHLLPFIKEYGFSMISVSTDGQLIDGLPNPKSIPLETVQKQVALEAKYMPALYFVD
FT                   LKSNKMSPVSYGFLSLEELKQRIFDVMTQFKRFSYEGVNE"
FT   CDS_pept        30097..30594
FT                   /transl_table=11
FT                   /locus_tag="plpp0035"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to putative conjugative transfer
FT                   protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17212"
FT                   /protein_id="CAH17212.1"
FT                   /translation="MKKRFFLIVLFLLSTQSFANVALDELTQLLDKKQEQQVLARTKNK
FT                   RINALSEQHYFIFIYRSTCPHCHQFAPILRDFASSFHIPVEAYSLDGESLDGFDSANLT
FT                   PELFQTLYVSGEYKPVVPALYLVNRPTNQAYAVLFGEAEPAQLANRVDELMTHLEEKFH
FT                   DE"
FT   CDS_pept        30612..31988
FT                   /transl_table=11
FT                   /locus_tag="plpp0036"
FT                   /product="hypothetical protein"
FT                   /function="putative pilus biogenesis protein"
FT                   /note="Similar to conjugative transfer protein TraH"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17213"
FT                   /protein_id="CAH17213.1"
FT                   /translation="MTMFKKTVAALLLLGTSQLFANAESDLSHFFNNLGFDANVTGSHA
FT                   YQTQAAGYAALGSVYARNQVRTIRLAHVDVPGMRSGCGGIDLFAGGFSFIKSDQIVKFM
FT                   HNILSGGAGYALNLALETELPEIAHAMQFMQKLANEINGTNFNSCEMGENLSAAVWPRN
FT                   RAAQQRLCEDLGRHKGTFTDWAMARQKCSTGGEADSILAEAKNNPEYKDRVLINTNIVW
FT                   DSLQINQFIAQDSKLAEVYMSISGTIVFNAKGALMTYPSLATNQDFIKALLYGGKLPSY
FT                   HCTDTGPQSHCLSIDTTSTQEISAKKALVAQVQELLQGIYDNIKMGKELSDKQKGLIEL
FT                   TQPAVFNLISANAQQNTGIQGSYELAQSVATDLLAQYLSNSLDIIRASLSGSELGAHNE
FT                   ERLYKNLQLAQQFVARFSTESRERFNAALQTNELIRNNVKQALSALTPTLRTAYYGDAQ
FT                   "
FT   regulatory      31973..31978
FT                   /locus_tag="plpp0037"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31985..34744
FT                   /transl_table=11
FT                   /locus_tag="plpp0037"
FT                   /product="hypothetical protein"
FT                   /note="similar to sex pilus assembly and mating pair
FT                   protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17214"
FT                   /protein_id="CAH17214.1"
FT                   /translation="MSLLTIYTPQNGEYLKTVLDAMVTLLSTSTYQSAQDIVSILAVGV
FT                   VGFQYVSGKRIQAISRYVLCTFVFLFCILGIKTPVAIIDMQTADSAGPALTVDNVPLGV
FT                   GLPAALISGIGYGITQVFSDVFHMPNDLDYTRTGMLFGSRTFLASTSSNLSLSPELSRD
FT                   LSTYIRQCIFSAKLLGSQQISPNEMKHSSDLIRLYFEHPSPIYRVLFHDGTNLSCIEAA
FT                   ARLKPELNTGIEKQLVHLSNIMTKGDKEKFSDGLAAAHSYFMNVSKDAANVLTQNILIN
FT                   ATRESALDAFAFAGADAELMNYTNSSSLQKMHVAEANSFWLAGYRLPYYMTVFWMLTLC
FT                   IFPLVMLLALVPGMHGVYMIYMQTQVFLWSWPPMFIIIHFFVSLASSTTLTLFGSKNGG
FT                   VTFSTIDSIASIQSSFAYTAGGLAISVPVIALFIAKGLPNLLSAASQHLGGMAQSLSTG
FT                   EAQSATQGNISMASYSGWNMNYNNTHANKWDTNYQHMEGRATVQADNGALLSQGLDGSR
FT                   VINAQSAMSQMATRLHASDRISASLQDSASQSFQNAQSHRTSADSHYQQALSGLSQFNE
FT                   SDASEVREGTGINRTLSNALNQDIRQMQDAVNQYNQHHDKSGQVSWDAAVSARVDTRKG
FT                   IFGGFVHAATGVSVEGSVSGKTGQSWSNSVQAFFNSSEGQSFSSALSHMESTAKTHHLD
FT                   ANDSFNLSKSEQIAANLSQGHALSDMALAEYSKGEHYQHMANRVKEHSDGMDRVLDQAF
FT                   HDWVVQHHGVQAEKALMGTDASSLSAQQQLADQFMSSSQGQSAVKEQVSRMIHSSSDKA
FT                   KSQFEAQRASMTAHQKALINQAHQDGSGDVLNKSQERHLSQVQDNTIQQAHDLRMENRE
FT                   DLSKAYQHQEGSTQKEIKASEADLANRQAKQKHDYVDNERWYKEGRYE"
FT   CDS_pept        34823..36826
FT                   /transl_table=11
FT                   /locus_tag="plpp0038"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to conjugative transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17215"
FT                   /protein_id="CAH17215.1"
FT                   /translation="MKQSSLQNMWQFMSGGQIFDYKTKMMIQVSQRIFHWAVLGFVVLF
FT                   SLIMAFYASSELKLVVLNHISRFLVKFHYGEYVLWTNLNGSKITALFYQKSPLIQASVQ
FT                   QALDALWRKAQVSLFFGGAVYLLITLLFSRFFIKLGEKYTKDQFVSGTRLASSPKETIK
FT                   SVNESQRGASEIKLLNRLPMPKYSEKQGMLFHGTTGAGKTQAMMMLLEQIRALGEPAII
FT                   YDKECTIKPYFFDERIDVELNPISELCANWKMWRECANPLEFGSFATYLIPKSVQGSDP
FT                   FWVDSARTIFTSMAWKIRDYAEKDPVFLLQLLLTTSLEEIRNILKGTESENLVSKEIEK
FT                   TAISIKSVLATYTKALRFLEGLDKSGKEDFSIKEWIENTTNPKKYNKGWLFITSRSKYH
FT                   KEIKPLISLWLGLAMQGVQSLVANNKGRIWLVMDELASLHRLETISDTLADIRKFGGCV
FT                   AIGIQSIAQLDFIYGTHEAGAIADLLNTSIYFRSPKSKVAKWVSEDLGSQVINEMKESQ
FT                   SYGPDSVRDGNTVGSQRTKRNTVEEGDIMTLDDMECYVRLVGNHPITRLKNKYIERKEI
FT                   CVPLVERSINFDALEKVNHRALMVQNNPQRNDDVKKIHQFETLAHEVSDKDLVPPQSPY
FT                   AEPEPKDHVTANKNDTDAIELREASIVIKEIF"
FT   regulatory      36834..36839
FT                   /locus_tag="plpp0039"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36848..42715
FT                   /transl_table=11
FT                   /locus_tag="plpp0039"
FT                   /product="hypothetical protein"
FT                   /note="similar to conjugative transfer protein TraI"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17216"
FT                   /protein_id="CAH17216.1"
FT                   /translation="MTLNKISAAKDALHYYTNQDNYYLSDRDSLNSLSRWIGRGAQKLQ
FT                   LSGEIEPSQFLQLLDGQLPSGQLLGIIDKGVRQHRPGTDVTLSAPKSVSILALVGQDER
FT                   LLQAHQEAVNITFGRIEQLAAEARITFNGETTFEKTRNLVAAMFVHTTSRELDPDLHTH
FT                   VPILNMTERSDGLWRSLSSRAKNDKEHLDHGFRELIYSNQHYLGLVYMSSLAKKVKELG
FT                   YDIRIKDRYGNFEIVGISDEAITATSKRRVQILDDMKERGTSSAKAAEKSNLSTRNPKT
FT                   EIDSQALHQQWVDEIKDLGIDLGTIIQDSKLNSGRGAVKSTHTTPLSTDAQKAVGDALA
FT                   HLSEYSTQIQHGALVRQAMIFSAGLVGHEDIEREIESLLAARALQGKPLEYYTTAHLLA
FT                   REKDFIAKTTNELKVSFSISVPNHGLTSTVFKNNERIQIIDIEGFRCEKELIQDMVHLA
FT                   EAHQLNSYVLHPGSLKTQQLRADIKHLDTGFISRIKNLFKDDIVHTVSGFQYHYGKHIK
FT                   SSPFLRKKQDLVIVHDAQKLSFDDLSALSDITQAHRSKLILLNNSAGTLGFSAGNPIKL
FT                   LKEQGIHSYKSLTAPIKGALKLSIGKQANESMSSAWLQLTPEQQQKSALVALNNKQKET
FT                   LTSQIREGLVQKGQLSRQMKKVAVLTTVSLTQTEKGYAHSYKVGDKITFYNEGRIPKHY
FT                   KVCEVGVNGLHLENAQGKTSLFAYDAKEDFHVSREKILEVAVGERLINEQSLYHQRVKY
FT                   APKSSFVVSKITEEGIYVRHESNTLFLTNKALSEYHFDYDYCKKPHEIKPDTTQVFMAA
FT                   RPYQLNRNLIGEIGENAQQVLLFTDDEQKAQRFLESVQLKWTAYDVQQKKPDLVYRDMA
FT                   YANKALEREINSLIHHLSLKSEDKEGIAATALTYALAKCTERNAAFKHSDLMTHALMHA
FT                   LGEADFEDIAPLLKGRMADSLVYLDTYWTTKEALHLEEAILKVNYKEQNTVQPIEPSAQ
FT                   KLLSLPETLTQGQKDAITLVVSTSDRFVSIQGLAGVGKTTMMRHVKDIAESNQFQVLGL
FT                   APTHKAVEELNANGIQAQTIDSFLRNNGGLGANHLVIVDESSMIDNEKYHALQQKCIDS
FT                   QSRMVFTGDITQLQSLASGIPHELTIKSQSQKTAFMTEIVRQNPNPELKKAAEFASRRE
FT                   IGKAFELIKNINPEEYVQRKTPVQGLNHSSLIEINCTDEEGKKDYTSIYRAIVDDFLSR
FT                   THECQKNTLIVAHAHEDRTPIEVLIREGLHKQHQLHGQDILCKRLFPVSMDQADQVQAH
FT                   SFEPGDVIRFGKNYSVAKKDDYFTVKSIDREANKLFCVDESQVAFTISASILPKTMPSF
FT                   YKLHERPLASGDRIRLKRNDDARGIIANEEYTVTQVFGETVGLSNSKNQVTLNLKKQLD
FT                   LHWDYSYTNTAYSSQGATSKFMIALELEDRLVVTTHRSHEIDATRASHQSTFYTDNFEG
FT                   LVKRLEDPLKQRDADKTSAVFTEEDYRFKQQKQQRISTQLMNRAQEHILEEPKEQVKDS
FT                   PLIKKYESAQKPSINAEELYNGLLNVSDSLVKSLLGEPNYRLSTQSEYRYGAKGSLKID
FT                   LDSGLWHHFETGESGNLFHLIEREKGLSGFKETLEHAAQYIHYIPEYERKAPQKLNEKK
FT                   EREVKEGKRQLAQKLFQQSQPIQGTIAEKYLIIHRGLAHYDHADLRFCRSVYTKTQDEQ
FT                   KHVPALLAFSKDEQGNIHHVQITKLEPHSANKDKSCESVKQTFGSISNYFVNLNHHGKG
FT                   DIAYFTEGVETGLSILQANEHARVYAVLGKANFSNIDPKDIPKQVVICLDNDGKDTYKY
FT                   AKNEQSNTIIKVAQRLHDSGILVSIMIPKKENTDLNDVLIKEGKDELKKQLNRCMSLEE
FT                   FKKQCALENKESELKKINQDKQIQSLIKQDRKFNAQSDNEFIRLNQGLINGNKERVYNK
FT                   EFVENTRTFNKSRSNREMEREL"
FT   CDS_pept        42895..43176
FT                   /transl_table=11
FT                   /locus_tag="plpp0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17217"
FT                   /protein_id="CAH17217.1"
FT                   /translation="MPRINELLPQEKEELKSIYNRTRLESLLTTDTFKIGDKVYIRDAE
FT                   AKEIWEIHKFISHLSQKPAAILVQKDDHDASYLPVSTITALLEQLILI"
FT   CDS_pept        complement(43309..43629)
FT                   /transl_table=11
FT                   /locus_tag="plpp0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17218"
FT                   /protein_id="CAH17218.1"
FT                   /translation="MEVTIDIGADTLHSLNKIAKMNNNELNVTAAEMLSFGARIYLQSL
FT                   EKRTDESTQLLLENSVRSIQIITEILYSVYNKDLSKIGAYDAETALAMIERMIPNLLKG
FT                   FS"
FT   CDS_pept        complement(43620..44069)
FT                   /transl_table=11
FT                   /locus_tag="plpp0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17219"
FT                   /protein_id="CAH17219.1"
FT                   /translation="MKENDVITLRISEYEREYLNKIAHQFELQKRGSSDISPAKALKFL
FT                   LEFCLHNEISPHKKSENPLQDIRKMIEQIHASIPHLMYHNHYQSLVISSNINDDSLKEI
FT                   KQKTIEYLNDNFSGFQNNSYKEVRFKMNGIGLKTVPIEEGESLWK"
FT   CDS_pept        44445..44891
FT                   /transl_table=11
FT                   /locus_tag="plpp0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17220"
FT                   /protein_id="CAH17220.1"
FT                   /translation="MKLFFQKDVIVDRIKKLIQLLIRIKDCVLEPPPGYLEYQKAIASK
FT                   DEHFNYMENEYFKRHILPYIIKGHGVKQSDHSSINHQQLVNNHSLDTFRVNPVTGLPML
FT                   GSYDAGGSPFGFNFNHSMHHINHHSSISNMHSNNQFNSFDYWNR"
FT   CDS_pept        44933..45136
FT                   /transl_table=11
FT                   /locus_tag="plpp0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17221"
FT                   /protein_id="CAH17221.1"
FT                   /translation="MPLITEDKIKQTEKIRVEIDANVYKEIQAYSEWAKLKGTDTFFEK
FT                   SALYILAKDKKWKASDEYSMIG"
FT   CDS_pept        45305..45622
FT                   /transl_table=11
FT                   /locus_tag="plpp0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17222"
FT                   /protein_id="CAH17222.1"
FT                   /translation="MAIVYNLIRGGVHCMMDINTILLFIIVLVFLRLFDLSNFESTCHQ
FT                   AIDHWLTRKYGIRGFEKRAYKRGFLDLFHEELTLRSHRPITQRECHYAFRVAQYRHENN
FT                   Y"
FT   CDS_pept        45695..46039
FT                   /transl_table=11
FT                   /locus_tag="plpp0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17223"
FT                   /protein_id="CAH17223.1"
FT                   /translation="MNIKVIFKHTFYYLIPLFILLAFIIFSYNAHYEDTSKVPELISLK
FT                   EFSLIAQERGNFRLSFLDTLFINVFDFIVPARFIPKKASLELLDQKRHSLEFNQAGESV
FT                   NQCVRTLNIT"
FT   CDS_pept        complement(46327..46731)
FT                   /transl_table=11
FT                   /locus_tag="plpp0047"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative anti restriction protein KlcA"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17224"
FT                   /protein_id="CAH17224.1"
FT                   /translation="MTTIITSKLVSDQQRLSFLPKHFGTMMIRAEQAIYNTLKVMCSSY
FT                   EGGYWRFYELSNRGFYLAPDMDEPLPIYVEGNGYDGEVSADAAGIITTLCVLNQLCWKT
FT                   KSDKTIQQYYLLRDYIEYHKEAADIYAAID"
FT   CDS_pept        complement(46854..47477)
FT                   /transl_table=11
FT                   /locus_tag="plpp0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17225"
FT                   /protein_id="CAH17225.1"
FT                   /translation="MDVSVKEFLITLYIVGGLITLSYSINSFLSFQRLKIYYNNDLLLK
FT                   RPDVKRYLILKPFLWPYFFVIEKNPIERFSELFFKHYGDEGHTYFRSQGLKNFLNDLFK
FT                   GKNRYKKYQIHTLCWPIDKNSQDWIEHKRLFKGNNFYAHIIYIKMQNEYLVRVSWEKES
FT                   APHPVESISRFELDQCQRLSASEFKTRMQQINANEANKLHLEMK"
FT   CDS_pept        47722..48621
FT                   /transl_table=11
FT                   /locus_tag="plpp0049"
FT                   /product="hypothetical protein"
FT                   /note="Similar to abortive infection bacteriophage
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17226"
FT                   /protein_id="CAH17226.1"
FT                   /translation="MHSKMVFNKPPLSISEQIRHLRQKGLLLDNEQEASQYLTTIGYYR
FT                   LMIYFKPFLISSATNTSQFKPNTRFSDLLNLYAFDRELRLLVIDALERIEVAFRTAISN
FT                   AMSLKYGAHWYLNMDLFSSTEQYQMFLEEVKSHLKRSHEDFIKTYYAKYHHPEHPPSWM
FT                   VMECISFGTVSKLYANIKDRTVRKEIGDTLGQYSEIIKSWMRSLTYTRNLCAHHSRLWN
FT                   RFFVNKPKVSEITISFEHNESPFYLQAYIIHALLKNSSPGNHWRKQLFHLMHNHPSIPF
FT                   SKMGFSEHWEQDGLWLLE"
FT   CDS_pept        complement(48703..49233)
FT                   /transl_table=11
FT                   /locus_tag="plpp0050"
FT                   /product="hypothetical protein"
FT                   /note="Similar to eukaryotic hypersensitive-induced
FT                   response protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17227"
FT                   /protein_id="CAH17227.1"
FT                   /translation="MILDDIFEKKDSIANAVKSHLSETMQDFGFEIVKALVTNIELETK
FT                   VKNAMNEINEQQRLQVAAQAKGEAEKILIVKKAEAEAESKRLQGEGTANQRKAIIDGLS
FT                   HSVEDFQKSVPGVSSADIMNLVLITQYFDTLKEIGSHNKSNTILLPQLPNDIASQLQQS
FT                   IITGNVASADIKN"
FT   CDS_pept        complement(49324..52371)
FT                   /transl_table=11
FT                   /locus_tag="plpp0051"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (Tn3 family)"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17228"
FT                   /protein_id="CAH17228.1"
FT                   /translation="MANLKRIYLLSEAEIADLYARPVFNKSEQRLYFEMNQAELDLLRQ
FT                   FGTTRTKVYFILQLAYFKAKSQFFTFKFDDVKSDVRYILDNFFKNEEALLLGSISRQCV
FT                   SEQKQEILTLFNYQDWSAKQSILIEAHICELLRYYPKGHDTFRQLLSYLDNKRIVIPTY
FT                   RNLQDLFTKAFAKENERIAKLMALIPKIHQEQLIALISRSEGITEFNTLRVDQKNFTYT
FT                   AISDEIDKALVIAELYEFSKHFLPTLLLSKIAIRYYADLADQYAASRLRRLDEPQQWLQ
FT                   ALCFIHHRYQQIMNNLITSFLYHTSGIMNDAKVHADKALSAHNSGLAVDLPKLARFLKW
FT                   FPNRKPGLSHEELNQAAYKILPKEQFPMLAKFLEGNTFDKKAAMREFYLKSSRLFALYL
FT                   RPIVLTVPFVYYKENSDIIALIEVLKNHYGCGKGPATFKLLEEQEALISKTMLPYLKKN
FT                   EGDEQVDSHLFEFYVYQKIYRRLEKGLLCCNESISYCDIDHDLVNDELVDDVEKIAKEF
FT                   GYPKIPIYCKQRLDDALTMLDSAWDKTTKGINLGENAAFNIKETKMGEQDWSLDYDSSD
FT                   SLDDAFFRTLSQVEIPDIMMHIGDRINMWQFFTHMKTRYNKRKKPVALAVNACVLSDAL
FT                   GIGIEKMAEMSDLNYNLLRSTQEDFIRIETLCAANDTVANFIHSLPIFKLWNLMDDKLL
FT                   ADADGQKLATSESTIQSRYSKKYLGKSPGLSVYTLVANSVAVNAKNIGLNEYEGHSLYD
FT                   VIYGNKTDINIDMVTGDNHSLNKLNFVILDSIDVEYVPSIKDIKEATNDLYSVKTPDNY
FT                   TGIITPKGIIDKSRIETQERSILRVLLSLLLQENTQANIVRKINSYARYTELKKALFEY
FT                   NAIFKSTHVLNLIDNMALRKALRTARNRTEGYHQLQGLIRKIYRGVFKGRKIVDNQVSS
FT                   HAVRLVANCIIAYNAIILNTIYEKMLKEGVSQEIIEEFARISPIAWAHIAFTGKYNFKK
FT                   SNGEIDVAAMVNAMEKHLKQYFWRTT"
FT   CDS_pept        52521..53126
FT                   /transl_table=11
FT                   /locus_tag="plpp0052"
FT                   /product="hypothetical protein"
FT                   /note="Similar to resolvase TnpR"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17229"
FT                   /protein_id="CAH17229.1"
FT                   /translation="MKIGYARVSTKDQLLSMQVEALNAAGCEQIHKEIASGAKTARPVL
FT                   DEIIRNLREGDTLVIWKLDRLGRNLAHLIHLTTKLIEKKVGLISLNDPIDTTTAQGRLI
FT                   FGIFASLAEFERELIRERTQAGLKSARARGRKGGRPKGMSQAAMEKAAIAEALYKNGTI
FT                   PVKKIAEQLDISKTTLYLYLRSRNVCIGEKIDALIIRD"
FT   CDS_pept        53129..54202
FT                   /transl_table=11
FT                   /locus_tag="plpp0053"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17230"
FT                   /protein_id="CAH17230.1"
FT                   /translation="MSSNQNPEHNNKEISFRLEKDYLLFLNGLKDRIRTARLKAALAIN
FT                   REVIELYWHIGNQIIEKQNWGSKLINTLSHDLQHAFPETSGFSVRNLHRMRQFAANFPD
FT                   ITIMPQSVAQLPWGHISLLIHKVKNQQELLWYAEQVIEQGWARITLERYIKDGLFQRQA
FT                   IDSVKASNFLARLPNPQSKLAHELLKQPYNFDFLGLHDEAHEREIEHASIEHITKFLLE
FT                   LGKGFAFVGRQIPIGLEESGYFIDMLFYHLKLHAYVVIEFKATKFKPEHAGQLNFYLNL
FT                   VDDFYKMPQDNPSIGLLLCKSRNKFEAEYALKGIEKPIGISEYQLTRAIPENLKSNLPS
FT                   IEEIEAELNEMEGNNDS"
FT   regulatory      54180..54185
FT                   /locus_tag="plpp0054"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        54192..55985
FT                   /transl_table=11
FT                   /locus_tag="plpp0054"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17231"
FT                   /protein_id="CAH17231.1"
FT                   /translation="MTRSDSISSESVHSLPSFIWHYLKDKKLYLLGFVLVALVWAIEMS
FT                   LSPYLLKVIVDNVVQFSPHKTEIFKTIILPAVFYASMSLIINLTFRLYDYINLQLYPYL
FT                   RASIERDLLEYLLNHSYTFFHNTFSGALTKKITDLMENIEPLVTIPNEWFYPRVFAALI
FT                   ASGTLFTVVHPIFGIILFVWAVVFVLLSYFAAKRAENYSRDFSENISRLSGSVSDSVSN
FT                   VMSVKLFDNVHHEISNIDNILGDVVTSDRTLSWFNLKINFLQGLGAFILIASMLAALIL
FT                   GLQNGWVSAGDFALVLTLSITFAWGVHDMGKQMQRYSKVVGTCNQALSIVRQSHEIRDI
FT                   PGATTLKIHKGGIRFQDVSFHYENRADLFKNLTVSLKPGEKVGLVGYSGGGKSTFIKLI
FT                   LRLLDIQQGTIFIDNKDIKKVTQGSLRSQIATIPQEPELFHRTIMDNIRFARTDATEEE
FT                   VIDAAKKARCHDFIMDLPQRYESLVGERGVKLSGGQKQRIAIARAFLKNAPILLLDEAT
FT                   SSLDSKTEDEIHQALHEVMINKTVIVIAHRLSTLKEMDRILVFVDGDIVEDGTLNQSLE
FT                   NKNGHFYKLWQMQVNGFISEI"
FT   CDS_pept        complement(56024..56380)
FT                   /transl_table=11
FT                   /locus_tag="plpp0055"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17232"
FT                   /protein_id="CAH17232.1"
FT                   /translation="MIELLIGIAVLLLIFVLTGLFIVKQQEVALIERLGKYHSIAHAGL
FT                   NFKIPFIDWIAGKLSLRIQQLDVKVETKTKDNVIVQIQVSVQYRIKDDGVYDAFYKLED
FT                   PTQQGGLWKNPQKC"
FT   regulatory      complement(56391..56396)
FT                   /locus_tag="plpp0055"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(56410..57264)
FT                   /transl_table=11
FT                   /locus_tag="plpp0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17233"
FT                   /protein_id="CAH17233.1"
FT                   /translation="MSYLRCHNYLIVINRIFALTLFMGAFLSFPAHSGYSKSFRVAHTY
FT                   GKTKPQQISPVVKHSKFLTGLAAGSILFSQKGHPISYNELDFESPDGELYSEYERNNQL
FT                   LAQGGLPQNKRLALERRNQQIKNRLIAFAEKRYMSAFTLQLVPLKEKVIESKIEKSYNT
FT                   NEKPDIQVKRKQFFYELRFSDESPKPISDFDVVNINEMKPNNAHPYQFTYAETWGNNTI
FT                   KVTLRDKKDKKLVLNLSHSYYVPNAARKDILESMLEKLEYVWPFLFLLLLLNFFFLKLN
FT                   NKL"
FT   regulatory      complement(57191..57213)
FT                   /locus_tag="plpp0057"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(57242..57415)
FT                   /transl_table=11
FT                   /locus_tag="plpp0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17234"
FT                   /protein_id="CAH17234.1"
FT                   /translation="MDYLNLWEQLAGVPINDEDEIEEDFLHFEKGTNKFELWTWFDGKL
FT                   PKGIAHELFKMS"
FT   CDS_pept        complement(57472..57702)
FT                   /transl_table=11
FT                   /locus_tag="plpp0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17235"
FT                   /protein_id="CAH17235.1"
FT                   /translation="MSNISTDGTNSLIQEISIVWSIEDVLDVRPLLSKEQASTVLQHLK
FT                   ENHDATIGINWDVIEIVSDDLFLTEEEKEEE"
FT   CDS_pept        complement(57783..58091)
FT                   /transl_table=11
FT                   /locus_tag="plpp0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17236"
FT                   /protein_id="CAH17236.1"
FT                   /translation="MIKHPLQIGSILYASWGYEQTNIDFYQVIDLIGTSTVVLREIAQE
FT                   KITERNDAFCGKTKAKPNCFIDEPFRKRANEQGRVRMNSFSHASLWDGTALYYSSYH"
FT   CDS_pept        58262..58546
FT                   /transl_table=11
FT                   /locus_tag="plpp0060"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17237"
FT                   /protein_id="CAH17237.1"
FT                   /translation="MKENEVIMIHLNQTNAPLELAFSLNDLLRALMLTSSSTRNQNISY
FT                   SYWNRLSIKRSHRHLSGIKYPCSLPPAVQCTKAVGAFGLSGRAFSWGYS"
FT   CDS_pept        58548..58988
FT                   /transl_table=11
FT                   /locus_tag="plpp0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17238"
FT                   /protein_id="CAH17238.1"
FT                   /translation="MNQQGIEEMIYSLEAIKNKLLDARTQKATLDAPFVYPYGQNATVP
FT                   VLHAFKSYYSLRRATFYSQYTTRARKINIFGVPYFMHYHGHRLQKLKNLYELNEHHLLD
FT                   RYFDATKQDTTAITPVMRTYLLGGFINTSVFAFRSKYDYTIW"
FT   CDS_pept        59104..59916
FT                   /transl_table=11
FT                   /locus_tag="plpp0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17239"
FT                   /protein_id="CAH17239.1"
FT                   /translation="MKKLLRFEVKQNLRRPSRVYVKSTDGKSIYGSFHMNEPDLFDGWN
FT                   NLSINQTIELKQFMQNLKAIHQHLHPSPTSTLLDLRFRLPYEFIEVLEQIEIICDEQKV
FT                   ELNIFEPMVSSMIQQIKIAVGKLSGSSKEQALTLLNQVNLAEYKKQDFSNQIKSIFSEL
FT                   QVVVNRSEKLHHKAITLFDKDKSYSPMAIKGMASGETTPSKWLVACAVEVLLDEKNDIL
FT                   FKILTEDDMFMLWAKQLLDQGHNLKKIIHKIDALNKNELINKIKCYKK"
FT   regulatory      59958..59963
FT                   /locus_tag="plpp0063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        59972..60844
FT                   /transl_table=11
FT                   /locus_tag="plpp0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17240"
FT                   /protein_id="CAH17240.1"
FT                   /translation="MFLTSTNGCIIVLGLVLTWCILFSIFNEKSSRRLGIKLGILVLFL
FT                   SPFISKLSYDFYATASRQLFLMGANGEIQLAYSPLKVPKTQNNHYCDRFTDSKGNLLNR
FT                   STIGDKHLFCGVFWNMAEHDVVFLPYKLLGNNKAIYWASPELKIIGPMPEDLSAKGKAN
FT                   NIDPVSSEKPNRIYVEAGKTAHIIVTKQFKLPSDKVHKEKTVSPGTVLSGVTLEPFDAS
FT                   EKLGHGRFKLFIGNTSCIASSDTHIRADYDTATAIANIISLNCFNDEEHAIPIQAIATV
FT                   SGRALYPKE"
FT   CDS_pept        60896..61381
FT                   /transl_table=11
FT                   /locus_tag="plpp0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17241"
FT                   /protein_id="CAH17241.1"
FT                   /translation="MRINLKTLIHYLSFLLLVLSYLSLSFETALKSGVFSSYSDLFTPI
FT                   THFFYWPRFALLLAPALVLIIFSSVKMKNYESMLKGFFLLTTPVIISNNLSLFSASNAI
FT                   PHLNQPEQFIQLYYYASWIKSITWMGIILLGLIWTFQKKPQTVETQTHLHSLSLLNK"
FT   CDS_pept        61462..61791
FT                   /transl_table=11
FT                   /locus_tag="plpp0065"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17242"
FT                   /protein_id="CAH17242.1"
FT                   /translation="MSEDLFVTAWKKGIKIVGVEFFNIKASSLDAAEKKWQLEPNYTFI
FT                   QSAMGGYSHGKQVLLAMMYSFFDPEDGQKFLEKTQTPNFVQTLSILNPESRQIISELWL
FT                   HYTGW"
FT   regulatory      61843..61864
FT                   /locus_tag="plpp0065"
FT                   /regulatory_class="terminator"
FT   CDS_pept        62005..63480
FT                   /transl_table=11
FT                   /locus_tag="plpp0066"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ATPase components of ABC transporters"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17243"
FT                   /protein_id="CAH17243.1"
FT                   /translation="MHHKPIQFKDLGLIYPHKICFQDFSGEIHFGERIALIGRNGSGKS
FT                   TLLKMLAGLCSASAGEIKMPQDVRIGYLPQIIEECPDLSGGQRLNHALTKILSEDPNVL
FT                   LLDEPTNHLDRRNRRSLIRMLLHYPGTLVIASHDTELINTVADTLWHIDLGKLTVFRGA
FT                   YCDYQQMLEDKKASIEQELSRISREKKESHLALMREQERNKRSRVQGEKKIAQRKWPTI
FT                   RSHTKLANAITTGNKRLSQINHKKQQVLEELSSLNLPETIKPKFKLNGLDHHKPLIRIQ
FT                   DASIAYEAFDVILEEIHFHLNGCERVALYGDNASGKSTFVKAILEDSHIKRTGKWTLPQ
FT                   RNTVGYLDQHYQHLNCDETVLDLMKSQMPHASHAELRVHLNDFLFRKNIEVEIKVKDLS
FT                   GGEKARLSLALIAANPPKLIILDEVTNNVDLETRAHIIEVLREFPGAMLVISHDYDFLD
FT                   SIHIETKYHVHQGKIHHFNGEQSEGVHHDSSFA"
FT   regulatory      63447..63452
FT                   /locus_tag="plpp0067"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        63461..65260
FT                   /transl_table=11
FT                   /locus_tag="plpp0067"
FT                   /product="hypothetical protein"
FT                   /note="Similar to multidrug resistance ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17244"
FT                   /protein_id="CAH17244.1"
FT                   /translation="MTHRLPNHIGSFMWHFLKPYRRMVFLFILLALMAGFWGPFNSLLI
FT                   KSFINTLAAKTSTDFSSLYWIAGLLVLNFIIFDNITWRTIGYLNYKYEAVIKNQIISQM
FT                   FEYVLGSSTQFFQDNLSGRIATQITTLADNLEIILHRVSVDFLRGASLLVVSFITAYFV
FT                   NVLFFYILFLWFIAFASFSIWMSARLVQLSDDHANSESQLSGQLVDGLANQSNIRIFSR
FT                   KIYEVERMNTFFSLVQRAFQRKELFIVLLCCAQGGMIAVMMGLASITLIHLYGKGLVSI
FT                   GDFALILGLSMELGHMMWYTMYQVDQFNQALGKARQSLNALVIPHEIQDKNNASQLVVS
FT                   QGRIEFSKVKFHYQGGYSLFQNKSVTIEAGQKVGLVGYSGSGKSTFVNLILRLYEVVDG
FT                   QILIDGQNLSEVTQESLRQAIAMIPQDPTLFHRSLMDNIRYGRTEASNEEVISASKKAH
FT                   AHEFISLLPEGYETLVGERGVKLSGGQRQRIAIARAILKNAPILMLDEATSQLDSITES
FT                   NIQDSLWDLMQGKTTLVVAHRLSTLLHMDRILVFDKGHIVEDGTHAELLDRGGLYKTLW
FT                   DAQVGGFLPDERKEESQDGVANE"
FT   CDS_pept        65253..66035
FT                   /transl_table=11
FT                   /locus_tag="plpp0068"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Legionella longbeachae
FT                   spectinomycin 3' adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17245"
FT                   /protein_id="CAH17245.1"
FT                   /translation="MNKPHTEFRVVYHLLNDLLSGLQSILKENLLGIYVYGSFIWGDFD
FT                   ETTSDIDVLVALNKEMTPEEFAALDDFHANLVQNFPAWNDRIEVAYASYSMLQHFKTEP
FT                   GQIAVISPGESFHIKQAGTDWLINYYLLQRNSLILYGPSAKSIIAPVSNSEFIEHVKKQ
FT                   AYAWQDWVIHTRNSLGYQYYAVLTLCRALYVLQHQEQGSKLKAGAWAKNQFPKWRVLIQ
FT                   RALTKAELNHASDILTEETYQEVTAFVNEMVQHIQERE"
FT   CDS_pept        66036..66995
FT                   /transl_table=11
FT                   /locus_tag="plpp0069"
FT                   /product="hypothetical protein"
FT                   /note="N-terminal part similar to conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17246"
FT                   /protein_id="CAH17246.1"
FT                   /translation="MMEVNQQQRLIEVVSYDANWSMQFEQEAERIKKALGSNCIEIHHI
FT                   GSTSVPGLAAKPIIDMIPVVLDISKVDSANAAMQALGYEAKGEYGIPFRRYFQKGESLR
FT                   THHAHIFEFGNSEIERHLKFRDWMRAHPKDREAYARLKQELAHQYPYDITAYCLGKEDF
FT                   IATIDKKAGVNGLRVVKALTPREWDKVRHFRQFYFFDKAGFSDPYTWTFEHDAHVHFVL
FT                   SQGSDIIGYAHLQLWPHQRAALRIIVIDEEKRNHQHGSQFLALCEKWLKNQGYQSLHVE
FT                   SSPDALRFYRNNGYIDMPFDDPDGYEGDARDTAVGKVL"
FT   CDS_pept        66992..68476
FT                   /transl_table=11
FT                   /locus_tag="plpp0070"
FT                   /product="hypothetical protein"
FT                   /note="Fusion of three acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17247"
FT                   /protein_id="CAH17247.1"
FT                   /translation="MIQIEKITGELAKSLCRTITKDLPEYFGLPEANEYYEIGVKTRTN
FT                   FAAKDGDDTIGLVSIDFPYPNNANIYWMAVKRDYHRQGVGKQLIEAACHFAATQGAKTI
FT                   TVETLSPSELEENYLKTYQFYQSVGFNALFDLKPAGYEWNMVYMVKQLEALAENQQLIA
FT                   IKPLELSDIPILVNAFQKANWQKPYVLFEGYHQEQQQSERAVWVAYVQDQIAGYVTLKW
FT                   ASHYEPFAHKEIPEIMDLNVLPAFRKLGIGSALLTAAEDKAASQCDVVGIGVGLYGGPD
FT                   GGYGQAQRLYVNRGYIPDGLGVTYGYKPSIPGETYPLDDDLILWFTKKLTKNLHAESDV
FT                   VTKKTPDSHDVYVPNTNYKLEFNAKDSFKIIDQKLFEFNKSCVPSTQKPEVIDINVTIK
FT                   NGDEVIAGICTDVYIWKIMYISVFFVEEKYRNQGLGAILLNKVEEKAKELGVTLIHLDT
FT                   FDFQAKDFYRKHGYEAFGVLDDCPKGHKRYYMKKVL"
FT   CDS_pept        68473..68685
FT                   /transl_table=11
FT                   /locus_tag="plpp0071"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17248"
FT                   /protein_id="CAH17248.1"
FT                   /translation="MSFIKKGIYRHYKGNLYEVIDVARHSESLEDMVVYRALYGDFKLW
FT                   VRPLKMFLEDIEINGEIQKRFELNE"
FT   CDS_pept        68678..69250
FT                   /transl_table=11
FT                   /locus_tag="plpp0072"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17249"
FT                   /protein_id="CAH17249.1"
FT                   /translation="MNRLEQANRFIFTGTPGSGKTSVILALKRLGHVVIPESATDVIAE
FT                   EQAKGTMRPWEQADFVDKIALTQKLRQLNAKGELQFYDRSPFCAYALGRYSAHWHHRDF
FT                   TPSSILVAEVDRCLKAGIYQRKVFFFENLGFIEPTSARKISYEDALIFEQIHIDVYKEF
FT                   GFEIVLVPKKTITERCELVLETLGIKK"
FT   CDS_pept        69327..70271
FT                   /transl_table=11
FT                   /locus_tag="plpp0073"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to MerR family transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17250"
FT                   /protein_id="CAH17250.1"
FT                   /translation="MTQWFVKDLSKLTGVSVQTLHHYDRIGLLKPSLRQSNGYRIYSEK
FT                   DLLKLQQIIALKFFGFELSQIKTLLSEERHALNHFEAQAQVLEQKAAACTSGAKTLRSI
FT                   INSVDINQSIPWETIIQLIEVYKMAEHLEHDWVKEIFTPDELKQYVAFEKEMKTNNKAE
FT                   FEKQWHQLLDELKQNMKHDPDSTIGIQTGKNYMEWVNSVYGKKYAHLRTKKWEKGFGEG
FT                   KGLDDIGLTSEIMAWLEKALDAYWKDRLYGILEQVGKTSASTVLMRWNKALDDMYGEEI
FT                   SRKYAVCDIALNDDKVSLEAKTWLKSILDAYKM"
FT   CDS_pept        70485..73598
FT                   /transl_table=11
FT                   /locus_tag="plpp0074"
FT                   /product="hypothetical protein"
FT                   /note="penicilin binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17251"
FT                   /protein_id="CAH17251.1"
FT                   /translation="MSYAKMAELLLLDVMSKAQIPGVSIAFISSDGIISTQEQGLTEGC
FT                   GLFAIPVDPLKCLFNKLGLGTKDAVVLFDDKLYYVNQTTQSIHQIQLNESNQSSYQKLR
FT                   ESCTDTYKLADPQESELITTLTGLAPPTRVKPETVFGAASLSKPVFAYLVQKLIQSNAT
FT                   NQAEKGTGKFNLDKFNLSQFDLDTPLFHILPLEEFEIDGMKFDMSDTSAVVCAQALTAR
FT                   MVLSHTTGLAHGEMKFQFIPNPKEKDSKEKMHGYSNVGIVYLQQVIEKLTEANLETLAK
FT                   NHVFDHCDMTHSTYEPPKAYHLLLHAEKEPLFDEMKPGQIVILKEDEQLTAYWLENGKI
FT                   VNRSFPERVVPGILRQLPDKGKLSNNLELIEAVISQYGCKEPKPCAANTLRTTATDYAK
FT                   FVKHLSHDNSIENPFVPHAFMTHDRGLAGAIGIARDKIPELILSHVAWGLGWGLQTNEK
FT                   EEVVTAYHSGDMNDCRAWVAVNLKDKSAVVFFANSHNGHILAEHIIPSTIKIELASHYF
FT                   FPKWGFARTLDELGGKTNNWGINPFPRPNPSKELTSSLGELQKRTNIPSIATAIISDRG
FT                   VVTTQEVGVTHVNKPEEVTSSTVFEAASLSKPVFAYIVLKLAQKGLIDLDKPLHEYGDF
FT                   GPPQMRADKNYKKLTARMILSHQAGLPNEFSSPESLKYVSEVGKQFDYSGVAYQFLGEI
FT                   VENITSKSLEALAQEEFAKLGITDSSFMPPTGCSLIKLPDEEEEPTPERIKKLLKDTLD
FT                   VHGQLSIILHKDKLFVAERAVNGSVQITEKNSNQIEEKSLKEIKARFAQIPLFFWSKPI
FT                   PVEARELPLVTTIVGHPPEHAATIAIGHDKNGSVNLKQKFYMVHAAGSLYTTTSDYAKF
FT                   LKACVNDPYIRWEMFKPVVSSLRDKDTKALSQGVSTDILDQISWGLGIGIQKNTDGTRI
FT                   AFHWGDNGTGCNLAAINLTTDEAVVCLTNSENGPAVFREIAEPIVGDLSAIGQWLSIRE
FT                   ELPLEKRVKEKPTQEMNQRLQEQTQIKTTVATIEQQEGEQNPSDLGLF"
FT   CDS_pept        73929..74351
FT                   /transl_table=11
FT                   /locus_tag="plpp0075"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17252"
FT                   /protein_id="CAH17252.1"
FT                   /translation="MPIKRGANTFAHDRLLTEVELELMNIIWSLNKVTIKDIVSNLPKE
FT                   RPLAYTTVATVVKVLEQKGFLGCQKNTYAHVFLPIVTKAEYESTCIEHMVTNVFDGEPV
FT                   ALVQRLLMAKKLQHDDIQAIEEALKQLVTSEQQIEA"
FT   regulatory      74341..74346
FT                   /locus_tag="plpp0076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74354..76276
FT                   /transl_table=11
FT                   /locus_tag="plpp0076"
FT                   /product="hypothetical protein"
FT                   /note="similar to penicillin-binding protein 2 (FtsI)"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17253"
FT                   /protein_id="CAH17253.1"
FT                   /translation="MLFLEILLGIHCLLLVSSWVIGGRWLLNQPSFKLKLARFLLISCV
FT                   ISPLMVHCINTNQKFEQHHYASIDALQEYVNQPILKSKPSQDITESATSFSISNTSYFH
FT                   LFYVVFCLLILFRSYKVLLSLGSLRALLAEAITYRTSGKLVIKVSRRCHIPFSVVLFNK
FT                   AYIVLPVSLFSSSKNVKIAIAHEGQHHRNGDCLWAYFIEALRIIFWGNPGVTRWSHILS
FT                   ELQECSCDEVLVGQPKISAHDYGNCLFDVVQTVSRCSVSSNREIACTVGMAMGKDNEDC
FT                   TFIIRRISMLSAYPLKPSKSLLLRAAFVGFSILAPICVAYSAVGTLTGSKTKEIDTSHL
FT                   DPKMQHIAEQEIKTAMKQYHAKSGVIAIVNAKTGDVIAFAETSKNKNQSSWKSRVFSPG
FT                   SLIKPFIAAAAIDSGSSSETKNYDCHAPYSIEGKTFTDYYVSQGSTSLMQAITRSSNVC
FT                   LIKVAQETGAPVIRKKLAEFGFDMNTWWQANQSDKLQLAMASVGENIPVTIDSLTKSYA
FT                   ILANFGHPFQGGEAPVISATTTNSINHILENVVTNGTGKLAAIPGVSVAGKTGTVAENI
FT                   NFAKAEHLALFAGFLPVNEPRYAIVVVIEDGHLSKNGKTLTSGGELAAPVFRKVAINSL
FT                   NNTKL"
FT   CDS_pept        76344..77144
FT                   /transl_table=11
FT                   /locus_tag="plpp0077"
FT                   /product="hypothetical protein"
FT                   /note="Similar to beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17254"
FT                   /protein_id="CAH17254.1"
FT                   /translation="MKKLSVFLCMTLVYCSTTLAQSTCFLVQENQTVLKHEGKDCNQRF
FT                   APESTFKIALSLMGFDSGILKDELHPEWQYKKEYELYLNVWKYPHNPRTWIRDSCVWYS
FT                   QVLTQKLGMLRFKNYVDAFHYGNQDVSGDKGKTNGLTNAWLSSSLAISPSEQIQFLQKI
FT                   VNKKLPVSPKARTMTKNILYIQELAGGWKLYGKTGNGRQLTKNKSQKSPLQHGWFVGWI
FT                   EKDGRVITFTKHIADSKKHVTFASFRAKNEALNQLFYLINELEK"
FT   CDS_pept        77148..78728
FT                   /transl_table=11
FT                   /locus_tag="plpp0078"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical polysaccharide deacetylase-related,
FT                   fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17255"
FT                   /protein_id="CAH17255.1"
FT                   /translation="MKSNIALLITQALFLFCYQAFSYANEIAITFDDLPASIEESIEEQ
FT                   ALINQRIVNALIKYRVPAIGFVNEGKLYRTNETQEKINLLKLWVDNGFDLGNHTYSHLS
FT                   LSSLTSEQFKAEVINGSKISKQLMQSAGRQYHYFRHPYLDTGKTLEIRSKFESFLKNEG
FT                   YLVAPVTIDTDDWKFNQQLHEFPQNKDKIIQSYLKHTRAKFAFYESASKQIFGRNINQT
FT                   WLLHANLINSLAIESLLTIAEEYGYHFISLDEALQDKAYLSADAYYAPFGVSWLYRWDF
FT                   TRGKVVDWSKDPEPDNNPFITVNTIKFYDKDRKRFIPVKMYVSNESQGKANAGILKLPV
FT                   AIINHGYTVRNTEYSFLANALAGNGYFVVSIQHDLKSDPPLAQTGNLFEQRKPLWERGS
FT                   ANIRYVIKELNRINPSLNLSKVTLIGHSNGGDIAMLFASKYPQLVEKIISLDSLRMPFP
FT                   RTGLTPILSLRGNDTKADEGVLPPKESLKQLAITIIPLPEVKHIDLCDRSSKVTQQQIN
FT                   DLILKFLRG"
FT   CDS_pept        78732..79628
FT                   /transl_table=11
FT                   /locus_tag="plpp0079"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17256"
FT                   /protein_id="CAH17256.1"
FT                   /translation="MKKILALFSLGWSLNLMAANDISTMKQTNTQAKKYTNELFLHHTL
FT                   TKEFSSKINRIKYNLYISLPKGYSSNNKSYPIIYLLDADYSFALAKQISEHLSDRNRIN
FT                   DSIIVGIAYANPNEYKKNRTRDYTPSYVSSGGYGSEYQKYSGGAEAFYRFIYSELIPYL
FT                   HQTYRVNQNSTFVGHSYGGLFGVYLLIHHPEVFNHYIIVSPSLWYDNHLVLKAAQRKRN
FT                   FNLQQKTRVCFIIGDHENKGDYRMIDDLKLFNEIIMSKPHKNLSTIFNILNDMDHDTVF
FT                   PGALSLGLLRSSFDLNK"
FT   CDS_pept        79771..80133
FT                   /transl_table=11
FT                   /locus_tag="plpp0080"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17257"
FT                   /protein_id="CAH17257.1"
FT                   /translation="MLKKVAFTMYPVENLDRAMDFYKKNLGLTPSKTSANGHWIEYDLP
FT                   QGGCFAITTLAEGVKPSAVSGGSIAFEVEDLDSLTQQLKKNGVTFKLDTFSSPVCRMAI
FT                   IIDSEGNAITLHELNQ"
FT   CDS_pept        80153..81325
FT                   /transl_table=11
FT                   /locus_tag="plpp0081"
FT                   /product="hypothetical protein"
FT                   /note="Similar to dihydrofolate reductase and
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17258"
FT                   /protein_id="CAH17258.1"
FT                   /translation="MMMFAKCSVFIATSLDGFIARDNGSIDWLTKANELVPPGEDGGYK
FT                   EFISTVDGLIMGRHSFEKVLSFDPWPYGELPVIVMSSKPIEIPTHLKYVSASSEAPIEL
FT                   VKRLTDEGFKHLYIDGGITVQNFIAANLIHELTITIAPVLLGSGRSLFGHLTQDIELEH
FT                   LETKCIGGGFVQLKYRTNPSTQKRNKNNVYLIYDEISEWFDSHRNKELKMEQSYLELLQ
FT                   NKLPSKGKILDVGCGTGEPMAQFLIKQGYEVTGIDASHKMIEQCKKRFPNAKWLLADMR
FT                   TLDLQEKFDAVIAWHSFFHLPHDDQRKTLKSLASLVEQNGLLIFTSGPGYGEVWGDNGG
FT                   YDLYHASLSSEEYTQILLECHFKVLVHNIRDPECGEATVWVAQKNHICPG"
FT   CDS_pept        complement(81354..81824)
FT                   /transl_table=11
FT                   /locus_tag="plpp0082"
FT                   /product="hypothetical protein"
FT                   /note="Similar to acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17259"
FT                   /protein_id="CAH17259.1"
FT                   /translation="MIVKCLRAGVHELKQINELMYRSKSYWGYDKAFMDKFMQLFQMTT
FT                   DYLEKNTVKLFYERNTEKPEKAIGFYSFSIRKKESELDNFFIDLNYIGKGFGKKMWSMM
FT                   VEDFKSHGVSRFKLWSDPGAESFYKKMGCIKIGVKKSPMMPNRYPIIFEYEI"
FT   CDS_pept        81973..83481
FT                   /transl_table=11
FT                   /locus_tag="plpp0083"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17260"
FT                   /protein_id="CAH17260.1"
FT                   /translation="MTIEQNELEIKNNPHQSITWGQPIPLSPILAPDCPYPVEALPSIV
FT                   RKAVVDYQQYGQQPLPLIACSALANMSLSCQSLANVARDNYLISPVSLYFLIASGSGTR
FT                   KTAADNVFSKAARHWETLIRKRREPEVLSALTQHQVWQMEKDSLFSQIKRATYTGEDSD
FT                   YAKEMLDELIHQEPEIPLQPTLYFEDATQEALAIHLAQGWPSASLWSDEAGIILGSHSM
FT                   QGNPTRFVALLNRLWDGKTFTAHRKTTQGFTIENRRLTLNLMMQPLILQQLTKQASGIS
FT                   RQSGFLARCLMAYPANSMGNRFYQEPPASLHSLTHYEQRVTACLNQSEQLSHQGCIQLP
FT                   LLKMSMAAKQQWILFFNAVEAGLKPQGQWVDVVDFASKAAENTVRLAALFHLFEGRHGD
FT                   ISVEHTENAIEIINWHLQEARRIMPTETVSLQFSDALKLMDWFIEKNISSTTLRTIQQL
FT                   SPLRDKIKRDLAVELLVEHNQIRIVKSGSKTMVEVNPRACKVPT"
FT   CDS_pept        83532..84107
FT                   /transl_table=11
FT                   /locus_tag="plpp0084"
FT                   /product="hypothetical protein"
FT                   /note="Similar to pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17261"
FT                   /protein_id="CAH17261.1"
FT                   /translation="MPSNMLKEWLSNEKERGIEDPACAVLSTCSSSGEPHSRVVAIREI
FT                   ETESLLFFTQQKTRKVTELLNNPKSCLNFLFAMQNRQVILEGTAIPISQEENEAFWSTL
FT                   PRERQLRFSAYAPTSGLVIKDLNQLETRKKELSDQFAGLPIPMNEYYFGFRFIPKTWIF
FT                   YTVGSISFSEVIRYTKIEDSWKSELISP"
FT   regulatory      84106..84111
FT                   /locus_tag="plpp0085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        84116..84427
FT                   /transl_table=11
FT                   /locus_tag="plpp0085"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17262"
FT                   /protein_id="CAH17262.1"
FT                   /translation="MYMLCFCVPETHLEIVKNAIFATGAGSVDHYQHCAWQTLGEGQFM
FT                   PLPGSHAFIGEINQLERVPEYKVEIICTEGQITVAVAALKKAHPYESPSYQAFRVESI"
FT   CDS_pept        84483..84665
FT                   /transl_table=11
FT                   /locus_tag="plpp0086"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17263"
FT                   /protein_id="CAH17263.1"
FT                   /translation="MLPKNASLGHIALAVNKLAECEQFYNLLGLQTELKTMGYVYLTGN
FT                   SDNCEIGGKSLNLTL"
FT   CDS_pept        complement(84759..85634)
FT                   /transl_table=11
FT                   /locus_tag="plpp0087"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to alpha/beta hydrolase fold family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17264"
FT                   /protein_id="CAH17264.1"
FT                   /translation="MNTKICFTNSTILLNDGRTLGYAEFGDPKGEVVFYFHGLPGSRLE
FT                   AGHWENIACLNHYRLISIDRPGMGLSSKHPTRTILSWADDVEALANYLGIPKFSIIGHS
FT                   GGAPFVAGCGYKIPHRLNKIAIVSGMGPFEIPEATASLGRGQRFINKMIKAIPPIATVM
FT                   VNLMFLMLKKPGILKKMTSKMSEVDQRILGDTEAGDLFIQSSLEAFKGGITGVSQEIQL
FT                   SLKPWGFDMSHIKCPVVIWQGRLDKQAPLAHANLYAKLIPNASLKVLDHEGHISLLINH
FT                   GEKILRSVRE"
FT   CDS_pept        complement(85692..86453)
FT                   /transl_table=11
FT                   /locus_tag="plpp0088"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17265"
FT                   /protein_id="CAH17265.1"
FT                   /translation="MAYTINQLARLSGVSTRTLRFYDEIALLKPAYYGGNQYRYYKEEQ
FT                   LLMLQQILFFRELGFPLNDIQQIMSSDDFDKIESLKRHKSALESSLERTATLIKTIDKT
FT                   ISHLRGKIIMRDAEMYDGFDPIKQQEHEKYMLETGVISQKQIDDSWTRVSHWKKSNWEQ
FT                   FKNAGEKLNLELANALAKGVRTDSDEVQALIQEHYDWVNNFWTPTKETYLGLGKMYLDH
FT                   PDFRLFYNKYHPGLVDYLVAAMRVFAERKLS"
FT   CDS_pept        complement(86666..86953)
FT                   /transl_table=11
FT                   /locus_tag="plpp0089"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to stability protein StbE"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17266"
FT                   /protein_id="CAH17266.1"
FT                   /translation="MIYELHFHPLALKEWKKLSKELQEQFKKLLKRRLENPHVISAKLS
FT                   GHLKDCYKIKLHQAGYRLVYQVNDNKMILLVVAVGKRNKNKVYESAEDRT"
FT   CDS_pept        complement(86943..87194)
FT                   /transl_table=11
FT                   /locus_tag="plpp0090"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to stability protein StbD"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17267"
FT                   /protein_id="CAH17267.1"
FT                   /translation="MQTLYATQVASISELKKNPTKLINDAHGMPVVILNHNVAAAYLIP
FT                   AETFEKLMDAVDESELKSIVEQRLSEPFTPVKVALDDL"
FT   CDS_pept        complement(87443..87910)
FT                   /transl_table=11
FT                   /locus_tag="plpp0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17268"
FT                   /protein_id="CAH17268.1"
FT                   /translation="MPSEKSRYLNRGPKSPVDMHQLKKYLNSFTKEHLAEIVLLNAQYN
FT                   SVLWRALSASIGMRLANGDWEEIKKAIDYAFYFPEYIRYTENGYGFIIYEMINALEFLY
FT                   KDRDKQFILQVADYMFEQAEQALESFEEGWDWTCALESLKDWIRNKKIKCK"
FT   regulatory      complement(87917..87922)
FT                   /locus_tag="plpp0091"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(88529..89350)
FT                   /transl_table=11
FT                   /locus_tag="plpp0092"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to spectinomycin 3'
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17269"
FT                   /protein_id="CAH17269.1"
FT                   /translation="MENNSDVKQQLKECLEVLTKILGADLLGVYLYGSYLVGGLQKYSD
FT                   IDLFVVTNRTTTSKEKMELTNHLLQISGIYMKSTKPPIEMTLVEREAINPWHYPPLFDF
FT                   QYGEWLRPSFEMGSFEPWPGREMPDLALIITQVLLKSHTLLGERPEHLLAPVPYSDFIK
FT                   AMLHDLGRLSAELEQDTRNVLLTYARIWSTLETNKIRSKPIAADWVIDRLPKMYQPVMN
FT                   RAKHICIGLEDEYWDDINVLVKPCADFILSRITDQKLSINLKDPCTLIKLA"
FT   CDS_pept        complement(89334..89771)
FT                   /transl_table=11
FT                   /locus_tag="plpp0093"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to Legionella longbeachae unknown
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17270"
FT                   /protein_id="CAH17270.1"
FT                   /translation="MTLDNLIGISLEKIPPHPDTIKRLLHAAERNILDSKIDLVSAENR
FT                   FDAAYKAIMQIANAALQSHGYRTLTSKPGHHQTMIQLLPQTLGIDKKTVIILDAMRKQR
FT                   NIADYSGDIIPESAVITCIAQAEALLKDFKKWLSVKDGKQQ"
FT   CDS_pept        complement(89758..90336)
FT                   /transl_table=11
FT                   /locus_tag="plpp0094"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to Legionella longbeachae unknown
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17271"
FT                   /protein_id="CAH17271.1"
FT                   /translation="MFDTSILFSEYRRRVLALLLLHPDERYHVREIARLTNTTAGTLHR
FT                   ELSKLAKSKVLLREQSGNQVYYQANRNFPIYTELTSILKKTSGLVDVLFDFLTPLAEKI
FT                   EVAFVFGSVAKGTENLGSDIDVLIIGEVDFTEAVEALYAAQASLGREINPKIYSREQWK
FT                   ASLQKQDLFIQEVLNNPKLFIMGAEHDLG"
FT   CDS_pept        complement(90624..91529)
FT                   /transl_table=11
FT                   /locus_tag="plpp0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17272"
FT                   /protein_id="CAH17272.1"
FT                   /translation="MNLHWSILMKKDKEKHQPVPESITADEPQTSSIALALQQFRKEAE
FT                   KKEAAEEGAKVRCPTCFKEIAPKRLCSGHGAGGSGGDSATSDKKTSEEKASPGEDKFLT
FT                   KSGKVVGSEDELVGVFGSEELDLESGFDPEIIEKLIADGKLLVDSDRESMTLKLKLQCD
FT                   PNELTPKQRHELKKFMEAIINEFSEFKEENHLSDDCIQILQDEEGNIRSLRITMPTLAL
FT                   YDAFIQQLANNLVPVPSPKAQERDEVTKEQSFAPHPLSREPRPSNKDQSSTQEANEIHN
FT                   KSEDGEQEIFNPSPFNMKPW"
FT   regulatory      complement(91538..91543)
FT                   /locus_tag="plpp0095"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(91618..92943)
FT                   /transl_table=11
FT                   /locus_tag="plpp0096"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17273"
FT                   /protein_id="CAH17273.1"
FT                   /translation="MSAYVKNFDEHKEIKSSRDICKSLKPVPTAYMDNKHCEHCYPEKR
FT                   SHFRRKFFNLFHYFIFNPFIYLLSKLFLLSEHDFLRFNNLLNQLVINIFQKLKLYTKTQ
FT                   TIDRKQFNNSVLAFWDEAQKRGLELYNFKESNLHTLYFKLVYNRKKYYFIQTPISLISQ
FT                   KNTRFDEDTKYDNKWILKKKLLDSQIPCPLGRVFISSKKAYNYGISLGFPLVVKPLSES
FT                   LSIHTSCTIQTPNELKEAINIVKQVDFRVLVEKHIPGDVYRSLIINDSLIACVRRQPES
FT                   IVGDGVTTLQELIDKKNKVRWKESHGKYPYKITPNSNLIKILSSQEVALNTVINKGQQI
FT                   FIAKKVTMSSGAKISDVTDLIHPENKLLLEKAHKILNIPLTGLDFICQDISLPWHKQQF
FT                   GIIENNSFPYIELHLNPSDGKGINVAGKIWDYVLDVLSQKNE"
FT   regulatory      complement(92950..92955)
FT                   /locus_tag="plpp0096"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        93135..93827
FT                   /transl_table=11
FT                   /gene="lrpR"
FT                   /locus_tag="plpp0097"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to Legionella longbeachae putative
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17274"
FT                   /protein_id="CAH17274.1"
FT                   /translation="MKDKSILLVEDNVKLANYLKESLQEAGYDVSIEKRGDRAVYRIIR
FT                   EQPCLVILDIMLPGMNGDQICHTIRDEYLGKILMLTAINDIESEVSSLNLGADDYLTKP
FT                   VADEVLKARIEALLRRPNLVNNQNQFQFGNFSINFSTKSVHLFDEEISISTSDFEMLAL
FT                   LVKNHDRLLSRDSIMYALSGHEYDGVDRGIDLKISRLRKALNDNNKKPYRIKTIHKKGY
FT                   VFVSAAWE"
FT   CDS_pept        94067..95890
FT                   /transl_table=11
FT                   /locus_tag="plpp0098"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to Legionella longbeachae unknown
FT                   protein, ankyrin repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17275"
FT                   /protein_id="CAH17275.1"
FT                   /translation="MKDAAIEILIYKPDPDHPLPENQRGVVVNPHLKQRFKQFVPIGVY
FT                   LEGSDLKYYFFDQCDKSPKIYSSLDELKRDLPEELDNIFEKNPKLFIMGHAGGGEYGMG
FT                   NCHGPSEQLYDNHFDNLLHGFKRALPAHHGEVFVTLEGCNTDNQLNAAANSQKKTFLER
FT                   VSVKHPEITFGGTGPWNAQDVQTGFRSLSPASPITSMAGNIWKAGNSVIFHHGEYQVAV
FT                   RKSLFASTQTAKELKVNTIEYARAILGKDGADELIAKIALNRDILNIQDLKKIEGFPEL
FT                   RFEGEDVAKFVEQENQILGKEQENYLTRVRDILGRADPIEQLTDRDVLELLLGLKEPSV
FT                   FKGHEDLLESILANKALLNLAMVSCGKVLIGGPSNDSVIALLLKHGADINSSDKKGMTA
FT                   LHYAVQNFYNYRKEPLHLIKKLLECGASLEVRNEKGQTPIETAQEHSKDGRVTASDKLL
FT                   ASLKSSNSLPTPLELKQSIRQIFQMSQHKADELLSLPIAKREYSKCSEGTLYIPEDVVE
FT                   KLHGILQSATGSNELLSAFESELSVVISALEKGIGTGEAIDGEEDEFIPKRFENAKLQL
FT                   TAAIDALVGMKQEMDTSKDATVEDQLPKLKS"
FT   CDS_pept        complement(95894..97498)
FT                   /transl_table=11
FT                   /gene="lskS"
FT                   /locus_tag="plpp0099"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to L.longbeachae sensor histidine
FT                   kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17276"
FT                   /protein_id="CAH17276.1"
FT                   /translation="MKFNIYIKILTAFFVIFLILVLAFFKYLKSVETKIVVNAGKTTSQ
FT                   GLLISLEKELINNPKSNWDAIIKKKTDNVIHLIAIDSLKLTLAQNNQLNNGEIIFLSGT
FT                   TYQFLNEVIVEHTAYKKIGNTPYALAYNFSDPDEIIFNYMNPVLKQIVQHLLSKSKNTW
FT                   SNELLSLEKIYGFPLHVYKTKSKLLPSNIINSLSTKRLVLETNKNSSQIVILYYRFSGG
FT                   ILKIGPLSYLPVMARISDVMYYFIGTFFFISLCLIALFSLLFVRNMKKVYQITKNFSQG
FT                   NFDFHRKIGTTSVLYGLYRNIIQMGEQLKELIESHKQLCRFVAHEIRTPLSTIQMATDS
FT                   IKRRNAEDALLNKQINSIQEDIADMNRLVSTFLIYSKMHSNELKLKQSETDIIVWLRKL
FT                   LESYSSSTFEITFHSNELNSLKAYIDENILKHAVTNLITNAMKFAEHTISLTISLDNSH
FT                   ILLHVDDDGPGLPEEGADDIFSEYTIAEDAGIGDKHIGLGLAIVKKVVNLHGGKVMATQ
FT                   SPILKGARFTIVLPIYS"
FT   CDS_pept        complement(97597..98253)
FT                   /transl_table=11
FT                   /locus_tag="plpp0100"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17277"
FT                   /protein_id="CAH17277.1"
FT                   /translation="MTQKKISLENDAVLQFIVDELISLHHCHTIILYGSRARGDFTVTS
FT                   DYDVAGIREKGDKQRIARFDEAHQVYHDIFVYPENAFDSISDEHLCMSDGIVVLEKAHF
FT                   GTELLKKLSAFLILPESLPLDEITARRVWYQKMLARAYTRDLEGKYRHIWSIFTILEDY
FT                   FVFKELRYQGPKKAFKYLETHDPETLSLFDEAITNIDNLDALNRLITRVIKIDKT"
FT   CDS_pept        complement(98341..98559)
FT                   /transl_table=11
FT                   /locus_tag="plpp0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17278"
FT                   /protein_id="CAH17278.1"
FT                   /translation="MILNNEPKMLDTTIIENNWRSRGFSFELWEDPPGQIWKDFRHETD
FT                   ELFMLLEGEVILTVGNKTLKPAIGEKY"
FT   CDS_pept        complement(98563..98859)
FT                   /transl_table=11
FT                   /locus_tag="plpp0102"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17279"
FT                   /protein_id="CAH17279.1"
FT                   /translation="MIYLYPWYKQKDNGLILSLLIQPGAKCNQVVGAVGEELKIKIAAP
FT                   SIEVKANMELVRYLSVLFKVPKSQIKIKRGLKSRHKIIEVIGCGVDALQWCKI"
FT   CDS_pept        99016..99993
FT                   /transl_table=11
FT                   /locus_tag="plpp0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17280"
FT                   /protein_id="CAH17280.1"
FT                   /translation="MNNLLPLFKWGTDYLVSNGYSIEHSPEIVLSTPWSHVIRFATSTE
FT                   NFYLKQTPPSLFLSNEPKIIRVLSSQFHANVPDIIEINEDLHCFLMRDAGISLRQTLKT
FT                   NFKPELLCQAIKQYATIQLSAEECIVTFLKLGVPDWRLNQLPFLYDHMLKQTAFLKAEG
FT                   LTDKELQTLHSLSPKFSAQCKLLASFRIPETIGYHDFHDKNVLLDPITKRMTFVDWGET
FT                   AIIHPFFSLHTCLEQSITHYGVTEGDSTYQKLQDACLEKWLGLATKERLLSAFLLAKQI
FT                   RLFWNILASNQFILSVDRQAYQAYYPNQHSPIAGGFKAFLEGMH"
FT   CDS_pept        100101..100793
FT                   /transl_table=11
FT                   /locus_tag="plpp0104"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17281"
FT                   /protein_id="CAH17281.1"
FT                   /translation="MSRTERLFDLIQLLRRHQLPVSGKNLSEELGVSLRTLYRDIITLQ
FT                   SLGAPIEGEPGVGYVLKSGFMLPPLMFSDDEIEAMVLGSRWVAQRADTQLKIAAQNVLA
FT                   KISAVLPTELKHQLETSGLLVPPGKCAESKDSDLILIRKAIRLERKIELEYQDLQNNHS
FT                   TRILWPIALGFFDEVHLMVGWCELRQDFRHFRTDRILQLSIKEQKYSERRQSLLKKWRT
FT                   LHNIPQSY"
FT   CDS_pept        100869..101237
FT                   /transl_table=11
FT                   /locus_tag="plpp0105"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17282"
FT                   /protein_id="CAH17282.1"
FT                   /translation="MSFDPNLVLFYVSNIEKSTHFYSELLTAHPIHTEPDYVMFLLKSG
FT                   LRLGLWSQNSAQPAPTTLGGGSELAILVGSEQTIDELFGNYRNKDFKIIQEPTHMDFGY
FT                   TFVICDPDGHRIRFFSKK"
FT   CDS_pept        101240..101668
FT                   /transl_table=11
FT                   /locus_tag="plpp0106"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17283"
FT                   /protein_id="CAH17283.1"
FT                   /translation="MNQNWLAVACATHVRIGVEGEFMQVCHGKLAPLKRIKADDCIIYY
FT                   SPTSHFGGTKKVQAFTAIGIVLPGEPYQVDMGNGFYPFRRNVLWSNKAIDVSIHTLIES
FT                   LELTKNTKNWGYQFRFGVLKISEHDKRIIAHAMQAYIN"
FT   CDS_pept        101692..102153
FT                   /transl_table=11
FT                   /locus_tag="plpp0107"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to probable transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17284"
FT                   /protein_id="CAH17284.1"
FT                   /translation="MTAIIPQLTQIQALTVTGISVRTKNEEELNPQKAQLPHLWEQFYG
FT                   STTNETQQNNPIYGVYHHYESDSSGHYTVTAGIEIPNESKATHLDRVIIKAGDYLVFEA
FT                   AGTNPSEIIKAWQTIWNYFNETSTYQRSYLTDFELYKTPIESAVYIGIK"
FT   CDS_pept        102176..102919
FT                   /transl_table=11
FT                   /locus_tag="plpp0108"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17285"
FT                   /protein_id="CAH17285.1"
FT                   /translation="MTTTPIIDSLIKLQSELEPLKKPASEQKATYYKTGPGDYAEHDQF
FT                   IGVSVPDLRKIAKRYQELPLLLLQELLYSPINEERLLALLILVTRYQRGDADLQQTIFQ
FT                   FYLTHINQVNNWNLVDASAHWIMGAHLLKEDKTFLSTLAESTNLWEKRIAIVATWYFIR
FT                   NDSFECTLKLAEKLLCDHHDLIHKAVGWMLREVGKRNQSILIEFLNRHAYQMPRTMLRY
FT                   AIERLMPTTRKTYLLAKKQILDSEI"
FT   CDS_pept        complement(102950..103921)
FT                   /transl_table=11
FT                   /locus_tag="plpp0109"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17286"
FT                   /protein_id="CAH17286.1"
FT                   /translation="MRRRELNYSDEQLMDFLYQGYQIMASELHFVAVGSFYGFVISTNT
FT                   TKKYFLKVYPEGQSLVPIQPTIESLNQTGIALNRLRNEFGMKNLSYMISDVQGHYCFRS
FT                   NKLILTLFDYIEGIHPAYTPNQLLADKMATLLFQLHQIPAHEFSFFETEHFDINYALGI
FT                   KGWINNAVEVIEETHAESMLSQLKRHKKQLLQGLSQLQEWKKQFSQQSIPFALTHGDPH
FT                   HYNVLQTPFDVWLVDWDGVKIAPIERDLWHYEQAPLAEFYLKLNLKCSINHELCRFYQL
FT                   QRFFEDGRYYLEQVLTGKNRTDQQSEEDKNTFLTHWGWSYCV"
FT   CDS_pept        complement(103938..104891)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="plpp0110"
FT                   /product="hypothetical protein"
FT                   /note="C-terminal part similar to acetyltransferase"
FT                   /db_xref="PSEUDO:CAH17287.1"
FT   CDS_pept        105014..105661
FT                   /transl_table=11
FT                   /locus_tag="plpp0111"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to lysE family transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17288"
FT                   /protein_id="CAH17288.1"
FT                   /translation="MQEFFSISLLIILAAISPGPDFAVVTKNSLFHSRKTGIYTALGVS
FT                   VSLLIHAVYCILGLALIISQSLLAFSIIKYLGATYLIYIGIKGLIAKREITKLDDQKSK
FT                   PSLTPLSAFYQGLLCNLLNPKAIMFLLAFFTLIVKPGHSLWVEMAYGFEIAIIHMIWFS
FT                   SLSMMMTHLAIKTNLNRIQFYIVKAMGAVLVAFGVRIATLSQAIMLPAAVLE"
FT   CDS_pept        105738..106253
FT                   /transl_table=11
FT                   /locus_tag="plpp0112"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17289"
FT                   /protein_id="CAH17289.1"
FT                   /translation="MTNFLETDRLIIKLTSLSDFENILALRSDPEVQKYTTQPPATKQD
FT                   VQRFLDWVIPYQKKHGHGMASVFEKKTGDFVGQAGIFHIGHWDLQPEIEIGYRFHVKHW
FT                   GKGFATEVTRALVAWGFDHLNIDTIVSFVETENSASKRVLEKCGFHHIGLKQCHYGMLE
FT                   RYEIYRQK"
FT   CDS_pept        complement(106325..107044)
FT                   /transl_table=11
FT                   /locus_tag="plpp0113"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N-terminal part of hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17290"
FT                   /protein_id="CAH17290.1"
FT                   /translation="MNRQELSKKVIGIVNRVLQEKQYVSSIDILLGLGYLSPSILDDWR
FT                   RGRFSYLEQRLQANLNKLSFAIQCFHQWAKQTGLLPRETAYVQKACSSTIHLKFSKSGQ
FT                   DTIERRYRTHYISPKLTQQKQQRLMEKVEKSTEPVVYIIVSESKCTQCKKDLPKGSFLM
FT                   MDENNPYCMACTPYKDLVFLPAGDALITRRAKKYSDKSLIVVKFSRARKRYERQGLLVT
FT                   DEALRRVQDHSMVASID"
FT   CDS_pept        complement(107216..108649)
FT                   /transl_table=11
FT                   /locus_tag="plpp0114"
FT                   /product="hypothetical protein"
FT                   /note="similar to esterase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17291"
FT                   /protein_id="CAH17291.1"
FT                   /translation="MPKYDSPYLQHLIEKLAVAISTEENDQIWQRLETPIIEDVSNQPE
FT                   QCLVTFIYREKSDKKTIYLWSTFTGLPCSLQSQFKAIPNTDIRYLTLILPRTFRSAYNV
FT                   LIVDKDTAKVEFSEQENTESLYPIPTGKFKESQMLLMHLFNQGCVQTDPRNKREITYYM
FT                   DYDNPGEFFGKESIIELPNVSTFVTDCSLDKAKEHRERCKKEHRFFSFELNFLETRLKN
FT                   VPGYYENPEQSIRKYWVYLPPDYDKQATPYPMILFLDGSDYLNPMPAPLILDKLIQEEN
FT                   IPPCVAVFLEYSSIHRMHEYNCNDVFTSFLVHDFVPMLHDKNQLNITQDARLITIVGQS
FT                   ASGLAAFYAALTNPTMFGNAISLSPSLEMQKLTDLEQKIEKHYKENPNTQFIFDIGTYE
FT                   TIPVDLEFEDGSTQSISTFEANRRIADLMEKKGMLIHKSEFIGGHNYGCWCANLPVHIQ
FT                   TIFEHRKVVTPSQQNSNQI"
FT   regulatory      complement(108654..108659)
FT                   /locus_tag="plpp0114"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(108721..109491)
FT                   /transl_table=11
FT                   /locus_tag="plpp0115"
FT                   /product="hypothetical protein"
FT                   /note="similar to shikimate kinase (AroK)"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17292"
FT                   /protein_id="CAH17292.1"
FT                   /translation="MNQPQRIFIVGHHGAGKGLLAKSVAQLLGWQFVDADLGLESHVGR
FT                   HLYEILGSHGSEAFYECQFDILKSLCTQEHIVVTTDSSVVLALKNCQLLRNEMTVFLDV
FT                   STPVQIERTARNSANLLPVPSWRDFFDQLHDERDSLYKEVATLTVHGDDGKLEEHTRCI
FT                   AKAILGNEKMLPQKTILEKKDFTLYHKVSHTRVDLSEQQAIYLKLLAQGKTAKEIAREA
FT                   HVSYRTVEGIIAKLMDSLGCSSSKELIALYHEQP"
FT   regulatory      complement(109500..109505)
FT                   /locus_tag="plpp0115"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        109545..111149
FT                   /transl_table=11
FT                   /locus_tag="plpp0116"
FT                   /product="hypothetical protein"
FT                   /note="similar to aminoglycoside 3'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17293"
FT                   /protein_id="CAH17293.1"
FT                   /translation="MHQYVELREYQVRDYYFNLTEELVLGKIAMFFSYKHSLEKILIAK
FT                   ITNKSLITISTSKYSMPNYLHLTLQSERLQLIPVSLKYAEDLCKEFTAEITEHMWPSAP
FT                   KTQEEINQHISEQQIKMQAGSEIALAIINKENQNFLGYACLHQANTKTPELGIWLKKSA
FT                   HGFHYGFEAMNLLKTWAETNLVYDYLKYPVVRQNISSRKIAEKMGGIIEDEYIKTSESG
FT                   KLLDEVEYRFYGATMTNTQSKINITAALVRELITQQFPQWGQLPIQAVNNSGWDNKTFH
FT                   LGTEMLIRMPSSAEYAGQVEKEQTWLPKLAPLLPLPIPAPLAMGKPNELYPWKWSINRW
FT                   LPGETAAATPINDLSEFAYDLALFLKALQSINSMGGPIAGPQSFYRGGDLAVYDSETRK
FT                   AIEDLKDTIDFRAATEIWEKALSTSWQNPPLWVHGDISVGNLLLSQGKLSAVIDFGQLA
FT                   IGDPACDLAIAWTLFEGKSRRIFLETLELDPDTWARGRTWALWKAMMYLVNQQTEMNFE
FT                   AKRALRTIHELVEDHRQ"
FT   CDS_pept        111146..112111
FT                   /transl_table=11
FT                   /locus_tag="plpp0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17294"
FT                   /protein_id="CAH17294.1"
FT                   /translation="MIMKTSYIEWALSALNDSGYLLETTKPEIILATAWSEVCRFQTNL
FT                   GLVYLKKVPPALSLEVIVIQLLQKRFNAPVPQIIAHNQELHCFLMQDAGIPLHEVFKQE
FT                   FKPNLLIDTMHHYTMLQINSANKINLFLDLGVPDWRLPQLPRLYHQLMNEEELLMGDGL
FT                   TKEEIKQLKNLESTVQIFCDQLVSFKVPDTFGHADFHDKNILINPNTHQTTLIDLGEVV
FT                   ITHPFFSFVNCLYRATEHLKLPSSQYRKLQEDCFKNWLSIESSAHLFEIIAIIEQCWAI
FT                   HAVLGEYRLIKSIDPIASMRLGRQGRFAGKLRGWIEQFLN"
FT   regulatory      112314..112319
FT                   /locus_tag="plpp0118"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        112324..113640
FT                   /transl_table=11
FT                   /locus_tag="plpp0118"
FT                   /product="hypothetical protein"
FT                   /note="Putative adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17295"
FT                   /protein_id="CAH17295.1"
FT                   /translation="MSPDTSWLTEHFSVLLANSKGQKYKKAIEPFAGSASWSLAAMEID
FT                   LAEEYIINDSNKILINTLLLIKDNPALVKTSYTALIEKYDASLSKKDFFLEVIGNYNQT
FT                   TDEEKALLLPFIINHSWGGILFYDKELNIIYREGELFEGKNANRFLEHANLSLEMFLSE
FT                   IDRVSNLLNANQVSFRSGDFMDVISIATPGDFVALNPPYPENEHSTLEKAGMYIELYSP
FT                   EKLHQNLVQIIQHLESQGIHYYMTYGFYNPKFRNYVLANENQRPINYFRVLGYEHCAFG
FT                   IGLDQMYFTSQFSIPKGINIFKAEGVLGAQDITPEEALKQFKLLSKKCFAVIYRAFIKP
FT                   ELEMEYQKAWHQVASYFVQYRGALGSCLHKTNDGMWLAYSRWPDKATRDASWPGDNAPS
FT                   EMLPNEIRKAVITIQECIDQTQKLPEITMEVVNDLLYSN"
FT   CDS_pept        113656..114093
FT                   /transl_table=11
FT                   /locus_tag="plpp0119"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17296"
FT                   /protein_id="CAH17296.1"
FT                   /translation="MNQAQINYQLELVIDAKLLEQQDKIIRDGIVNFNAPFTGTKPERY
FT                   SIYVKDNEGIIIGGAIVYAHKSSIYVDVLWVKEEYRGLGIGAELLHSVEAEAITRGIPA
FT                   STLDTFSFQAERFYLKQGYQHLGTIKNYLEGHDRIYFRKQL"
FT   CDS_pept        complement(114212..115009)
FT                   /transl_table=11
FT                   /locus_tag="plpp0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17297"
FT                   /protein_id="CAH17297.1"
FT                   /translation="MTNINNNKAALVTGASHGIGLELAKILLGDGWVVYGTGRDVSSLE
FT                   DTKALYPRFVPIQSDFTRNSDIEQVAKIINDSGIPLHLLVQNAGMKSPPRPLTEYDCDS
FT                   IDEVFQVNLLAPMKLTALLAAQMPEKSRILFVTSRAATLKLKESSTYCASKAGLDEVTA
FT                   IVRKELAEKNIGVSCIIPGEVDTRIQKILRETTSFHLHKMFDEAYQSGQLISPETCAEF
FT                   LKWFLCDLSFDEFKQSNMPVSIYEEWHHPFWLKDRNQLPPFPF"
FT   regulatory      complement(115015..115020)
FT                   /locus_tag="plpp0120"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(115070..115798)
FT                   /transl_table=11
FT                   /locus_tag="plpp0121"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17298"
FT                   /protein_id="CAH17298.1"
FT                   /translation="MTLKLSFLENPNPDDVQILTNGIKAYAKQQKGFESLDFFACFIRD
FT                   ADNSIVGGCSGGTLYGGLHVDNLWVSESIRHQGWGTKLMQAALRYGNEKGCAFATVNTM
FT                   DWEAIGFYKKLGFELEFERHGFQKNSIFYFLRKEFQAKREIGLLNGDSVSSLSQKPKLP
FT                   VSESVVREEVVSINNAPYFKWGQGSDGWWLKNDGQFSVIYETMPAGIEQVFQVLPTIIQ
FT                   VKASIPELIQLVTHELGITF"
FT   CDS_pept        complement(115804..116190)
FT                   /transl_table=11
FT                   /locus_tag="plpp0122"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17299"
FT                   /protein_id="CAH17299.1"
FT                   /translation="MNTQEIPKEHQHISPAGAEVRLLMNNHLGGMAHCTLKAGTISKAV
FT                   RHKTVSEFWHVLSGEGAIWRKLNDEESITPLTPGVSIDIPLGTHFQYRSDAADLVFICV
FT                   TMPPWSGSDEASYVEQGAWLPTVE"
FT   CDS_pept        complement(116238..117131)
FT                   /transl_table=11
FT                   /locus_tag="plpp0123"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17300"
FT                   /protein_id="CAH17300.1"
FT                   /translation="MNILCPTPLQKGDIVGLISPSSPIMEQDIEAGVHLLKSHGFKVKY
FT                   AKHMLASERFLAGKDSDRANDVMDFFKDSEVKAIIATRGGQGSQRLLPFLDYELIQRNP
FT                   KQLYGFSDTTALQLGLFKNSGLVSYTGFTLTIHLSNQVKKTLLSSLLGQEYMISKGIKV
FT                   HAGVSRGPLLGGNLTLMTNLMGTPYLPSFKESILLVEDVGVEPYNIDGMLSQLDLAGIF
FT                   DEVSGVIFGTFEHCKSKKSNPYDGTVEDVINEWAAKIKVPCIKEFPYGHGKQNCILPIG
FT                   KVVTLDADNTCVTIQI"
FT   regulatory      complement(117138..117143)
FT                   /locus_tag="plpp0123"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(117144..118394)
FT                   /transl_table=11
FT                   /locus_tag="plpp0124"
FT                   /product="hypothetical protein"
FT                   /note="bifunctional protein, similar to acetyl transferase
FT                   and to methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17301"
FT                   /protein_id="CAH17301.1"
FT                   /translation="MKIKRVMQEDWELWKSFRLEALKNSPENFGSSYEEEVHMSDADFQ
FT                   NGLSKGFVLGVFVDDLLVSCVGFYTFNSLKTKHRGVLWGMYTRLEYRGKGIATALIQTL
FT                   IQHARTCVTQLHLTCVVSNFVARAFYQKQGFRIYGTEPKALKINDTFYDEYLMVLDFKE
FT                   EPMKKLDTYQSLCTEVYDLSKPNAPQNEYSFYRSYAVEAKGPILEPMCGTGRFLLPLVE
FT                   EGFDVHGFDASQPMLERLHAKAISKNLKPKVWHGFIENLNQSNQYSLIFIPSGSFGLIT
FT                   EKADIQKSLKIIFEHLEDKGLFVFEVETRQAVPKELGIWRGSRWPKEDGTLIVLSQLAT
FT                   LDNDVCYSIGKYDLVDNNCVVQTEVEEYKIRIYQDPSFLRNLLTEVGFSNVRMVKGFDR
FT                   NSSPDEKDESIVFECRK"
FT   CDS_pept        complement(118391..118855)
FT                   /transl_table=11
FT                   /locus_tag="plpp0125"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17302"
FT                   /protein_id="CAH17302.1"
FT                   /translation="MITIAYLKQYSDCIPKLAKIWHEVLGKIWMPEIGIEEIESLYYEE
FT                   LNQDMPFTYIALYDEIPVGSCTLQLNEDIRPDLGPWIGDLVVDPKYQKQGIGKILVDAA
FT                   VEKAKELGFEKLYLFALDPTIPEYYRRLGWKKIGMDEFKSHPVTVMEISL"
FT   regulatory      complement(118402..118407)
FT                   /locus_tag="plpp0124"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(118878..119234)
FT                   /transl_table=11
FT                   /locus_tag="plpp0126"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17303"
FT                   /protein_id="CAH17303.1"
FT                   /translation="MKQEHQLIYELEISLLRSETRKSIAQLKLLIADEFIEYGASGSIY
FT                   NKNDLLDSLPEEEQRSYMVNDFSVLEVSPEVMLATYKVTVASKSSLRSSLWQYKHNRWQ
FT                   MVFHQGTPCHECEE"
FT   CDS_pept        complement(119231..120406)
FT                   /transl_table=11
FT                   /locus_tag="plpp0127"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetyltransferase (C-terminal part)"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17304"
FT                   /protein_id="CAH17304.1"
FT                   /translation="MRCSPQETIQKLIHERYSEARAVFWAGSVSQGEETQVSDLDLVIV
FT                   YEKLIRAYREAFVYEGWPIDAFVHDRESIRYFFEESRINSGISGTIQMILSGKDMMPAS
FT                   DFSNGIREEAYLYLKRGPLSWDKNQIDKERFLITDVLEDILSPKSYEEQIASASWLFEA
FT                   LSQFYFRAQNKWCASGKSIIRYLHQENPDLAREFSESFNRVYKEGDSTHLKKLVEKILQ
FT                   PYGGILWSGYHSDAPEDAKIPELIILAKNNDYEICFEERTNQEITAILSDGLKIYNEEM
FT                   IGAYNHTPFTIYIKSIDKTVLAGCYGDVTRANCYVDCIWVHPDFRQKGLGRNLMEKLEI
FT                   FAKQKNCQVITIETAEFQARSFYEQLGYVVISMTEHNCFLDFNVYLMRKSL"
FT   CDS_pept        complement(120457..120729)
FT                   /transl_table=11
FT                   /locus_tag="plpp0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17305"
FT                   /protein_id="CAH17305.1"
FT                   /translation="MRLFIYLIGILFTAYVFNRFCLWLEQKGWLYYRYKKPQKGIIGSA
FT                   LQELNAQLLPNHRHVVVAKEEKVQSKKCEKDLPNDGNVEMTDQIK"
FT   CDS_pept        complement(120790..121833)
FT                   /transl_table=11
FT                   /locus_tag="plpp0129"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17306"
FT                   /protein_id="CAH17306.1"
FT                   /translation="MMTKWHIKEISELTQTSVRMLRHYDKIGLLQPSYREPNGYRCYTE
FT                   PDLAKLQQIIALKYFGFSLSKIKDILQKHSNVYAHLQAQHQVIRKQSEDLLKVNQVLEE
FT                   ILKSRSASMFPNWQDLLLLIEGYKMTENLRDKLKKTWAGKQLTVSQFEDYLFLYEQFPE
FT                   EFALRDSIIEEINQQKVGDPEGPDGERIAAVMEDLSKKMKKFFTEQVKLGASLLESIQS
FT                   GRLTQLEITPEGAYWLSRAMMAYSLKRWNNLYNQIIDNMNSPPEGEHGKRLAQEWKDLI
FT                   DNYLAAGNRDYLIGILLWQEISRQEHEVKALKTMPPPQEMIKPWHIKLLFNAEASAWIS
FT                   KALETHQ"
FT   CDS_pept        complement(122086..123333)
FT                   /transl_table=11
FT                   /locus_tag="plpp0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17307"
FT                   /protein_id="CAH17307.1"
FT                   /translation="MKASSINEHRILDSNLLDKIIYILNKRFDAEVKIISTQFLSEPER
FT                   RNCVVRLFLSSQTKEIPESIILKQSLREDTDANDEEAYARFARDWAGLEFASEIKQNKH
FT                   NVPKFFGGSKEYRFILIEDLGVQHVSLVDSLTVADRKKAIAALTRFMKALGSFHAASFG
FT                   NTGLYEQILQMIHPEAETVDDELNFALNDLLPKLGLANKNLGLTLTHECIEEAKSLIEY
FT                   VIKPGSFTVLTHGDICPDNVFDHAETKDLQLIDFEWCVVRNALLDGTYLRMSMPTCWCA
FT                   KAIPTDVIEHMEQIYREELKQTISEATDDKQYNQAYTYACGFWLLQQTIPFINSTWEKD
FT                   RIGPSGPVPKDSLWNEEDNWVRPRVLSRLQAFIDSSNAYQHLPYLRAMAQAMLAELKRC
FT                   WPETSFLKFYTAFEQE"
FT   CDS_pept        complement(123311..123985)
FT                   /transl_table=11
FT                   /locus_tag="plpp0131"
FT                   /product="hypothetical protein"
FT                   /note="Similar to alanyl tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17308"
FT                   /protein_id="CAH17308.1"
FT                   /translation="MHKLFWDNPYQRQLMTKVVSVNENRLLFAETIGFSFSGGQESDTV
FT                   RVNGLMVTHSEIEDDLIYYTLPSEHGLSEGDVVLMEIDFVRRYKLMRLHFAAELILELV
FT                   QRMLPIEKIGAHIAEHKARIDFSYQHNISDIFDSLLFEYNQIIAKDMLIRTGFSDEKSQ
FT                   RRYWEIEGFSNVSCGGTHVQSTVEVGFITLKRVNIGSGKERIEIKLLDPNLGLKDESKL
FT                   HK"
FT   CDS_pept        complement(123989..124480)
FT                   /transl_table=11
FT                   /locus_tag="plpp0132"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17309"
FT                   /protein_id="CAH17309.1"
FT                   /translation="MNKDKNLSKSAQIIQDFLSQKGISCDVKELDSSTRTAKDAADTLG
FT                   CNVAQIVKSLLFRTEKTNKPILVLASGVNRVKEVLIGHLINEDIGKADADFTREITGFA
FT                   IGGVPPVGHKHVINTVLIDEDLLCYEVLWAAAGTPNAVFSLSPDELKYITNGIVVKIRE
FT                   "
FT   regulatory      complement(124490..124495)
FT                   /locus_tag="plpp0132"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(124497..124919)
FT                   /transl_table=11
FT                   /locus_tag="plpp0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17310"
FT                   /protein_id="CAH17310.1"
FT                   /translation="MVEHPFKNKLVAVLNKHIEPGKVMNALAHMCIGLGAVIGNEELRL
FT                   TDYRDADGGAHPYISEIPFIILCENSNKIRSLRQNALAKNVLFNDFTDTMTVGTYQEQI
FT                   ERTAQVKENDLIYYGIVLFGDWDVVTELTRKCSLWR"
FT   regulatory      complement(124925..124930)
FT                   /locus_tag="plpp0133"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        125023..125598
FT                   /transl_table=11
FT                   /locus_tag="plpp0134"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17311"
FT                   /protein_id="CAH17311.1"
FT                   /translation="MQEISKRIAKTLKSLRQERGWSLDKTALETGVSKAMLGQIEREES
FT                   SPTISTLWKIASGFQASFSSFIEDSLDNSTNPVYRAGHAETLHPDDEKIRVLPLFPFDE
FT                   QLHFELFVIELLPECEHLSPPHKHGVIEHVIVVDGTIELLLGGSWKKLSKGEGLRFNAN
FT                   QPHGYRNPTNELSRIHDIIHYPPQYKSP"
FT   CDS_pept        complement(125603..126556)
FT                   /transl_table=11
FT                   /locus_tag="plpp0135"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17312"
FT                   /protein_id="CAH17312.1"
FT                   /translation="MIWETTLKKITDETANRAANKWVKKPTHLKLINNQINCVYRFESK
FT                   NQGFYLRMTHEKIRKAHELLSAIDFQKHLFLCGTPICEPVVSQEGNDVETVHQDDLEFF
FT                   VHVCREVPGQIMNFDYPDKKAYLTWGRALGLLHQASQSYVASEHHFLTWEDLWRETWDY
FT                   ARQEEALIQDLYQTITTRFKTFSINSAHFGLTHGDHRPGNVLYDGESVHLIDFDEPVYH
FT                   WYLADIAKPFLDLCNKPWPLWKPLFEWFIEGYRQIRPLSSDELKEMNHFSQMKSLDIYL
FT                   WCKYNWFEETAPGGKPRNEWLHDLKTMALTPLFYVP"
FT   CDS_pept        complement(126553..127119)
FT                   /transl_table=11
FT                   /locus_tag="plpp0136"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17313"
FT                   /protein_id="CAH17313.1"
FT                   /translation="MNILETSRLILRTWREADLDPMSLIDQDKKVCQFLPGIGNRSATK
FT                   AGIERMIAHYKEKGFSLYAVELKNTGEMIGFLGLMTPSFEAHFTPAVEIGWRLSSMHWN
FT                   QGYATEGAKAVLHYAFTSLNLPKVVSFTAVNNLASRRVMEKIGLQHNPKDDFDHPKLEQ
FT                   NSPLRRHVLYRLSRADYLKNKSIQE"
FT   CDS_pept        complement(127106..128239)
FT                   /transl_table=11
FT                   /locus_tag="plpp0137"
FT                   /product="hypothetical protein"
FT                   /note="C-terminal part similar to acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17314"
FT                   /protein_id="CAH17314.1"
FT                   /translation="MPTNMMILLMGIAGTGKKTIGEAITTLASQFRLAHHHAWIDPVLK
FT                   LLGNDAQVFWSLDDKGWAALNKARDVIFDTMTEVCSKETSFVITYELLANNSWHQEFFN
FT                   QVQAVAQKREAMFVPIRLICNGAELVKRLKYSDRKGYFKTQDEALITKRLFEEDVYFSK
FT                   EPYEMTLDVSCLSAEESARRILDWTSLVYGSKNQNLEFKPLGQRDLNLMTQWFAEPTVK
FT                   QGYARNQQFSLEDISAKYSPRIEGIESIPSFIIYLNQKPIGFIQYYCLSDHLPEGISGH
FT                   NASLFDEATPEQLAGIDLFIAEPSFRGVGLGRQIIRRFIAEQLYKFKAVVVDPQIGNEQ
FT                   AIPCYQKAGFLPTQYSEDANYLLMINMLSYRGSYEYS"
FT   CDS_pept        complement(128246..128788)
FT                   /transl_table=11
FT                   /locus_tag="plpp0138"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to DNA topology modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17315"
FT                   /protein_id="CAH17315.1"
FT                   /translation="MINLQRIMIIGRPGSGKSTFSVMLQKSLNIPLFHLDKYFFIADWV
FT                   PREYENFLSLQKELVAKPCWIIDGNSSKSFEIRYRESDMCLYFNLPKWLCYWRVFKRLF
FT                   YKASEIDDRAAGCNETVRWSLLSYMWNYEQRINPLLNALKNQYPKVKFIELRSPYDVAH
FT                   LMRVLTHKEEYSIVTGF"
FT   CDS_pept        complement(128871..129329)
FT                   /transl_table=11
FT                   /locus_tag="plpp0139"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to regulatory protein recX"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17316"
FT                   /protein_id="CAH17316.1"
FT                   /translation="MNTLIDAAIKYLSNHYCSEKELIRQLERDFSHVPELDAQIHATIV
FT                   RLRELHLINDNRLAESLSARYIHKGNRFIQQILKQKGVKEEVIEQILEHIELEEVRALD
FT                   EARKKMRGFKNDTDEAINTKLARFLSGRGFSHATIKTVLKQLSEEQTT"
FT   CDS_pept        129429..130013
FT                   /transl_table=11
FT                   /locus_tag="plpp0140"
FT                   /product="hypothetical protein"
FT                   /note="Similar to integrase proteins"
FT                   /db_xref="EnsemblGenomes-Gn:plpp0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17317"
FT                   /protein_id="CAH17317.1"
FT                   /translation="MPKEGKARVLSETEFKRLLIVAKDGQFAIRNSALVYCSFGLGLRV
FT                   KEIASLTIADVADYNYQLLEEICLKRSMTKGEKQRYAYLANEKIRKALQAHLDTLKHVA
FT                   RDKPLFQTQRKSRFTPNSLQKWFKSLYDKAGIIGASSHSGRRTFITRLIEQGADIKAVS
FT                   RLAGHANIVTTAIYVEDNPDRLKRIANLAIF"
FT   CDS_pept        complement(130347..131387)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="plpp0141b"
FT                   /product="hypothetical protein"
FT                   /note="similar to ATP-dependent DNA helicase
FT                   RecG(C-terminal part)"
FT   CDS_pept        complement(131326..131850)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="plpp0141a"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N-terminal part of ATP-dependent DNA
FT                   helicase recG"
FT                   /db_xref="PSEUDO:CAH17319.1"
XX
SQ   Sequence 131885 BP; 41565 A; 24441 C; 24935 G; 40944 T; 0 other;
     aacaggctta attacgttat aacccacgat tatcacacaa cgttatcaac agattttgtg        60
     gataactatc ctctttcgct cattagtttg atcaaccaat caacctcact agcagaattc       120
     acctcgataa tcacttttcc cttaccttca gcatttactt ttacagaaac atttgttgta       180
     aattgttgag atagataggt actccactcc tcacacttgt catgccgtgt agcaaaagaa       240
     aaagtcttgt cacgttcatt attccctgat aacttcaatc ggtttgctaa tacctccgtg       300
     tcccgcacat tgagctgttt ctcaatgacg gtgcatgcaa cctgatattg atgttctggc       360
     gaaagtttca aaagcgatcg ggcatgtccc atatcaattt taccctcgtt tagcatctct       420
     attactctag aatccaaaga tagtaagcga agcgtattag taaccgagac tctagatcgc       480
     cctatcattt gtgctatgtc ctcatgagtc atttcaaact cttcgcgaaa acggtttaat       540
     gctaacgctt cttcaatcgg gttaagattt tcacgttgaa tattttcaat cagtgaaaat       600
     gcaagagcaa cattatcatc aatatttcta ataataactg gcacataagt taatcctgct       660
     ttttttgctg ctcgccaacg tctctcacca gcaataattt cataacgttc ttctgtaatc       720
     tttctaacaa taagtggctg aataatccct tggactttga tggagtttgc aagctcgtct       780
     aaaatagatt cattaaattg ttgtctaggc tgatatttgc cagaatttaa taactcaaca       840
     gctaaatgag ttatcgattc gctgggtata gattctccat cctggaatga attgtctaag       900
     gctcgaagca acttcaatcc cttcaattct atatttgaca caagtgtctc tcctcaatta       960
     tccctgcaaa cgtcccacct tacctgtaaa cgtcgcatca tcagttattt ttcttatttt      1020
     tgcttcccga aaacgtctca ccctatcctg taaatgccgc aaccatccct gtaaacgtcc      1080
     ctgacaattc ccgtaagtgt ccccaagatt cttttaaaac ccttaagaac attgactcat      1140
     ccaacttcta aacaactaat aaaatgatct taaaaaaatt aaaacacgtt gtgtttctat      1200
     agtaaataga aattttaatt ttctgttgca ttttcaataa atcacagata aattataaaa      1260
     aatgtgaaaa ttaattattt taataaaagg gaaatcatgc ttgatcctca aatcattacg      1320
     tatggtacag atcatccaga acaattaatg gataagttct atcaagcggg taacgaaatg      1380
     ttactgacat taagaaattt tgtaattaat cccgaaaaaa gaaaaaaacc aagaacttgg      1440
     ggagcaattg aagccgcaaa aatggttaag gtttctgacc ctacattcag aaaattatta      1500
     gaatcctcag atgatatacc aggagtagta atcgaagact ctgaaaatgg cagaaaagta      1560
     aaaaaatata cattagctgc catcaatgcg cttagagata aagcagaaac tcgatacaaa      1620
     agaccaaaag gttcgaaatg cttaaccata gctgtttcta acttaaaagg cggagttggg      1680
     aaaactgaaa ctacagttga tttaggaaag aaaattgcca tcgaaggttt aaaggttctc      1740
     ctgttagact tcgatgcaca aggaacagca actttaatta gttcagggtt aatccccgat      1800
     ttggaactac gttatgaaga cacaataacc aatgtgttaa tctcaaatcc taacaacatc      1860
     aaaaatgtaa tactaaaaac gcattttgat ggtttagata tcatccctgc taacttagcc      1920
     atacaagatt gtgatcttat attacctaac gaaaaagaaa acaaccatga gcgtttaggt      1980
     tctcctttta ttcgcttatc tgagtcatta aagattatta aaaatcaata tgatgttatt      2040
     ttgatcgact gtggcccaaa tcttggcttg ttaacgctca acgcaatcat tgcctgtgat      2100
     ggaatcatta tccctattcc tcccagtatg aacgactatt caagctttat tatgtatacg      2160
     gctaccttac gaaatatgtt caaggaatta ccttcaaaaa aattggagta tttgcgaatc      2220
     ctcatttcca agcacagcgg aagtaacgaa gcattacaga tggagaatat gatgcgagaa      2280
     cagtttggta gatatattct cacaaatcat atgtgtgaaa ccgttgaagt tgcaaaagca      2340
     gctaatgaga ttggaaccat ttatgatgtt tcaaaaccgc gtggtagccg cgaagcttat      2400
     cgcagagctt tgcaacattt ggatgatgta aatcttgaaa ttattaataa ctttaaagaa      2460
     atctgggaaa agcaatctaa agcatccttt gtaagtggag agtaacatgg ataatagcaa      2520
     acgtaacgtt cataattctg gccccttagg tatgctaatg aaaagtggtc aagtaaagaa      2580
     aatagagacc gctgaggaag aagttgtttt aaaacaagct gctcctaagg cgccatctta      2640
     ttttaaaacc caatctggga ttgaatttgc tgaacaggaa ttaatttacg ttaacccaga      2700
     agagtgcgag ccatggaaat atgctaaccg ccaagaaggt gagttgggtg atattgatgg      2760
     tctaattgat tctattaaat caaataagca gttacagcca gctttagtaa gaaaccaccc      2820
     taatcctcat gggaaaataa agtatgaggt tattttcggc cgaagaagac acatcgcctg      2880
     tatgcgatta ggaattcctt ttcttgtaat tagaaaagat attcccaacg tacaagacgc      2940
     gattgcatcg caagatgcag aaaataagct aaggaatgat gttagtaatt attctaatgc      3000
     gatgctttat aaacgattgt tatcagataa tgtatttaaa acagaaaagg aactttctga      3060
     aaaattacgt atttcctatt caacatttaa tgaattgatg gcttattcta aaattccaga      3120
     agatatagtg gacgctatcc ctgatgtaca taccctttct aaacagcttg ctgtaacgat      3180
     tgttcaatta cttaataagt ctaaaagcaa ctacgataaa atgctctcta ttgcgaatca      3240
     gttaggtaag acaatcacct cacaggctaa attagaaaaa atatttgaag agaagacatt      3300
     actacaaaaa aatgaaacta aaaccacgag taatgctaag tcttatattt ctataaatgg      3360
     aaaaaaatta tttactttta agtcagatta tcgaggactt ccatctattg ttcttaataa      3420
     agagattgct agttttgtta atgtagaaga tatgtgtaaa cacgtttcaa attatttaga      3480
     gcaaattgta gcagaatccg agtactcgga ttgaaagcta atccgagtac tcggattacg      3540
     tgtttagtag catggagaaa cgtatgggaa gcgtagcaat aaataataag agtctcgaac      3600
     tcaaaaaaca tgttaacgca atacattgtt ctaataacct gtcattagtt cagcgaaagc      3660
     tgtttaatgc cctgctattt aatgcatatc cagatcttcc ttacaaacag caattcgaaa      3720
     tcagaggaaa ggatctatat caactgattg gttacaatag caaagatact gcaaagttaa      3780
     aggaagctct cattggatta ataacaatag ctatcgagtg gaacgttatt gattgttcaa      3840
     caggacaaga aaaaaagtgg aaggcaagct caatattggc ttctgcggaa ctttcaaatg      3900
     ggatttgtat ttatgaatat agtcaggtaa tgaaagatct catgtatcaa cctgagattt      3960
     atggtcaaat caatatcgat ctaatttcaa agtttaaatc aggttatggt ttggcgcttt      4020
     atgagaactg tattcgatat aaaggacttg cgcagacacc atggtttcct atagagattt      4080
     ttagaaagtt aatgggcgta tttgatggaa aatatcaagt atttaaggat tttaagaaaa      4140
     gagtacttga tgttggggta aatgaagtaa ataccgtatc acctatccgt attgttcctg      4200
     aaatagaacg agttaatcag aaagttacta gagttcgatt caaactagaa aaacaggttg      4260
     atgaatctcc aattcagcta aataacttat caattgatga ggagttaaaa caaatattga      4320
     ttaatacttt tggattttcg actcaaatga ttgatgagac atatgcaaaa tatgatagtg      4380
     agtatattcg agagaaagta gaaattatta ctcaatcaga aagttttgtt gctggaaaaa      4440
     ttagaggatt agctggctat ttgattgaag cattgaaaaa agattataag ctaagcagat      4500
     cgagcaaagc tgtaattaat gagcgtcgca agatcttaga ggctaaagaa aaagaaaaga      4560
     aagaaaaatt ggaagaacag tcagagcgtt acaagcagta tgtaaataaa aagataaaca      4620
     cttatctaga taaattaaca gaacatcaaa aaagcgattt aaacaatgat tttgaggagt      4680
     tcataaaaga gcaaagtagt attcttaaaa attggtataa aaagcatggc ctagatcacc      4740
     ctgcaaccaa agcctctttt catagcttca ttaaagaaaa taaacataat gaaataggta      4800
     ctatcatatc aatggaagat tatattgagt tggttcaata gaaattaaac cttaaagatg      4860
     ggacatttac ggggattggt attattttat ggtgggacgt ttgcagggag tgttcgttcc      4920
     ataatttcta ttcctatttc ataccaagcg ctgtttgtat gatacaaagt aagtaataaa      4980
     gggaatgtgt aatgaaaaca atttgtgtat accttggcgc tagctctgga agtaatccgg      5040
     catttcaaaa agctgttatt aaacttgctc atgaaatagt ggctcataga ctttccctag      5100
     tttatggtgg gtcaagtctg ggtatgatgg gtttattagc aaaaactgta aaagagctag      5160
     gcggtaaagt agtcggggtt ataaccacac atcttttaga caaggaaaaa ccgttagaca      5220
     ttctagatga acttcatata gtttcttcca tgcaagaaag gaaaagaatg cttcaacaac      5280
     tggcagacgc atttgtcgtt atgccaggtg gtttgggaac attagaggaa gcgattgaaa      5340
     catggaatgc cataaaagtt ggagagctag acaaaaagat aggatttctt aacgttgata      5400
     attattttat aaagctattt agttttattg agcattgtaa taaaagtgga tttatattgg      5460
     ccgaacaaac agctattcca tcaatgcaaa ttgaacctaa aaaattgttg cgggatttaa      5520
     tcctactaaa atatgaagaa attgattgtg tgatgtaaca gtaaagaatt ttttttaata      5580
     aggatatgaa atgcatgctg taagaggtga gaaaaaagga atagtgtatt tacattggtt      5640
     aaacgcagta actacattta gttttgctat tttattttca tcattatccc tttatttgac      5700
     aaagaacatt ggcttaactc aaatgcaatc caatggggtc gttggatttt ttcttgcatc      5760
     aaatttcatt ttgcattttg tagctggtta cattggggac agatttttaa gtaatcgatt      5820
     gctatttgcc atttcaacac taatacaaac tttaggccta atagtcctta atttttctga      5880
     gtcatttgta tatctagggt taagtttgtt tcttatcggt tgcggattag gatctacatg      5940
     tattaattgc cttattaccc aacaatttac tagtaacgaa aatgaattaa gagaaaaagc      6000
     atttttttat aattacagcg cgatgaatat agggtttctc tctggttatg tcatgagtgg      6060
     gtttattgat attaacgata gatacgatcg tttatttgaa gtaagtaatt tgattaattt      6120
     aattacggtg tttttcataa ttaaatcgtg gagatatttt gcaaaagata acgtaaatat      6180
     cagagaggag ataaagaggg ggcagctagg actggtatta atcatactaa ttatacctat      6240
     ccttctagta gggttttatt attcctggtt agcaaatagc ctcatacttt ttattggtgc      6300
     tgcggcatta ttatatatta cattacttgg acgtagttta agtccgcata atgcacggaa      6360
     aaaaatttat tcttttgtat ttttaactgg aagttcaatt gtattttgga tgctttattt      6420
     tgtaggaccg atgggtattt ctcaattttt gaagtacaac gtgaatattt acatgggttc      6480
     ttattatatt cctccacaat ggttaatgaa tttaaactca atttttgtaa ttattggctc      6540
     acctatagct gtcaaactat ttgataaatt aaggaagaaa caaatcacca tttccatatc      6600
     aaaacaattt atgagttcct tactgtttat tgctttgtcg tttttggcat tgactgttgg      6660
     catagagaat tgtggtactg atggattaac tagcatgagt tggattattg tgcattatct      6720
     tcttcaagca ataggggagt tgcttattgc tcctgttggt tacgcgatga taggaagtct      6780
     tgcaccagaa aaattacaag ggctcatgat gggtatatgg atgatggctt caggaatagc      6840
     agccacaata tccaattatt tttctaattt aatgactcaa tctgaatcat taaatcctct      6900
     tattagtaat gaacactatt tgggcgcttt tacccagcta ggtttttatg caattttggg      6960
     tgcacttatt ctatggtttt gttctaaaac gattgagaat agtatacaaa aaaactcgac      7020
     cgaagctatc aagggaatgg cataatctat tgtaacgata attcggcctg taacttagat      7080
     aattttgttt cttcttgagc taatatttta agaaaattat ccaatatatt acggtttttt      7140
     attgttttaa tatctttttt aataccatta ataaggcttt gttgaatttg aagggatttt      7200
     tgcaattcct tgttagtact tggatgatga gccaattcat aaccattgca taaacggtta      7260
     ttcgtagcta tctcatctaa tccagaataa gtacactctt ctttcttcaa ttgcaggcgg      7320
     gccgcctttt cttgatcttg cttttcttgg taatgtttcc cttcaggaga gtatttatta      7380
     aatcctttgg gtgttctcca gcgattagtg cgaagaagtt gagaaattat attaattttg      7440
     tgttgaaaag tgccaatttt ttgaaattgc tcttggttat ttaatgaaaa taccacctca      7500
     tcgaagactt tttgtggtga ggatagtttt actccgtgtt gcttttgaac attcaacaac      7560
     atccctttaa cgatattgag ctcagtaaat ggtagtttat tgtctgaatt aggaaaagta      7620
     atattattaa ttactctatt tttttcttta ttaatggtat ctgttgaaac aagataatcc      7680
     attctctcgt ttatatccgg ttcaggggta atctcctttt cttttatctc tataatggtt      7740
     tctggttctt tgtagatcag ttgtaatttg ttttgaagtg tttctgtaat agctataaac      7800
     gatcgaggta cgccgtaata tttaaatcgt tttcgaataa ttaggccttc ttcttctaag      7860
     ctttttaggt agatgtatat tctactttca ctaaacccaa gttctgcagc aagatcaggg      7920
     attttccttg taaaccataa tctattgtca cgctttaaaa gagtgccttg atgatgaaaa      7980
     attattttat ctaagagaag tgcttcttta gagcatttgg ttaatgaaag aagcttgtta      8040
     aagcctaaat aataaatcga attattcata atacatccat gtaaaaaata ttacttaatt      8100
     aaccctgatg tagtcagcat ataaattaac tgaggcgtgg ttttacaatt aaagcttgtt      8160
     tttaagtcac tgagtcgata aagaatgtat ctttttgact tttttgtatc ttctgcaatg      8220
     tcattcacat gacagccgct gactatcatt tttatgattt gattatccac atgatcgatt      8280
     gtcatttaaa actccgtttt tatataaaac gcattccatg tgacataatt tataacttga      8340
     aatgcattaa tgcaataaaa attattattt ttaccgataa attttattac atgaaataca      8400
     acttgattga ataccctcat cttctcttgt atgattcagt tattaatagg attttatatt      8460
     gatgccatat gagtgaatta tcgtggggta aggtaaaaac ggacatagct cgggttaaca      8520
     aacgcctcta tgaagtattg gaaactatag acggtattca aaatatgctt tttactgttc      8580
     ttgaatatca gtatgggcag atcattgcag atgaacacca tttctattta ccaaatacgg      8640
     gtggcagact gtcttcagtt cctttttcaa tggttttaga aaaaaatctt gaaatgttta      8700
     ttgaatttaa agggaagtcg agtacacacc aggtctatag agaaggagat tttttaagcg      8760
     ttagttcact ttataatgct tcaaatactc atcatcctac tgatatatta caaatatcct      8820
     cgggcgcaag gaatacattc ttactctgtc ctgtggcaga tgcaaggcct catgcgagtt      8880
     tagaaaagta ttttaaggca gatattccag tcccagatga tcttggaaaa cattatttaa      8940
     ccttcaaaag cttatgtgat gcggctaatt gtaactggcg ttcaagatta ttggtatttc      9000
     cttctgaaat tgtaacctta ataaaagaga ataaattacc tactcttttg agtttagtga      9060
     tggagtttga ttctaatcag acaggatatt atgcaaatct acctttttat aattatctaa      9120
     tggcttatgt tcgggcaaat aaccccgaaa tatctcaaaa tgaattcact aataatgcga      9180
     ttagccaatt aattaccata ggaacgggac aagttcctgg ctacggattg gctgtcggtg      9240
     atgatttatt gcccttagac tttattgttg acttatatcg cgatatatat aaatccaaat      9300
     acactccctt tgttatggag cctgtgcatt ttgataaaaa taaaaatgat cctgtttttt      9360
     attcaatact caaagaagag atggctttca aaccaacatc attttcaaat aaaccacagc      9420
     gttgtgaatt aatattcgat acttatttac aatatgcaga acatataaat aaattaggtc      9480
     atttcaagag tacgcctttt tttgaaagcg caacgaatct ggagctaacc ctttttcatg      9540
     aaaagaacaa ccaagtgact aataacctat ttaagctgcc tagagagaca attttttctt      9600
     acgatcctcg ttttttagaa gtaactgata agcttggtta ttcagttgag cagtttcctt      9660
     cgaaaacaac atttttagta ggatgttttg gtattaaata taatgaaaat aaagaaactg      9720
     ttatgcattg atccccttca ggattatgaa ctaattgatt gtgatctact cattcaatta      9780
     gggatttctc ccattttttt gattaaagat gtatctaaat ttgttaagga cagagaaaat      9840
     gtattagtaa gctcattttc atttgaagat ctactagcta tttgtgattc gattcgccct      9900
     gattatatag tctgtttttc ggaagatatg tttgttgata tagcaaaagt cagggaaaat      9960
     ctaaatattg caggtatgag cttgaataca tcgatgctat taagtcataa agatcttatg     10020
     tatcaaaaat tggatggttt attttcatat cctaaaacaa ctacattgat tgaatcttca     10080
     aacctaaaat caatcaaaga aaagataggt gtacaagaga tatttattaa acctattaat     10140
     tcctctggtt cttatgagac atatcatatt aaaaccgaag aggagttttg taattttttg     10200
     ctcaataaga aagagaatga ggaaaaatat atcgttcaag cttatgtggc agatgattta     10260
     taccattcag aattggcagt atttgatggg aatatattat ttgtagaagc cagaaaatat     10320
     actcatccaa atcatttaat ggtcagtaaa aatttgccta tatttagtct gaatatttta     10380
     gatgcacacc agcgacaatt aattttggat gcttcgatta aggtgtgcca gttattagaa     10440
     ttcaataacg gggtacttca cactgagttt tttatgagta aggatggtta tattcaattt     10500
     attgaaacca atcctagacc tccaggtatt ggtctaaata agctatacca gaagaaatac     10560
     tccataagtc ttgaaacaat tttatgttgt attgtttgtg ggattgaacc tcctcgcttg     10620
     gtaaagaata aaagctatta cgtttgtggt tattttccta caaagaacgg tgttataaaa     10680
     agaattaata agcctgagct ttctgtacaa aatgagtgga cactttttgt taggccagat     10740
     gataccagtg agcaaatggc gcatatgtct aagtcagcgc tggtaatttg ttgggatgat     10800
     tctattactg aaataaatca aacaggaaac tttcttgcag agcaagatat tgtagaaata     10860
     tattaattct aaaaatcgat tatagcctca ttttggctgc tgatgagttt ttagtaaggt     10920
     ctttaaacag ttgttcgttc atattttcgt cacaattgtt aaaaatataa gtaaattata     10980
     tatgtcgttt atacaaaaat ctacgggtta taggaatgca taaatatcaa ttaatagagt     11040
     ttaattcaga tagaaaacaa atccaattgg tttccaataa atcaaatttg caacaagtat     11100
     tagcagaatt ttataaagaa aattttgaaa agatgtttga cgacagtggt tgttcaaagg     11160
     gatatatttc cgtatttgtt aactcagaac agatatcatc cattaaagac attactctta     11220
     aacctaatga tgaggtgtgt attgtaactt caatttcagg agggtagtgg agtggataga     11280
     tacaaacgcc aaatttctgt tattggagaa caaggtcaaa aactaataaa taacgcaaca     11340
     attatgatcg ttggactcgg cgggataggc agtccagtag ctcaatatct tgccgcagct     11400
     ggtgttggaa agttaattct tgtcgacgat gataaagtag atctttctaa tttgcataga     11460
     cagatcttat ttaatgaatc cgatataggg ttctataagg cagaaaaggc gagagatgtt     11520
     ttaagtaaag ttaataaaaa tgtggttata gaggcgcaca ctaaaagatt tgatgtggat     11580
     tttggctatt ccttagtatc cgatatcgac ttgatcatcg acggaacaga taattttgaa     11640
     acaagatatc ttattaacga tatttgtgtt ttaaagaata aagtatttat cagctgtagt     11700
     attttggtca atatcattca gcttgcttta tttggtacaa agcacctttg ttatcgttgt     11760
     ctatacccta atccaccacc tataggtgta atacctaatt gttctgaagc gggtgtgtta     11820
     ggcactgtga caggaatagc aggaaccatg gctgctaatc tggcgttaaa ttacttactc     11880
     aagatagaga atgagaaagt accacagata cgaataatag atacaaaaaa cttcaacatc     11940
     tcttcgatgc ccataaagca aaataataac tgttttgcat gtaaacaaag aaaaatcagc     12000
     ttaaggtatc tgcaaaatca aaacgctgat tatggaattt ccttggagca acttgataga     12060
     accaaacatt ttctggttga tataaggcaa aaagaagaac gagagattgc taagttagat     12120
     gatgatctat tttttcctat aaaagagaat actgattatt cgtttttctt atcgtataaa     12180
     gataaaaagt tggtattcta ttgtgcatca ggatatcgaa gtaaattgtt tgtatcagaa     12240
     cttagaacct taggcattga tgcctattat cttaatgaaa ggctttctaa atgatttttg     12300
     agcatacaga aacgtcttta agagctcgca attacggcga aacactaagc gtattatctc     12360
     atttcaaaaa actggcagga attacacgat tagctgattt aacccattta gattacacag     12420
     cattacctgt ctacactgca ataaggccta gagcaaaatc gttaactacg agtcaaggaa     12480
     aaggatttac aaaagaagcg gctcagtgct cggcattgat ggagtctatt gaagtatatt     12540
     ttgctgaaga attagctcca caattaacta ataagtcaga gctggagtta gttcaagata     12600
     aagctgtttt tttaccaata aatcatcttt caaagtctgt acattttagt gattcatcaa     12660
     gaccaatgaa ttgggtacaa gctgaattag tatttgcaga aaaaaccatt tttgtacctt     12720
     tttctgagta ctcactaaat tcttatttgc cggaagtgtt gatttactct cctgatacaa     12780
     ccggacttgt ggggggaaat aattataaag aggccctttt acacggaatt ctagaggtga     12840
     tagaacgaca aaatgcgcaa cagatctctg agatcgcttt tgttaatggc aaaatggtca     12900
     aaaatataac aaaaaaattt gattgtcata tttactttca tgaaaatatt tatgaaattc     12960
     cttcgtttga ggtattgatt aaatcaaaga atccttttga aaatcaaatc ctatttaaag     13020
     gaggtggatg tcatctcaat aaacaaatag ctttaaatcg tgcactgacg gaggccattc     13080
     aatcgcgagt aaccacaata gcaggctccc gcgatgattt gattcatact aagtatgatt     13140
     ttaaaactag tgagtttcct gttgttacag ataaaaaggg ttttgctgag ctgcccaatt     13200
     attcggtaga gacgatagac gatgctcttt cggttctatt tgaaaagatt aaggggaaga     13260
     atcaggatat tttagtttat aaatactatg acaaagaaat atgcatttta aaagtaaaac     13320
     tagtttctat ggatttgata agtcatgcat gaaaccgtcg tttttttaga aacttcctta     13380
     acctatcaag aggcgataca tctacttccc catgcgatgt atttaccttc aatcaaaaag     13440
     ggagatgtgc ttaaagcaat aaaagcagga tataaacgga tagttatcat cgatggaaat     13500
     ttttcctggg ttccttctgt gtggcataaa gaaatattaa cagcattaga ctacggtatt     13560
     gaggtttggg gtgcggcttc aatgggtgct ttaagagcag cggagctgga ttcttttgga     13620
     atgagggggc atggacgtat atatgagatg tataagaatg aagaagtaga tggtgacgat     13680
     gaagtggcaa ttgcttattc taaattcaat aacgtacaaa ctattccttt aatcaatatc     13740
     cgcctaacgc ttgaacgact aaatagtatt aataatgaaa ctgttttaaa ttcaatacga     13800
     tccatttttt atgctgaaag aacttgggtg aaaattgctc gacacgtgtc agaagatctt     13860
     tatcatttga ttaaatctaa ttatatagac gcaaaaaaag aggatgcaaa gtcgttattg     13920
     ctttctttaa accaacaaca cattctttct acggtttctg atttaaatag aaaaaaaaga     13980
     gagtttactc tttttgaaaa aaaattaatt gagtctactt tgtcttctgt ttggttgcgt     14040
     gctcctatgc atgagcagac agaatgttca gcttctcaac agagggcgga aaatattctt     14100
     aaattactat caattcctga aacaaaaaag aataggatcc attatcaata cttactgtct     14160
     cttcttgatc aacaaacgta cgcaattaca gaatacgagc ttatatatca agtcgaacaa     14220
     tttagagagg agcataattt gttaaaagga gaggattttt ttaactggtt aaaggacatg     14280
     ggattgcatg agtctaacct agaacaactc tttaccgatt atgtaaaact tatgaaacat     14340
     ttgataatta cctacgattt caatagttat tttaattagc ctattcatcc taaaaaatat     14400
     tttcactttt ttcttatcct tgcacctagg tgaatgcacc ttcatttaaa taatggttca     14460
     ataatcttat cgcttatcaa aataatccat tatgactgta gaacaagaag tatttgatat     14520
     tttagagagt tgtatttcct gtttgcaaca ggcggcccta aacataggtg gctttgattt     14580
     tgataaacat gcacaagcag cgatatatgc ttattcatta ttaaggaggc agcagttgtt     14640
     tttaatgtat ccgatcgaga atgaaacagt gcattaaccg ataaaaataa gccaatagaa     14700
     gaggaacaaa tatgttgatt ttaacacgta gggtaggaga taccgtagtt atcggaaatg     14760
     aagtattttg tactgtctta gagcaacaac acgatggcca aataaagctg gcatttgatg     14820
     cgccaaagtc tattcctatt catcgctttg agattcaaaa gcaaattatg caaaagatta     14880
     tagaggggac ctatacgaat gatgtggcat ggaatgaaac agtgattgag cgtttaacga     14940
     gtcagtttaa tagggtatct cactggaatt aactgcttat aaataaggat aatgcaatga     15000
     acgcatacat taaatcagga ttgacacaat cattgctcgt tggagcgatg atcgtactta     15060
     caggctgtgc ggcaactcac actgtcctag aacacggttc gttgcaagtg agtacaggac     15120
     aaagcgacac catcttttta caccccgtat ccagcgctca aaaaacggtt tatgtttctg     15180
     tgcgaaatac ttctgatgaa gaggttacta tccagcctca gctaaaaacc gcattaatga     15240
     atcatgggta taaagtactc aataatccag atgctgcaca ttatatcttg caagcaaata     15300
     tcttaaaaat tgggaaaatg agtgcttcag cgagccaatc agcattactt ggtggttatg     15360
     agtcagctat cgcaggagct gtggtgggta cggctgcagg aagtttcact aactccacgg     15420
     ccggaatggt cgctggtggt ttgggtggtg gattaattgg tatggctgcg gattcgttag     15480
     ttaaagatat taattacacg atgattactg acattcaaat cagcgaaaaa gtggggaaag     15540
     gaattaaggt gaaagaacaa gtgcaatcga atctaaaaaa tggcagtagc acaatgatct     15600
     ctcaaaagta ttcccgcgac agcaagtatc aaagctataa aacgcgcgta gtgtcgaacg     15660
     caaataaaat gaatctaaag tttgtggatg cacgtcccgc attagaacag ggtttggtaa     15720
     aaacaattgc gggtatcttt tgattaagct tgagtagagc tctattccag atacagatca     15780
     gacatcggat taattttaaa gggttatgtt cacaacaaag aaaaaaggag tacttaatga     15840
     gtgcaattaa aatactcatg ctgtcgatga cattcttggt tggaagtgga gtggcttatg     15900
     ctgagccaga gacagggctt gaaaacaacg taaaactaaa tcaggtactt acagccaata     15960
     ttccaatgaa tgaggaacag gatgtcgaat atttcaagca catatttact aatggaggcc     16020
     tttatgagtt tctgttggct ctgaataccg aggtgccaga actatctaaa acagccgagt     16080
     atgtggcttt gtacaaaaaa ctggatttaa caaaccaggt gttgtcacaa attttagtgg     16140
     aactaaaaaa aaacaatcaa ttattaagtc aaaaggagtg accatggatg gataagcgct     16200
     ctttttaaaa ccgcgattca ttaaataaaa aagaataaaa aatgagcaca agttggggct     16260
     caggggattt ctttacccaa aaaacggaga tttattaaaa atgaaacaaa tgaagcttaa     16320
     aaaatcatca gtattcctaa gcaccttgct tttatcggga gccgtgtttt cggcctctct     16380
     ggataaagag gagttggctt cagagtgcca atttttggga gctagtttga gccaattggc     16440
     aaaagccaac ctcaaagagt attgcacaat cgatgtaggt tattcaggaa gcatgatgga     16500
     gcagtctgcc tccttaattc gaggcgaacg catggaactt gcacgggata atctcgattt     16560
     tgcgaataga acattcgcac gcgttgcatc taattataac gattgtcctt atttctctgt     16620
     cgttgctgaa tataaactga tcccctttgc cgactgaaaa ttgatccccc tactatagtt     16680
     ttcttcagga gaataaattc tggaggaggg aatgattcaa ttagaggagt caaaaatgat     16740
     tcatattttg tataagcagg gatacagtaa aaaagcgatt gctagaaaat tgggtatgtc     16800
     gataaatact gttcgaaaat atcttaaaag tggttcagag ccttattaca aaaggcgtga     16860
     taaaaagcca ttaaagcttg acccctataa agcatatatt caaaaaagat taaaagatgc     16920
     aacacctcat tgggtaccag ctactgtgat ttatcgagag attaaattgt ttggttatga     16980
     tggatgcagc tcccaattaa gagcatatat gcatacttta aggtcaaaaa aagaagatgt     17040
     tattgttcgg tttgaaacag agcctggaca gcagatgcag gtggattggg ctcaattccg     17100
     aagaggaaag gatagattaa gtgcttttat tgcaaccatg ggatattcca gagcatctta     17160
     tgtagagttt gtcagcgatg aaaccttgga aacgcttatt gcatgccata aaaatgcatt     17220
     cgaatatttt ggtggagttc cttatacgat cctatatgac aatatgaaaa cagtcattat     17280
     tgaacgaaat ggatatggcc taagtcaaca tcgatttcaa gctggttttt gggattttgc     17340
     aaaacatact ggatttcgtc ctaaagtgtg tcaaccttat agggcacaaa caaaaggtaa     17400
     agttgaacgc tttattcatt atttaaagta cagtttttat tttcctttag ttgggcaatt     17460
     gaaggcactt ggcttaagtt tagataaaga gacagccaat atgcatgttt taaaatggct     17520
     aaatgaaatt gctaatcaac gagtacatgc tacaacagga gcaattccat tcgaacgact     17580
     tcttgatgaa caagcgaaac tacaaccatt gtcatctacc tattctggta aattattttc     17640
     tcatttggaa aataaggagg ttcactattt tgcctttcaa ttattagaca acactgcaat     17700
     gcaacatgaa ttgtcaattt atcagaaact actcgagcgc acagaggagg ctgcatgaat     17760
     attcaacatg agcgtatttt atcactatgt gaacgcttga atttatcagc gatagcgaca     17820
     aattactctt atttagctca agaggcagca actcataatc aaggatttag tgatttttta     17880
     gaaaatgtat tgactgtgga gttacaggaa aaacagtatc gaagtcgaac cctgctcact     17940
     aaaatggctg gttttccaat gattaaaaca atagatgatt ttgattttaa atttgcttct     18000
     ggtgtaccaa aaaataaaat ccgagaactg acttctttgg ctttcattga acgacaggaa     18060
     aatattttat tacttggtcc tagtggatta ggcaagactc atttagcgat tgctctgggt     18120
     tatttagcag ttcaagcaaa cattaaaaca aaatttatta gcgcagcaga tttgatgtta     18180
     ttgcttgaaa cagctcatcg ccaagggcga tataaagata ttatgcgacg ggttattaat     18240
     aatgctcgac tgctcattat tgatgaaatt ggatatttac caatgaaccg agatcaggca     18300
     aatcatttct tccaagttat tgcaaatcgc tatgaaaaag gttctattat tgccacctcc     18360
     aatctcgctt ttggtcaatg ggacaatact ttcgccggcg ataaagtatt aacagcggct     18420
     atgctcgaca ggttgctcca tcatgctcat gtcattcaat gcagaggcga cagttataga     18480
     ttaaaagaca aatttaaggc cggtttaatt caaaatcaga aggaggagca aaataatata     18540
     actgattaat ttttttacca ggggggatca attttcatct ggcaaaagga tcaattttca     18600
     atcggcattg acatttctca tcaatgacac gaccttttac acaaaaaata aatcatttaa     18660
     ttcacgaatt agattcactc aatcagcgtt catcaaacta aaggagagca ttatgaatgt     18720
     aagtgcagta atcagaaaga gcagtatcaa gctctatgaa tttatgaggt ggtctctgcc     18780
     cttgctggta ttaagttggc ttattgtttt atgccttacc aatataggtt atgcagaagg     18840
     tcaaaattat ttgagtgggg tcaaaagcga cgtcagtgca accttcggta agaattcgga     18900
     tttgcctggg tatttgtatg caggagaaac gctggtggcg ggcgttacct ggatgaaaac     18960
     caaaagtcct tgggtgtttg tggggttgcc tttactcatg atcttcacgc attggggttt     19020
     aagttatgtc gcataactat tccacattta tgttgtcaga ggagccacgt atagcaggga     19080
     ttcctttgac cactggatta cccgtgtatt tgctcacggg tattggatta ctaatcggtt     19140
     atgcaccgca gctttttgtg attggggccg ttttaagttt aatcatgcat gttcagtttg     19200
     gtgggctgcc tttacgggtt ttattaggaa ttatttattg gtccttaccg catgccataa     19260
     cgacgcttat ttttaggtca ttccctaatt ccgcgcatcg aatctacgtg gggtgagttt     19320
     atgaacagtg tatttcgtga caatgtgctt tcaaaaaata aagtgttgct tcatctgaca     19380
     ctggcttggg cagtcacatc caccattgcg gtgttcattt tgggtgggct ttgtgttcat     19440
     gttgttaata ataaagaaac gcattggttg cccatctgta ctgaggacgg ttacttcttg     19500
     agtaactcct ttttttcacc ttcttatatt aaagacatga ctaaaaaggt tattcaatta     19560
     cgattaacct acaatccaga cacggtagca gctcgatttg cttcattagt tcatttaatt     19620
     cctgcgtctc atcaagaggc attcaaaacc attctggact cagagtcttc agtggtgaaa     19680
     gaaaaaaaca tcagctctgt gttttatgaa aaagacattg aaatagacga atccacgctg     19740
     caagccaagg taaaaggtat cttaaatcga accagtcatg gtctggaagt caagccacaa     19800
     agcaaagttt atttagtcca gtttgctcac ttgaacggga tgatgtggcc taaggctatt     19860
     aaggaggttc atcaatgaaa tcacttcaaa tcctcatgtt aagtagcgtg ctttctacct     19920
     cactgcatgc aggcaataca gcagccacgc ttaagtttga agaaggggag cgatttgcgc     19980
     tgtctttgtc ttctcttaac tttaatcgta ttgatgtaga aggcgagcga attgttaaag     20040
     tcagcttccc tgaacattcc tttattgtag aacaaagtaa agaaacagag gatgatttgg     20100
     atggtgctgt ggttttaaag ccattagcgc atattccgtt aaccgtctat ttcacaacca     20160
     atctgaatca tcatttctca gccaccatat ctccgattga agatttgggt aaaaccatta     20220
     aattggtatc caaaaaatta aaagggtttg attacgctaa ggtgcaagaa cagagccaat     20280
     accaacaaag tgacttaatg actgctctta tggaggggac ccagccttcc ggttttcaag     20340
     aagtgggcat taaacccacg acctttcgtt tgcataaaca gttaaaagta acgctggtga     20400
     aacaataccg aggcaaagag tcttcgggct atgtgtatcg catcgaaaat caatccaaca     20460
     aacccatgga attaacacca acattattcg aacaccccaa actggttacg atggagctgt     20520
     cagaaaaaat gttgcaaccc agtcaaaccg cctattttta tggcatttac cgtgaacaat     20580
     ccaacatggg gtaataagga agcgtgtcat gatgaaatcg tttaaaaagt taataaagaa     20640
     aagtaaaaaa gctaatctta atcaaagtgc caaaatggag cagctccgta atggcttggc     20700
     ttttctgctg cttggtggtt tgtgttatgg attttatctg tattcgtcaa agccacaatc     20760
     tacgcttcct acaaataaaa aacctgtatt tgatggggta ttagacagcg cctttagcaa     20820
     attaagtgat gaggcagtgc ttgaaaaaca acaacgccaa attgatgcac tcaaagcctt     20880
     ggtagaaaaa aataaaaaga acacaccaaa caaatcagac gacctcgttt ccgaaaatca     20940
     agccttatta agcgccatgc aaaaacaatt agagcagctt gcgcttgaaa ataaagaaat     21000
     caacggcaaa ctacaggtgg cgttgcttaa aaattcacaa accagtttag ctgctgtggc     21060
     tccaagaccg cctacacgtg aagaaataga ggctcgtcat aaacaacgga ttttggatga     21120
     aaaagcctat tatggcaaag caggtcttga aacggttcat tttaattacc gtcgtcaaca     21180
     aaaagaagag cgtacaccgg ataattatgt atgggcagga acccatgctg agggcatttt     21240
     actgagcggg gccaaagggg atgctgggat taatggtgct aaaaatatgg gaacggcact     21300
     gattcgactg gattctaatg gaattatgcc caacaatcgc cattcacgcc ttaatggctg     21360
     ccttgctatt gtctctacgt atggtgattt gtccgatgat gcagtagtga tgcaccttga     21420
     aaccctttcg tgtgcgaaac ctaatttaag ttttgaacaa aaggtgtatg gcgcagtgta     21480
     tgacttggat gcgatgcaag acttacgcgg tacatccatt ttaaaaacca aacctctttt     21540
     agaatacagt gcggctgcag ggattttagc aggctttggg gatgggctta aaaacctcaa     21600
     tacagctcag accattaatc caggcgcagg caccattacg acttatggtc aggcctctac     21660
     gctgatgcaa tcagcagcag gaggggcggt gagtaatccg gccaataaaa tctccgacta     21720
     catcatgaaa atcgccgata tttatcaccc tctggtggtg gcacgtgcag gacggcgtgt     21780
     atccatcatg ttcaccaaag gcttttggat tgatagggcg caccaatcgt ttgaatcggg     21840
     taaatccatt gataatcaat cggctcaaaa tgaggccgcg attacaacaa ccattagccg     21900
     agcaggcggt gaaggtgggg agagtagcag tggagagtca actgctccgc aatccacgtt     21960
     ccaatccgat acgcaaacgg cacagcaatt tttaaatcag aacgggatgc ccaatcaacc     22020
     actcttttca acagttaatc ctacaggaga cgtacatggt taaagcttgg tttgttttgt     22080
     tctgttgttg ttcggcagtg acgcttacgg ggtgttcacg ctccattttt gatcatcaag     22140
     atgttcgctg tccttttgtc gagcgtggtg ggtgccaaag catggagcag gtgaatcgta     22200
     tggtggatgc acggcgattt acaccggatg ggcaatacgt gcaacaagag caatgtgtag     22260
     gctgcagcgc ctattcaaaa taaatgaaac ggaaactttt ttaggattaa ctatgttcgc     22320
     aacactaaaa aaatacgtcc agggttttag gaattcaatt gatgattatt tggtggatgg     22380
     ggaagaatcg tcttcccaaa ataccttaaa tgttggcgat caccaatacc ctcttttttg     22440
     caaggaactt ccttatcagt attatgacga ggaatcgcat ttatttatta atcgctggaa     22500
     cacaggctta ttgtatcgca tcaccccgtt aaccggtgcg aatgaaaaaa ttgcagagca     22560
     gttggactcg attttaagaa ccaaggtttc tgatgaattt accttacagc tcatcttagt     22620
     caaacacaat caagtggggc atgagctgga tgctttttca aaccagttca tgactccaga     22680
     ttttgaacag ttaagtgtga tgggcaaaag ccttcgttcg ttttatggtg aggccgcagt     22740
     tcatggattt aaaaccaata ccaatgttaa tcctcgaatt acacaaactg aatgttatgt     22800
     cgttgtcgat aaaatcaagg gaaaaaatga ggaagaggtt aaagcctgct ttgctcaatt     22860
     tcgtattgcc tttgaagcct cgttgatgtc ggccaaaatt ggctttagaa cctgtaatgc     22920
     tgaagattta ttacgcttac ttcattttta cctggctcat gaacccgata atatttaccc     22980
     caaatcctcc tcttatgatc caacgcaact cattaagcat caggtggttg gccgtgattt     23040
     tgatgtagag gtagccaaag aaggcctgct ttttagtggg gttaataatc aaggaaaggc     23100
     ttttgaaact gtgggttccg tgatgaccat cgatggttta ccgagtgagt accatctttg     23160
     ggacaacatt aataacagtg ccaatatttt tcatccagaa caaagcatcc cctgtaatca     23220
     cattatttct gttacttatc tggttgacga acaaaataaa gcgcagggac gtgcgaatcg     23280
     caagaccagt gatttggata aaaaagcgaa aggcgattat gcgctgcatg ttgccggtac     23340
     agaaaaaaaa gcgcgtgaat ggcgtcattt tcgtgatgat ttggcttcag gaaagacgcg     23400
     ttcttgtaag atgctgtata acgtcgtgct attttccaga cgttccgaat atgcccgcga     23460
     tgtggaagca gctcgtacct gtttttctta taacggtatt aagctcgcgc taagccgtag     23520
     gatgcaatct ccctattttc tagcaacatt gcctttttta tttacgaatc atctccaaaa     23580
     aggatttcag ctacccacga tgatgtggcc tatttcctca tggaatgcga ctcaatacat     23640
     gcctattctt tcggattggt cgggtacggg atcgggcatt ttattgccga cactacgcaa     23700
     ccaattttct tgtattgatc cattctcagg taagttgggc acgaattaca acatttctgt     23760
     gaccggcaca tcaggcgggg gaaagagttt ttttattcaa atgctgatgc tcaacgtgct     23820
     gttcaacggc ggggatctct ttattgtcga tgtcggggga agttataaga agttatgcca     23880
     caccttaggc ggtgtgtatc tggaatactc caatttggca atgaatccct ttactcatgt     23940
     cacgaatatt ggcaaagaaa tacagcatat tctttctttg tttcaattat tagcgtgcgc     24000
     taaggatgga gccagtgatg atgaccgagg aacgttacga gaggcaatat tgcaggcgtt     24060
     ttttgaacat cagcaagcca cattaattga tcatgtgcag gctaagcttc tggagttgca     24120
     tcagaacgac cgagaaaaat accctacagg gaaaattctg gcgaaaaatc ttgatcccta     24180
     ttgcactcat tcagagcatg gtacggtctt taatgcgcct tctaagttag cgcctgatgc     24240
     acgcattatt gtcgtggatt taaaagaaat tgaggacgat gaacacattc gtgcaccggt     24300
     tttactgtct attttgtctc agtttcaagg ccgtatgttt aattccgatc gtagccgtca     24360
     aaaaatgtgc atcattgatg aagcctggtc cttattctct ggcgatcaaa ttgcagtgaa     24420
     tttcattaac cgagggtttc gtacagggcg gcggcataat gcttcttttg tgacgatcac     24480
     gcaaggtatc gatgattatt acgccttccc tgaagcacgt gctgcttggg aaaattctgc     24540
     tatcaaactc atttttcttc aagatggaga ttcccttgtc aagcaccaac aagagcataa     24600
     cacgttttct gattttgaat ttaaattact ttcttctttt cctaaagcga aggacgctgg     24660
     attttcacaa gttctgattc gtgcagacgg tatttcctcg tttcatcggc tctttgttga     24720
     tccgtttaca cgggtcctat tgtcttctga tggacgcgat tatcaagcgg taatgaatta     24780
     catcgcgcag gggcgatcgt acattcatgc cgccatgctg gtagccaaca aacactatgg     24840
     cctatccaaa aacgtgttag tggaaggagg gcttgctgat gctgcgtaat tataaaaccc     24900
     aactcttgat tctagcgggt ttagtcttgt ctggaatggt gttatggagc atgcacaagc     24960
     ccgcacccct ggctgtggtg gatatgcagc ggttactgaa tcagccggcg gttttattga     25020
     gccaaagtaa tttatcagaa caagagcaaa aaaaggtgtt aaagcagtat tcatcgttgt     25080
     tgcctcagac cttgtctcag tatggggctt ctcatcatgt gaccctaatc accgcaacag     25140
     tgatttccag tggacgtttc gatgtgacgg atgaggtgat tgcagcaacc ttggaacagt     25200
     tgggtgcact atgaaaaaag tggcgagctt gattgcagca ctcttaatga acgttgctcc     25260
     gatatatgcc aaaaacttag gcaattacgg ccagcttttt cctgttgtcg agcaagacat     25320
     ccgtcaggtc atcatggcga agctgcatcg cttagagcaa tcaggtgcct tgaaacaaca     25380
     tcaacaacaa atagtggcgc gagtggagga gcatgtgaga agaccaaaac cacttcattt     25440
     acctacgacg aacactccta aaacgcatga attagatcca agtatcgtcg tgaatcaaac     25500
     gctttacacc caggatggga cgattattgc gaagaaaggg gtgcacctta atccttttga     25560
     acgcgtatct ttttctaaaa cactgttttt tttcgatgcc gatgatccga agcaactcgc     25620
     ctgggccaaa gcgcattata agcattttga ccaggtgaaa tttattttaa ccggagggga     25680
     tgttaaggag gcctccgagg ttttgggttc ggtttatttt gatttagaag ggcgcttgag     25740
     tcgttatttt cacttaaagc atgtgccttc cgtagccagc caaaaaggat tggtttggcg     25800
     tattcaagaa attggtcaat acgagttacg caaataggag taggtactat gaataaaaaa     25860
     acgttgatta cccgattcat ggtgctgttt ttattgagtt cgctgaactt catctatgcg     25920
     tctcagtgca aaggacactt cgtcaatcca attaccgatg tctgctggaa ttgtttgttt     25980
     ccacttacta ttggcagtag tgaagtggtt aaaagcagtt atcctgatac aaaaaatcca     26040
     ggtaatcctt tgtgtttatg ccctacaccc attggcgagc gtttaggcgt cactattggt     26100
     tattgggaac cagcggcctt ggttgatgtg acgcctaaac cctggtgtat ggtcaattta     26160
     ggcgtgcaac tgaatgtcac taaaaaaggg ttaggtggct cacagatgcc ggagaccgat     26220
     ggacgcggtg cgttttatta cgttcattgg tacaaatacc ctctggttta ttggctgcaa     26280
     gtattaacgt ccttagggtg tatggaaact gaagattttg acatcttata tccgtcggag     26340
     ttagacccca cttggaatga ttcagaactg gcctttgttc taaatcctga agccgtttta     26400
     tttacctcct cgtctgcaag agcttcttgt gcctttgatg cgaccaaagc acttgcaggc     26460
     actgccgtga acagtctttt ttggtgccag ggtgcgcaag gttctacgta tccattaacg     26520
     gggtttgtgg cacatcaagc aagtcctata agtaccgcag ccttacttgc agaacgcgtt     26580
     gattttaagt tgcatcgacc accgacacct gcgattcgcg attcgatagg ccaagattgg     26640
     cctgctgtat gtcataccta tgcatcgagc attatgccca aagaccgtta tcgctatcag     26700
     ttggtgaata ccttgcctga agcgcatcgt tgccatccgt ttggacaatc cgtcattgga     26760
     tgggaagcag gacacaccta tccaggtgat ggcgacaatt ttgggttttt aatttggaag     26820
     aaaaggaact gttgttttct ttaaatgatg gggatgaatt atgaatgcat tcggaatttt     26880
     tttaagtagc ctgtttttag ccaccgcaag tcatgccaat gtgaatgatt ttcttaatga     26940
     ggcatcggca acgggtaagg cggcgcacga ttcagtaagc caggacacgt tggctcattg     27000
     gaatgcgaca tccaatcaat cctatgcaca aaataagacc ttgattgatc agattattga     27060
     acagtcacgg caaggagccc ctattgccca aaaaggccaa accgttgatg gagccgtatt     27120
     atttgtgtct ttttccatgc cagaaccctt gttgttttca ctgagcgatg aggcagctgc     27180
     ttataaaatt ccggttgtga ttaatggtct gattgagggg gattttaaaa aaaccataac     27240
     ggtgttttcc aagcttcatg ctaaggccaa agagtccaaa tgggcgttta atggagtatc     27300
     gattgatcct ctatggtttg aacaatttca tatcactgcg gtgcctgcac ttgttgtgag     27360
     caaaaggccg agctcctgtg gacagcaact tatttgtccc gaacagactt atgatgtggt     27420
     gtatggcaat gcatctataa aaaacagttt acaactcatt gcacagaaag gggatagtgc     27480
     aaacgaggtg gcgcaagctc ttttggagaa cactcatgtc taagtgggtt gttttaatgg     27540
     cgttactttc tatgggatgt tttgcgaatc aaacaggaac cgattttaac gcctttaaaa     27600
     attatgctaa atcgttaaac gcccaaccta aagatgccat gcacggattt gatccccatg     27660
     cgctttttga tcagtactca gagcaccctg cgcaagaagg atactatcaa gggattcaaa     27720
     aggagcaaac agatttatca agccaggcca atgcggcgat taaaaatgat cctggtgcca     27780
     aaacggtcat tgatcatttt ggaacaaaca aatttgaact caatcaagca aattccgtat     27840
     tggctcaatc tcaattgatt caggatgaaa gttatgcgat tacgcacgga caatccaatg     27900
     atcgtgttca atgctcgaat caaaagccta cctgcacgat taagacacat gaagaacaat     27960
     gcttcagctc tcgtttattg cccgatcaaa cctgcaccaa gtaccttaag gtcctggtgg     28020
     actccgaaaa agtggtgcaa cgcgctgatt tttcgtttta tgttgctaaa aaatggaccg     28080
     gagtgattac tgtaaatttg gtgactggcg caatcactaa tgctgtgggt ggctctgttc     28140
     cttatcccat tcggatgaaa cattcgtgtg atggaatgag tgccaccatt cattcgatac     28200
     gaaataatgg ggcgaatgcg tattgggttc aggtgattgg tactccaaca tgcgctaata     28260
     atgggttgtt gaccttttat attaataaag gatggggacg aatttatccc attcaagttg     28320
     ctttgacggt cacagcacac tccaaaccct acatcagcca agaatattgg gacaatcatt     28380
     gcatgagctt tgaaaataag gggtcgctgt gtcgaatcaa aaaagaacaa tgcacggata     28440
     ctcagtcacc taaagtaatt gatggtcttc ctgtatcccg tgcgtgttgg gcaaaagagc     28500
     tgacgtattc ttgttctagc gcggctgctg atgaatgcat cacacagaaa aataaagggt     28560
     gttttcaaac ggcctctgag tgtgcgcgtt ttgataagca gacttgtgcc ctgtataagc     28620
     aaacgtacag ttgtcaagaa aatgtgtgtg aagcacctat cgaatgtatt aaagacttat     28680
     tttgtgccga tggtgactgt acagagcatt cccaaaccca aaatactgat tttgggcaaa     28740
     gtgtttcttc tttagcggtt gtgggggaag cggggcatga attaagtcaa caacccaatg     28800
     cgtctctttt tggtggtaaa gcagtgcaat gcaaaatatg gcccttggat cttattgatt     28860
     gttgtcatga taaaggatgg ggaaaagaca ttgatttgct tcattgtcgt gatgaagaca     28920
     aagcgctggg tcgcgccaaa ttaaattatg tagctcatta tctgggcgag tattgtagtg     28980
     aagaagtggc tggggtttgt ttagaacaca aacgctctta ctgcgtattt ccaagcaaaa     29040
     tggcccgaat tatccaggag gctcgtctta cacaagttaa tggtcatggt ttaggtgatg     29100
     cagagcatcc aacctgtgca ggaatgagtg ttgcggaact gcagaagatg gatttggggc     29160
     gggttgattt tgtgacccca atctatcctt ttggttacgg gacacccaat aaagcggcag     29220
     ggattgcagg tgatctaaag atcaagtctc aagatcctaa aaagtccatt gatgaagtca     29280
     cacgaagaat gcaaaaaaag gcaggtgagt tatgagtcgc ctgttgatgc tgatggtatg     29340
     gggactgttc gtgacatcgc ttcatgcgga cattgtgcag gagcatgcaa aaggctttca     29400
     ttggtatagc gttgaagagg ctcccaaacc gattaaaaaa acactgcagc cacgacctgc     29460
     tccggtggtg aaatctcctt atgagcgctt aatggataag cgtaaggaaa ctctgaataa     29520
     actggcagag gctttgattg cgccatcttt taatgcaacg cacgagtata tgaaagcgca     29580
     aatggattat tcaaaaaata atcagcaatt tgtgcgctat tggcaacaag ttttattggt     29640
     ccatcctgaa ttggatagca cacttaattt tccaaccgat aactcagcga ttgcagtacg     29700
     caatgatgca caaaaagtat taatcaacaa agtcattcaa gaaagcagtg tgcgttatgg     29760
     ctttatctta ttttatcgtg gcacgagctc catttcacaa aaaatggtca tgcatttgct     29820
     tccctttatt aaagaatatg gtttttccat gatctcagtc agtacggatg gccaactcat     29880
     tgatgggctt cctaatccta aatcaattcc tctggaaacg gttcaaaaac aagtagcact     29940
     tgaggcgaag tacatgcccg ctctttattt tgtggattta aagagcaaca agatgtcgcc     30000
     agtgtcttac gggtttttat ctttagaaga gctgaagcag cgcatttttg atgtgatgac     30060
     gcagtttaaa cggtttagtt atgaaggagt gaatgaatga aaaaaaggtt ctttttaatc     30120
     gtactattcc ttctcagcac gcagtcgttt gcgaatgtag ctttggatga gttaacccag     30180
     ctcttagata aaaaacaaga gcaacaggta ttggcgcgca ccaaaaacaa aagaatcaat     30240
     gcgctttcgg aacaacatta ctttattttt atataccgtt ctacatgccc tcattgtcat     30300
     caatttgcgc ccatacttcg tgattttgca tccagttttc atatccctgt agaggcgtac     30360
     agtttggatg gggagtcttt agatggattt gattcagcca atttaacgcc tgagttgttt     30420
     caaaccttat atgtgtctgg cgaatacaag cctgtagtgc ctgccctgta tcttgtgaat     30480
     cgtcctacga atcaagctta tgccgtgttg tttggtgagg cagagcctgc acaacttgca     30540
     aaccgcgtgg atgaactcat gacgcatttg gaggaaaaat ttcatgatga atagattcac     30600
     aactttgcga gatgactatg tttaaaaaaa ccgttgcagc cttattgtta ttagggacca     30660
     gtcagctctt tgcaaatgca gaatccgatt tatcccattt ttttaataat ttggggtttg     30720
     atgccaatgt gacgggatcg catgcttatc aaacacaagc ggcaggttat gcagcccttg     30780
     gttcggtgta tgcccgtaat caagtacgta ccatccgcct tgcgcatgtg gatgtacctg     30840
     gaatgcgctc tggttgtggt ggcattgatc tcttcgcagg cggtttttcc ttcatcaagt     30900
     cggatcagat tgtgaagttt atgcacaata ttttatcagg aggagcaggc tacgcattaa     30960
     acctggcttt agaaacagaa ttgcctgaaa ttgcacatgc gatgcagttt atgcagaaac     31020
     tggcgaatga aattaatggc accaatttta attcctgtga aatgggtgaa aatttaagtg     31080
     ctgctgtgtg gccgcgaaat agggcggcac aacagcgtct ttgcgaagat ttgggtcgtc     31140
     acaaaggaac ctttacggat tgggccatgg cacgtcagaa atgttccaca ggcggtgaag     31200
     cggattccat attggctgag gctaaaaata atcctgaata caaagacagg gtgctaatca     31260
     ataccaatat tgtttgggat tccttacaaa ttaatcagtt tattgcacaa gattccaaat     31320
     tagcagaagt atacatgtcc atttcaggaa ccattgtctt taacgcgaaa ggggcgttaa     31380
     tgacttaccc ttcgcttgca accaatcaag attttattaa agccttgttg tatggaggaa     31440
     agttacccag ttatcactgt actgatacag ggccacagtc gcattgctta tctattgata     31500
     ccacaagcac gcaagaaatc agtgccaaaa aagccttagt ggctcaagtc caggaattac     31560
     tgcaggggat ttatgacaac attaaaatgg gcaaagagtt atctgataag caaaaagggc     31620
     tgattgagtt aacacaaccc gcagttttta atcttatttc cgccaatgcg caacaaaaca     31680
     ccgggattca aggcagttat gagctggctc aaagtgtggc aactgattta ttggcacaat     31740
     acctttccaa ttccctcgat attattcgcg cttcgctctc agggagtgaa ctaggcgctc     31800
     acaatgaaga gcgtttatac aaaaatctgc aactagcaca acagtttgtg gcgcggttta     31860
     gcacggagag ccgtgagcgg tttaatgcgg ctttacagac gaatgaatta atccgcaaca     31920
     acgtcaaaca agcattaagt gctttaacac ccaccttaag aacagcctat tatggagacg     31980
     cgcaatgagt cttttaacca tttatacgcc acaaaatgga gagtatctaa aaacagtact     32040
     ggatgctatg gtgacgctgc ttagcacatc aacctaccaa tcggctcaag acatcgtgag     32100
     tattcttgct gtaggagtgg tcggatttca atatgtcagt ggtaaacgga ttcaagccat     32160
     tagtcgttat gttttgtgta cgtttgtttt cttgttttgt attttaggca tcaaaacccc     32220
     agttgccatt attgacatgc aaacggcaga ttcagcaggg cctgcactaa ccgtagataa     32280
     tgttccttta ggcgttgggc tgcctgcggc actgattagt ggcattggat atgggattac     32340
     tcaagtattt agtgacgtgt ttcatatgcc gaatgattta gattacacca gaaccggcat     32400
     gttgtttggc tcacgtacct tcttagcgtc caccagttct aacttgtctt tgtcacctga     32460
     actctctcgt gatttgtcca cttacatcag gcaatgcatt ttttcagcca aacttttggg     32520
     gagtcagcaa atttcaccca atgaaatgaa gcacagctcg gatttaattc gcctgtattt     32580
     tgagcatccc tctcctattt atcgtgtctt atttcatgat ggcactaatt tgagctgcat     32640
     tgaggctgca gcacgtttaa aaccagaatt gaatacggga atagaaaaac aacttgttca     32700
     tttatcgaat attatgacca agggtgataa agagaagttt agtgatggtt tggcggctgc     32760
     tcattcctat tttatgaacg tgtccaaaga tgcggccaat gtgcttacgc aaaatatttt     32820
     aattaatgcc acccgtgaat cagcccttga tgcctttgct tttgctggcg cggatgcgga     32880
     gctgatgaat tataccaaca gttccagtct gcaaaaaatg cacgtggctg aagcgaacag     32940
     cttttggctt gcaggttatc ggcttcctta ttatatgact gtcttttgga tgttgactct     33000
     gtgtattttt cctttagtga tgttgttagc gctggtgcct ggcatgcatg gggtatacat     33060
     gatctacatg caaacccaag tgtttttatg gtcttggcct ccgatgttta tcattattca     33120
     tttttttgtg tcgttagcgt cctctaccac actgacttta tttggttcta aaaatggcgg     33180
     ggttactttt tcaacaattg attccatcgc cagtattcaa agtagctttg cgtatacggc     33240
     agggggcttg gccattagtg ttccagtgat tgcccttttt attgccaaag gcttacctaa     33300
     tttattaagt gctgcgtctc aacatctagg aggaatggcg caatctttat ccacaggaga     33360
     ggctcaatcg gccacgcaag gaaatatttc catggcgtct tacagtggtt ggaacatgaa     33420
     ctacaacaac acgcatgcga ataaatggga tactaattat cagcatatgg aaggacgagc     33480
     tactgttcaa gcggataatg gtgcgttgct ctcgcaagga ttggatgggt cacgcgtgat     33540
     taacgcacag tctgcaatga gtcagatggc aacgcgatta cacgcatccg atcgtatcag     33600
     cgcttcattg caagacagtg ccagccaatc cttccagaat gcacaatcgc accgaaccag     33660
     tgcggattct cattatcaac aagccttgag tgggctctct caatttaatg aaagcgatgc     33720
     aagtgaggta cgcgaaggaa cgggtattaa tagaacgctc agtaatgcgc tgaatcagga     33780
     tattcgtcaa atgcaagatg cggttaacca atacaatcag catcatgaca aatcaggaca     33840
     agtgtcgtgg gatgcggcgg tttcggcgag ggttgataca cgcaaaggaa tatttggagg     33900
     ttttgtacac gcagcgacag gggtttccgt agagggtagt gtgagtggaa aaacaggaca     33960
     atcttggtct aactcggttc aggccttctt taactccagt gaagggcagt ctttctctag     34020
     cgcattaagc cacatggagt ctacagccaa gacgcatcac ttggatgcca acgattcgtt     34080
     taacttgtcg aaatcggaac aaatcgcagc caacctatct caaggacatg ctttatctga     34140
     tatggcctta gcagaataca gtaagggcga acattatcag cacatggcta accgtgtgaa     34200
     agagcactca gacggtatgg atagagtatt ggatcaagcg tttcacgatt gggtggtgca     34260
     gcatcatggg gtgcaggcag aaaaggcact gatggggacc gatgcttcga gcttgagtgc     34320
     acaacaacaa ttggccgatc agtttatgag ttcttcccaa ggacaatcgg cagtaaaaga     34380
     gcaagtaagc cgcatgatcc actcatcatc cgataaggct aagagccaat ttgaggcgca     34440
     acgtgcttcg atgacagcac atcaaaaagc actaatcaac caagcccatc aggatggttc     34500
     tggagacgtt ttaaataaat cgcaagagcg acatttaagc caggtgcaag acaacaccat     34560
     ccagcaagct cacgatctgc gtatggagaa tcgagaagat ttatcgaaag cctatcaaca     34620
     ccaagagggc agtacacaaa aggagattaa agcatctgaa gcggatttag cgaatcggca     34680
     agcaaaacaa aaacacgatt atgtggacaa tgagcgttgg tacaaggaag ggcgttatga     34740
     ataagcaaac attcgcgctt acgcgtccgc ctagtgcatt ggtttcttca agaagagcgg     34800
     tcaaatcgat ggatttaaaa tcatgaaaca aagttctttg caaaatatgt ggcaatttat     34860
     gagtggcggt cagatttttg actataaaac caaaatgatg attcaggtaa gtcaacgtat     34920
     ttttcactgg gctgtcttag gttttgtcgt acttttttcg ctgattatgg cattttatgc     34980
     ctcctctgaa ttaaagctgg tggtgcttaa ccacatttca aggttcctgg ttaaattcca     35040
     ttacggggag tatgtattat ggaccaatct gaatgggagt aaaattacag cgctttttta     35100
     tcaaaaaagt ccccttattc aagcatccgt gcagcaggct ttggatgctc tttggagaaa     35160
     agcgcaagtt tctttatttt ttggtggagc ggtgtatttg ttgattacgc tgttgttttc     35220
     ccgtttcttt attaagttag gtgaaaaata caccaaagat caatttgttt ccggtacgcg     35280
     cttagcgtct tcgcctaaag aaaccatcaa atcggtcaac gaatcacaac gtggcgcttc     35340
     agaaattaaa cttttgaatc gccttcctat gcctaagtat tctgaaaaac aagggatgtt     35400
     gtttcatggc acaacaggtg caggaaaaac gcaagccatg atgatgctgt tggagcaaat     35460
     tagggcgctg ggcgagccgg caatcattta tgataaagaa tgtaccatca aaccttattt     35520
     ctttgatgag cgcattgatg tggagctcaa tcccatttca gaattatgtg ccaattggaa     35580
     aatgtggcga gaatgtgcca atccgttgga gtttggctcc tttgccactt atttaattcc     35640
     taaatcagtt caaggcagcg atccattttg ggttgactca gcaagaacaa ttttcacctc     35700
     gatggcgtgg aaaatcaggg attatgcaga aaaagatcca gtgtttcttc tgcagttatt     35760
     actcaccacc tcattggagg aaatcaggaa cattctcaaa ggtacggaat ctgaaaatct     35820
     ggtgagtaag gaaattgaaa aaacggccat ttccattaaa tccgtgttgg caacctatac     35880
     caaggcgctg cgctttcttg aagggcttga taaatcgggt aaagaagact tttcgattaa     35940
     agaatggatt gaaaatacaa ccaatcctaa aaaatacaat aaagggtggt tatttattac     36000
     ctcacgctcc aaataccata aagagataaa gcctttaatt tctctgtggt taggactcgc     36060
     tatgcaaggg gtgcaatcct tggtggctaa taataagggg cgtatatggc ttgtcatgga     36120
     tgaattagca agcctgcatc gtttagaaac catttcagac actctagctg atatccgtaa     36180
     atttggaggg tgtgttgcca ttggcattca atccattgcg caattagatt ttatctatgg     36240
     aactcatgag gccggagcca ttgcggatct actcaataca tccatttatt ttaggagccc     36300
     aaaatcgaaa gtggctaagt gggtttccga ggatttaggc tcacaagtga ttaatgagat     36360
     gaaagaaagt cagtcttatg gtcctgattc ggttcgtgat ggtaatacgg tgggctcgca     36420
     acgtactaaa agaaatacgg ttgaagaggg cgatattatg actcttgatg atatggagtg     36480
     ttatgtccgt ttggtaggaa atcatcccat cactcgtttg aaaaacaaat acattgagcg     36540
     taaagaaatt tgcgtaccac ttgttgagcg atccatcaat tttgatgcgt tggaaaaagt     36600
     aaatcaccgc gcgttaatgg ttcaaaataa tcctcaaaga aatgacgacg ttaaaaaaat     36660
     ccatcaattt gaaacattgg cgcatgaggt atcggataag gatttagtac ctccacaatc     36720
     accttatgcg gaaccggaac ccaaagatca cgttacagcc aacaaaaacg acactgatgc     36780
     tattgagttg cgtgaggcct ccattgttat aaaagaaatt ttttaagtca tccagggagg     36840
     tattatgttg accttaaata aaataagtgc ggctaaagac gcgctgcatt attacaccaa     36900
     tcaagataat tattatttaa gcgatcgaga ttcgcttaac agtctgtccc gatggatcgg     36960
     gcgcggtgcg caaaagttac aattgtccgg tgaaattgag ccttcgcaat ttttgcaatt     37020
     attggatgga caattaccca gcgggcaact gctgggtatt atcgataagg gagtacgtca     37080
     acatcgtcct ggaaccgatg tgactttatc agcgcctaag tccgtatcca ttttagccct     37140
     ggtgggtcag gatgagcgct tgcttcaagc ccatcaagaa gccgtgaaca ttacctttgg     37200
     tcggattgag cagctggcag cagaagcacg cattacattt aatggcgaaa ccacctttga     37260
     aaaaacccgt aatttagtag cagccatgtt tgtccataca acctctcgtg aattagatcc     37320
     tgatttgcac acgcatgtac ccatactcaa catgaccgaa cgttcggatg gattatggcg     37380
     ttctttatcg tcaagagcaa aaaatgataa agagcatctg gatcatggtt ttcgtgaatt     37440
     aatttattct aatcagcatt atttgggatt ggtgtacatg tcctctttag ctaaaaaagt     37500
     taaggagctg ggctacgata ttcgcattaa agacaggtac ggtaattttg agattgtagg     37560
     tattagtgat gaggctatta ctgctacatc caaaaggcgc gtgcagattc ttgatgatat     37620
     gaaggaacgc ggtacaagca gtgcgaaggc tgccgagaaa tctaatttat cgacgcgcaa     37680
     cccaaaaact gaaatagaca gtcaagcgct gcatcaacag tgggtagacg aaattaagga     37740
     tcttggtatt gatttaggca cgattattca ggattccaaa ttaaatagcg gacgaggagc     37800
     ggttaaaagc actcacacca cacctttaag cactgatgcg caaaaagcag tgggcgatgc     37860
     actggctcat ttgtccgaat attctactca aattcagcat ggggctttgg tgcgccaggc     37920
     tatgattttt tcagcaggtc ttgtggggca tgaggacatt gagcgggaaa ttgaatcgct     37980
     tttggcggca agggcactcc agggaaaacc cttggaatat tatacaacgg cgcatcttct     38040
     tgcacgcgag aaggacttta ttgcaaaaac taccaacgag ttaaaagtaa gcttttcgat     38100
     ttcagtacca aatcacgggc tcacatctac ggtatttaaa aataacgagc gcattcaaat     38160
     cattgatata gagggttttc ggtgcgagaa agagctgatt caagacatgg tgcatcttgc     38220
     agaagcacat caactcaatt cttatgtact tcatcctggt agcctaaaaa cgcagcaact     38280
     tcgagcagac atcaaacatt tggatacagg atttatttcc aggattaaaa atttgtttaa     38340
     agacgatatt gtgcatacgg tgtctggatt tcaatatcat tatgggaaac acatcaaatc     38400
     atcaccgttt ttgagaaaaa agcaagattt agtgattgtt catgatgcac aaaaactttc     38460
     ttttgatgat ttatccgcgt taagcgacat tactcaagca cacagaagca aactcatttt     38520
     attgaataac tcggcaggaa cattgggttt tagtgcagga aatccgatta agctattaaa     38580
     agagcagggc attcattcgt ataaatcgtt aacagcccct atcaaaggag cgcttaagct     38640
     ctcgattggg aaacaagcaa atgaatccat gagttctgct tggcttcaat taacgccaga     38700
     acaacagcaa aaaagtgcac tggttgcctt gaataacaaa caaaaggaga ctttgacgag     38760
     ccagatacga gaaggtctgg tgcagaaggg gcaattatcc aggcaaatga aaaaggtagc     38820
     tgttttgacg acagtttcct tgactcaaac ggaaaaagga tatgctcatt cttataaagt     38880
     aggcgataaa atcacgtttt ataacgaagg acgaataccg aagcactata aggtatgtga     38940
     agtcggtgtc aatgggctgc atttagaaaa tgcccagggc aagacaagtt tgtttgctta     39000
     tgatgccaaa gaagactttc atgtatcacg agaaaaaata ctggaagtcg ctgttggtga     39060
     acggttaatc aatgaacagt ccttatatca tcaacgagtc aaatatgcgc ctaagagttc     39120
     gtttgttgtg tcaaaaatta ctgaagaagg catctatgta cgccatgagt ccaacacctt     39180
     atttttgact aataaagcgt tgtctgaata ccattttgat tatgattatt gtaaaaaacc     39240
     gcatgagata aaaccagaca ccacacaagt gtttatggcg gcaagaccgt accagctcaa     39300
     tcgtaatctc atcggagaaa ttggtgaaaa cgcgcagcag gtgcttttat ttacggatga     39360
     tgaacaaaaa gcacagcgct ttttagagag tgtgcaattg aaatggactg cctatgatgt     39420
     gcaacaaaaa aagcccgatt tagtttatcg tgacatggcc tatgccaata aggcactgga     39480
     acgagaaatc aactcgttaa ttcatcatct gagtctgaaa tcagaagata aagagggcat     39540
     tgcagccaca gcacttacgt atgcgcttgc taaatgcacg gaacgcaatg cggcttttaa     39600
     acacagtgat ttaatgaccc atgctttaat gcatgcatta ggagaggcag attttgaaga     39660
     cattgcccct ttactgaaag gacgaatggc cgattctttg gtgtatttgg atacttattg     39720
     gacgaccaaa gaggcattac accttgaaga ggcgatactt aaggttaatt acaaagagca     39780
     aaatacggtg caacccattg agccttcggc gcaaaagctt ttgtctttac ctgaaacctt     39840
     aacgcaaggg caaaaagatg ccatcacgtt ggtggtgagc acatcagacc ggtttgtatc     39900
     cattcaagga cttgcgggtg ttggtaagac cacgatgatg cggcatgtga aggatattgc     39960
     tgagagcaat cagtttcaag tgcttggatt agcaccgacg cataaagccg tagaggaact     40020
     caatgcaaat ggcatccagg cgcagaccat tgatagtttt ttacgcaata acggtgggtt     40080
     gggtgctaat cacttagtca ttgtggatga aagctccatg attgataatg agaagtacca     40140
     tgccttacaa caaaagtgca ttgactccca atcgcgaatg gtgtttacag gggatattac     40200
     tcagttgcaa tcgctggctt cagggattcc tcatgagctt accatcaaaa gccaatcgca     40260
     aaaaacagca tttatgacgg agattgtgcg ccaaaatccg aatcctgaat taaaaaaagc     40320
     agcggagttt gcatcacgta gagaaattgg gaaggctttt gaactcataa aaaacattaa     40380
     tccagaagag tacgtgcagc gaaagacacc ggtacagggg ttgaatcatt catcactgat     40440
     tgaaattaat tgtactgatg aggaaggaaa aaaggactac acatccattt atcgtgccat     40500
     tgttgacgat tttctcagcc gaacccatga gtgtcaaaaa aatacgctaa tagttgctca     40560
     tgctcatgag gacagaacac ccattgaagt gttaatacgt gaagggttgc ataaacaaca     40620
     tcaactacac ggtcaagata tactttgtaa gcgcttattc ccagtcagca tggatcaagc     40680
     tgaccaagta caggcacatt cttttgaacc aggtgatgtc attcggtttg gtaaaaacta     40740
     ttcagtggct aaaaaggacg actatttcac cgtcaaatcc attgatcgtg aagcaaacaa     40800
     attgttctgt gttgatgagt cacaggttgc gtttacaatc agcgcttcta ttttacccaa     40860
     aacaatgcct tctttttaca aattgcacga acggccttta gcctcagggg atcggattcg     40920
     gttaaaacga aatgatgatg cccgtggcat tattgccaac gaagaatata cggtcacaca     40980
     ggtttttggt gaaacagtag gcttaagcaa cagtaaaaat caggtcacgc taaatttaaa     41040
     aaaacaatta gatcttcatt gggattattc ctatacgaat acggcttatt ccagtcaggg     41100
     tgctacatcc aagttcatga ttgccttgga attggaggac cgtcttgttg taaccaccca     41160
     ccgatctcat gaaattgatg caactcgtgc cagtcatcaa tcaacctttt atactgataa     41220
     ttttgaagga ttggttaaaa gactcgaaga tcccctgaaa caacgcgatg cggataaaac     41280
     ctctgctgta tttaccgaag aggattatcg ttttaaacaa cagaaacagc aaagaatcag     41340
     tacgcagtta atgaatcgag ctcaggagca cattctggaa gaacctaagg aacaggtaaa     41400
     agattctcca ctcataaaaa aatatgagtc tgctcaaaag ccgtccatta atgcggaaga     41460
     actgtataat ggattattga acgtatctga ttctttagtt aaaagccttt taggagagcc     41520
     gaattatcga ttatcaaccc aatccgaata tcgatatgga gccaaaggaa gcttgaaaat     41580
     tgatcttgat tcaggtcttt ggcaccattt tgagacaggg gagtcgggta atttatttca     41640
     tcttattgaa cgtgagaagg gtttatccgg ttttaaagaa actctggagc atgcagcgca     41700
     atatatccat tacattcctg agtacgagcg taaagcaccg caaaaattga atgagaaaaa     41760
     agagagggaa gtcaaagaag ggaaacgtca actggcccaa aagttatttc aacaatcaca     41820
     gcctattcaa ggcaccatcg ctgaaaaata cttaatcatt catcgtgggt tagcgcatta     41880
     tgatcatgct gatcttcgct tttgtcgttc ggtatacacc aagacccaag atgagcaaaa     41940
     gcatgttcct gcactattgg cttttagtaa agatgaacag ggcaacatac accatgttca     42000
     gatcactaaa ttagaacctc attctgctaa taaggataag tcttgtgaat ctgtgaaaca     42060
     aacgtttggc tcaatcagta attattttgt caatttaaat caccatggta aaggcgatat     42120
     tgcttatttt accgaagggg ttgagacagg attaagtata cttcaagcca atgaacatgc     42180
     gcgtgtgtat gcagttttgg ggaaagcaaa tttttcaaat attgatccaa aagatatacc     42240
     gaaacaagtg gttatttgtc tggataatga tggaaaagac acctataaat acgcaaagaa     42300
     cgaacaatcc aacacgatta taaaagtagc tcagagatta catgattctg gtatcctcgt     42360
     atccattatg attcctaaaa aagaaaatac cgatttaaat gatgttctta ttaaagaagg     42420
     aaaggacgag ctaaaaaaac aattaaatcg gtgtatgagc ttagaggaat ttaaaaaaca     42480
     atgcgcctta gaaaataagg aatcggagct aaaaaaaata aatcaggata aacaaattca     42540
     gtctttgata aagcaagatc gtaaatttaa tgcacaaagt gacaatgagt ttatacggct     42600
     caatcaagga ttaattaacg gaaataaaga acgtgtgtat aacaaagagt ttgtagaaaa     42660
     tactcgtact tttaataaat cacggtctaa tcgagaaatg gagcgagagc tttaaaaagc     42720
     ttttatttgt aaatggggag atgttttcat ctatcctgac ataaattgag agtatctctg     42780
     acgttctttg taggtatacc ttattagtac gctaaattaa tagactgtgg atatgtgtcg     42840
     gtaaaaaaag aacatatgtt ataattattc aattaaatta tttaagagtt tcgtatgcct     42900
     cgcattaatg agcttcttcc tcaggaaaaa gaggagttga aatctattta taacagaaca     42960
     agactagaat ctttacttac tacagatact tttaaaattg gtgataaagt ttatattcga     43020
     gatgcagaag caaaagaaat ttgggaaatc cataaattca tttctcattt atcacaaaaa     43080
     ccagcggcga tccttgttca aaaggatgat catgatgcat cctatcttcc agtcagcacc     43140
     attaccgctc ttttagagca acttattttg atttgatcat gcactttata acaatcctat     43200
     ctatacaaat ctataactgc aaatatatgg ctacttagtt ttatcagcca ttaaagagta     43260
     tccaatgact ggaaattttt cgataactag tgaagtggag ataacgattt aagaaaaacc     43320
     ttttaataga tttggaatca ttcgttcaat catagctaac gctgtttctg catcataagc     43380
     accaatttta gacaagtctt tgttgtatac actgtataaa atttcagtaa taatttgtat     43440
     ggagcgaaca ctattttcga gtaataattg ggttgattca tctgtccttt tctctaaaga     43500
     ttgcaaataa atacgggcac caaatgatag catttccgct gcggttacat ttagttcgtt     43560
     gttattcatc tttgctattt tattcaacga atgaagagta tctgcgccaa tatcaatagt     43620
     tacttccata acgattcacc ttcttctata ggtactgttt taagtccaat tccgttcatt     43680
     ttaaaccgaa cctctttata agaattattc tgaaatcctg agaaattatc atttaaatac     43740
     tcgatggttt tttgtttaat ttctttcaaa gaatcgtcat taatattgga tgaaatgact     43800
     aaactttgat aatgattgtg atacatcaaa tggggtatgg atgcatgaat ttgttcaatc     43860
     atttttctta tatcttgcaa tggattttca ctttttttat gtggtgaaat ttcattatgc     43920
     aggcaaaatt ctaaaagaaa ttttaatgct tttgctggcg aaatgtctga tgatcctcgt     43980
     ttttgtaact caaattgatg tgcaatttta tttaagtact cccgttcata ttctgaaata     44040
     cgtaaggtaa tgacatcatt ttctttcatg gatgggctca tttatggcat taatacaagt     44100
     atacaatagt attatttatg tatacaactg tatgtttgac ttaatatcgg ttgatttata     44160
     agggcttcat gtatacaatt gtatacatta ggcttttact ttaaattact cgtttcttaa     44220
     ggttatttta ttatttatat ataaatcata tggttatgtg caaatatttt aaagcaatca     44280
     tattgcgtgg tgtgtgtgta gaatcagaaa atacaactag gcacaatctt tgtgaagtac     44340
     tactattagt atagttagaa taatggacta tggaataaat aaagagcgca tgcctttgcg     44400
     cgtttgtgaa ggaataaatt agccatctaa ataggataaa aaaaatgaaa ttattttttc     44460
     aaaaggatgt gatagttgat cgtataaaaa aattaataca attactcatc cgaattaaag     44520
     attgtgtatt agaaccacca ccaggttatc ttgaatatca aaaagccatt gcatcaaaag     44580
     atgaacactt taattatatg gaaaatgaat attttaaacg gcatattttg ccttatatta     44640
     taaaaggtca tggtgtaaag cagagcgatc attcgtccat taatcatcaa caattagtta     44700
     ataatcattc actagatacc tttagagtaa atccagttac tgggttgccc atgcttggtt     44760
     cgtatgatgc tggagggagt ccatttggtt ttaatttcaa tcactccatg catcatatta     44820
     atcatcattc aagtattagc aatatgcatt caaataacca atttaattca tttgattatt     44880
     ggaatagata gttaatacgt gttaagaatt tgtaacatta agcgaggata taatgccttt     44940
     aattactgaa gataaaataa agcaaactga aaaaataaga gttgaaattg atgccaatgt     45000
     atataaggaa attcaagcct attctgaatg ggcaaaactg aaaggaacgg atacattttt     45060
     tgaaaaatca gctttgtata ttctagcaaa agataaaaaa tggaaagcct ctgatgaata     45120
     ttcaatgatt ggttaaataa aagttgcatt gcagttaata cggcatgtag tttatcaaaa     45180
     aattagcatt aataattaat gccaagaagt aatttatttt tattaaaatt tgcattgtta     45240
     tgaattcaat tgcaatgatt ttttgtgctt taagtgctaa tagtaataga aaggcagcgg     45300
     tgcaatggcg attgtgtaca atctaataag aggcggagta cattgtatga tggatataaa     45360
     tactattctt ttattcatta tcgtgcttgt atttctgcgg ttattcgatc tcagtaattt     45420
     tgaatctact tgtcaccaag cgattgatca ttggctaact agaaaatatg gaatacgtgg     45480
     atttgaaaaa agagcttata aacgtggatt ccttgattta tttcacgaag agttaactct     45540
     tcgttcacat cgaccaataa ctcaacgcga gtgccattat gcgtttcgtg ttgctcagta     45600
     cagacatgag aataactatt aaaagtaagt ggtgtaatag tttgctgatc ggcgtattaa     45660
     atgatggttc tattaacagt atttggatta gaatatgaat atcaaagtaa tttttaaaca     45720
     cacattttat tatttaattc ccttattcat tttgttggcg tttattattt tttcttataa     45780
     tgcgcattat gaggatacat ctaaagttcc agagctaatc tcgttgaagg aatttagcct     45840
     tattgcccaa gagagaggaa attttcggtt atcattttta gatacgcttt ttattaacgt     45900
     ttttgatttc atagtaccag cacgatttat acctaaaaaa gccagcttgg agctattaga     45960
     tcagaaaagg cattctcttg aattcaatca agctggtgag agtgttaatc aatgtgtacg     46020
     gactttaaat atcacgtaat gtagatacaa acagccgtta agctagtttt tggttaagct     46080
     taacacaaat actgcaaatt attctgagta attattgatt agggttttta agctgtaccc     46140
     gcataaacat acaaaaatag catcaatttc tatttgattg gcgctgttta aataggtttc     46200
     aattgagtat tcagattgtt tgttcggatc ttcgtcatcc tcaaaatggc ctgagtaatt     46260
     ttttttataa tattcataga ccttatgtaa ggccgtaatt taagtttacg gcctgtttta     46320
     attcgcttaa tcaatcgctg cataaatgtc cgcagcttct ttgtgatatt cgatataatc     46380
     tcgcaataaa tagtattgct ggattgtttt atccgattta gttttccaac acagttgatt     46440
     aagaacacat agggttgtaa tgattccagc ggcatccgcg ctcacttctc catcatatcc     46500
     gttgccttcc acatatatgg ggagtggctc gtccatgtca ggagccaaat aaaaaccacg     46560
     attgctcaat tcgtaaaaac gccaatagcc gccttcgtaa gaagagcaca tcacttttaa     46620
     tgtgttgtag attgcttgtt ctgctcttat catcatggtg ccaaaatgtt taggcaaaaa     46680
     agaaaggcgt tgctgatcgc taactagttt tgaagtaatg attgttgtca tttttgatcc     46740
     ttatgttttc tattatgttc ctaagtgaac aaatacatta tggcaaacaa tggtgatttt     46800
     gtcaacaaaa aacatctttt aaattgacgg ttttttgtta ttgcatgagg atgctatttc     46860
     atttcaagat gtaatttatt agcttcattg gcattgattt gttgcattct tgttttaaat     46920
     tcagacgcgc taagcctttg acattgatct agctcaaacc tgcttataga ttcaacaggg     46980
     tgaggggcac tttctttttc ccaagagact cgcacaaggt attcattctg catttttata     47040
     tagataatat gcgcataaaa attatttcct ttaaaaagtc gcttatgttc aatccaatct     47100
     tgagagtttt tgtcaattgg ccagcaaagt gtgtgtattt gatacttttt ataacgattt     47160
     tttcctttga ataggtcatt taaaaagttc ttaagccctt ggcttctaaa ataagtatgt     47220
     ccctcatcac cataatgttt aaaaaatagc tcggaaaatc gttctatagg gtttttttcg     47280
     ataacaaaaa aatatggcca aaggaaaggt ttaagaatca aataacgttt aacatcaggt     47340
     ctttttagca acaaatcatt attgtaatat atttttaagc gttggaaact gagaaagctg     47400
     ttgatggaat aacttaaggt aattaatcca cctacgatat atagcgttat caaaaactct     47460
     tttacactta catccattgc ttaccaccat aattcctaaa tcaaaatata atctttaaat     47520
     gaggattttt aacgatgggt taattataac attattatgg gtaattggcg tgtactgtga     47580
     ttcagttacg ttacacattc tgttaaaatt acattaatga caatcaatcg tatttgattt     47640
     tgagcgcaat cgggttataa tataattaac catacccgcc acgcctctta acaatgcgga     47700
     ccagggcggg ttatttattt tatgcattca aaaatggttt ttaataaacc acctctttcc     47760
     atatcagaac aaatacgtca cttacgacaa aaaggtctgt tgctggataa tgagcaagaa     47820
     gctagccagt atttgacgac cattggttac tatcgtttga tgatttattt taagcctttt     47880
     ctcattagct ctgcgacaaa cactagccaa tttaaaccta acacgcgatt ttcggatctt     47940
     ttaaatttgt atgcctttga tagagaacta cgcttattag ttatcgatgc cctagagaga     48000
     atagaagtcg cttttcgtac cgccatatca aatgccatga gtttgaaata tggcgcacat     48060
     tggtatctaa acatggattt attttcttcg actgagcaat atcagatgtt tttggaggag     48120
     gttaaatcac atctgaaacg ttcacatgaa gactttatta aaacatatta tgctaaatat     48180
     catcatccag aacacccacc aagctggatg gtcatggaat gtatttcttt tggtacagtg     48240
     tccaagctct atgccaatat taaagatcgt actgtaagaa aagaaattgg tgatacactt     48300
     ggtcaatata gtgaaatcat caaatcatgg atgcgctcac tgacttatac cagaaattta     48360
     tgcgctcacc attctcgttt atggaatcgg tttttcgtca ataaacctaa ggtttcagaa     48420
     ataacaatat cttttgaaca taacgagagt cctttttatc tacaagctta tattattcat     48480
     gcattattaa aaaatagctc gccaggcaat cattggcgca aacaattgtt tcatcttatg     48540
     cacaatcatc cttctatacc cttttcaaaa atgggatttt ctgagcattg ggaacaagat     48600
     ggcttgtggt tgttggaata gataatctca gataatgctt gatggaaaca cctaatacct     48660
     tttgttatgg ggttatagag cataacccca attactccgt tattaatttt ttatgtctgc     48720
     actagctaca ttgccagtta taatactttg ctgcaattgc gatgcgatat cattcggtaa     48780
     ctgcggcaat aagattgtat tggatttgtt atgtgagcct atttctttta atgtatcaaa     48840
     atattgagta atcaatacca agttcattat atctgcagac gatacaccgg gtacggactt     48900
     ttggaaatct tctacagaat ggcttagccc atcgataatg gcttttcgtt gattggctgt     48960
     tccttcgccc tgtaaccgct tgctttctgc ttctgcctca gcctttttga caatcaatat     49020
     tttctctgct tctcccttgg cttgagctgc aacttgcaat cgttgttgtt cgttaatttc     49080
     attcattgca ttttttactt tcgtttctaa ctctatgttc gttactaatg ctttgacaat     49140
     ttcaaatcca aaatcttgca tggtctcgct taaatggctt ttaacggcat tagcaatgct     49200
     gtcttttttt tcaaaaatat catccaagat cattgttggc gtttcagagc ggactagatc     49260
     aagcacatag gctgtaattt gttggggttc tgtggaagaa cccccaaaag tgttagttct     49320
     gagttaagta gtcctccaga agtattgttt taagtgcttt tccatcgcat tgaccattgc     49380
     agccacatca atctcaccat tgcttttctt gaaattatac ttccctgtga aagcgatatg     49440
     cgcccaagca attggtgaaa ttctcgcaaa ttcttcaata atttcttggc taaccccctc     49500
     tttgagcatc ttctcataaa tagtgtttag aataatggca ttgtaagcaa tgatacaatt     49560
     tgctactaga cgaacagcat gtgaactaac ctgattgtct actatttttc ttcctttaaa     49620
     aacgccacga taaattttcc tgattaaccc ttgtaattgg tggtatcctt cagttcggtt     49680
     tctcgcagtt cgtaatgcct ttcgaagagc catattgtcg attaaattta acacatgtgt     49740
     gcttttgaat atcgcattat actcaaatag tgcctttttt aactcggtat aacgagcata     49800
     tgaattgatt tttctaacaa tgttcgcctg tgtgttttct tggagaagca gggagagtaa     49860
     cacccttaat atacttcttt cttgagtctc aatccggctt ttatcgatta tcccctttgg     49920
     agtaataata ccagtgtaat tatcaggggt tttgaccgaa tatagatcat tcgttgcctc     49980
     tttaatatct ttaatgctag gcacatattc aacatcgata gagtccagta taacaaagtt     50040
     aagtttattc agagagtgat tgtcccctgt taccatgtcg atattaatgt ctgttttatt     50100
     tccataaatc acatcataaa gagaatgccc ttcgtattca ttaagcccaa tattcttagc     50160
     attcacagcg acagaatttg caaccaaagt gtatacagaa agcccaggag atttgccaag     50220
     atactttttt gaatatcttg attgaatggt actttcacta gttgcaagct tttgcccatc     50280
     ggcatctgct aataatttat catccattaa attccatagc ttaaaaatag gtagtgaatg     50340
     gataaaattg gctactgtgt catttgcggc acacagggtc tctatacgaa tgaagtcttc     50400
     ttgagttgaa cgaagcaaat tgtagtttaa atcagacatc tcggccattt tttctatacc     50460
     aataccaagg gcatctgata aaacacatgc gttgacagct aaggccactg gcttttttct     50520
     tttattataa cgagttttca tgtgggtgaa gaactgccac atgttaatcc gatcaccaat     50580
     atgcatcata atatcgggta tttctacttg ggacaaagtt ctaaaaaaag catcatcaag     50640
     gctgtctgaa ctatcatagt ctaagctcca gtcttgctca cccattttgg tttcctttat     50700
     attgaacgcg gcattctcac caagatttat tccttttgtt gttttgtccc aagcactatc     50760
     tagcatcgtc agggcatcat ccagacgttg cttacaataa attgggattt tagggtagcc     50820
     aaattcttta gctatttttt caacatcatc gaccaattca tcatttacca aatcatgatc     50880
     aatgtcacaa taagaaatgc tctcattaca acaaagaaga cctttctcta agcgacgata     50940
     tattttttga taaacataaa attcaaataa atgagagtct acctgctcat caccttcatt     51000
     tttctttaaa tatggcagca ttgtcttgga gattagagct tcttgttctt ctaataattt     51060
     aaatgttgcc ggtccttttc cgcaaccata atgattttta agcacctcaa taagggcaat     51120
     aatgtcacta ttttccttat agtaaacaaa gggtaccgtc agaactattg gccttagata     51180
     tagagcaaat aatcgtgacg actttaaata aaattcacgc atggcggctt ttttatcaaa     51240
     ggtatttcct tctaaaaatt tggccagcat gggaaactgt tcttttggca gtattttata     51300
     agcagcctga tttaattctt catgacttag cccgggttta cgatttggaa accacttaag     51360
     gaaacgggct agtttaggta aatcaacagc taaaccagaa ttgtgagcag ataatgcttt     51420
     gtcagcatga acttttgcat cattcattat gccgcttgtg tgatacaaaa aactggtgat     51480
     taggttattc atgatttgtt gatatcgatg gtggataaaa caaagtgcct gcaaccattg     51540
     ttgtggttca tccaatcgcc ttagtctaga agccgcatac tgatctgcca aatcagcata     51600
     atagcgaatg gcaattttag ataacaatag agttggtaaa aaatgttttg aaaattcata     51660
     tagttcagca atcactaagg ctttatctat ttcatcactt atggctgtat atgtgaaatt     51720
     tttttgatca acccgtagcg tattgaattc ggttattcct tcgcttcgac ttattaaggc     51780
     tattaactgc tcttgatgga tttttggtat caatgccata agcttagcaa tcctttcatt     51840
     ttctttggca aaggctttcg taaatagatc ctgtagatta cggtaggttg gaatcacaat     51900
     tcgtttatta tcaagatagg aaagtaattg acgaaaggta tcatgacctt ttggataata     51960
     tcttagcaat tcacaaatat gagcctcaat taaaatagat tgttttgctg accaatcttg     52020
     ataattaaat aaggtaagaa tctcttgttt ttgctcgcta acacactgac gtgagatgct     52080
     gccaaggagg agagcctcct catttttaaa aaaattatcc agaatgtatc gaacatcaga     52140
     tttaacatca tcaaacttaa aagtaaaaaa ttggctttta gctttgaagt acgcaagctg     52200
     caaaataaaa tacacttttg ttcttgtggt accgaattgc cttaataaat ccaattctgc     52260
     ctgattcatt tcaaaataga gtctctgttc acttttgttg aaaactggtc ttgcatacag     52320
     atcagcaatt tcagcttcag ataggagata gatacgtttt aggttagcca tgttaggttc     52380
     aaaaaaacgg aggtttagct ggactgaata tttcagtcac aaaagattgg attgtaccct     52440
     tatttttagt aagataaagc ggttcagtaa atctaggttc aaaatataat tttttaatta     52500
     gtaaaatgga ctaaggtact atgaaaatag gatatgcacg tgtttcgacc aaagatcaat     52560
     tattgtccat gcaggtggaa gcattaaacg cagctggttg tgaacaaatt cataaagaaa     52620
     ttgctagtgg agcaaaaact gcaaggcctg ttcttgatga aattataaga aaccttcgtg     52680
     aaggtgatac attggtgatt tggaaattag ataggcttgg tagaaatcta gcgcatctaa     52740
     ttcatctcac aacaaaattg atagagaaga aagtgggttt gattagtctc aatgatccta     52800
     ttgataccac tactgcacag ggtaggttaa ttttcgggat ttttgcatca ttagcagaat     52860
     ttgaacgtga attaatccgc gagcggactc aagccggact aaaatctgcc cgcgctcgcg     52920
     ggaggaaagg aggcagaccc aaaggaatgt cacaggctgc tatggagaag gctgctattg     52980
     ctgaagcact ttataaaaat ggaactattc ctgttaagaa aattgctgaa cagttggata     53040
     tttctaaaac aactttatat ctatacttac ggtctcgaaa tgtttgtata ggagaaaaaa     53100
     ttgacgctct gattattagg gattaaccat gtcatctaac caaaaccctg agcacaacaa     53160
     caaagaaata tcatttcgct tagaaaagga ctacctactt tttcttaatg gattaaaaga     53220
     taggatacga acagcaagac ttaaagcagc attagcaatt aaccgagagg taatagagct     53280
     ttattggcac attggcaatc aaatcattga aaaacaaaac tggggcagca agctcatcaa     53340
     taccttatca catgatttgc aacatgcatt tcctgaaacc agtggttttt cggtaagaaa     53400
     tttacataga atgaggcaat ttgccgctaa ttttccagat ataacaatta tgccacagtc     53460
     tgtggcacaa ttaccgtggg gacatatttc actgcttatt cataaagtta aaaaccagca     53520
     agaacttctt tggtatgctg agcaagtaat tgaacaaggc tgggcaagga taaccttaga     53580
     acgttacatt aaagacggtc tattccaaag gcaggcaatc gattcagtaa aggcttcaaa     53640
     ttttttagca agattaccga atccgcaatc aaaacttgca cacgaacttt tgaaacaacc     53700
     ctataatttt gattttcttg gcttacatga tgaagctcat gaacgtgaaa ttgagcacgc     53760
     atcaatagaa catattacaa agtttcttct tgagcttgga aagggatttg cgtttgttgg     53820
     gcgccaaatc ccaattggcc ttgaggaatc tggatacttt attgatatgt tgttttatca     53880
     cctaaagctg catgcctatg tagtaattga atttaaagca acaaaattta aaccagaaca     53940
     tgcaggtcaa ttgaattttt acttaaattt agtagatgac ttctataaaa tgccacaaga     54000
     taatccttcc attgggctgt tactttgtaa gtcacgtaat aagtttgagg cagaatatgc     54060
     tttaaagggt attgaaaaac caattggaat atcagaatac caacttactc gggcaatccc     54120
     tgaaaatcta aaatcaaatc taccatcaat tgaagaaatt gaagcagaat tgaatgaaat     54180
     ggagggaaac aatgactcgt agtgattcaa tatcatcaga aagtgttcat tcattaccaa     54240
     gtttcatctg gcattatttg aaagataaaa agctatattt gcttgggttt gtgttagttg     54300
     ctctggtatg ggcaattgaa atgtcattaa gtccttattt attaaaagtg atagttgata     54360
     atgttgttca attttcacct cataaaacag agatatttaa aacaatcatc ttgcctgctg     54420
     ttttctatgc atcgatgagc ttaataatta atctaacttt tcgtttatat gactatatta     54480
     atttacagtt atatccatat cttagagcat caatagagag agacttattg gagtatttgc     54540
     ttaatcactc ctatactttt tttcacaata ccttttctgg ggcattgacg aaaaaaatta     54600
     cagatttaat ggagaatatt gaacctttag taactatccc aaatgaatgg ttttatccaa     54660
     gagtttttgc cgcccttatt gctagtggaa ctttatttac agtggttcat ccaatatttg     54720
     gtattatttt gtttgtatgg gctgttgttt ttgtattgct ttcctatttt gctgcaaaaa     54780
     gagcagaaaa ctactcaagg gatttttcag aaaatatttc acgattgtcc ggctctgttt     54840
     ctgatagtgt ttctaacgtc atgagtgtga aattatttga taatgttcat catgaaattt     54900
     ccaacataga taatatattg ggcgatgtag ttactagtga tcgcacgtta tcttggttta     54960
     atttaaaaat taatttcctt cagggccttg gtgcatttat cttaattgcc tccatgttgg     55020
     ctgcacttat cttaggccta caaaacggat gggtgagtgc aggagatttt gcattagtct     55080
     taacgttgtc aattactttt gcctggggtg ttcatgacat gggaaagcaa atgcaacgct     55140
     attctaaagt agttggaaca tgtaaccagg cattaagtat tgtaaggcag tcccatgaaa     55200
     ttagagacat tcctggcgca acaacactca agatccataa aggagggatt aggtttcaag     55260
     acgtgtcatt tcattatgaa aatagagccg atttatttaa aaatttaaca gtttctttaa     55320
     aaccaggaga aaaagttggt ctggttggtt actctggtgg aggcaaatcc acgttcatca     55380
     aattaatttt acggcttctc gatatacaac aaggcactat ttttatagat aataaagata     55440
     taaaaaaagt cactcaaggc tcgttaagat cccaaattgc caccatcccg caagaaccag     55500
     aactttttca tcgaacaatt atggataaca tccgatttgc acgtactgat gcaactgagg     55560
     aggaagttat agatgcagct aaaaaagctc gttgccatga ctttattatg gatttgcccc     55620
     aaagatatga gtctctagtt ggagaacgtg gtgttaagct ctctggtgga caaaaacaac     55680
     gtattgcaat cgcccgtgcg ttcttaaaaa atgcaccgat tttacttttg gatgaagcga     55740
     cttcttcgct ggactcgaaa actgaagatg aaattcatca ggccttacat gaagtaatga     55800
     taaataaaac agttattgtc attgcacacc gtttatctac attaaaagaa atggatagaa     55860
     ttttggtctt cgtagatggt gatattgtag aagatggaac attaaatcaa tcactggaaa     55920
     ataaaaatgg acatttctat aaattgtggc agatgcaagt aaatggattt atttctgaaa     55980
     tttagcgggg ttgagcaaat ttagaaaagg ggataattca gaactaacac ttttgggggt     56040
     tcttccacag gcccccttgt tgcgtaggat cttccaattt atagaaagca tcataaacgc     56100
     cgtcatcttt gatgcgatat tgtacggaaa cttgaatctg gacaatcaca ttatcttttg     56160
     tcttggtttc gactttgaca tctaattgtt gaattcgtaa cgataactta ccagcaatcc     56220
     aatcaataaa gggtatttta aaattaagcc ctgcatgtgc aatagaatga tattttccta     56280
     ggcgttcaat aagtgcgact tcttgctgtt tgacaataaa caggcctgtt aagacaaaga     56340
     ttaacaagag aacggcaata ccaattaata gttcaatcat catttatata gctccttata     56400
     cccttatagt tataatttat tgtttaattt taaaaaaaag aaattcaaca gtaacagcag     56460
     gaatagaaat ggccatacat attccaactt ttctagcatg gattccaaaa tgtcttttct     56520
     tgctgcattt ggaacgtagt aagagtgaga taaatttaat acaagctttt tatctttttt     56580
     atctctcaaa gttactttaa tggtgttatt cccccaggtt tctgcatagg taaattgata     56640
     gggatgtgcg ttattaggtt tcatttcatt aatattcacc acatcaaaat cacttattgg     56700
     ttttgggctt tcatctgaaa acctgagctc ataaaagaac tgtttgcgtt ttacttggat     56760
     atccggtttt tcgttagtgt tatacgattt ttcaattttt gattcaatta ccttttcttt     56820
     gagtggaacc aattgaagag tgaatgcgct catgtatctt ttttcagcga acgcaattaa     56880
     tctgtttttt atctgctgat ttctgcgctc taatgctaat cgcttattct gaggcaagcc     56940
     accttgagcc aataattgat tgttgcgctc gtattcacta tacagctcac catcaggtga     57000
     ttcaaaatca agctcattgt aagagatagg atgtcccttt tgcgaaaata aaatagagcc     57060
     tgcggctaat ccggttaaaa atttagaatg ttttactaca ggcgatattt gctgcggttt     57120
     cgtctttcca taggtatgag caactctaaa tgatttagaa taccctgaat gagcaggaaa     57180
     ggataaaaaa gcccccatga atagggtgag ggcaaaaatc ctatttataa caattaaata     57240
     gttatgacat cttaaataac tcatgtgcga ttcctttagg taattttcca tcaaaccatg     57300
     tccagagttc gaatttattc gttccttttt caaaatgaag aaaatcttct tcaatttcgt     57360
     cctcatcgtt tattggtaca cccgctaact gctcccataa atttaaataa tccattgtgc     57420
     tccctcctga taggtgagta ggctagaaaa aatctagcct acttaactgg attactcttc     57480
     ttctttttct tcttcggtta agaataaatc gtctgaaacg atttctatca catcccaatt     57540
     aatacctatg gtggcatcat gattttcttt taggtgttgt agtacggtac ttgcctgctc     57600
     tttgctgagt agaggcctta catccaacac atcttctata gaccaaacga tgctgatttc     57660
     ttgtattaaa ctatttgttc cgtctgttga tatattgctc atcaaaatct ccaattcttt     57720
     attaaacagt taattagtaa ttagtggtaa ctccctgctt atgcagggag tattttcgaa     57780
     tactaatgat aagaggaata ataaagagca gtgccatccc aaagacttgc atgagagaag     57840
     gaattcatgc gtactctgcc ttgctcgttt gctctttttc taaatggttc atcaataaaa     57900
     caattaggtt tggcttttgt ttttccgcaa aaagcatcgt ttcgttcagt gattttttct     57960
     tgtgcaattt ctctgagtac tacagtggaa gttcctatta gatcaatgac ctgataaaaa     58020
     tcaatgttag tttgctcgta accccaagaa gcatagagaa tggaaccgat ttgaagaggg     58080
     tgtttaatca tgatttattc cttattttat ctattatgtt cctaagtgaa catctatagt     58140
     atggcagacc acaactaaat agtcaatata aaagatgtat ttaatctatc tttattatag     58200
     attttatttg ttgacaaatt tggttcttgt aaataaacta agtagtagtg tcattaggac     58260
     aatgaaagaa aacgaggtaa ttatgattca tctaaatcaa accaatgcac cacttgagct     58320
     ggccttttct ttaaacgatt tattgagagc gttaatgctt acatcttcat ctaccagaaa     58380
     tcagaatatt tcttattcct actggaatag gctgtccatt aaaagaagcc atcggcactt     58440
     atctggaatt aaataccctt gttcattacc cccagctgtg caatgcacta aggcggttgg     58500
     agcgtttgga ttatcaggta gagctttctc ttggggatat tcctgagatg aatcaacagg     58560
     gtattgagga gatgatctat tctttagagg caataaaaaa taaattattg gatgcacgaa     58620
     ctcaaaaagc cacccttgat gctccatttg tttacccata cggacaaaat gcaacagtgc     58680
     ctgtattgca tgcttttaaa tcttattatt ctttgcgaag agcaactttc tatagtcagt     58740
     acactacacg tgccagaaaa ataaatattt tcggtgttcc ttatttcatg cattatcatg     58800
     gccatcgatt acaaaaacta aaaaaccttt atgaattaaa tgaacaccat ttattagatc     58860
     gatattttga tgcaacaaaa caggatacaa cagcaataac cccagtaatg agaacttatt     58920
     tattgggagg attcattaat acgtctgtgt ttgcatttcg ttctaaatac gattacacaa     58980
     tctggtaaaa aaatactaca ttgatttggc aacaaacaaa atgtacatgc gattaaacga     59040
     tgcaaaagac tgtgctttgc aatactgcaa caattcatca cttattttat tagaggcttt     59100
     ttaatgaaaa aattattgcg attcgaagtg aaacaaaatt tgcgtaggcc ctcaagggtt     59160
     tacgtcaaat caacggatgg gaagagcatt tatggttctt ttcatatgaa tgagccggat     59220
     ttattcgatg gttggaataa tctttcaatt aatcaaacaa ttgaattaaa acagttcatg     59280
     caaaatctta aggccattca ccagcacttg catccttcac caacaagcac gttgctcgat     59340
     ttgcgttttc gactacctta tgaatttatc gaagttttgg agcagattga aattatttgt     59400
     gacgagcaaa aagtggagtt aaatatcttt gaacctatgg ttagcagcat gatacagcaa     59460
     attaaaattg cagtagggaa gctttcaggt tccagcaaag aacaggcttt aacgttactg     59520
     aatcaagtaa accttgccga atataaaaag caagatttta gtaatcaaat aaaatcaatt     59580
     ttttcagaat tacaagtcgt tgttaatcgt tctgagaaat tgcatcacaa agcaataacc     59640
     ttatttgata aagataaaag ctattctcct atggctatta aaggcatggc tagcggagaa     59700
     acaacaccct caaaatggct tgtggcctgt gcagttgaag tattgctcga tgaaaaaaac     59760
     gatatccttt ttaaaattct caccgaggat gatatgttta tgttatgggc taaacaattg     59820
     ctcgatcaag ggcataatct taagaagata atacataaaa tagatgcact caataaaaat     59880
     gagttaatta ataagattaa atgttataaa aaataatatg ataaaatggt aaccatttgc     59940
     atagatggtt tttagaagag aggtattgat agtgttctta acatctacta acggttgtat     60000
     cattgttctg gggcttgtac ttacgtggtg cattctattt tctattttca atgaaaaatc     60060
     atcgcggcgt ttgggtataa agctagggat cttggtgctg tttttatctc ccttcatttc     60120
     taaattgagt tatgatttct atgcgactgc ttcacggcaa ttgtttctta tgggtgccaa     60180
     tggtgaaatt caattagcgt actccccatt aaaagttcca aaaacccaaa ataaccatta     60240
     ttgcgatcgc tttacagaca gcaaaggtaa tttattgaat cgctctacaa taggtgataa     60300
     gcatctattt tgtggtgtct tttggaatat ggcggaacat gatgtagtgt ttttgcctta     60360
     caaacttttg ggaaataata aagccatcta ttgggcttca ccagagctaa aaattatcgg     60420
     tccaatgcct gaggaccttt cagcaaaagg aaaagcaaac aatatcgatc cggtttcatc     60480
     agaaaaaccc aatagaattt atgtagaagc aggtaaaacg gcgcacatta tagttacaaa     60540
     acaatttaag cttccatctg ataaggttca caaagaaaaa acagtatctc ctggaacagt     60600
     tttatcagga gttacgctag agccatttga cgcatcagaa aaactggggc atggacgttt     60660
     taaattattc attggaaata catcttgtat cgcctcgtca gatacacata ttagagctga     60720
     ttacgatact gcaactgcta tagctaacat catcagctta aattgtttta atgatgagga     60780
     acatgcgatt cctatacaag caatagcaac tgtttctgga agagcactat atcctaaaga     60840
     ataagaggtg agttgaaacg cagctcacac ctgccccaaa aaggaaacta ttattatgcg     60900
     catcaattta aaaacactaa tacactactt atcgtttttg ctgttagttt tgtcttattt     60960
     gtcgctttct tttgagaccg ctctaaaatc aggggtattt tcctcttata gcgatttatt     61020
     taccccaatc acacattttt tttactggcc aaggtttgct ttgctgctag cgcctgcgct     61080
     tgttttgatt attttttctt ctgttaaaat gaagaattat gagtctatgt taaaaggatt     61140
     tttcctttta acaacccccg ttattataag taataatctc agtttatttt cagcttctaa     61200
     tgcaattccc catctaaatc agcccgaaca atttatacag ctttattatt atgcctcatg     61260
     gatcaaatca ataacttgga tgggaattat tctattaggc ttgatttgga cttttcaaaa     61320
     gaaaccacaa acagttgaga cacaaaccca tttgcattca ttatcattgc tcaataaata     61380
     acgcggataa ttctttatgg aagttaatat attttgcatc ttaaagtata atggatgaat     61440
     tttattaagg gtgaacaata tatgtctgaa gatttattcg ttactgcatg gaagaaagga     61500
     attaaaatag taggcgttga attttttaat ataaaagcat catcccttga tgcagccgaa     61560
     aaaaaatggc aattagaacc caactacact tttatacaga gcgctatggg tggatatagc     61620
     catgggaaac aagttttatt agcgatgatg tactcatttt ttgatccaga agatggccaa     61680
     aaatttcttg aaaaaaccca aacgcccaat tttgtacaaa ccctatcaat tttgaatccg     61740
     gaatcacggc aaattatttc tgaattatgg ctacattaca ctgggtggta aatataggtg     61800
     accccccgtg cagtcaaaaa ttatattgac tttagtgatt attttgcttt aaaatttgaa     61860
     ataatatgaa aaaaccgtca aaagtaggtt tataacgcca tgaaaattac atcttaagta     61920
     cgcccatcta cagggcagag agagaaaatc atttttgatt ttctattttt ttattgtcct     61980
     aaaagacatg cttaagagta aatcatgcac cataaaccga ttcaatttaa agacctaggt     62040
     cttatctatc cgcataaaat ctgttttcaa gacttcagtg gtgaaattca ctttggtgag     62100
     cgtattgcac tgattggccg aaatggctca ggaaaatcaa ccttactaaa gatgcttgct     62160
     ggtctttgtt cagcctctgc tggcgaaatt aaaatgccac aggatgttcg tattggttat     62220
     ttaccccaaa taattgaaga gtgtcctgat ttaagtggtg gtcaacgatt aaaccacgca     62280
     ttaaccaaaa tattatctga agatccgaat gttttgttgt tagatgaacc cacaaatcat     62340
     ctggacagac gcaatcgtcg ttctttaata cgtatgcttt tgcattatcc ggggacgttg     62400
     gtcattgctt ctcatgatac ggagctcatc aatacagtcg cggatactct atggcatatt     62460
     gatttaggta agctcactgt atttagaggg gcttattgtg attatcagca aatgcttgaa     62520
     gacaagaaag catcgattga acaggaatta tcacggattt cacgtgagaa gaaagaatca     62580
     catcttgctc taatgagaga acaagaacgg aataaacgtt ctcgtgttca gggtgaaaaa     62640
     aagatagcgc agcgtaaatg gccaacgatt cggtctcata caaagctcgc caatgcaata     62700
     acaacaggaa ataaacgatt aagtcagatt aatcataaaa aacaacaggt gcttgaagag     62760
     ctttcatctt taaaccttcc ggaaacgatt aagcccaaat ttaaattaaa cggtcttgac     62820
     caccataagc ccttaatcag gattcaagac gcttctattg cctacgaggc tttcgatgtg     62880
     attcttgaag agattcattt tcacttgaat ggctgcgaac gggtggcatt gtatggggac     62940
     aacgcatcag ggaagtccac ctttgtcaaa gcgatcttgg aggatagtca cattaagaga     63000
     acaggtaagt ggactcttcc tcagcgcaat acagttgggt atctcgatca gcattatcaa     63060
     catctgaatt gtgacgaaac agttctggat ttgatgaaaa gtcagatgcc ccatgcttct     63120
     catgctgaac ttcgtgtcca tttgaatgac tttttatttc gcaaaaacat cgaggtagaa     63180
     ataaaggtca aagatctctc tggtggtgaa aaggcaaggc tttctttagc cttaattgct     63240
     gccaatccgc ctaagctaat tattttagat gaggtaacca acaatgtaga tctggaaaca     63300
     cgcgctcata tcattgaagt attacgtgaa tttccaggtg caatgctggt tatttctcac     63360
     gattatgatt ttttagattc cattcacatt gaaactaagt atcacgttca tcaagggaag     63420
     atacatcatt tcaatgggga acaatcagag ggtgttcatc atgactcatc gtttgcctaa     63480
     ccacataggc tcttttatgt ggcatttttt aaaaccgtat cgacgcatgg tttttttatt     63540
     tatcctgctt gctttaatgg ctggattttg gggaccgttt aatagtttat tgattaaatc     63600
     ctttattaat accttggcag caaaaacaag tacagacttc tcctctttgt attggatcgc     63660
     aggacttttg gtattgaact ttattatctt tgacaatatc acctggcgaa caatcgggta     63720
     cttgaactat aaatacgaag cggtgattaa aaaccaaatc attagccaaa tgtttgagta     63780
     tgtgctggga agtagtacgc aattttttca ggataatcta tctgggcgaa ttgccacaca     63840
     aattaccact cttgctgata atcttgagat tattttgcat cgcgtgtctg tcgattttct     63900
     tcgtggtgct tcattgttag tggtttcatt tattacagcc tattttgtta atgtcctgtt     63960
     cttttatatt ttatttcttt ggttcattgc ctttgcatca tttagtattt ggatgtcggc     64020
     acgattggtt caattgtccg atgaccatgc aaattctgaa tcgcagcttt ctggacaatt     64080
     agtagatggc ctggcgaatc aatccaatat tcgtatcttt tcacgaaaaa tctatgaagt     64140
     ggaacgtatg aacacgtttt ttagcttggt acaacgggct tttcaaagaa aagagctgtt     64200
     tattgttttg ttatgctgcg cacagggtgg aatgattgcg gtaatgatgg gtttggcctc     64260
     gattacctta attcacttgt atggcaaggg actggtgagt attggtgatt ttgctttgat     64320
     tcttggactt tccatggaat tggggcatat gatgtggtac accatgtacc aagtggatca     64380
     atttaaccaa gctttaggca aggcaagaca aagtttaaat gcattggtca tcccccatga     64440
     gatacaggat aaaaacaatg catcccaatt agtggtctcg caaggacgaa ttgaattttc     64500
     caaggtaaaa tttcattacc aaggcggtta ctccctgttc cagaataagt cggtaacaat     64560
     tgaagccggt caaaaagtgg ggttagtggg ctattcagga agcggcaagt ccacttttgt     64620
     taatttgatt ttgcgacttt atgaagtagt ggatgggcaa attctaatcg atggtcaaaa     64680
     cttatccgaa gtgactcaag agagtttaag gcaagccatt gccatgattc cacaagaccc     64740
     aactcttttt catcgaagcc tcatggataa tattcgttat ggcaggactg aagcctcgaa     64800
     tgaggaggtc atttcagcct ccaagaaagc acatgcacat gaattcatca gtcttttgcc     64860
     agaaggttat gagaccttgg tcggtgaacg tggggtgaag ctttcaggtg gtcaacgcca     64920
     gcgcattgcc attgctcgtg cgattttaaa aaatgcgccc attttaatgt tggacgaagc     64980
     cacgtctcag ctcgattcta ttacagaatc caacattcaa gacagcctct gggatttgat     65040
     gcagggaaaa acaaccctgg tagttgcgca tcgcttatct actttgttgc atatggaccg     65100
     aattttagta ttcgataaag gccatatcgt tgaagacggg acacatgctg aactactaga     65160
     tcgcggtggt ttgtacaaaa cactatggga tgcgcaggta ggtgggtttt taccagatga     65220
     acgaaaagaa gagtctcaag atggggtagc aaatgaataa accacataca gagtttaggg     65280
     tagtgtatca tttacttaat gacttactat ccggtttgca atcaatttta aaggaaaatt     65340
     tgctgggcat ttatgtgtat ggttcattca tttggggtga ttttgatgaa acaaccagcg     65400
     acattgatgt tcttgtggca ttaaataaag aaatgacacc agaagaattc gcggctttag     65460
     atgattttca tgccaatctg gttcagaatt ttccagcctg gaatgaccga attgaagtag     65520
     cttatgcatc ttatagcatg ttacaacatt ttaagacaga accaggtcaa attgcagtca     65580
     ttagcccagg agaatcgttt cacatcaaac aggcggggac tgactggctt attaattatt     65640
     atttgttgca aagaaatagc ctcattctat atggtccatc tgcaaagtcg ataattgctc     65700
     ccgtatcaaa cagtgaattt atagagcatg tcaaaaagca ggcttatgcg tggcaagatt     65760
     gggttattca taccagaaat tctttagggt accaatatta tgctgtatta actctatgca     65820
     gggctttgta tgtgctccaa catcaggaac aaggctctaa gttaaaagct ggagcttggg     65880
     ctaaaaatca attccccaaa tggcgagttt taattcaacg agcattaact aaagctgaac     65940
     taaatcatgc aagcgatatc ttgactgaag aaacttatca agaagtcact gcatttgtga     66000
     atgaaatggt tcagcatatt caagagagag aataaatgat ggaagtcaac caacaacaac     66060
     ggcttatcga agtagtttct tatgatgcta attggtctat gcaatttgaa caggaagcag     66120
     agcgaattaa aaaagcatta ggtagtaatt gcattgaaat tcatcatatc ggttccactt     66180
     cagtacctgg cttggctgca aaaccaatca tcgatatgat tccagttgtt ttagatatta     66240
     gcaaagtaga cagtgccaat gctgctatgc aggcacttgg ctatgaagcc aaaggagaat     66300
     acggtattcc ttttcgccgc tatttccaaa agggagaaag tctacgaaca catcatgctc     66360
     atatttttga gtttggaaat tccgaaatcg agcggcattt aaaatttagg gactggatga     66420
     gagcacatcc aaaagataga gaagcttatg ctcgtttaaa acaagagttg gcccatcaat     66480
     atccctatga cattactgcc tattgtttgg gcaaagaaga ttttattgca acaattgata     66540
     aaaaagcagg ggttaatgga ttaagagtgg tgaaggcatt aacgccgcga gaatgggata     66600
     aagtacgtca tttcagacaa ttctattttt ttgataaagc tgggttttct gacccttaca     66660
     cttggacttt tgagcatgat gctcatgttc attttgtttt atctcaagga agcgacatca     66720
     ttggttatgc ccatctgcaa ttatggcctc atcagagagc cgctttgcgt atcattgtga     66780
     ttgatgagga aaaaagaaac catcaacacg gtagccaatt cctggcgtta tgtgaaaagt     66840
     ggctcaaaaa ccaaggctat caaagcttgc acgtggagtc ctcaccggat gctctaagat     66900
     tttatagaaa taatggttat atcgacatgc catttgatga tccggatggc tatgaaggtg     66960
     atgcgagaga tactgcggta gggaaagtac tatgattcaa atcgaaaaaa taacgggtga     67020
     actggccaaa tcattgtgcc gaacaattac aaaggatcta cctgaatact ttggtttacc     67080
     agaagctaat gagtactacg aaataggtgt gaaaacacgt acgaattttg cggcgaaaga     67140
     tggagatgac acgatcggcc tcgtttctat tgattttcct tatcctaata atgccaatat     67200
     ttactggatg gctgtaaaac gtgattatca tcgtcaaggt gtaggaaagc aattaatcga     67260
     agcggcttgc cattttgctg caacacaagg agctaaaacc ataaccgttg aaacacttag     67320
     cccctctgaa ttggaagaga attaccttaa aacctaccaa ttctatcagt cagttggttt     67380
     taacgccctt tttgatttaa aacctgcagg gtatgagtgg aatatggtgt atatggtgaa     67440
     acagcttgaa gctttagcag aaaaccaaca gttaattgcc attaagccac tggaattatc     67500
     cgatattccc attttggtca atgcgtttca aaaagcaaat tggcaaaaac cttacgtctt     67560
     atttgaaggg taccatcaag aacaacaaca atctgagcga gcagtttggg tcgcctatgt     67620
     tcaagaccaa attgcgggct atgttactct aaaatgggcc tcacactatg aaccctttgc     67680
     tcataaagaa atcccagaaa ttatggactt aaatgtattg cctgcttttc gcaaacttgg     67740
     aataggcagc gctttactaa cagctgctga agacaaggca gccagtcagt gtgatgttgt     67800
     aggtattggt gttgggttat atggtggtcc tgatggagga tatggacaag ctcaacgact     67860
     ttatgttaac cgaggttata ttcctgatgg tttaggggta acttatggtt ataaaccaag     67920
     cattcctggg gaaacatatc ccttggatga tgatttaatt ctgtggttta ccaaaaaatt     67980
     aaccaaaaat ttgcatgcag aaagtgatgt cgtaactaaa aaaacacctg atagccacga     68040
     tgtgtatgta ccaaatacaa actataaatt ggagttcaat gcaaaagatt catttaaaat     68100
     tatcgatcaa aagttgtttg agtttaataa atcgtgcgtc ccttccacac aaaaacctga     68160
     agtaattgat ataaacgtta cgattaaaaa tggtgatgaa gttatagcag gcatttgtac     68220
     agatgtttat atatggaaaa tcatgtacat cagtgtcttt tttgttgagg aaaaatatcg     68280
     caatcaaggt ttgggtgcca ttttactcaa taaagttgag gagaaagcaa aagaattagg     68340
     agtcacttta attcacctcg atacctttga ttttcaagca aaagattttt atcgcaaaca     68400
     tggttacgaa gcgtttgggg ttttggatga ctgtccaaaa ggtcataagc gttattatat     68460
     gaagaaggta ctatgagttt tataaaaaaa ggaatatacc gtcattataa aggcaatcta     68520
     tatgaagtga ttgatgttgc tagacactca gaaagcttgg aagatatggt ggtgtacaga     68580
     gcgctttacg gcgattttaa actatgggtt cgacctctta agatgtttct tgaagacatt     68640
     gagataaatg gagagatcca aaaaagattt gaattaaatg aatagattag aacaagcaaa     68700
     tcgttttatc ttcactggca ccccaggcag tggaaaaact tctgttattt tggcattgaa     68760
     aagattaggg catgtagtga ttcctgaatc tgcaacggat gtcattgcag aagagcaggc     68820
     aaagggaact atgcgcccat gggagcaggc tgattttgta gataagatcg ccttaacaca     68880
     aaaattacgg caattgaatg ctaaaggtga gttgcaattt tatgatcgat caccattttg     68940
     tgcttatgca ttgggacgtt actccgctca ttggcatcat cgtgatttta caccctcatc     69000
     tatcttagta gctgaagttg accgctgcct aaaagcgggt atttatcaac gcaaagtatt     69060
     cttttttgag aacctggggt ttattgaacc aacttccgct cgcaaaatca gttatgaaga     69120
     tgctcttatt tttgagcaaa ttcacataga tgtatataaa gagtttggtt ttgaaatcgt     69180
     gctggtgcct aaaaaaacga ttacagagcg ttgtgaactt gtccttgaaa cgttaggtat     69240
     aaaaaaataa atatccattt tatgaaaaaa ctgcttgacc ctattgttac tatatatctt     69300
     acctttgttc ctaaggatgt aatacgatga ctcaatggtt cgtaaaagac ttaagcaaat     69360
     tgaccggtgt ttcggtgcaa acattgcatc attatgaccg cattggttta cttaaacctt     69420
     cattgcgaca gtccaatggg tatcgtattt actccgagaa ggatttattg aaattacaac     69480
     agattattgc tttaaagttt tttggttttg agttgtcaca aatcaaaacc ttgctctctg     69540
     aagaacgtca tgcgctaaac cattttgagg cccaagctca agtgttagaa caaaaagcag     69600
     cggcatgtac ttccggagct aaaaccttaa gaagcattat taactctgtt gatatcaatc     69660
     aatccattcc atgggaaacc attattcagc tgattgaggt atataaaatg gcagaacatc     69720
     ttgaacatga ttgggttaag gaaatattca ctcctgatga attaaaacaa tatgtagcgt     69780
     ttgaaaagga aatgaaaaca aataataagg ctgagtttga aaaacaatgg catcaactct     69840
     tagatgaact gaaacaaaac atgaaacacg atcctgattc cactataggt atccaaacag     69900
     gaaaaaacta catggaatgg gttaacagcg tatacggtaa aaaatatgct catctaagaa     69960
     ccaaaaaatg ggaaaaagga tttggagaag gaaaaggtct tgatgacatt gggttaacat     70020
     cagagatcat ggcatggtta gaaaaagctt tagatgctta ttggaaggat agactttatg     70080
     gcattcttga acaagtagga aaaacttcag cttccactgt actaatgcgt tggaataagg     70140
     ccttagatga tatgtatggt gaagaaattt cacgaaaata tgctgtttgt gacattgctt     70200
     tgaatgatga caaggtcagt ctagaggcaa agacttggct taaaagtatc ttagatgcct     70260
     acaaaatgta aacaatagat gtaaatttgg atcggtgcta tttttaccga tccaatctta     70320
     attaaatatc aacttaatcc atcttggggg attctgtccg gtaaaaagcc accaacctga     70380
     gcatccgcca atgttaaaaa attcgtaaaa aaaaatgctg attgagaata aattttacgg     70440
     catcaggtat aattaaatca ctagtttgta ttttgagcaa ttttatgtct tatgcaaaaa     70500
     tggcagaatt acttttgctg gacgtcatgt ctaaagcaca gattccagga gtttctattg     70560
     ccttcataag cagtgatgga atcatatcta ctcaagaaca aggccttaca gagggttgcg     70620
     gtctttttgc aataccagtt gatccactca agtgtctctt taataagctg ggactaggaa     70680
     ctaaagatgc tgtagtttta tttgacgaca aactttatta tgtgaatcaa acgacacaaa     70740
     gcattcatca aatacagtta aatgaaagta atcaatcctc atatcaaaag ttacgagaaa     70800
     gttgtactga tacctataaa ttggccgatc ctcaagagtc tgaattaata actactctaa     70860
     caggtcttgc accacctacg agagtgaaac cagaaaccgt ttttggagca gcctcgctaa     70920
     gcaaacccgt atttgcttat ttagtgcaaa agttgattca gtcaaatgcg acgaatcaag     70980
     cagagaaagg gacaggtaaa tttaatttag ataaattcaa cctgagtcaa tttgatttag     71040
     atacccctct ttttcatatc ttgccgttag aagaatttga gatagatgga atgaaatttg     71100
     atatgtctga cacatctgct gttgtctgtg cccaagcact tactgcaagg atggtgttat     71160
     cacatacaac gggccttgct catggtgaaa tgaagtttca gttcattcct aatcctaaag     71220
     aaaaagattc taaagaaaaa atgcatggat attcaaatgt tggtatcgtg tacttacaac     71280
     aagtgattga aaaattgact gaagcaaatc tagaaacatt ggccaaaaac catgtgtttg     71340
     atcattgtga catgactcat agcacttatg agccaccaaa ggcctatcac ttgcttttgc     71400
     atgctgaaaa ggaacccttg tttgatgaaa tgaagcctgg tcagattgtc atactaaaag     71460
     aagatgagca actaacagcc tattggttag agaatggaaa aatagtcaat cgttcttttc     71520
     cggaaagagt agttccagga attcttagac agttacctga taaaggtaaa ctttcaaaca     71580
     atttggagtt gatagaagct gtaatctcgc aatatggatg taaagaaccc aaaccatgtg     71640
     ccgccaatac actacgaact acagcaacag attatgcaaa gtttgtcaaa catctaagcc     71700
     atgacaactc cattgaaaat ccttttgttc cgcatgcctt catgacgcac gatagaggtt     71760
     tagctggagc gattggaatt gctagagaca agatacccga gctcatttta agtcatgttg     71820
     catggggctt aggttggggg ctacaaacca atgaaaagga agaggttgtt acggcttacc     71880
     actcaggcga catgaatgat tgtagagcgt gggttgccgt caatttaaaa gataagagtg     71940
     ccgtggtgtt ctttgctaat tcgcataatg gacatattct tgcggaacac attatccctt     72000
     cgacaattaa aatagaactg gcttcacact attttttccc aaaatggggt tttgctagaa     72060
     ctcttgatga gctaggtggt aaaacgaata attggggcat aaatccattt ccaagaccca     72120
     atccatctaa agagctaaca agctccttag gtgaattgca aaaaagaact aatatcccaa     72180
     gtattgctac agcaattatt tctgaccgcg gcgttgttac tacgcaagag gtgggtgtga     72240
     ctcatgtcaa caaaccagaa gaagttacta gttcaactgt ttttgaagcc gcttcattga     72300
     gtaagcctgt atttgcttat attgtcttga aactagcgca aaaaggtctc attgatttag     72360
     ataaaccact tcatgagtac ggtgattttg gtcctccaca gatgcgagct gataaaaatt     72420
     ataaaaaatt aaccgctcgt atgatcctat ctcatcaagc agggttacct aatgaatttt     72480
     catctcccga atctttaaag tatgtttctg aagtaggaaa acaatttgat tattcaggtg     72540
     tggcctatca atttttaggt gaaattgtgg aaaacattac ttcaaaatca ctggaagctt     72600
     tagcccaaga agagtttgct aagctaggta taactgatag tagtttcatg ccaccaacgg     72660
     gttgcagtct tattaaactg ccagatgaag aggaagagcc aacgcctgaa cgcattaaaa     72720
     aattattaaa ggatacttta gatgtacatg gtcaattaag tattatcctt cataaggata     72780
     aattatttgt tgctgaacga gcagtaaatg gcagcgtaca aattactgaa aaaaactcca     72840
     accaaattga agaaaaaagt ctaaaagaaa tcaaagcccg ctttgctcaa ataccactat     72900
     ttttttggtc aaaacccata ccggttgaag caagggaatt accccttgtg actactattg     72960
     ttggccatcc cccagaacat gctgcaacaa tagcaatagg tcatgataaa aatggttcag     73020
     taaatcttaa gcaaaaattt tatatggttc atgcagcagg atctttgtat acaacaactt     73080
     ctgactatgc aaaattttta aaagcctgtg ttaacgatcc ctatattagg tgggaaatgt     73140
     tcaaacctgt tgtttcatcg ttaagagata aagatactaa agccctgagc cagggagttt     73200
     ctactgatat tttagatcaa atctcttggg gtctaggcat tgggattcag aaaaataccg     73260
     atggaacccg tatcgctttt cattggggtg acaatggaac tggatgcaat ttagcagcga     73320
     ttaatcttac tacagatgaa gcggttgttt gtctcactaa tagcgagaat gggcccgctg     73380
     tttttcgaga aattgcagag cctatcgttg gtgatttaag tgctattggg caatggttat     73440
     caatacgaga agaattacct cttgagaagc gtgtaaaaga aaagccaact caagaaatga     73500
     accaacgttt acaggagcag acacaaatta aaacgacagt cgctactata gaacagcaag     73560
     aaggagagca aaatccttct gatttaggac tgttctaagt attaattggg ttgttcgcaa     73620
     gggtttttat ccgggagaaa gcctccaacc tgagcatcct atagagttta tatataagcc     73680
     actcaaattc agtagttcag catgtgttta atttgccgct catcaagtat ggcatctgga     73740
     gtttccaccc agaaccctta tacggtgttt taactatata aaattttatt tgttataccc     73800
     aatgaatctt tctaagaaac ttcaccacat taatttttct ttagaactat ttcaagtcta     73860
     ctatttttat agtagtatct actaaaaata tagtagcctg agttttattt aagtttctgg     73920
     agaaaaaaat gccaataaaa agaggggcaa acacctttgc tcatgatcgc ctccttacag     73980
     aggtagaact tgaattaatg aatattattt ggagccttaa taaagtaaca attaaagata     74040
     ttgtttcaaa tttgcccaaa gaaagacctt tagcttatac cactgtagca actgtagtaa     74100
     aagtgcttga acaaaaagga tttttgggat gccaaaaaaa cacttatgcc catgtttttc     74160
     tcccaattgt taccaaggct gagtatgaaa gtacatgtat tgagcatatg gtaactaatg     74220
     tttttgatgg tgaacctgta gcactggtgc aaagactctt gatggccaaa aagctacagc     74280
     atgatgacat tcaagcaatt gaggaagcac taaaacaatt agtaacctcc gaacaacaaa     74340
     tagaggcttg agtatgttat tcctggaaat tttattgggc attcattgct tacttttagt     74400
     aagttcatgg gttattggcg gtcgttggct tctaaatcag ccatctttta aactcaaatt     74460
     ggcccgtttt ttattaatta gctgtgtgat ttctccatta atggttcatt gtataaacac     74520
     caatcaaaaa tttgagcagc atcactatgc gtccattgat gctttgcaag agtatgtaaa     74580
     tcaacccatc ttaaagtcaa aaccctctca agacattact gaatcagcaa cctctttctc     74640
     aataagcaat acgagttatt ttcatctttt ttatgtcgtg ttttgtttac tcatcttatt     74700
     tcgtagttat aaagtattgt tgagtttggg tagtttaaga gcactattag ctgaagcaat     74760
     tacgtatcga acgtccggta aattggtcat taaagtttct cgacgttgcc atattccttt     74820
     ctcagttgtt ttatttaaca aagcttatat cgtattaccc gtatccttat tttcttcttc     74880
     caagaatgtg aagattgcga ttgctcatga aggtcaacat catcgtaatg gtgattgcct     74940
     atgggcctat tttattgaag ccctgcgcat tatcttctgg ggtaatccag gtgttactcg     75000
     ctggagtcat attttaagcg aattacaaga atgttcatgt gatgaagtac tggttggcca     75060
     gccaaaaatt tcggcacatg actatggcaa ctgtctgttt gatgtagtgc agacagtatc     75120
     tcgatgttct gtgtcatcta accgagaaat tgcatgcacg gtgggtatgg ccatgggcaa     75180
     agacaatgaa gactgtacat ttatcatcag gagaatttca atgttatcag cttatccact     75240
     taaaccctct aaatccttat tgctaagggc tgcatttgtg ggcttttcta ttttggcccc     75300
     aatctgtgtt gcctattcag cagtaggaac attgactggt tctaagacaa aagaaatcga     75360
     tacatcccat ttagatccta aaatgcagca tattgcagag caagaaatta aaacagcgat     75420
     gaaacaatat catgcaaaat cgggggttat tgctatcgtc aatgcaaaaa ctggtgatgt     75480
     cattgcattt gcagaaacaa gtaagaataa aaatcagagc agttggaaat cacgtgtttt     75540
     ttcaccaggg tccttgataa aaccctttat tgcagcggca gcaattgatt ctgggagtag     75600
     ctcggaaaca aagaactatg attgtcacgc gccatactct atagaaggca aaacatttac     75660
     agattactat gtaagtcaag gctctacttc attgatgcaa gcgattacac gatcaagtaa     75720
     tgtttgcctt attaaggtcg cccaagaaac tggggcacct gtaattcgta aaaaacttgc     75780
     tgaatttggt tttgatatga acacttggtg gcaagcaaat caaagtgata aattgcaact     75840
     cgcaatggct tctgttggtg agaatatacc agtcacgatt gattcgctaa caaaatctta     75900
     tgccattctt gcaaactttg gacatccatt tcaaggagga gaagctcctg ttatttcagc     75960
     aacaacaaca aactcaataa atcatattct cgagaacgtt gtgaccaatg gtacaggaaa     76020
     actcgctgct attcctggtg taagtgtcgc aggtaaaaca ggaacagttg cagaaaacat     76080
     taattttgca aaggcggaac atcttgcctt gtttgcaggt tttctaccgg ttaatgagcc     76140
     acgttatgcc attgtagtcg taattgaaga cggtcatcta agcaaaaatg gcaagacttt     76200
     aacctccggt ggggaattgg ccgctccggt atttcgtaag gttgccatta atagcctaaa     76260
     taatacgaag ctataaatcg cctatgggtg cggctgattt gctgtaccca tatctatata     76320
     aattcaaatg atggtgagtt gttatgaaga aattaagcgt atttttatgt atgacgctag     76380
     tatattgtag tactacattg gcccaaagca cttgcttttt ggtacaggaa aatcaaactg     76440
     tgctaaagca cgagggtaaa gattgcaacc aacgttttgc accagaatca acctttaaaa     76500
     ttgccttgag tcttatgggt tttgactcag gaatattgaa agatgaactt catccagaat     76560
     ggcagtacaa aaaagaatac gaactttatc tcaatgtatg gaaatatccc cataatccac     76620
     gtacctggat aagagattcc tgtgtttggt attcacaagt tttaacccag aaattaggca     76680
     tgctccgatt taagaattat gttgatgcat ttcactatgg caatcaggac gtttccggcg     76740
     acaaagggaa gacaaatgga ctaaccaatg cctggttatc aagctctctt gctatatcac     76800
     ctagtgaaca aattcaattt ctacaaaaaa tagtcaataa aaaattaccc gtgagcccaa     76860
     aagcacgcac tatgactaaa aatattttat atattcaaga attagcaggt ggttggaaac     76920
     tatatggaaa aacaggtaat ggtcgacagt taacaaagaa caaaagccaa aaatcaccac     76980
     tacaacacgg atggttcgtg ggttggatcg agaaagatgg tcgtgtgatt acctttacga     77040
     aacatattgc agacagtaaa aaacatgtaa ccttcgccag tttcagagcg aaaaatgagg     77100
     cactaaatca attattttac ttgattaatg aattggaaaa ataatacatg aaatctaaca     77160
     tagctctatt aataacacag gctctattcc tattttgcta tcaagctttt agttacgcca     77220
     atgaaatagc aattactttt gatgatctac ctgcttcaat agaagaatct atagaggaac     77280
     aggctctaat aaatcaacga atagtcaatg cgcttatcaa atatagagta cctgcaattg     77340
     gatttgtgaa tgaagggaaa ctctatcgca ctaatgaaac tcaagaaaaa ataaatctcc     77400
     taaaattatg ggtagataac ggatttgatt tggggaacca tacctattcg catctgtctt     77460
     taagcagcct cacttctgag caatttaaag ctgaagtgat taatggctct aaaatatcca     77520
     aacaattaat gcaaagtgcc ggtaggcagt accactactt taggcatccc taccttgata     77580
     cgggtaaaac attagagatt cgttctaaat ttgaatcgtt tttaaaaaat gagggatatc     77640
     tggttgcgcc agttactata gacactgatg actggaagtt taatcagcaa ttacatgagt     77700
     tccctcagaa taaagacaaa atcattcaaa gttacctgaa gcatacacgt gctaaatttg     77760
     ccttttatga aagcgcatcc aagcaaatat ttggtagaaa tattaatcag acttggcttt     77820
     tgcatgccaa tcttattaat tcattagcca ttgagtcgct cttaactata gcagaggaat     77880
     acggttatca tttcatcagt cttgatgaag cattacagga taaagcctat ctgtccgctg     77940
     atgcctatta tgcccctttt ggtgtttcct ggctttatcg atgggatttt actcggggga     78000
     aagtagttga ttggtctaaa gatcctgaac ctgataacaa tccatttatc acagttaata     78060
     ccattaaatt ttatgataaa gaccgcaagc gctttattcc agttaaaatg tatgtgagta     78120
     atgaatcaca aggaaaagca aatgcaggca tccttaaatt gcccgtcgcc atcattaatc     78180
     acggatacac agtgcgcaat actgaatatt catttttagc taatgcactt gcaggaaatg     78240
     gttattttgt tgtaagcatc caacatgatc taaaatcaga tcccccatta gctcaaactg     78300
     gcaatttatt tgaacaacgg aaacccttat gggaacgagg aagtgccaat atacgttacg     78360
     taatcaaaga gcttaaccgc atcaacccca gtttaaactt gtctaaagta acattaattg     78420
     gccattcgaa tggtggtgat attgccatgc tgtttgcaag caaataccct caattagtgg     78480
     aaaaaattat atcgctggat agcctccgca tgccttttcc acgcaccgga ttaacaccta     78540
     ttttatcgct acgtggaaat gatactaaag cagatgaagg cgtactgcct cctaaagagt     78600
     cgttaaaaca attagccata acaattatcc cactacctga ggtcaaacat atcgatttat     78660
     gtgatcgtag ttcgaaagta actcagcaac aaattaatga tctgatttta aagttcttac     78720
     ggggctagtg tatgaaaaaa atactcgcat tgttcagttt aggctggtct ttaaacctca     78780
     tggcagcaaa tgacatatcg accatgaaac aaaccaatac tcaagcaaaa aaatacacga     78840
     atgagttgtt tttacatcat actttaacta aagagttttc ctccaagatc aataggatca     78900
     aatataattt atacatcagc ctacccaaag gatattcctc taacaacaaa agctatccaa     78960
     ttatttactt attagatgct gactacagtt ttgcattagc gaaacaaatt agtgagcatt     79020
     tatccgaccg aaatagaatt aacgactcca ttattgttgg aatagcctat gcaaatccta     79080
     atgagtataa gaaaaacaga accagggatt ataccccaag ttatgttagc tcagggggct     79140
     atggatctga atatcaaaaa tactcgggtg gtgccgaagc attttatcga tttatttatt     79200
     cagaacttat tccctatctt caccagacat atagagtcaa tcaaaacagt acttttgtcg     79260
     gtcattctta tggtgggtta tttggggtgt atttattaat tcatcatcct gaagtattta     79320
     atcattacat tatcgtcagc ccctctctct ggtatgataa tcatttggtg ctaaaagcag     79380
     ctcagaggaa acggaatttt aatctacaac aaaaaacccg tgtttgcttt attatcggcg     79440
     accatgaaaa taaaggcgat taccgcatga tagatgattt aaaattattt aatgaaatca     79500
     tcatgagcaa gccccacaaa aatctcagca ctatttttaa tattctaaat gatatggatc     79560
     acgatactgt ttttccaggg gctttaagtt taggactact aaggtcttca tttgacttaa     79620
     acaagtgaat cagagtgtga tgacattaag ttaaagcttg gttctcaacc tcatttagca     79680
     ttttaccact accatgtgat caagtattat ttcgataaaa aatgtaaaaa caaataaaat     79740
     gataaaatca ttttattata aggaaaaacc atgttaaaaa aagtagcgtt caccatgtat     79800
     cctgtcgaaa atttagatcg agcgatggat ttttataaaa aaaatcttgg tttaacgcct     79860
     agcaaaacat ctgcgaatgg tcattggata gagtacgact taccccaagg cggatgcttt     79920
     gcaatcacaa cccttgcgga aggtgttaaa ccaagtgctg tgtccggagg tagtattgct     79980
     tttgaagtgg aagatttgga ttccttaacg caacaattaa aaaagaatgg ggtaacattc     80040
     aaattggata ctttttcatc acctgtatgt agaatggcaa ttatcatcga ttctgaagga     80100
     aatgctatta cactgcatga gctcaatcaa taagtctgta taaagaggat aaatgatgat     80160
     gtttgctaaa tgttctgttt ttattgctac aagtcttgat ggctttattg caagagataa     80220
     tggttctatt gattggctaa cgaaagcaaa tgagcttgtg cccccaggtg aggatggtgg     80280
     ttataaagag ttcatatcta cggtcgatgg actcattatg gggaggcatt cttttgagaa     80340
     agttttatca tttgaccctt ggccttatgg tgagcttcct gtcatagtga tgagtagcaa     80400
     acctatagaa attcctactc atttaaaata tgtttcagca tcttccgaag cacccatcga     80460
     gctcgttaag cggttaactg atgaaggatt taagcatctt tatattgatg gtgggataac     80520
     tgtccaaaat tttatagccg cgaatttaat ccatgaatta acaataacca tcgcaccagt     80580
     cttgctaggt tctggtcgtt cattatttgg acatttaaca caagacattg aactggagca     80640
     tcttgaaacc aaatgtattg gcggtggttt tgttcagttg aaatatcgga ctaatccctc     80700
     aacccaaaaa agaaataaaa ataatgtcta tcttatttat gatgaaatct ccgagtggtt     80760
     tgatagtcat cgcaataaag agctcaagat ggagcaatct tatttagagt tattgcaaaa     80820
     taagcttcca tcaaaaggca aaattttaga tgttggctgc ggtacaggcg aacccatggc     80880
     acaattttta attaaacaag ggtatgaagt aacaggcatt gatgcaagtc acaaaatgat     80940
     tgagcaatgc aaaaaacgat tcccaaatgc aaaatggcta cttgctgata tgaggacttt     81000
     agatctacaa gagaaattcg atgcggtcat tgcctggcat agtttctttc atttacctca     81060
     tgacgatcaa cgaaaaacat taaaatcact tgcctcttta gtggagcaaa atggtttatt     81120
     aatatttact tccggaccgg ggtacggaga agtttggggt gataatggag gatatgattt     81180
     atatcatgcc tccctttcgt ccgaagaata tactcaaatc cttctagagt gccattttaa     81240
     agtccttgta cataacatta gggacccaga gtgtggagaa gcaacggttt gggttgctca     81300
     aaaaaatcac atttgcccag gataaaatgg aaaagaaact tatcaaagct ccttcaaatc     81360
     tcatactcaa aaataatggg atatctattt ggcatcatag gagatttttt aacaccaatt     81420
     ttgatgcatc ccattttctt gtaaaatgat tcggcaccag gatcgctcca taatttgaac     81480
     ctactcacgc catgtgattt aaaatcttca accatcatag accacatttt tttaccgaac     81540
     cccttaccaa tatagtttag atcaataaaa aaattatcca gttcagactc tttttttctg     81600
     atgctaaaac tataaaaacc tatcgctttt tcgggttttt cagtattcct ttcataaaaa     81660
     agtttcactg tatttttttc aagatagtct gtcgtcattt gaaaaagctg catgaattta     81720
     tccataaatg ctttatcata tccccaataa gattttgagc gatacattaa ctcattgatc     81780
     tgttttaatt catgtacacc agctcgtaga cattttacaa tcatctaaac cctaaccatt     81840
     tttaatagaa gcgctatatc cgaatcgcca tagaaccagt atttagcatc atcagtatat     81900
     ttcagccact aattttacat catactgacg ctactggtaa aatcggaaac caacacttca     81960
     tcctctaaaa caatgactat tgaacagaat gaattagaga ttaaaaataa tccacatcaa     82020
     agcatcacat ggggacaacc tattccactt tctccaatct tagccccgga ctgtccttat     82080
     ccagttgagg cacttccctc aattgttaga aaagccgtag tagactatca acaatacgga     82140
     cagcaacccc tgcctttgat tgcatgcagt gccttagcta atatgtctct atcatgccaa     82200
     tcgcttgcca atgttgcgcg agacaactat ttaattagtc ctgtatcgct ttatttttta     82260
     attgccagcg gctctggcac ccgaaaaact gctgcagata atgttttttc taaagcagcg     82320
     cgtcactggg aaacacttat tcgtaaaagg cgcgaacctg aagtgttatc agcgctaacg     82380
     caacaccaag tatggcaaat ggaaaaagac agtttattct cccaaatcaa acgtgcaact     82440
     tatacgggag aagattctga ttatgccaaa gaaatgctcg atgaattaat tcatcaagaa     82500
     ccggaaattc ctttgcaacc tactctttat tttgaagatg ctacccaaga agcactggct     82560
     attcatttgg cccaaggttg gccttctgct tccttatggt ctgatgaggc gggtatcatt     82620
     ttaggtagtc atagcatgca aggcaatcca actcgttttg tagcattgct taatcgtttg     82680
     tgggacggta agacgttcac agcacatcgt aagacaacgc aaggatttac cattgaaaat     82740
     cggcgtttaa cacttaactt gatgatgcaa ccgcttatct tacaacaact taccaagcaa     82800
     gcatcgggta ttagtcgaca aagcggtttt ttagctcgtt gcctgatggc ttatcctgcc     82860
     aacagtatgg gaaatcgatt ttaccaagag ccgcctgctt ctttacattc tctaacccat     82920
     tatgagcaac gcgtcactgc ctgcttaaac cagtcagagc aattaagcca tcaaggttgt     82980
     attcaacttc cattattgaa aatgagtatg gccgcaaaac aacaatggat tttatttttt     83040
     aatgcagtgg aagctgggtt aaaacctcaa ggacagtggg tcgatgtcgt tgattttgca     83100
     tcaaaagcgg ctgaaaatac tgtgcgccta gcagcactct ttcatctctt tgaaggacgc     83160
     catggggata ttagtgtcga gcataccgaa aatgccattg aaataattaa ttggcatttg     83220
     caagaagcac gaagaattat gcctactgaa accgtttctt tgcagttttc cgatgccctc     83280
     aaactaatgg actggtttat tgaaaaaaat attagctcaa caacgttacg aaccattcaa     83340
     caattaagcc cactgcgaga taaaataaaa cgcgacttag ctgttgaatt attagtggag     83400
     cacaatcaaa tacgcattgt aaaatcaggt tcaaaaacga tggtggaagt gaatccacgc     83460
     gcatgcaaag tgccaacatg agttttgttt aatactttta actttatcac accaatttac     83520
     aggagaaact cgtgccctct aacatgctaa aagaatggtt gagcaatgaa aaagaaaggg     83580
     ggattgagga ccctgcctgt gctgttttaa gcacttgtag cagttctggt gaacctcata     83640
     gtcgagtggt tgccattcgc gaaattgaaa cagagagtct tttatttttt acgcagcaaa     83700
     aaacacgcaa ggttactgaa ttattaaata accctaaatc ctgtttaaat tttttatttg     83760
     cgatgcagaa ccgacaagtt attttagaag gtacagcaat acccatttct caagaagaaa     83820
     atgaagcttt ttggagtact cttcctcgtg aacgccaatt gagattctct gcttatgctc     83880
     ctacttcagg acttgtcatt aaagatttaa accaattgga aaccaggaaa aaagaattga     83940
     gtgatcaatt tgcaggactt cctatcccta tgaacgagta ttatttcggt tttcgcttta     84000
     tcccaaaaac atggattttc tacacggtcg gctctatttc tttttctgaa gtaattcgct     84060
     atacgaagat agaagattct tggaaatcag aattaatttc cccataggtg atatcatgta     84120
     catgctttgt ttttgtgttc cagaaaccca tttagaaatt gttaaaaatg ctatttttgc     84180
     tacaggcgca gggagtgttg atcattatca gcattgtgct tggcaaacat tgggtgaggg     84240
     gcaatttatg ccattacctg gaagccatgc ttttattggg gaaatcaatc agcttgaaag     84300
     agtacctgaa tataaagtag aaattatctg tactgaagga caaatcacag tggctgttgc     84360
     ggccttaaag aaggctcatc cctatgaatc accttcttat caagcgtttc gggttgagag     84420
     tatctaataa taaacaatgc ttccaatatg aaccaactta cattcaaata aggacctaaa     84480
     aaatgttacc caaaaatgcc agtttgggac atatagccct agcagttaat aaacttgctg     84540
     aatgtgagca gttttataat ttattgggat tgcaaacaga acttaaaacg atgggctacg     84600
     tttatcttac aggcaatagc gacaattgtg aaattggggg aaaatcgttg aatctaacgc     84660
     tctaatataa ataacaatgt tctcttgtat gccactttta tcacgatcgt tacttccaat     84720
     acggttgtaa cctaaaatag tagcgacgat gcaaaatttt attcacgaac actgcgcaaa     84780
     attttctcac catggttaat gagcaacgag atatgtcctt catgatccaa aacttttagt     84840
     gaggcgttag ggattaattt tgcataaaga ttggcatgag ctaacggagc ttgtttatct     84900
     aatctacctt gccaaatgac aacagggcac tttatatggc tcatatcaaa tccccaaggc     84960
     tttaggctta attgaatttc ttgagatacg cctgtaatac cacctttaaa agcctctaac     85020
     gatgattgga taaataaatc accagcttct gtgtcaccta aaatacgctg atctacctct     85080
     gacattttac tcgtcatttt ttttaatatc ccgggttttt tcagcatcaa aaacatgaga     85140
     tttaccatta cggtagcaat tgggggtatt gctttaatca ttttatttat aaaccgctgt     85200
     cctcgtccta gacttgctgt agcctcaggt atttcaaaag gccccatacc tgagacaatc     85260
     gctattttat ttaaccgatg aggtatttta tatccacatc ctgcaacaaa aggagctcca     85320
     ccagagtgac ctataataga aaatttaggg atacctaagt aattggcaag cgcctcaaca     85380
     tcatcagccc atgaaagaat agtgcgcgtt ggatgtttag aagataaacc cattcctggt     85440
     ctatcaatac taattaatcg ataatgattt aaacatgcta tattttccca atgcccagcc     85500
     tcaagcctag aacctggaag tccatgaaaa taaaaaacta cctctccttt tggatctcca     85560
     aactcagcat atccaagtgt tctgccatcg tttaacagaa tagtagaatt agtaaagcaa     85620
     attttggtat tcataataat ttcccagaaa gatagtgctc tactgatgct tctatcagca     85680
     gagcaagatg atcacgatag cttacgttca gcaaaaactc tcatagcagc taccaaataa     85740
     tcaaccaaac cagggtgata tttattataa aataatcgaa aatctggatg gtccaggtac     85800
     atttttccaa gtcctaaata tgtctccttt gttggtgtcc aaaaattatt aacccaatcg     85860
     taatgttctt ggattaatgc ctgaacctca tccgaatcag tcctaactcc ttttgctaat     85920
     gcattggcca gctcaagatt aagcttttca cccgcatttt taaactgttc ccaatttgat     85980
     tttttccagt gagaaacacg cgtccaacta tcatcaattt gcttttgtga tatcactcct     86040
     gtttcgagca tatatttttc gtgctcttgt tgtttgatgg gatcgaagcc atcatacatt     86100
     tccgcatcac gcataattat ttttcctctt aaatgtgaaa tggttttatc aatcgtcttg     86160
     atgagcgttg ctgttcgttc aagactagat tccaaagcag atttatgtct ttttaatgat     86220
     tctattttat caaaatcatc actactcata atctgttgga tatcatttag aggaaaacca     86280
     agctcacgaa aaaataaaat ctgctgtaac ataagcagct gctcttcttt gtaataacga     86340
     tattgattgc caccatagta ggcaggtttt aataaagcaa tttcatcata gaatcgcaga     86400
     gtgcgggtac tgacccctga aagcctcgcc aattgattaa tcgtgtatgc cattttgctc     86460
     tcctctaatt gacaacatac acgataaggg ttgacgtaac ggcaaggtca atagatataa     86520
     taattttttt aaacctgtta aaacgaccat taatccagtc atcaaattga ttacataaac     86580
     taagttaaat tagcaagttt ctgtagttgt tatttttaag aatcacttca ggtgcacacc     86640
     atcaaatacc ctattcatca tcagcttaag tcctatcttc tgctgactca tagactttat     86700
     ttttgtttcg cttgcctaca gcaacaacaa ggagaatcat tttattatcg ttaacttggt     86760
     agaccaatct atagccggcc tgatgcaatt ttatcttata gcaatcttta agatggccac     86820
     taagtttggc agaaataaca tgcggatttt ccagtcgccg ttttaatagt tttttaaact     86880
     gttcctgcaa ctccttcgat agtttcttcc attcttttaa cgcaagcgga tggaaatgta     86940
     actcatagat catcaagcgc aaccttaact ggcgtaaagg gctctgaaag gcgttgttct     87000
     acaatgcttt ttagctcgct ttcgtcaaca gcatccatca gtttttcaaa agtttctgct     87060
     ggaattaaat aagcagcagc tacattatgg ttaagaatca ccacgggcat cccatgagca     87120
     tcattaataa gttttgtggg atttttcttt aattcgctaa tgctagcgac ttgtgttgca     87180
     tataaagttt gcattttaat gacctaaata aataccttta ttatgactta attatagtgc     87240
     tttttataat aaaaggtcaa tcatcacgaa atttataaag gggattaggg aagttgaatc     87300
     aaaagattta agtatcccta agaaaaaatt ttaagcaaca tctctttcac gattgtgcgc     87360
     ctgcttgcga tccctttcat ttaggagaaa gccaatgaga taaaagttgt tttttctgtg     87420
     ttaattctat taagttacac cttcatttac atttgatttt tttatttctt atccagtctt     87480
     taaggctttc taatgcacaa gtccaatccc aaccttcttc aaaagattca agagcctgtt     87540
     ctgcctgctc aaacatataa tcagcaacct gcaaaataaa ttgcttgtct ctatctttat     87600
     acaagaactc aagcgcatta atcatttcat aaataatgaa tccataccca ttttctgtat     87660
     aacggatgta ctcagggaaa taaaatgcat agtcaatggc tttctttatc tcttcccagt     87720
     ctccattggc aagtcgcatt ccaatagatg cacttaaagc cctccataag acagaattat     87780
     attgtgcatt taaaagaaca atttcagcca aatgttcttt agtaaaagaa tttaaatact     87840
     ttttcagctg atgcatatcc acaggtgatt taggtcctct gttaaggtac cgagattttt     87900
     cagaaggcat taacttcccc ttgatttaaa cgttattcta atattcaccc attgagcacc     87960
     atgctacttt tgctactcgt tgacaaacga gcatacctat attgatcaga taatacagtg     88020
     ttcacaagga tcataacaat attcatcgca tcaaaatgaa tgcatttatg tagcaattat     88080
     attgctacat aaatgctaca tatcgctaca atttcagaga ttaataaatt tcactggatc     88140
     acgtcttgtt tctgccattt tccttattta tagaaaatta ttataaataa ggaactcttt     88200
     gcaaaaaaca aaagaactta aaaaaacaaa acatgaagaa accaaagcca caactgagga     88260
     catcctcttt tgtctatttc aggatgtgtt ttacagcatt tgaaatgtag cgtgtcgtag     88320
     caatacagta gcaacttttt tgctacaaat aattaatcgg atttttaaca aaaaaatgcg     88380
     ttactctatg aattcataga taatttcatc tagatggttt gaatgatttg atgaacgtgt     88440
     agcaatgtag cagaatacct ggaaatgact gaataaacct taatgaaaat catactaatg     88500
     gcagaaatct tagtctcctg ccctctatct aggctaactt tattaaggtg caaggatctt     88560
     ttagatttat tgataacttt tgatccgtaa ttctacttaa tataaaatca gcacagggtt     88620
     ttacaagcac attaatatca tcccaatatt catcttccaa accaatgcat atgtgtttcg     88680
     ctctgttcat cacgggctga tacatcttag gtagacgatc aatcacccaa tcggcggcta     88740
     taggtttcga tcgaatctta ttagtttcta atgtactcca aatccgtgca taggttagta     88800
     atacatttcg agtgtcctgt tcaagctcag ctgaaagtct cccaagatca tgaagcatcg     88860
     cttttataaa gtcgctatat gggacagggg ctaatagatg ttcaggtctt tcacccagca     88920
     atgtatggct ctttaataag acttgagtga taatcagcgc aagatcgggc atttcacgac     88980
     caggccatgg ttcaaaacta cccatttcaa atgatggacg aagccattca ccgtattgaa     89040
     aatcaaacag aggaggataa tgccaaggat tgatagcctc cctttccaca agggtcattt     89100
     ctataggtgg cttcgtactt ttcatgtaaa tgcctgatat ttggagaaga tggttagtca     89160
     actccatctt ttcttttgaa gttgtggtac gatttgttac aacaaataaa tcaatgtcac     89220
     tgtatttttg caaaccacct acaagataag aaccataaag ataaacaccc aaaagatctg     89280
     cgcctaaaat ctttgttagt acctcaagac attctttgag ttgttgcttt acatcactgt     89340
     tgttttccat ctttaacact cagccatttt ttaaaatcct ttaacaatgc ttctgcttga     89400
     gcaatacaag ttattactgc actctcagga ataatatcgc cagaataatc tgcaatattg     89460
     cgttgtttac gcatagcatc caatataatc actgtttttt tatcaatacc taaagtctga     89520
     ggcaataact gaatcatcgt ttgatgatgt cctggtttag aagtcaaggt tcgatatcca     89580
     tgagattgaa gtgctgcatt tgctatttgc ataattgctt tataggcagc atcaaagcga     89640
     ttctccgcgc taaccaagtc aatttttgaa tccaaaatat tacgttcagc cgcatgcaaa     89700
     agccgtttta ttgtatctgg gtgaggtggt attttttcca ggctgatgcc aattaaatta     89760
     tccaaggtca tgttcagctc ccataataaa tagcttggga ttatttaaaa cctcctgaat     89820
     gaaaagatct tgtttttgta aagatgcctt ccattgttcc ctggaatata ttttgggatt     89880
     aatttctctc cctaaactag cttgagcagc ataaagagcc tcaactgctt ctgtaaaatc     89940
     aacctcacca ataataagca catcaatatc acttccaagg ttttcagttc ctttggccac     90000
     cgaaccaaaa acaaaagcta cttcaatttt ttcagctaat ggagttaaaa aatcaaacaa     90060
     cacatccacc aaaccagacg ttttctttaa aatacttgta agctccgtat aaataggaaa     90120
     atttcgattt gcttggtaat aaacttgatt accactctgc tcgcgcagaa gtactttgga     90180
     tttagcaagt ttggatagtt ctcgatgaag tgtacccgct gtggtattcg ttaaccgcgc     90240
     aatctctcgg acatgataac gctcatcagg atgaagcaat aaaagtgcca gcacacgccg     90300
     ccgatattca gaaaacaata ttgaagtatc aaacatgatt tttatattga agccaactaa     90360
     gcttcaatca tagcctaaaa agctacacca ttcaatcaga taaataagaa aaccagaaaa     90420
     ataaatatca gttataaatc gactccccac ggaagagcat caacactaca accaatgacc     90480
     tcaacgctct tgtgtcaaga cttaagggct ccgtcttgga gaaagcataa aatggtattt     90540
     cccaattacg taatcgtatt attggatacg aaatggtatc ttgaatagtt cttttcaata     90600
     atcaataaac cccctgctct ttattaccac ggcttcatat taaaaggaga tgggttaaaa     90660
     atttcttgtt ccccatcttc agatttatta tgtatctcat tagcttcttg tgtggaggat     90720
     tgatctttat tagacggcct gggttccctc gaaagtgggt gtggagcaaa gctttgctct     90780
     tttgttacct catctctttc ttgtgctttc ggactgggta cgggtactaa attatttgct     90840
     agctgttgga taaatgcatc gtataaagct aatgtgggca tggtaatgcg aagagaacgt     90900
     atgtttccct cctcatcttg aaggatttgt atgcaatcat cagaaagatg attttcttct     90960
     ttaaattcac tgaattcgtt tataatcgct tccatgaatt tttttaattc atgtcgttgc     91020
     tttggagtta attcattagg atcacattgt aatttaagct taagagtcat tgattcacga     91080
     tcactatcaa ccaacaattt cccatcagca attaattttt caattatttc tgggtcaaaa     91140
     ccagactcta aatcaagttc ttctgaacca aatactccta ccaattcatc ttcagaccca     91200
     actactttgc ctgatttagt taggaattta tcttcaccag gactcgcttt ttcctcagat     91260
     gtcttcttat cagaggtggc actatcacct ccgctaccac ctgcaccatg tccggaacaa     91320
     aggcgcttag gtgcgatttc tttaaaacaa gtcggacagc gtacttttgc accttcctca     91380
     gcagcctctt ttttttctgc ttcctttcta aattgttgta aagctaatgc tatagaagag     91440
     gtttggggtt catctgccgt tatggattca gggacaggct gatgtttttc tttgtctttt     91500
     ttcatgagaa tactccagtg caagttcata atggtttcat ccgaataaag atttacttat     91560
     ctgttattat accgagttaa aaaaacccaa ttgtatataa attgtacatt tattgggtta     91620
     ctcgtttttt tgacttaaaa catcgagtac atagtcccaa attttacctg ctacattaat     91680
     tcctttccca tcagacggat tgagatgtaa ttcaatgtaa gggaagctat tattttcaat     91740
     aattccaaat tgttgcttat gccatggaag agaaatgtcc tgacaaataa aatcaagacc     91800
     cgtaagcggt atattgagga ttttatgtgc tttttccaat aatagtttgt tctcaggatg     91860
     tatcagatcg gtaacatcac tgatttttgc accactactc atagtaactt tttttgcaat     91920
     aaagatttgt tgtcccttgt ttattaccgt attaagagca acttcctggg atgacaaaat     91980
     tttgatcaag ttgctatttg gagtaatttt atatggatat ttaccatgac tttctttcca     92040
     cctaacttta ttttttttat caattaactc ttgaagtgta gtgacaccat cgccaacaat     92100
     gctctcaggt tgtcgcctca cacaagcgat taatgaatca ttaataatta atgaccgata     92160
     aacatcccca ggtatgtgtt tttcaaccag cacgcgaaaa tcaacttgct ttactatgtt     92220
     tatcgcttct tttaattcat ttggagtttg aatagtacat gaagtgtgaa tacttagaga     92280
     ttcagataat ggcttaacca caagaggaaa tcccaatgaa atgccatagt tgtaggcttt     92340
     tttgctggaa ataaaaaccc tccctaaggg gcagggaatt tggctatcta ataatttttt     92400
     cttgaggatc catttattat catatttagt atcctcatca aagcgtgtat ttttttgaga     92460
     aataagagag attggagtct gtatgaaata atattttttc ctattgtaga ccaacttaaa     92520
     atacagagta tgcaagttag attccttaaa attatacagc tctagccctc ttttttgtgc     92580
     ttcatcccaa aatgcaagga cactgttatt gaattgtttc ctatcaatgg tctgagtctt     92640
     ggtatatagt tttagttttt gaaaaatatt aatgaccaac tgatttaata ggttattgaa     92700
     tcgtaaaaaa tcatgctctg ataggagaaa gagtttagat aaaagataga taaatggatt     92760
     gaatataaaa taatggaata aattaaaaaa ttttcttcga aaatgagaac gtttttcggg     92820
     atagcaatgc tcacaatgtt tattgtccat atatgctgtg ggaaccggtt ttaatgattt     92880
     gcaaatgtca cgtgaagatt tgatttcttt atgttcatca aaatttttaa cataagcgct     92940
     cataatttat ctccacagat tcgcccatta gctatcatta tatcgagtta aaacagatca     93000
     attgtatata aaatgtacgg atgcaccgtg tgtttgctta cctactgata tctatgtaac     93060
     actgaactta aaaatcaatt cagactaaat ttgtttagag agttttctta tttaaagagg     93120
     cttagacaga acgaatgaaa gataaatcaa tattgcttgt agaagataac gttaagttag     93180
     ccaattacct caaagaaagc ttacaagaag caggttatga tgtttctatt gaaaaacgtg     93240
     gtgatagagc ggtctatcgc atcattcgtg agcaaccttg cctagtaata ttagatataa     93300
     tgcttcctgg catgaatggt gatcaaatat gccataccat tagagatgag tatttgggga     93360
     aaatactcat gctaacagca attaatgata ttgaaagtga agtatcctct ttaaatttag     93420
     gagcagatga ctacttaact aaacctgttg cagacgaggt tttgaaagca agaatagagg     93480
     cattgttacg tcgacccaat ttagttaata atcaaaatca atttcaattt ggcaattttt     93540
     ctatcaattt tagtactaag agtgttcatc tctttgatga agaaatttca ataagtacca     93600
     gtgactttga aatgcttgct ttgttggtta agaaccatga taggttgctg agtcgagata     93660
     gcattatgta tgctctttct gggcatgaat atgatggggt tgatagaggt atcgatttaa     93720
     aaatatcacg tttaagaaaa gcattgaatg ataataataa aaagccctat cgtataaaaa     93780
     caattcataa aaaaggatat gtatttgtat cagcggcttg ggaataaata cagatcacag     93840
     ccaccgatct tatgtaagac ttatgaaaaa tagtaaaaaa ttcttttgcc tcgaccttga     93900
     gatttttcgt ccagtgatga aagcttcacc aaatatatcg caaatctata atcatttacc     93960
     ctcgacaaaa gtatcatttt agaacgtttg tacaatatat atacatttga gctgagtgtt     94020
     tttgataaaa tcaacctatt attttaagta atagttgaga tgagccatga aagacgctgc     94080
     aatagaaatc ttaatatata aaccagatcc agatcatcca ctgcctgaaa atcagagagg     94140
     tgtggtggta aatcctcact taaaacaacg gttcaagcaa tttgttccaa ttggcgtcta     94200
     tttagaaggc tctgatttga agtattattt tttcgatcag tgtgataaat ccccaaaaat     94260
     ctatagtagt ttggatgaac tcaaacgaga cttaccggaa gaactagaca atatatttga     94320
     gaagaaccca aaattattta ttatgggcca tgctggtggt ggcgaatatg gtatgggtaa     94380
     ttgccatggc ccaagtgagc agttatatga taatcatttt gataatttat tacatggttt     94440
     taaacgagca ttgcccgcac atcatggtga agtttttgtg actttagaag gttgtaatac     94500
     agacaatcaa cttaatgctg cagcaaactc acagaaaaaa acatttttag aaagagtatc     94560
     agtgaaacat ccagaaatca cgtttggtgg aactggacca tggaatgcgc aagatgtaca     94620
     gaccggcttc cgatcccttt cgccggcatc ccctatcaca tcgatggcag gaaatatttg     94680
     gaaggctgga aacagtgtta tttttcatca tggtgaatat caagttgccg ttcgaaaatc     94740
     tttatttgcc tcaacacaaa cagctaaaga attaaaagtg aacaccatag aatatgcccg     94800
     tgcaattcta ggtaaagacg gagccgatga actgatagca aaaatcgctt taaatcgaga     94860
     tattctaaac attcaagatt taaagaaaat tgagggtttt ccagaattgc gatttgaagg     94920
     agaagatgtt gcaaagtttg ttgaacagga aaatcaaata ttaggtaaag aacaagaaaa     94980
     ttatttaaca cgtgtccgtg atatcttagg tcgggcggac cctatagaac aactgaccga     95040
     tagagatgta ctagaacttc tcttaggttt aaaagaacct tctgtattta aaggtcatga     95100
     agacttgcta gagtcaattc tagctaataa agctttgtta aacctggcaa tggtaagttg     95160
     tggaaaagtc cttattggtg gcccaagtaa tgatagcgtc attgctttat tattaaaaca     95220
     tggcgctgat attaatagtt ctgataaaaa aggcatgact gctttgcact atgcggtaca     95280
     gaatttttat aattatagaa aagagccgtt acatctcatt aaaaagttat tagagtgtgg     95340
     tgctagtctt gaagtgcgaa atgaaaaagg acagactcct atcgagacag cgcaagaaca     95400
     tagcaaagat ggaagagtaa ctgctagtga taagcttctc gcatctttga aatctagcaa     95460
     ttcgctacca actcccttag aactaaaaca atctattaga caaatatttc agatgagtca     95520
     acacaaggct gatgaactac tttcattacc tattgcgaaa cgtgaatata gcaaatgcag     95580
     tgaaggcact ctttatattc ctgaagatgt agtggaaaaa ttgcatggaa tcttgcaatc     95640
     tgcaacgggg agtaatgaac tattatcggc gtttgaatca gagcttagtg tggttatcag     95700
     cgctcttgaa aaaggcattg gaactggaga agcaattgat ggtgaggaag atgaatttat     95760
     ccctaaacgt tttgaaaatg caaaactcca gttaacagcg gctatcgacg cactggttgg     95820
     gatgaaacaa gagatggata cttcaaaaga tgctacagtt gaagaccaac ttccaaaact     95880
     aaaatcttaa tcgttaagaa tatattggaa gtactatggt gaatcgagca ccttttaata     95940
     tcggtgattg tgtagccatg acctttcctc cgtggagatt aacaactttt ttaacaatag     96000
     ctaatcctaa cccaatatgt ttatctccaa ttcctgcgtc ttcagcaatt gtatattcag     96060
     aaaaaatgtc atccgcaccc tcctccggca agcctgggcc atcatcgtct acgtgaagta     96120
     aaatatgact attatccagc gaaatggtta aagaaatagt gtgctctgca aatttcatgg     96180
     catttgtaat caaattggta acagcgtgtt ttaaaatatt ttcatctatg tatgctttca     96240
     aagaatttaa ctcattagaa tgaaatgtaa tttcaaatgt tgaggaagaa taagactcta     96300
     ataactttct taaccatact attatatcgg tctcagactg ttttaatttc aattcgtttg     96360
     aatgcatttt tgagtaaatc aaaaaagtgc tgacgagccg attcatatct gcaatatctt     96420
     cttgtatgct gtttatctgt ttattgagca atgcatcttc agcgtttctc cttttgatac     96480
     tatccgtcgc catttgtatg gttgacaaag gagtcctaat ttcatgcgcg acaaaccggc     96540
     acaattgttt atgtgattca atcagttctt ttaattgctc acccatttgg atgatatttc     96600
     tatacagccc atacaaaaca gaggtggtac caattttccg atgaaaatca aagttacctt     96660
     gactaaaatt ttttgttatc tgatatacct ttttcatatt tctaacaaaa agcaatgaaa     96720
     ataaggcaat aagacaaagg gatataaaaa agaaagttcc tataaaataa tacataacat     96780
     cactgattct tgccataact ggcagatagc ttagtgggcc aattttgagt attccaccac     96840
     taaaacgata atagagaata acaatttgtg acgagttttt attggtttca agtactagac     96900
     gctttgttga taaagaatta attatattac ttggcaagag tttactcttg gttttataaa     96960
     catgaagagg aaacccatat attttttcta aacttaatag ttcattactc cacgtatttt     97020
     ttgattttga taataaatgt tgaacgattt gttttaaaac aggattcata taattaaaaa     97080
     taatttcgtc aggatctgaa aaattgtaag ctaatgcata tggggtatta ccaatttttt     97140
     tatacgccgt atgttctaca atgacctcgt ttagaaattg ataggttgta cctgataaaa     97200
     aaatgatttc accattattt aactgattat tctgcgccag ggtgagtttt agactgtcga     97260
     ttgctataag atgaataaca ttatctgttt tcttctttat tatcgcatcc cagtttgatt     97320
     tcgggttatt aattaactct ttttctaaac taattaaaag cccttgcgag gtcgtttttc     97380
     cagcattaac aactatcttt gtctcaactg actttaaata tttaaaaaat gccaaaacaa     97440
     gaattaaaaa aatcacaaag aacgcagtca aaattttaat ataaatatta aatttcatta     97500
     ctaggcactc taaataaaaa taatagatac cttttcacaa gaaagtactc tggattatct     97560
     ttgataattt caatatctaa ttctggcata attatcctac gttttgtcta tctttataac     97620
     tcttgtaatt agcctattta aggcatccaa attatcgata ttcgttatgg cctcatcaaa     97680
     taatgataaa gtctctggat cgtgtgtttc taaatacttg aatgcttttt ttggaccttg     97740
     ataacgcaat tctttgaata caaaataatc ctctagaatt gtgaagattg accaaatatg     97800
     gcgatatttt ccttctaaat ctctagtata cgcccttgcc agcatttttt gataccacac     97860
     tctacgtgct gtaatttcat caagagggag ggactcaggc aatattaaaa aagcagagag     97920
     tttttttaat aactctgtgc caaaatgagc tttttcaaga acaacgatgc catctgacat     97980
     acataaatgt tcatcagaaa ttgaatcaaa agcattctcg ggataaacaa aaatatcatg     98040
     ataaacttga tgtgcttcat caaagcgtgc aattcgttgc ttatctcctt tttccctaat     98100
     ccctgcaaca tcataatcac tggttactgt gaagtctcct cgtgcgcgcg agccatataa     98160
     aataattgta tggcaatgat gtaaagatat taattcatca acaatgaatt gcagaacagc     98220
     atcattttct aatgatattt tcttttgtgt cattccctta ccttcttatt ttgtaaccat     98280
     aataccaacg gcttcctgtg gtggaactgg tttgaaccgt atgatctact cctgctggaa     98340
     tcaatacttc tctccaatag caggttttaa cgttttattg cccacggtta aaataacttc     98400
     accttcaagc aacatgaata actcatccgt ttcatgccta aaatccttcc aaatttgacc     98460
     tgggggatct tcccaaagct caaaactaaa gccacgagag cgccaattgt tctcaattat     98520
     tgttgtatcc agcattttag gctcattatt taaaatcatt ctttaaattt tacaccactg     98580
     aagagcatca acaccacaac caatgacttc aatgatcttg tgtcgagact taaggcctct     98640
     ctttatttta atttgacttt tagggacttt gaataagaca gacaggtatc gcactaattc     98700
     catgttggct ttaacttcaa tagaaggtgc cgcgattttt atctttagtt cctctccaac     98760
     agcacctact acttgattgc atttggcacc gggttgaata agcaaactaa gaattaatcc     98820
     attatccttt tgtttatacc acggatatag gtaaatcatc ttgctgttcc attattttat     98880
     cctgctttta ctattctatt gagactcgct tttttatgta taatattctc ttggtaacta     98940
     tttaaaggga agttttttat gttaagtaag acttatattt ttctcgtcat tttttatgca     99000
     ttttaacttc caaaaatgaa taatctacta ccacttttca aatggggaac cgattacctg     99060
     gtttctaatg gctactcaat agagcactca ccagaaattg tattgtcaac accgtggtct     99120
     catgtgatcc gatttgcaac atcaacagag aatttttatt taaaacaaac accaccctct     99180
     ctttttctat ctaatgagcc caaaatcatt cgagtattgt catcccaatt ccatgccaat     99240
     gtgcccgata taattgaaat taatgaggat ttacattgtt ttctaatgag ggatgcgggt     99300
     atttctttgc gtcaaacgct taaaaccaac ttcaagccag agctattatg ccaagcaata     99360
     aagcaatatg ccacaatcca actcagcgca gaagaatgta tcgtgacatt tctcaaacta     99420
     ggcgtacctg attggcgatt aaatcaatta ccctttcttt atgatcacat gttaaagcaa     99480
     actgcttttt taaaagcaga gggtctaacg gataaagaat tgcaaacatt acacagtcta     99540
     agtccgaaat tttcagcgca gtgcaaatta ttagcaagct ttaggattcc tgaaaccata     99600
     ggttatcacg attttcatga taagaatgtt cttcttgatc caattactaa aagaatgacg     99660
     tttgttgatt ggggagagac cgcgatcatt catccatttt tttcgttaca tacctgtcta     99720
     gaacaatcga ttactcacta tggagtaaca gaaggtgatt caacatacca gaaacttcaa     99780
     gatgcttgcc tcgaaaaatg gttaggatta gcgacaaagg aacggttatt aagtgcattc     99840
     cttttagcga aacaaatccg gctattttgg aatatactcg cgtctaatca gtttatacta     99900
     agtgtggatc gacaggccta ccaggcctac tatcccaatc agcatagccc gatcgcaggt     99960
     ggctttaaag cgtttcttga gggcatgcat taaacccaag gttcgttgct attagaataa    100020
     tcataataag caaattatta gttctataaa tattcatgat acactactga catgatttgg    100080
     cagcagtatt tattacaata atgtctcgaa ctgaacgttt atttgattta attcaattac    100140
     tacgacgtca tcaattaccc gtgagtggca aaaatctttc agaagaatta ggcgtgagcc    100200
     tacggactct ttaccgagat ataataacct tacaatcctt aggcgcgcca attgaaggcg    100260
     agcccggtgt tggttatgtg cttaaatctg gttttatgtt gcctcctttg atgttttcag    100320
     atgatgaaat tgaggcaatg gtgctagggt cacgttgggt tgcacaacga gcggatactc    100380
     aacttaaaat cgcagctcaa aatgtgcttg caaaaatttc agcagtcctt cctactgaat    100440
     taaaacacca actagaaact tcaggactct tagttccccc aggaaaatgt gccgaaagta    100500
     aggatagtga tcttattctc attcgcaaag cgatacgttt agaacgaaaa atcgaattag    100560
     aatatcaaga tctccaaaac aatcattcga cacgaatact ctggcctatt gcgctcggct    100620
     tttttgatga agtgcatctc atggtgggtt ggtgtgagct aaggcaggac ttccgtcact    100680
     tcagaaccga tagaattctt caattatcca ttaaagaaca aaaatattcc gaacgccgac    100740
     aatccctttt aaagaagtgg cgcaccctac ataatattcc ccaatcctat tgaatgatgc    100800
     tgacaaaaac tgtcacgacc ctaccgtata ttctccaaca ggttaataaa taaaaaacag    100860
     gagaaagcat gtcattcgat cccaatttag ttctatttta tgtgagcaat atagaaaaaa    100920
     gtactcattt ttattcagaa ttactcactg cacatcctat acacaccgag cctgactatg    100980
     tgatgttttt attaaaatct ggcttacgac taggtttgtg gtctcaaaat tctgcccaac    101040
     cagcccccac tacgcttggt ggcggtagcg agctcgccat tttggttggc tctgagcaaa    101100
     cgattgatga actttttgga aattatcgaa ataaggactt taaaataata caagaaccga    101160
     ctcatatgga ttttggttat acctttgtaa tctgcgaccc agatggccat cgcattcgct    101220
     ttttttcaaa gaaatgacca tgaatcaaaa ctggctcgct gtcgcctgtg caacacatgt    101280
     gcgaattgga gtggaaggag aatttatgca agtttgccat ggtaaacttg cacctctaaa    101340
     aagaataaaa gcggacgatt gtattattta ttactcgcca acctcgcact ttggcggcac    101400
     caagaaagtg caggcattta cggcaattgg aatagttcta cccggcgaac cttatcaagt    101460
     ggatatgggc aatggttttt atccttttcg acgcaatgtg ctttggtcca ataaagcgat    101520
     tgatgtttca atacatacac tgattgaatc gctggaattg acaaaaaata ccaagaattg    101580
     gggatatcaa tttcgttttg gcgtattaaa aatcagtgaa cacgacaaac gcatcattgc    101640
     ccatgccatg caagcttata ttaattaaaa aaaatctact tggagcttct tatgactgct    101700
     atcatacctc aactaaccca aattcaagca ctgacagtaa ctggaataag tgtgagaaca    101760
     aaaaatgagg aggagcttaa tcctcaaaaa gcacaactgc ctcatctttg ggaacaattt    101820
     tatggctcga caacaaatga aacacaacaa aataacccaa tttatggggt gtatcaccac    101880
     tatgagtccg attcatcagg acattataca gtaactgcag gaatagaaat tccgaatgag    101940
     tccaaagcca cacacttgga tagagttatc ataaaagcag gagattatct ggtttttgaa    102000
     gcagcaggga ctaatccttc agaaatcatt aaagcctggc aaactatttg gaactatttt    102060
     aatgagacat caacatacca acgaagctat cttactgatt ttgagctcta taaaactcct    102120
     attgaaagcg cagtgtatat aggcattaag taaccaacat aagagcacta actatatgac    102180
     aacaacccca ataatagatt cacttataaa acttcaaagc gagcttgagc cactcaaaaa    102240
     gcctgcgtca gagcaaaagg caacctatta taaaactgga ccaggagatt atgcggagca    102300
     tgaccaattt ataggagtta gcgtccctga tttaagaaaa attgccaaac gctatcagga    102360
     gttacctctt ctcttgttac aagaattgct gtattcaccc atcaatgaag agcgactatt    102420
     agccttgttg attttagtaa cccgttatca aagaggagat gcagacctac aacaaacgat    102480
     ttttcaattt tatttaactc acatcaatca ggttaataac tggaatttgg ttgatgcttc    102540
     agctcactgg attatgggtg cccatttatt aaaagaagat aaaacatttc tgtccacact    102600
     ggcagaaagc actaaccttt gggaaaaacg tatagcgata gtcgccactt ggtattttat    102660
     ccgaaacgac tcttttgaat gtacgcttaa acttgcagaa aaactgctgt gtgaccatca    102720
     tgatttaatt cataaggcag taggctggat gttaagagaa gtcgggaaac gcaaccaatc    102780
     catcctcatc gaatttttaa atcgccatgc gtatcaaatg ccaagaacca tgctccgtta    102840
     cgccattgaa cgattgatgc caacaacgcg aaaaacttat ttattagcta agaagcaaat    102900
     cctggatagt gaaatataac tttcttggct aaggctacat gctctaatac tacacgcagt    102960
     atgaccatcc ccaatgagtt aaaaaagtat ttttatcctc ttctgattgc tgatcagttc    103020
     tattttttcc agtcaaaacc tgttcaagat aatagcgtcc atcctcaaaa aatcgttgaa    103080
     gctgataaaa tcgacacaat tcatggttaa tgctgcattt gaggtttaat tttaaataga    103140
     actcagccaa tggagcctgt tcataatgcc aaagatctct ctcaatcggt gcaattttaa    103200
     ctccgtccca atcaaccaac caaacatcaa aaggagtttg tagtacatta tagtgatgag    103260
     ggtcaccatg agttaaagca aaagggattg actgctgact gaactgcttt ttccattctt    103320
     gtaattgaga tagtccttgt aacaattgct ttttatgacg ttttagttgg gacaacatcg    103380
     attctgcatg cgtttcctca atcacctcaa ctgcattgtt aatccaaccc tttatcccta    103440
     atgcataatt gatatcaaaa tgttctgttt caaaaaatga gaactcatga gctggaattt    103500
     gatgtaattg aaatagaaga gtagccattt tatcggccaa aagctgattg ggcgtatagg    103560
     ctggatgaat cccttcaatg tagtcaaaca atgtcaaaat caatttattg ctcctaaaac    103620
     aataatgacc ctgaacatct gaaatcatat aagacaagtt cttcatgcca aattcgtttc    103680
     ttaatcgatt taaagcgata ccggtctgat taagtgattc aattgtaggt tggattggaa    103740
     ccagcgattg gccttcagga taaactttta gaaaatattt tttagtcgta ttcgtcgaaa    103800
     taacaaatcc ataaaaagac cccaccgcaa caaaatggag ctctgaggcc ataatctgat    103860
     agccttgata taaaaaatcc atcagctgtt catcagaata atttaattct ctacggcgca    103920
     tctctagccc tctaagatta tttgtctaaa tagcaggtgt aacgtttacc atgcttattc    103980
     ataaatgcct cacatcgaaa tccacattgc tgataaaaac cgtaagcctc atcatctgtt    104040
     tcagcgcgaa gcatttgtat tgaaaaatga ttgagtacat acatcagcat gttcttacct    104100
     attccttggt ttctatatac ttcaattacc gcaatatgtc tgattatggc aaaactctcc    104160
     tctaaatgaa gaccaatcac accaactaag tcatttttta aaaacgcccc tacaagatgc    104220
     tggcctgatt gagtatagga tagaagtact tgttccattt tttcaggtgt tgggcatcca    104280
     acgcttggtt caaggagatg ggacaatccg ggataagaaa atgaaatttc tttacactca    104340
     atctcaagct gcaatttttt cctaaccaac tccataagtt ccatgacaag catattgatg    104400
     ctgtcctgcg aagaatcaag aataacgcca cccatttcaa tagttttctc tttaagaaat    104460
     agagcccaat tgttcatgtg gatatctgct aactcaggtt gattgcgaag tacactcaac    104520
     cgatgctctc gcatggcttg ctccgtgtgt aagcaaatca gtaaataatt ttttatgccg    104580
     tgctctttaa gtggtattaa agcaaactcg ggattaaatt gcccttcaag aaaaatcagc    104640
     tttttatcat gaatctgact taaacgctca atccagcgtc ttgtagtgac ctcttgccat    104700
     ttttcggttg agccatattg ttggatcatg tcatcaaagc tggggacacc aatgctgtca    104760
     aaaaaatgag aagaaatggt ctccttggga tattgctgtt cgatttcttt aagtagcgtt    104820
     gttttcccga ttcccgatgc tccggtaatg agtacaatca atggctgtaa agaagactcg    104880
     cattcataca ttatttcaat ccaaaaacat taaacttcga ttattataac tgatttgatt    104940
     atcctgccga aaatatcacc attctaagta tggtatacta gacttcctaa gttaccttga    105000
     atcaaggcaa gccatgcaag aatttttctc catcagttta ttaattattt tagccgctat    105060
     ctctccgggc cctgattttg ctgtagtgac taagaattcc ttattccatt ccagaaaaac    105120
     tggaatttat acagcactag gagtttctgt gagcttattg attcatgctg tctattgtat    105180
     tcttggtctt gccttgatta tttctcaatc tttgttggca tttagtatta ttaaatatct    105240
     tggagctact tatttgattt atattggtat taagggattg atagctaaac gagaaatcac    105300
     aaaattagat gatcaaaaat ctaaaccttc actcacaccg ttatccgcat tttaccaagg    105360
     attactatgt aatctcttaa atcctaaggc cattatgttt ttgttggctt tttttactct    105420
     aattgttaaa ccgggccact ctttatgggt tgaaatggct tatggttttg aaatcgccat    105480
     cattcatatg atttggtttt ccagcttaag tatgatgatg acgcatcttg cgattaaaac    105540
     gaacttaaac cgaattcaat tttatattgt gaaagcaatg ggtgctgttc ttgtggcatt    105600
     tggtgttcgt attgcaacat taagtcaagc aataatgtta ccagcggcag tcttggagta    105660
     gttaatcctc tggaagtgaa tgatttttaa aaggaaaaat aaaaaattta tcgagacaga    105720
     taacaggata atgtttcatg acaaattttc tcgagacaga taggttgata atcaagctta    105780
     catcactcag tgattttgaa aatattcttg cgcttcgatc tgatcctgag gtgcagaagt    105840
     acaccacaca gccgcctgca acaaaacaag atgtgcagcg atttttagat tgggttatcc    105900
     cctatcaaaa aaagcacggc catgggatgg catctgtatt cgaaaaaaag acgggggatt    105960
     ttgttgggca agcaggtatt tttcacattg gccactggga tctgcagccg gagattgaaa    106020
     ttggctaccg cttccatgta aaacactggg gaaaagggtt tgccacagaa gtgactcggg    106080
     cgctagtagc atggggattt gatcatctta atatagacac aattgtttct ttcgtggaaa    106140
     cagagaattc tgcatcaaaa cgtgtcttgg aaaaatgtgg gtttcatcat attgggctta    106200
     aacaatgtca ctatggaatg cttgaaagat atgagattta taggcagaag tagtttccat    106260
     gtttgaaata agcaggaaac ttgggattga ttgagcatct gtgagaaaaa tattaaatgc    106320
     tcttttaatc aattgatgca accatcgaat gatcttgaac tcttcgcagc gcctcatcag    106380
     ttaccaataa accttgacgc tcatatcttt ttcttgcacg actgaatttt acgactatta    106440
     atgacttatc agagtatttc ttagctctac gtgtaattag tgcatcccca gcaggcaaga    106500
     aaactaagtc tttataaggg gtacaggcca tgcaataagg attgttttca tccatcatca    106560
     gaaagctgcc ttttggtagg tcttttttac attgagtgca tttggattcg ctcacaataa    106620
     tgtaaacaac gggttcagtg gatttttcaa ccttctccat tagccgttgt tgtttttgtt    106680
     gcgtgagttt tggtgaaatg taatgtgtgc gatagcgtct ttcaatagtg tcttgcccgc    106740
     ttttgctaaa ttttaaatga atggtgctcg agcacgcttt ttgtacgtat gcagtttctc    106800
     gtggcaataa tccggtttgc tttgcccatt gatggaaaca ttgtatcgca aaacttaatt    106860
     tgttcagatt ggcttgtagc cgttgttcta aataagaaaa tcgtccacgt cgccaatcat    106920
     ctaaaatact aggcgatagg tagccaagcc ccagtaaaat atcgatgctt gaaacatatt    106980
     gtttttcttg taaaactcta ttgacaatgc caatcacttt tttagataat tcttggcgat    107040
     tcattgtgta tccagctatt tcaaattacc catgttgtta aaaaatgaga agaaatggtc    107100
     tcccgggcta ttgttatttt cccaactcca gatgccatag caacaagtgc aaccaatggt    107160
     tataaagatt cgccgtagtg catcatttcg acccattagc attaaatttt gtttattata    107220
     tctgatttga gttttgttgt gagggtgtta ccacttttct gtgttcaaaa atggtttgta    107280
     tatgaacagg caaattggca caccaacaac cataattatg accgccaata aattcagact    107340
     tatggataag cattcctttc ttttccatta aatcagcaat tcttcgattc gcttcaaacg    107400
     tggagatgga ttgagtagaa ccatcttcga attctaagtc taccgggatg gtttcataag    107460
     taccaatatc aaaaataaat tgcgtattag gattttcttt atagtgtttt tcaatctttt    107520
     gttctaaatc agtcaatttt tgcatttcca aggaaggtga taaagaaata gcattgccaa    107580
     acatcgttgg attggttaaa gcggcataaa aagcagctaa gccactggca ctttgcccaa    107640
     caattgttat taaccttgcg tcttgagtga tatttaattg gttcttatca tgtaacatcg    107700
     gaacaaaatc atgcactaaa aatgaggtga atacgtcatt acagttgtat tcatgcatac    107760
     gatgaatgct tgagtattcg aggaacaccg caacacaagg aggaatattt tcctcttgaa    107820
     tgagcttatc taaaataagc ggtgccggca taggatttaa ataatcacta ccatctaaaa    107880
     ataaaatcat agggtaaggt gttgcctgtt tatcgtaatc aggaggcaaa tagacccaat    107940
     attttcgtat cgattgttca ggattttcgt aatagcctgg aacatttttt aaacgagttt    108000
     ccaagaagtt cagctcgaaa gaaaaaaatc gatgttcttt tttacatcgc tcacgatgtt    108060
     cctttgcttt atctaaagaa caatcagtta caaaagttga tacattaggt agctcaataa    108120
     tggattcctt gccaaaaaat tctccgggat tgtcataatc catgtaatag gttatttccc    108180
     gtttatttct tggatcagtt tgaacgcagc cttgattaaa taagtgcatt aataacattt    108240
     gtgattcttt gaattttcct gttggaatgg gatagaggct ttcagtgttt tcttgttcag    108300
     agaattccac ttttgcagta tctttatcaa caattagtac gttatatgca gagcgaaaag    108360
     tacggggcaa tatcaaagtt aaatatctaa tatcagtgtt tggaatcgcc ttaaattgac    108420
     tttgcaaaga acaaggtaat ccagtaaagg tagaccacaa ataaattgtt tttttatcgc    108480
     ttttctctct atatataaaa gtgaccaaac actgctctgg ctgatttgaa acatcttcaa    108540
     taatgggtgt ttcaagcctt tgccaaattt gatcgttttc ttctgtagaa atcgctacag    108600
     ctaatttctc aataagatgt tgtaaataag gtgaatcata ttttggcata gatactccat    108660
     gagaattagc attacatcat cctatccatt ttagaacatt ttaaagagat agggttagct    108720
     ttatggttgt tcatggtata aagcaattaa ttctttactc gaagagcatc ctaacgaatc    108780
     catcaattta gcaataattc cttcgactgt cctataagaa acatgggctt cacgcgcaat    108840
     ttccttagcc gtttttcctt gagccaacaa cttaagatat atggcttgtt gctcagataa    108900
     atcaactctc gtatgagata ctttatggta taacgtgaaa tcttttttct ccaaaattgt    108960
     tttttggggc agcatttttt catttcccaa aatagctttc gcaatacaac gcgtatgctc    109020
     ttctaatttg ccatcatctc catgaacagt cagcgtggcc acttctttat ataggctatc    109080
     gcgctcgtca tgtaattggt caaaaaagtc tctccaactg ggtacaggca ataaatttgc    109140
     tgaattgcgt gcagtgcgct cgatctgaac cggagtactc acatccaaaa atacagtcat    109200
     ttcatttcgc aataattgac agttttttaa agctagaaca acactagagt cggtggttac    109260
     aacaatgtgc tcttgcgtgc atagagactt taatatgtca aactgacact cataaaaagc    109320
     ttcacttccg tggcttccga gtatttcata caaatgacgt ccaacatgag actctaatcc    109380
     taaatctgca tcgacaaatt gccatcctaa taattgggct acggactttg ctaataatcc    109440
     tttaccggca ccatgatgac caacaataaa aattcgttga ggttgattca ttcttactat    109500
     ctcctaatcc aaataataca ataattatac aaacagacca taagatgcat caatacgtag    109560
     aactacgtga gtatcaagta cgggattatt attttaatct aacagaagaa ttagttttgg    109620
     gaaaaatagc aatgtttttc tcttacaagc attcacttga gaagatactc attgctaaaa    109680
     taacaaacaa atcattgata acaatttcta cgagtaagta ttctatgcct aactatctgc    109740
     atctcacctt acaatccgaa cgccttcagt taattcctgt ttcactaaaa tatgcagaag    109800
     atttatgtaa agaatttact gctgaaatta cagagcacat gtggccaagt gccccgaaaa    109860
     cacaagagga aattaatcag cacatttctg aacagcaaat taaaatgcaa gcaggctcag    109920
     aaatcgcatt ggccatcatc aataaagaga accagaattt tttaggatat gcctgcctac    109980
     accaagcaaa tacgaagaca cctgaattag gcatttggtt aaagaaaagt gctcatggat    110040
     ttcattatgg ttttgaagcg atgaatttat taaaaacctg ggctgaaact aatctagttt    110100
     atgattatct aaaatatcct gttgtaagac aaaatatctc tagccggaaa attgctgaaa    110160
     aaatgggtgg cattattgaa gatgaataca tcaaaacaag tgagtcaggc aagttgcttg    110220
     atgaagtaga atatcgattt tatggtgcaa caatgacgaa tacacaatcc aaaataaata    110280
     ttactgcagc cttagtacgt gagctcatta cacaacaatt tccacagtgg ggtcagctac    110340
     ctattcaagc tgtaaacaat agcggttggg acaataaaac ctttcattta ggtacagaaa    110400
     tgctcattcg catgcccagt agcgccgaat acgcagggca agtggaaaaa gaacaaacat    110460
     ggttacccaa attagcccca cttcttcctc ttccaatacc cgccccactt gcgatgggaa    110520
     aacccaatga actgtaccct tggaagtggt ccattaatcg ttggcttcct ggggaaacgg    110580
     cagcagctac tcccattaat gatttgtctg agtttgccta tgatttggcc ttatttctta    110640
     aggcactcca aagcatcaat tcaatgggtg gacctattgc cggtccccag agtttttatc    110700
     gcggcggtga tttagcagtc tatgattcag agacacgaaa agccatcgaa gatttgaaag    110760
     acactataga tttccgtgct gcaacagaaa tttgggaaaa agcattatcc acttcttggc    110820
     agaatccacc cctttgggta catggtgata tcagtgttgg caatttgtta ctttctcaag    110880
     gaaaattaag tgcagttatc gattttggcc aactcgccat cggcgatcct gcttgcgatc    110940
     ttgctattgc ctggacatta tttgaaggaa aaagtcggag aattttctta gaaactctgg    111000
     aacttgatcc agacacttgg gcacgaggac gtacttgggc tttatggaaa gcaatgatgt    111060
     atcttgttaa ccaacaaacc gagatgaatt ttgaagcaaa aagagcattg cgcacgattc    111120
     atgagttggt cgaagatcat aggcaatgat tatgaagact tcttacatag aatgggctct    111180
     tagtgcctta aacgattcag ggtatctact tgaaaccacg aaaccagaaa taattctcgc    111240
     cacagcttgg tcagaagtgt gtcgttttca aacaaatctt gggttggtct atttgaagaa    111300
     agtgcctcct gcattgtcat tagaagtcat tgtcattcag ctattgcaga aacgattcaa    111360
     tgctcctgtt ccgcaaatca tagctcataa tcaggaactt cactgttttt taatgcaaga    111420
     tgctggcatt cctttgcatg aggtctttaa acaggaattt aaacccaatc ttttaattga    111480
     tacgatgcat cattacacca tgcttcaaat aaattccgca aataaaataa acctgtttct    111540
     tgatttaggc gttcccgatt ggcgtctacc acaattgccc agactttatc accaattaat    111600
     gaatgaagag gagttattga tgggagatgg attaactaaa gaggaaataa aacaattaaa    111660
     aaatttagag agtacagtac aaatcttttg tgaccaatta gtcagtttta aggtgcctga    111720
     tacatttggt catgccgatt ttcacgataa aaatatttta ataaatccaa atactcatca    111780
     aaccacgctg attgatttag gggaagttgt cattactcat ccatttttct cattcgttaa    111840
     ttgcttgtat cgggccacag aacatttaaa actaccaagc agtcaatata ggaaattaca    111900
     ggaagattgt tttaaaaact ggctctcaat agagtcatcg gcacatttgt ttgagatcat    111960
     tgcaattatt gaacaatgtt gggctattca tgcggtgttg ggcgaatatc gcttaattaa    112020
     aagcatcgac ccaatcgcat caatgaggct aggtcgacaa ggtcgatttg ctggaaaatt    112080
     aagaggttgg atagagcaat tccttaattg agcattttta gctatcacgt gagggtcaat    112140
     acttaattag taataaagaa taaaggaatt tttttttcat gttaaaatgt gcgactcaat    112200
     agttatattt actacatagc ggctattatg agctcaaatt ctattcaatt aaatcaaaat    112260
     catggaggac cgctccatta tctcggaaat aggtacctta ctcttcccga tttaacaggg    112320
     catatgtccc ctgacactag ctggttgact gaacatttct ctgtattatt ggcaaatagt    112380
     aagggccaaa aatacaagaa agccattgag ccttttgcag gttctgcttc ttggagtctg    112440
     gctgcaatgg agattgacct tgcagaagaa tatattatca atgacagcaa taaaattttg    112500
     attaatacac ttcttttaat taaagataac cctgctcttg tcaaaacttc ttatactgcc    112560
     ttaatagaaa aatatgatgc ctccctatcg aagaaagatt ttttccttga agtgattggg    112620
     aattacaacc aaacaactga tgaagaaaaa gcgttactgc tccctttcat cattaatcat    112680
     tcatggggcg gaatcctttt ttatgataag gaattgaata ttatctatcg cgaaggtgaa    112740
     ctctttgaag gaaaaaatgc taatcgattt cttgagcatg cgaatttgtc cctagaaatg    112800
     ttcttgagtg agattgaccg agtatctaac cttcttaatg cgaatcaagt ttcattcaga    112860
     agtggtgatt ttatggacgt gatttcgatt gcgacacctg gtgattttgt ggcactgaat    112920
     cctccttatc cagagaatga acattcgacg cttgaaaaag ctgggatgta tattgaactt    112980
     tattcgcctg aaaaactgca ccagaatttg gtgcaaatca ttcaacatct tgaaagccaa    113040
     ggtattcatt actacatgac ttatggattt tataatccaa aattcagaaa ctatgtctta    113100
     gctaatgaaa accagcgacc aattaattac tttcgtgtcc taggctatga gcattgtgct    113160
     tttggaatag gtcttgatca gatgtatttt acgtcccaat tttcaattcc caaaggtata    113220
     aacatattca aagcggaggg agttttgggt gcccaggata taacgcctga agaagcactc    113280
     aaacaattta agttgctttc aaaaaaatgt tttgctgtta tttaccgagc ttttattaag    113340
     cctgagcttg agatggagta tcaaaaggcc tggcatcagg tcgcttccta ttttgtgcaa    113400
     tatcgcggcg cattaggttc ttgcctgcat aaaactaacg atggtatgtg gcttgcctat    113460
     tctcgttggc ctgataaagc gactcgagat gcttcttggc caggcgacaa tgccccatct    113520
     gagatgttac ccaatgaaat tagaaaagcg gttataacca ttcaagaatg tattgatcaa    113580
     acgcaaaaac tacccgaaat tactatggaa gttgtcaatg atttattgta ttcaaactaa    113640
     tagaagatat aactcatgaa tcaagcgcaa ataaattacc aactagagct tgttatagac    113700
     gctaagctac tagagcagca agataaaatt attcgtgatg ggatagtaaa ttttaatgct    113760
     ccttttacag gaaccaaacc agagcgttac tcaatctatg tgaaagataa cgagggtatt    113820
     attattggcg gagctattgt gtacgctcat aaaagctcaa tatatgttga tgtcctctgg    113880
     gttaaggagg aataccgtgg tcttggtatc ggtgctgaac tattgcacag cgttgaagcc    113940
     gaagcaatta cacgaggaat tccagcatca acattagata ctttttcttt tcaggcagaa    114000
     agattttatt taaaacaagg ctatcagcat ttaggcacaa ttaaaaatta tttagaaggg    114060
     catgatcgga tctattttag gaagcaattg tagagtggaa agcatatccc ccataagaaa    114120
     atatgccttg aaaaaagaac agaacaaacg aagcatctat tctccaaagt taaactttta    114180
     ttggaaatgc tcgtaaaagt tcataaacaa attagaaagg aaaaggaggt aactgattcc    114240
     tatctttaag ccaaaatgga tgatgccact cttcatagat ggaaactggc atattgcttt    114300
     gcttaaattc atcaaaagat aagtcgcaaa gaaaccattt aaggaattcc gcgcaagtct    114360
     ctggacttat taattgaccc gactgatagg cctcatcaaa cattttatgt aaatgaaatg    114420
     aagttgtttc tcttaaaatt ttttgaattc ttgtatccac ttcccctgga ataatacaag    114480
     acacaccaat atttttctct gctagctctt ttctcacaat agcagttact tcatccaaac    114540
     ccgctttgct ggcacagtat gttgaacttt ctttaagttt cagagtagct gctcttgatg    114600
     taacaaataa aatccgagac ttctcaggca tctgcgcggc aagtagtgct gtaagtttca    114660
     ttggagctaa taaattaacc tgaaaaactt cgtcaatact gtcacaatcg tattcggtca    114720
     acggacgtgg aggacttttc attcctgcat tttgaactaa aagatgaagc ggtattccag    114780
     aatcattaat aattttagca acctgttcga tatcactatt gcgagtaaaa tccgattgaa    114840
     tgggaacaaa acgaggatat agcgctttag tatcctccaa gctgcttaca tcccgccctg    114900
     ttccatagac aacccagccg tcacctaaaa gaattttagc aagttcaaga ccaattccat    114960
     ggctggctcc ggtcactaat gcagctttat tattgttgat gttcgtcatg aagcattcct    115020
     tgaaacttaa gttactttcg tgcggtatgg taatcaaagt tggcgaaagt taaaaggtta    115080
     ttcctaattc atgtgttact aattgaatta attctggaat acttgcctta acttgaataa    115140
     tagtaggtaa aacctgaaac acctgctcaa tacccgcagg catcgtttca taaataacac    115200
     taaactgacc atcatttttt aaccaccatc catcagaacc ttgtccccac ttaaaataag    115260
     gcgcattgtt tattgaaaca acctcttctc taaccacaga ttctgataca ggcagttttg    115320
     gtttttgact taagctcgag actgaatcac catttaagag tccgatttct ctttttgcct    115380
     gaaattcttt ccgcaaaaaa tagaatatag agtttttctg aaacccatgc cgttcaaact    115440
     caagttcaaa tcctaatttt ttataaaatc ctattgcttc ccaatccata gtattaactg    115500
     ttgcaaaagc acaacctttt tcattgccat acctcaatgc cgcttgcatg agcttcgttc    115560
     cccatccttg atgtctgatg gactcactca cccaaagatt atcaacatga agacctccat    115620
     agagcgttcc gccactacaa ccacccacaa tgctattgtc tgcatcacga ataaagcatg    115680
     caaagaaatc taaggattcg aagccttttt gttgtttggc gtacgcctta atcccattcg    115740
     ttaatatttg aacatcatca gggtttggat tttctaaaaa cgataatttt aaagtcatct    115800
     gatttattcc actgttggaa gccaggcacc ttgctccaca taacttgcct catcactacc    115860
     tgaccaaggt ggcatagtaa cgcaaataaa caccaaatct gctgcatcac ttcgatattg    115920
     aaaatgtgtt cctaaaggaa tatcgatgct gactccaggc gttaaagggg taatactctc    115980
     ttcatcgttc aacttacgcc aaatagctcc ttccccagaa aggacatgcc aaaattcaga    116040
     tacagtttta tgacgaactg ctttggaaat tgttcctgcc ttcaaagtac agtgagccat    116100
     tccacctaaa tgattattca tcagcaatcg aacttcagca cctgctggag agatatgttg    116160
     atgctctttg ggtatttctt gtgtattcat ttatgcctct attaaaacaa tgttctcatc    116220
     agtagtagtt atttttttta aatttgaatt gtaacgcaag tattatctgc atctaaagta    116280
     accactttgc caattggaag aatacaattt tgcttaccgt gcccataggg aaactcttta    116340
     atgcaaggta cttttatttt tgcagcccat tcattgatta catcttctac cgtaccatcg    116400
     tacggattcg atttcttact tttacagtgt tcaaatgtac caaaaataac gccagaaact    116460
     tcatcaaaaa ttcctgctaa atctagttgg gagagcatgc catcaatatt atagggctcg    116520
     acaccaacgt cttctactaa caaaatactt tctttaaaac taggtagata aggtgtgccc    116580
     attaaattag tcatcagagt taaatttcca ccaagtaaag gacctcgact aacacctgca    116640
     tgaaccttta ttcctttgga aatcatgtac tcttggccta ataaagagga aagtaatgtt    116700
     tttttaacct ggttacttaa atgaatagtc aaagtaaatc ctgtataact tactaagcca    116760
     ctgtttttaa ataggcctaa ttgcaacgcg gtggtatcac taaacccgta taattgtttt    116820
     ggatttctct gaattaattc atagtccaaa aaaggtaaaa gacgttgtga accttgtccg    116880
     cctcgggttg caataattgc tttcacttca gaatctttaa agaaatccat cacatcattt    116940
     gcacgatcac tgtcttttcc tgctaaaaat cgttctgatg caagcatatg ctttgcatac    117000
     tttaccttaa atccatgcga ctttaataaa tgcactcccg cttctatatc ctgttccata    117060
     atagggctcg acggtgagat aagcccgacg atgtctcctt tttgcagtgg tgttggacat    117120
     agaatattca tttttatcct caattatttt ctacattcaa aaacaatact ttcgtctttt    117180
     tcatcaggtg atgagtttcg gtcaaatcct ttaaccatcc gtacattgct gaaaccaacc    117240
     tcagtaagca aattgcgcaa gaaagaaggg tcttgataaa tgcgaatttt gtattcctca    117300
     acctctgttt gcactacaca gttgttatca accaagtcat atttgccaat agagtaacaa    117360
     acatcattat caagcgtggc taattggctt aagactataa gtgttccatc ttctttaggc    117420
     catcttgagc ctctccatat acctaattct ttaggcacgg cttgacgtgt ttctacttca    117480
     aatacaaaga gtcctttatc ttccagatgt tcaaaaatga tttttaagga tttttggata    117540
     tccgcctttt ctgtgatgag gccaaatgaa ccactgggta taaaaattaa agaatattga    117600
     ttggattgat ttaaattttc aataaaacca tgccagactt ttggcttaag gtttttgcta    117660
     atagcttttg catgcaatcg ttctagcatt ggctgacttg catcaaagcc atgaacatca    117720
     aatccttctt caaccaaagg taataaaaaa cgacctgtgc cgcacatagg ttctaaaatg    117780
     gggcccttag cttctacagc atagcttcga tagaatgagt actcattttg tggtgcatta    117840
     ggtttactta aatcatatac ttcagtacac aggctctgat aggtatctag ttttttcatg    117900
     ggttcctctt taaaatccaa taccattaaa tattcatcat agaaggtatc attaatttta    117960
     agcgctttag gttcagtgcc ataaattcga aacccttgct tttgataaaa agcgcgagcc    118020
     acaaaattac ttactacaca ggttaggtgc aattgagtga cgcaggtcct tgcatgctgt    118080
     atcagggttt gaattaatgc tgttgcaata ccttttcctc tgtattcaag acgagtatac    118140
     ataccccaaa gtacacctcg gtgtttggtt ttaagtgaat taaacgtata gaatccaaca    118200
     caagacacca ataaatcgtc aacaaagaca cccaatacaa atcctttact taatccattt    118260
     tgaaagtcag catcggacat atgcacttcc tcttcataag aagagccaaa attttcaggt    118320
     gaattcttta gcgcttctaa tcgaaatgat ttccatagtt cccagtcttc ttgcattacc    118380
     ctttttatct tcataaactg atctccatca ccgttacagg atgagattta aattcatcca    118440
     taccgatttt tttccaccca aggcgcctat aatactcagg tatggtagga tcaagagcaa    118500
     acaagtacag tttttcaaag ccaagttctt ttgctttctc gactgcggca tcaactaata    118560
     tttttccgat cccctgtttt tgatattttg gatcaaccac caaatcacca atccacggcc    118620
     ctaaatctgg tcgaatatct tcgtttaatt gcaaagtaca agaacctaca ggaatttcat    118680
     cgtatagcgc aatgtaagta aaaggcatat cttggttcag ctcttcgtaa tacaaagatt    118740
     ctatttcttc aattccaatc tctggcatcc agattttacc taaaacttca tgccaaatct    118800
     tagcaagctt tggaatacag tctgaatatt gttttaggta ggctattgtt atcatcataa    118860
     tacctgttta aaatggatta ttcctcgcac tcgtggcaag gcgttccttg atgaaacacc    118920
     atttgccaac gattgtgttt gtattgccag agcgaagaac gtaaagaact ttttgaggca    118980
     acagtaacct tataagttgc caacatgact tcaggcgaca cctctaaaac tgaaaaatca    119040
     ttaaccatat agcttcgttg ctcttcttct ggaagagaat caagtaggtc gttcttattg    119100
     taaattgagc cagaggcccc atactcgata aattcatcag caatcaatag tttcagttgc    119160
     gcaatagatt ttctcgtttc cgaccttaat agagaaattt ctagctcata aatcaattgg    119220
     tgttcttgtt tcatagcgat tttctcatca aataaacgtt gaaatccaaa aaacaattat    119280
     gctctgtcat ggatatgaca acatacccaa gctgttcata aaaagatctt gcctgaaatt    119340
     cggccgtctc aatggtaatc acttggcaat tcttttgttt tgcaaaaatt tccagttttt    119400
     ccatgagatt tcgtcctaat cctttttgtc taaaatccgg atgaacccaa atgcaatcga    119460
     catagcaatt ggctcgagtg acatccccat aacaacctgc taaaacggtc ttgtcgatag    119520
     attttatata gatggtaaag ggagtatgat tgtaagcacc aatcatttct tcattgtaga    119580
     tctttaagcc gtcagataaa atggcagtga tttcttggtt ggttcgttct tcgaaacaaa    119640
     tctcatagtc attgttcttg gctaaaatta taagctctgg tatttttgca tcttctggtg    119700
     catcggaatg ataaccgctc caaagaatac ctccataagg ttgtagtatt ttttcaacca    119760
     acttttttaa atgagttgaa tcaccttcct tataaactcg attaaaactt tcagaaaact    119820
     ccctggctaa atcgggattt tcttgatgca aatagcgaat gattgattta ccactggcgc    119880
     accatttatt ttgagctcta aaataaaatt gagacaatgc ttcaaaaagc catgaggctg    119940
     aggcaatttg ttcttcataa gacttaggag ataaaatatc ttctaagaca tccgtaatta    120000
     aaaaacgctc tttatcaatt tgatttttat cccaagaaag aggtccgcgc tttaagtaaa    120060
     gataggcctc ctctctaatc ccgtttgaaa aatcgctagc tggcatcata tcttttcccg    120120
     acaaaatcat ttgaatggtt cctgaaatac cggaatttat tctcgattct tcaaaaaaat    120180
     aacgaatgga ttctctgtcg tgtacaaaag catcaatagg ccaaccttca taaacaaagg    120240
     cttcacgata agctctgatt aatttttcat agacgattac gagatctaaa tctgagactt    120300
     gggtttcttc cccttgagaa accgaaccgg cccaaaaaac agcacgtgct tctgagtaac    120360
     gttcatgaat taacttttga attgtttctt gaggtgagca acgcatttaa tctgtttcct    120420
     tttttttcgc taaaatcacc tgatttccag gttgatctat tttatttgat cagtcatttc    120480
     gacattacca tcattcggta aatctttttc gcatttttta ctttgtactt tttcttcttt    120540
     tgcaacaacg acgtgacggt gatttggcag aagttgggca ttcaattctt gcaatgcaga    120600
     accaataatc cctttttgtg gctttttata acgataatac aaccatcctt tctgttctaa    120660
     ccataagcag aaccgattaa aaacatatgc ggtaaacaga atcccaatca gataaataaa    120720
     taatctcata attctcacta tttcattaat tttcgccaaa ctcaaaaaag tctggcgagt    120780
     taaaaaccat tattgatgtg tttctagtgc tttacttatc caagctgatg cttctgcatt    120840
     gaacagtaat ttaatatgcc atggctttat catctcctga ggaggcggca ttgtttttaa    120900
     ggcttttact tcatgctctt gtcgcgaaat ttcttgccat aataaaatac cgattaagta    120960
     atctctattt cctgcagcta aataattatc gattaagtct ttccattctt gagcaagcct    121020
     tttcccatgc tctccttcag gtggagagtt catgttatcg atgatttggt tgtacagatt    121080
     attccaacgc ttcaacgaat aggccatcat cgcacgcgac aaccaataag caccttccgg    121140
     ggtgatttcc aattgggtta gtctcccaga ttgtatgctt tccaaaagac tggctcccaa    121200
     tttgacttgc tcagtaaaaa atttcttcat tttttttgat aaatcttcca taacagcagc    121260
     aattcgctca ccatctggtc cttcaggatc acctaccttt tgttggttaa tttcctcaat    121320
     aatagaatct ctaagtgcaa attcttcagg aaattgctcg taaagaaaca agtagtcttc    121380
     aaattgagaa acagttaatt gttttccagc ccacgttttt ttcaatttat ctcgtagatt    121440
     ttctgtcatt ttatacccct ctatgagtaa caacaaatct tgccaattag gaaacattga    121500
     tgcagaacgg ctttttagaa tttcttcaag cacttgattc actttcagta aatcttcact    121560
     ttgctttctg attacttggt gttgtgcttg caggtgagca taaacattgg aatgtttttg    121620
     cagaatatcc tttattttgc ttaatgaaaa accaaaatac ttcaaagcaa taatctgctg    121680
     taactttgcc aaatccggct cggtgtaaca gcggtaacca ttgggctcac gataagaggg    121740
     ttgtaacaaa cctattttgt cataatgccg caacatgcga accgatgtct gagttaactc    121800
     actaatttct tttatatgcc attttgtcat catgtctcct cccaagattg agaatagggc    121860
     atgacactat gttagggtca atagtcaaat tcaaaacctg ttatccaatg agttttttac    121920
     caaataatgg tgtaagcacc atttgcatca ttccatgatg ccactcatcg agtggcttta    121980
     ctcctgatgc tgtttccgga atctgtcaat aaaaatgaat tattccgtct tgtctaggcg    122040
     tgccttctta agcactcatt tatcgaataa ttaaatattc ttttattatt cttgttcaaa    122100
     tgcagtataa aatttcagaa aagatgtttc aggccaacaa cgttttaatt cagctaacat    122160
     ggcttgagcc atcgctcgta agtagggtaa atgttgataa gcattgctac tatctataaa    122220
     tgcttgcaac ctcgataaaa ccctaggtct aacccagtta tcttcttcat tccataaaga    122280
     atccttcggt acaggacctg aaggtccgat cctatctttt tcccaagttg aattaataaa    122340
     aggtatcgtt tgttgtaaaa gccaaaaacc gcaggcatag gtataagctt gattgtattg    122400
     tttatcatca gttgcttctg aaatcgtttg tttgagttcc tccctataga tttgttccat    122460
     atgctcaata acatccgtag gaatggcttt agcacaccag cacgttggca tactcattcg    122520
     caaataagtc ccatctaaca aagcattacg cacaacacac cattcaaaat caataagctg    122580
     caaatcttta gtttctgcat gatcaaatac attatcagga caaatgtccc catgagtcag    122640
     aacagtaaaa gatccgggct ttattacata ttcaattaaa gatttcgctt cttcaatgca    122700
     ttcatgagtt aaagttaagc ctaaattttt atttgccaat cccagtttcg gtaataaatc    122760
     attcaatgcg aaattaagct catcatcaac cgtttccgcc tcaggatgaa tcatttgcaa    122820
     aatttgttca taaagcccgg tatttccaaa acttgctgca tgaaaacttc ccaaggcttt    122880
     cataaaacgg gttaatgcag caatagcttt tttgcgatca gctacagtaa gtgaatcgac    122940
     taaactaaca tgctgaactc ctaaatcttc aatcagaata aatcgatact ctttacttcc    123000
     accaaaaaac tttgggacat tatgcttgtt ttgcttaatc tcagaggcaa attcaagacc    123060
     tgcccaatcc cttgcaaatc gtgcataagc ttcctcatca ttagcatcgg tgtcttctcg    123120
     taaagattgt tttaaaataa tactttcagg gatttctttc gtttggcttg ataaaaagag    123180
     tcttactacg caatttctcc gttcaggctc acttaaaaac tgagtggaaa ttatcttaac    123240
     ctctgcatca aatctcttat ttaatatata gatgatttta tcaagaagat tagaatcaag    123300
     aattctgtgt tcatttatgg agcttgcttt catcttttaa acctaagttg ggatcaagga    123360
     gctttatttc tatgcgttct tttccgctgc caatattaac cctttttagg gtaatgaatc    123420
     caacttccac ggttgattgt acatgtgttc caccacaaga aacattagaa aatccttcaa    123480
     tctcccaata acgtctttga ctcttctcat cagaaaaccc agtgcgaata agcatatctt    123540
     ttgcaataat ttgattgtat tcaaacaaaa gagagtcaaa aatatccgag atattgtgct    123600
     gatagctaaa gtcgattcta gccttatgtt cagcaatatg cgcacctatt ttttcaatgg    123660
     gaagcattct ttggacaagt tccaagatta attcagcagc aaaatgaaga cgcatcaatt    123720
     tgtagcgacg aacaaagtcg atttccataa ggacaacatc gccctcagaa agcccatgct    123780
     ccgaaggtaa tgtataataa atcaagtcat cttctatttc agaatgagtg accatcaggc    123840
     cattcacgcg aactgtatca ctttcttgac caccggaaaa cgaaaaacca atagtctctg    123900
     caaaaagtag tcggttctca tttaccgaca ccactttagt cattaattgg cgttgatagg    123960
     gattatccca aaatagttta tgcatgattt attctctaat cttaaccact atcccattcg    124020
     ttatatattt cagttcatca ggagagagtg aaaacactgc attgggcgtt ccagcagctg    124080
     cccatagaac ttcatagcac aacaaatctt catcaataag aaccgtatta ataacgtgtt    124140
     tatggccaac tggaggaact ccaccaatcg caaagccagt tatttctcgt gtaaaatctg    124200
     catcagcttt cccaatatct tcattgataa ggtgcccaat aaggacctct ttcacacgat    124260
     taacaccact tgctaatacc aatatcggct tgttggtttt ttcagtgcga aatagtagtg    124320
     acttcacaat ttgagcaaca ttacacccca aagtatcagc ggcatctttt gcagtacgtg    124380
     tactcgaatc aagttccttg acgtcacacg atattccctt ctgagataaa aaatcctgta    124440
     tgatctgagc gcttttactt aagtttttat ctttattcat catgattacc atcccatcat    124500
     cgccacaaag aacacttcct agtgagttct gtcactacgt cccaatcccc aaataaaaca    124560
     atgccatagt aaatcagatc gttctcttta acctgtgccg ttctttcaat ttgctcttga    124620
     taggtaccca cagtcatcgt atcggtaaaa tcattaaaaa gaacattttt tgctaaagca    124680
     ttctggcgta atgatctaat tttgttggag ttctcgcaaa gaatgataaa gggtatttct    124740
     gaaatataag ggtgagctcc tccatctgca tctcgataat cggttaaacg cagttcttca    124800
     ttaccaatca cagcacctaa accaatacac atatgagcaa gtgcgttcat cactttgcca    124860
     ggctcaatat gcttattaag taccgcaacc agtttgtttt taaaagggtg ttcaaccata    124920
     cagtcctcca caatttactt cacaattcgt gcgttataac gcataataga ccagtatata    124980
     cctgtgcgct aaaacgcaca agctttttta ttaagagata tcatgcaaga aatttcaaaa    125040
     cgtattgcaa aaacattaaa atcattaaga caagaacgag gttggagttt agacaaaaca    125100
     gcgcttgaaa ccggcgtttc taaagcgatg ctcgggcaaa ttgaacgaga agaatcaagt    125160
     ccaacgattt ctaccttatg gaaaattgcg agcggctttc aagcctcctt ttcttcgttt    125220
     attgaagaca gtctggataa ttcaaccaat cctgtttata gggcgggaca tgctgaaacc    125280
     ttgcatccag atgatgaaaa aatacgagta ctgcctctat ttccttttga tgagcagtta    125340
     cattttgaat tgtttgttat tgagttattg cccgaatgtg aacatctttc acctccccat    125400
     aaacatggag tcattgagca tgtcattgtt gtggatggaa ccattgagct tttgttaggc    125460
     gggagctgga aaaaactttc taaaggagaa gggcttcgtt ttaatgccaa tcaaccgcat    125520
     ggctaccgga atccaaccaa tgaactatcg cgcatccatg atattattca ttacccaccc    125580
     caatataaat cgccttaatc gattatggta cataaaacaa aggcgttaat gccatagttt    125640
     ttaagtcatg aagccactca ttgcgtggct ttcctcctgg cgctgtttct tcaaaccagt    125700
     tgtatttaca ccaaaggtag atatccaagc ttttcatttg cgaaaaatga ttcatttctt    125760
     ttaattcgtc tgaactcaat ggccggattt gcctataccc ttctataaac cattcaaaca    125820
     ggggtttcca gagaggccat ggcttattgc ataagtccaa aaaaggttta gcgatatcgg    125880
     caagatacca atgataaact ggctcatcaa aatcaatcag atgaacgctc tcaccatcat    125940
     aaagcacatt cccaggacga tggtccccat gggttaggcc aaaatgtgct gagttgattg    126000
     aaaaagtttt gaagcgtgtc gtgatggttt ggtataaatc ctggatcaga gcctcttctt    126060
     gacgcgcata atcccaagtt tcacgccaca aatcttccca agttaaaaaa tgatgttccg    126120
     atgcaacata actttgcgag gcttgatgca atagacctag ggcgcggccc catgtgagat    126180
     aagctttttt atctggataa tcaaaattca tgatttgccc tggcacctca cggcaaacat    126240
     gaacaaaaaa ttccaaatca tcttggtgta ccgtttcgac atcatttcct tcttgggata    126300
     caaccggttc acaaataggc gtaccacaca aaaataaatg cttctgaaaa tcaatggcac    126360
     tcaaaagttc gtgagctttt cgtatttttt catgcgtcat gcgaaggtaa aagccttggt    126420
     tcttagattc aaatcgataa acacagttaa tttgattatt gataagctta agatgggtag    126480
     gtttttttac ccacttatta gcagcacgat ttgccgtttc atccgtaatt ttttttaatg    126540
     tggtctccca aatcattctt gaatactctt gtttttcaaa taatcagccc tagataatcg    126600
     ataaagcaca tgccgtctca agggactgtt ttgctccaat ttgggatggt caaaatcatc    126660
     ctttgggtta tgttgtaaac caattttttc cataacacgt cttgaagcta gattattcac    126720
     tgctgtaaat gaaactactt tgggaagatt taaagaggta aatgcataat gcaaaaccgc    126780
     ttttgctccc tccgtagcat aaccctgatt ccaatgcatt gaggaaagtc tccagccaat    126840
     ttcaacagca ggggtaaagt gcgcttcaaa agaaggggtc attaacccta aaaatcctat    126900
     catttctcca gtatttttta gttcaacagc atacaaagaa aatcccttct ctttataatg    126960
     tgcaatcatc cgctcaatgc ctgcttttgt agcactcctg ttccctattc ctggtaaaaa    127020
     ttggcatacc tttttatctt gatcaataag tgacatagga tcaagatcag cttctctcca    127080
     agtacgtaaa atcagacggg aagtttcaag aatattcata ggagcctcta taagaaagca    127140
     tgtttatcat gagtaggtaa ttagcgtctt cactgtattg cgtgggaaga aaaccagcct    127200
     tttgatagca cggaatggct tgctcatttc caatttgtgg atcaaccaca acggctttaa    127260
     atttgtagag ttgttcggca ataaaacgcc ttataatttg tctgcccaac cctactccac    127320
     gaaacgatgg ctctgcaata aaaaggtcga taccagccaa ttgttcaggt gttgcctcgt    127380
     caaacaagga agcattatgt cctgaaattc cttcgggtaa atggtcggaa agacagtaat    127440
     attgaataaa accaattggt ttttgattta aataaataat aaaactgggg atagactcaa    127500
     tgccttcaat tcggggtgag tactttgcac taatatcttc caaagaaaac tgttgatttc    127560
     gtgcgtaccc ttgttttacc gtaggctctg caaaccattg ggtcattaag ttcaaatctc    127620
     tttgacccaa tggtttaaat tcaagattct gatttttact cccataaact aaggaagtcc    127680
     aatccaaaat acgacgcgct gactcctctg ctgaaagaca gctaacatct agagtcattt    127740
     catacggctc tttgctaaaa taaacgtctt cttcaaacag tctttttgta atgagtgcct    127800
     catcctgtgt tttaaaatag ccttttcgat ctgaatattt taagcgttta acaagctctg    127860
     caccattaca aatcaatcgg ataggaacaa acatagcttc ccgtttttga gcaacggctt    127920
     gtacttgatt aaaaaactcc tgatgccaag aattattcgc taagagctca taggtaataa    127980
     caaagctcgt ttctttagaa caaacctcag tcatcgtatc aaaaatcaca tctcgggcct    128040
     tgttaagcgc tgcccatcct ttatcatcaa gagaccaaaa tacttgagca tcgttaccta    128100
     gaagttttag aaccggatcg atccaagcat ggtgatgcgc taatcgaaac tgagaagcca    128160
     gtgttgtaat tgcctcgcct atggtttttt taccggtacc tgcaataccc atcaagagta    128220
     tcatcatatt cgtcggcatc atttattaaa atcctgtcac aatactgtac tcttctttat    128280
     gtgtaagcac acgcatcaag tgcgccacat catatggact acgcagctca atgaatttca    128340
     cttttggata ttggttcttt aaagcattta ataaagggtt aatccgttgt tcatagttcc    128400
     acatataact taatagcgac catcgtaccg tttcattgca accagcggct ctatcatcga    128460
     tttctgaagc cttataaaac aagcgcttaa atacccgcca ataacatagc catttgggta    128520
     aattaaagta caagcacata tcggattcac gataacgtat ctcgaatgat ttactggaat    128580
     taccatcaat aatccagcaa ggcttagcaa ctaattcttt ttggagtgac aaaaaattct    128640
     catattctcg tggcacccaa tcggcaataa aaaaatattt atctaaatgg aacaaaggaa    128700
     tatttaaact cttttgcaac ataacagaaa aagtggactt gccacttcct ggtctaccaa    128760
     taatcatgat gcgttgtaag tttatcattt cattcagagt ttaatttaca gttttctttt    128820
     cttatagatg caaatgattg ttgtattcat ccgctacact atctaaaact ttaagtagtc    128880
     tgttcttcac ttaactgttt aagtacggtt tttatcgtag catgggaaaa acctcggcca    128940
     cttaagaaac gagccaattt tgtatttatc gcctcatctg tatcattttt aaatccacgc    129000
     atttttttcc gagcttcatc tagggcgcga acttcttcca gttcaatatg ttctaagatt    129060
     tgctcaatca cctcttcttt aacgcccttt tgttttaata tttgttgaat aaaacggttt    129120
     cctttatgga tataacgggc acttaatgat tcagccaaac gattatcatt aattaaatgt    129180
     aattcccgaa ggcgaactat ggttgcatga atctgagcat ctaactcggg cacatgcgaa    129240
     aaatccctct ctaattgcct tatgagctct ttttcactgc aataatgatt ggaaagatat    129300
     tttattgctg catcgatgag tgtattcata ctaaagttct actataaacc acagttttat    129360
     ttttgctttt gccaagacag cctaatttat ttagaatacc attaaaacag gaaaatattg    129420
     agtcttttat gccaaaagaa ggaaaagcca gggtcttaag tgagacagag tttaagcgcc    129480
     tgcttattgt tgccaaagat gggcaattcg ctataagaaa tagtgccctt gtatattgtt    129540
     cttttggact tggattgcga gtgaaagaaa tcgcctctct cactattgca gatgtagccg    129600
     attacaacta tcaattactc gaagagattt gtttgaagcg ctcaatgacc aaaggtgaaa    129660
     aacaacgtta cgcttatctt gccaatgaaa aaatccgcaa agcactccaa gctcatctcg    129720
     ataccctaaa acatgttgca cgagacaaac ccttatttca gacccaacgt aaaagtcgct    129780
     ttacgcctaa tagtttgcaa aaatggttca agtcactcta tgataaggca ggaatcattg    129840
     gggcaagctc ccattctggt cgacgtactt tcattacccg cttaattgaa caaggcgcgg    129900
     atattaaagc tgtctctcgt cttgcgggtc atgctaacat tgtcaccacc gcaatttatg    129960
     ttgaagacaa ccctgatcgc ctaaagcgca ttgctaattt ggctattttc taaatgacgc    130020
     catggcttac cgttttgcct tagctgattt tctcttttaa tatcgaatcc atctatgttt    130080
     aatgattatt taatatatag agttatcata aacgtgtttt aatagcgctt aatgaaacga    130140
     cgttttttat gtaaccaaaa ccattggttg tagtcaaaac aacgcttaaa actaaaatat    130200
     ggaagttgat ttttttactt aaacgcataa aaattgccct tcggtgatat tttgctaaac    130260
     agcgctccct tatacagaaa tcattcaaac aaagtcactt taataattgc ttttatctct    130320
     ttctcttttc taacaccggc ttaatcctat tttttatttt tagataaatc ttctaataaa    130380
     atttttccct ttttggacaa gcgatatttt tgcaatctac ttttaggctt atctgggata    130440
     gtacgctcga ttaactcatc cctgagcaat tgatcaagat aattacgttg aaaagtttca    130500
     cgatgcctga tcccagcaat ctcttgcagt tctatacttt tcagctctcc ttttaattcg    130560
     catgctctga gtacccgctc aatccatgga tcgacttgtc cggtaacttg tccggtaact    130620
     tgtccggtca tcgatgatga tttacgccaa atggttgtct tgaatccatc ggagatagaa    130680
     aattcaggct caggcagtcc aacctcacgg caactacgaa tcatatcgcc tgtaccagtt    130740
     cccatgcgct caatgtattt cgtcaaatac aagggttcag caagtaaagg gttccttgga    130800
     acagaaccat gtggatgacg taatttttct aaggttaatg atggagggag tcctcctgga    130860
     ttccaaattt ccaatcgatc tgcaaacagc ataacctgca cacttccatt actatcatag    130920
     tcacggtgag caaccgcatt cacaatcgct tctgcgacaa cttcctgagg aatttcatag    130980
     gcaacaggca cttccgcccc gccctctctg gttcccaccc aaagattaat tttggacatt    131040
     acgaaatcaa tcgcctgatc gaccagtgaa aataacgtgc ctttatatac ttgatatgaa    131100
     ggaatgggtt tggctacttc tgtcccgtga aaatgagcac attttacctc ggatgacata    131160
     acaaaccgtt gtggttgttt tccaaagagt aacattgctg catgtgtagg cttatcctcc    131220
     tctagcaaat tcaaatggga cagtaattca aaagaggtcg catcgatagg cagtggaaat    131280
     ccacgtcctc gttttgctcg acgtaaaaaa gccgtcatcc cctcttcatc taaatctaaa    131340
     taatgttgct cctcgacaag gagcagcatc aaaagggcta tttctgatta attttcgttc    131400
     ttctaaatca tgtattaaag ccgcataaac actggaaata agctcggaaa tagattgata    131460
     acgccttctg attaattcag ttccaacacg agtaataaga tttttcattt tagggtgacg    131520
     tttactttct tcatttccct ttataaaaat taatcgggtc ttatgttcct cggaggctag    131580
     attgtattct tcctcagtag gggaaacacc ttttgcattc tcaaagccat aatcatagcc    131640
     aaaaagacca atatagatat cacaagcacg tacttgttct agataaactt gatctgccct    131700
     cctatcatga gcaggcaatt cttcgaataa aaatggatca aaaaaacgac gcattaaggg    131760
     atcatttttc aaccaatggc atatctctag acgatcttct ttaaattctt gttgtacgct    131820
     actgataaaa atacgcaatg gtctcatcat taatccaaaa attaaacacg ctcttctttc    131880
     tcatt                                                                131885
//

If you have problems or comments...

PBIL Back to PBIL home page