(data stored in ACNUC7421 zone)

EMBL: CR628339

ID   CR628339; SV 1; linear; genomic DNA; STD; PRO; 59832 BP.
XX
AC   CR628339;
XX
PR   Project:PRJNA13126;
XX
DT   03-OCT-2004 (Rel. 81, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Legionella pneumophila str. Lens plasmid pLPL, complete sequence
XX
KW   complete genome.
XX
OS   Legionella pneumophila str. Lens
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales;
OC   Legionellaceae; Legionella.
OG   Plasmid pLPL
XX
RN   [1]
RC   (er) Nature Genetics online version available ahead of print (2004)
RX   DOI; 10.1038/ng1447.
RX   PUBMED; 15467720.
RA   Cazalet C., Rusniok C., Bruggemann H., Zidane N., Magnier A., Ma L.,
RA   Tichit M., Jarraud S., Bouchier C., Vandenesch F., Kunst F., Etienne J.,
RA   Glaser P., Buchrieser C.;
RT   "Evidence in the Legionella pneumophila genome for exploitation of host
RT   cell functions and high genome plasticity";
RL   Nat Genet 36(11):1165-1173(2004).
XX
RN   [2]
RA   Cazalet C., Rusniok C., Bruggemann H., Zidane N., Magnier A., Ma L.,
RA   Tichit M., Jarraud S., Bouchier C., Vandenesch F., Kunst F., Etienne J.,
RA   Glaser P., Buchrieser C.;
RT   ;
RL   Submitted (05-AUG-2004) to the INSDC.
RL   Buchrieser C., Institut Pasteur, Genomique des Microorganismes Pathogenes,
RL   25 rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL   cbuch@pasteur.fr Phone: (33-1)-45-68-83-72, Fax: (33-1)-45-68-87-86
XX
DR   MD5; 6828cddf1e1264ccd3ecff94fc34576b.
DR   BioSample; SAMEA3138253.
DR   EnsemblGenomes-Gn; EBG00001064738.
DR   EnsemblGenomes-Gn; EBG00001064739.
DR   EnsemblGenomes-Gn; EBG00001064740.
DR   EnsemblGenomes-Gn; EBG00001064741.
DR   EnsemblGenomes-Gn; EBG00001064742.
DR   EnsemblGenomes-Gn; EBG00001064743.
DR   EnsemblGenomes-Gn; EBG00001064744.
DR   EnsemblGenomes-Gn; EBG00001064745.
DR   EnsemblGenomes-Gn; EBG00001064746.
DR   EnsemblGenomes-Gn; EBG00001064747.
DR   EnsemblGenomes-Gn; EBG00001064748.
DR   EnsemblGenomes-Gn; EBG00001064749.
DR   EnsemblGenomes-Gn; EBG00001064750.
DR   EnsemblGenomes-Gn; EBG00001064751.
DR   EnsemblGenomes-Gn; EBG00001064752.
DR   EnsemblGenomes-Gn; EBG00001064753.
DR   EnsemblGenomes-Gn; EBG00001064754.
DR   EnsemblGenomes-Gn; EBG00001064755.
DR   EnsemblGenomes-Gn; EBG00001064756.
DR   EnsemblGenomes-Gn; EBG00001064757.
DR   EnsemblGenomes-Gn; EBG00001064758.
DR   EnsemblGenomes-Gn; EBG00001064759.
DR   EnsemblGenomes-Gn; EBG00001064760.
DR   EnsemblGenomes-Gn; EBG00001064761.
DR   EnsemblGenomes-Gn; EBG00001064762.
DR   EnsemblGenomes-Gn; EBG00001064763.
DR   EnsemblGenomes-Gn; EBG00001064764.
DR   EnsemblGenomes-Gn; EBG00001064765.
DR   EnsemblGenomes-Gn; EBG00001064766.
DR   EnsemblGenomes-Gn; EBG00001064767.
DR   EnsemblGenomes-Gn; EBG00001064768.
DR   EnsemblGenomes-Gn; EBG00001064769.
DR   EnsemblGenomes-Gn; EBG00001064770.
DR   EnsemblGenomes-Gn; EBG00001064771.
DR   EnsemblGenomes-Gn; EBG00001064772.
DR   EnsemblGenomes-Gn; EBG00001064773.
DR   EnsemblGenomes-Gn; EBG00001064774.
DR   EnsemblGenomes-Gn; EBG00001064775.
DR   EnsemblGenomes-Gn; EBG00001064776.
DR   EnsemblGenomes-Gn; EBG00001064777.
DR   EnsemblGenomes-Gn; EBG00001064778.
DR   EnsemblGenomes-Gn; EBG00001064779.
DR   EnsemblGenomes-Gn; EBG00001064780.
DR   EnsemblGenomes-Gn; EBG00001064781.
DR   EnsemblGenomes-Gn; EBG00001064782.
DR   EnsemblGenomes-Gn; EBG00001064783.
DR   EnsemblGenomes-Gn; EBG00001064784.
DR   EnsemblGenomes-Gn; EBG00001064785.
DR   EnsemblGenomes-Gn; EBG00001064786.
DR   EnsemblGenomes-Gn; EBG00001064787.
DR   EnsemblGenomes-Gn; EBG00001064788.
DR   EnsemblGenomes-Gn; EBG00001064789.
DR   EnsemblGenomes-Gn; EBG00001064790.
DR   EnsemblGenomes-Gn; EBG00001064791.
DR   EnsemblGenomes-Gn; plpl0019.
DR   EnsemblGenomes-Tr; EBT00001667766.
DR   EnsemblGenomes-Tr; EBT00001667767.
DR   EnsemblGenomes-Tr; EBT00001667768.
DR   EnsemblGenomes-Tr; EBT00001667769.
DR   EnsemblGenomes-Tr; EBT00001667770.
DR   EnsemblGenomes-Tr; EBT00001667771.
DR   EnsemblGenomes-Tr; EBT00001667772.
DR   EnsemblGenomes-Tr; EBT00001667773.
DR   EnsemblGenomes-Tr; EBT00001667774.
DR   EnsemblGenomes-Tr; EBT00001667775.
DR   EnsemblGenomes-Tr; EBT00001667776.
DR   EnsemblGenomes-Tr; EBT00001667777.
DR   EnsemblGenomes-Tr; EBT00001667778.
DR   EnsemblGenomes-Tr; EBT00001667779.
DR   EnsemblGenomes-Tr; EBT00001667780.
DR   EnsemblGenomes-Tr; EBT00001667781.
DR   EnsemblGenomes-Tr; EBT00001667782.
DR   EnsemblGenomes-Tr; EBT00001667783.
DR   EnsemblGenomes-Tr; EBT00001667784.
DR   EnsemblGenomes-Tr; EBT00001667785.
DR   EnsemblGenomes-Tr; EBT00001667786.
DR   EnsemblGenomes-Tr; EBT00001667787.
DR   EnsemblGenomes-Tr; EBT00001667788.
DR   EnsemblGenomes-Tr; EBT00001667789.
DR   EnsemblGenomes-Tr; EBT00001667790.
DR   EnsemblGenomes-Tr; EBT00001667791.
DR   EnsemblGenomes-Tr; EBT00001667792.
DR   EnsemblGenomes-Tr; EBT00001667793.
DR   EnsemblGenomes-Tr; EBT00001667794.
DR   EnsemblGenomes-Tr; EBT00001667795.
DR   EnsemblGenomes-Tr; EBT00001667796.
DR   EnsemblGenomes-Tr; EBT00001667797.
DR   EnsemblGenomes-Tr; EBT00001667798.
DR   EnsemblGenomes-Tr; EBT00001667799.
DR   EnsemblGenomes-Tr; EBT00001667800.
DR   EnsemblGenomes-Tr; EBT00001667801.
DR   EnsemblGenomes-Tr; EBT00001667802.
DR   EnsemblGenomes-Tr; EBT00001667803.
DR   EnsemblGenomes-Tr; EBT00001667804.
DR   EnsemblGenomes-Tr; EBT00001667805.
DR   EnsemblGenomes-Tr; EBT00001667806.
DR   EnsemblGenomes-Tr; EBT00001667807.
DR   EnsemblGenomes-Tr; EBT00001667808.
DR   EnsemblGenomes-Tr; EBT00001667809.
DR   EnsemblGenomes-Tr; EBT00001667810.
DR   EnsemblGenomes-Tr; EBT00001667811.
DR   EnsemblGenomes-Tr; EBT00001667812.
DR   EnsemblGenomes-Tr; EBT00001667813.
DR   EnsemblGenomes-Tr; EBT00001667814.
DR   EnsemblGenomes-Tr; EBT00001667815.
DR   EnsemblGenomes-Tr; EBT00001667816.
DR   EnsemblGenomes-Tr; EBT00001667817.
DR   EnsemblGenomes-Tr; EBT00001667818.
DR   EnsemblGenomes-Tr; EBT00001667819.
DR   EnsemblGenomes-Tr; plpl0019.
DR   RFAM; RF01317; CRISPR-DR4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..59832
FT                   /organism="Legionella pneumophila str. Lens"
FT                   /plasmid="pLPL"
FT                   /strain="Lens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:297245"
FT   CDS_pept        275..1336
FT                   /transl_table=11
FT                   /locus_tag="plpl0001"
FT                   /product="hypothetical protein"
FT                   /note="Similar to chromosome partitioning protein parA"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17320"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WS06"
FT                   /protein_id="CAH17320.1"
FT                   /translation="MIKIIQNINHIMRFNMDIQNNVTQNHQPKRAISDVADFLGISMQA
FT                   VHKQLKNKNINCEKIGNKSFLTFESARELFNFKFKRKKIAVQIVKGGTGKTTTINNIAS
FT                   CANTYGARVLLIDADPQGNLTDANGIDAEEYPVLIDLLKDGASIQESIVTVSQGLDLIP
FT                   SRIENVILDNEIVNGRYPLEKLYNNLLSKVENYYDFILIDCPPTMGQAVTAASLYADII
FT                   LAPLNPDKFSAKGLKILKQEVDTLNKHFHKKIEYKVFLNKFSSKTILSDKAIVSLISDP
FT                   ELEGKVLSTTVQYAQEIPNITDDNKSSFSNLKKSLVRDDFDRLTRELLEINAETFAKDE
FT                   RALSKNLKEESLA"
FT   CDS_pept        1350..2747
FT                   /transl_table=11
FT                   /locus_tag="plpl0002"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with eukaryotic proteins"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17321"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WS05"
FT                   /protein_id="CAH17321.1"
FT                   /translation="MPDLEELLQSRSKKKFMKKSYRPWDLSGGPTSLTEKNEFGTTTLE
FT                   NLVHQKDSVVKNNLSVVAQCISQENTHSTLDNDKDIGKITNKYQSGTDSENHGISNEYQ
FT                   MDNSTDTIKETTRNHLDNNLDNKETSNNQSILEKFIKETSEITNNFNENLEYDHNEIDL
FT                   ISPSKIEQEIIRLSGKQKLIFDMVIEICSARKCFETGPVQTLTLATLAQTTTGTAKTTI
FT                   KRLIDKGLIFRHQGKNAKGGYINLGINQVIWEHVKNIKNNNKTSIFTSEAILNNRYQKD
FT                   INPDDINSSIYNINTTTLSKRHEQIPPEWEKINFEPLSHIGFSKTQIKQLIGKNDPTIV
FT                   QESIYHFAFGLEYNQKTKKYDDPLNVLMGVLRKGQAWIEGDYRSAIEIAQEKLLESKKA
FT                   EIERKKSLEEKAFKLAFHEWESEITESELQKLTERKNGDLTPPKAKLTMYFRENIWPSK
FT                   KGEYLLF"
FT   CDS_pept        3036..4490
FT                   /transl_table=11
FT                   /locus_tag="plpl0003"
FT                   /product="hypothetical protein"
FT                   /note="similar to major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17322"
FT                   /db_xref="GOA:Q5WS04"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR006605"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WS04"
FT                   /protein_id="CAH17322.1"
FT                   /translation="MDSVKMNRKGVVYLHWLNGISTFSFAILFSSLSLYLTKNIGLSQV
FT                   QSNGVVGFFLASNFILHFIAGYLGDKWLSNRLLFATSTIVQSIGLIVLNFSESFVYLGL
FT                   SLFVIGCGLGSTCINCLITQQFNSQEDELREKAFFHNYGAMNIGFLSGYILSGYIDIND
FT                   KYEHLFEMSNLINLITVFFIIKSWKHFAKKTVAIRKEIGDGKLGLLLILLIIPILFAGF
FT                   YYYWLANGLILSIGAAALFYITLLAHGFKNNNERKKIYSFIFLTVSSIVFWMLYFVGPM
FT                   GVTQFLKYNVNIYVGTYYIPPQWLMNLNSLFVIIGSPLMISLLERLRKKHIIISIPKQF
FT                   ICSLVFIALSFSVLALGILKSSPDGLTSVNWIVAHYFFQAVGELLIAPVGYAMIGHLAP
FT                   EKLQGLMMGIWMMASGVSVTLSNYFSNLMTQSESLNPFISNEHYMSVFNQLGLYAVLGA
FT                   LILWLFSKTIENSIQKTSNRTIEGIA"
FT   CDS_pept        complement(4492..5514)
FT                   /transl_table=11
FT                   /locus_tag="plpl0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17323"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WS03"
FT                   /protein_id="CAH17323.1"
FT                   /translation="MNNSIYYHRFNKLLSLTNCPKEALLLDKIIFHYQGTLLKRENKLW
FT                   FTKKIPDLAAELGFSESRIYIYLKNLEEEGLIIRKRFKYYGVPRSFIAITETLQSKLQF
FT                   LSKEKENTIEIKEKKPTSRNDINERMDYLVSADTNNKEKNRVINNITLNQLDDKLPINE
FT                   LNIVKGMLLNVQKSHGVKLSSPQKVLDEIVFSLSNKEQFQNIDTFQHKINIISQLLRNN
FT                   RWRTPKGFNKYSPEAKRYQEQCDQENTARLKIKKDECTYSGLNEISTNKRLHNVYDLNR
FT                   RACSNINLQNSLQLQQSLVNGIKKDIKTIKNPTILENFLKILAQEEIQLSKIQGELSLQ
FT                   "
FT   CDS_pept        5913..7175
FT                   /transl_table=11
FT                   /locus_tag="plpl0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17324"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WS02"
FT                   /protein_id="CAH17324.1"
FT                   /translation="MSELSWDRVKTDIARVNKRLYEILETIDGIQNMLFTVLEYQYGQI
FT                   IADEDYFYLPNTCGKLSSVPFSMVLEKNLEMFIEFKGKSSTHQVYKEGDFLSVSSLYNA
FT                   SNTHHPTDILQISSGARNTFLLCPVADARPHASLEKYFKADIPVPDELGNHYLTFKSLC
FT                   EAANCKWRSKLLVFPSEIVTLIKENKLPTLLSLVMEFDSNQTGYYANLPFYNYLMAYVR
FT                   ANNPEISQNEFTNNAISQLITIGTGQVPGYGLAVGDDLLPLDFIVETYRDIYKSKYTPF
FT                   VMEPVHFDKNKNNPVFYSILKEEMAFKPTSFSNKPQRCELIYDTYFQYADHIKKLGHLK
FT                   NTPFFESATMLDLTLFHEKNNQVTNNLFKLPRETIFSYDPRFLEVTNKLGYSVDQFPSK
FT                   TTFLVGCFGIKYNENNDTVMH"
FT   CDS_pept        7147..8310
FT                   /transl_table=11
FT                   /locus_tag="plpl0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17325"
FT                   /db_xref="GOA:Q5WS01"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WS01"
FT                   /protein_id="CAH17325.1"
FT                   /translation="MRITTLLCIDPLQDYELIDCEMLLQLGITPFFLIKDASKAVKDRE
FT                   NVLVNSFSYEDILAICDSIRPKYIVCFSEDMFVDIAKIREHLKIAGMSSNTAMLLSHKD
FT                   LMYQKLDGSFPFPKTTTLIESPNLKSIQEKIGVQEIFVKPINSSGSYETYHIKTEREFS
FT                   NFLANKKEDEENYIAQAYVADDLYHSELVVFDGNILFVEARKYTHPNHLMVSKNFPIFS
FT                   LNILEAPQRQSIIDASVKVSQLLGFHNGVLHTEFFMNEDGYIQFIETNARPPGIGLNKL
FT                   YQRKYSISLETILCCIVCGVEPPSMVENKSHFVCGYFPTKMGVIKKINKPELHVQNEWT
FT                   FFVKPDDTSEQMAHMSKSAMVLCWDDSVTEINKTGNFLAEQDIVEVY"
FT   CDS_pept        8458..8709
FT                   /transl_table=11
FT                   /locus_tag="plpl0007"
FT                   /product="hypothetical protein"
FT                   /note="similar to molybdopterin converting factor 2
FT                   (subunit 1)"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17326"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WS00"
FT                   /protein_id="CAH17326.1"
FT                   /translation="MHEYQLIEFSSSKKEIQLVSNQSNLQQVLLEFYKEKFEKMFDEDG
FT                   CSKGYISVFVNSKQITSVKEIALNPNDEICIVTSISGG"
FT   CDS_pept        8714..9736
FT                   /transl_table=11
FT                   /locus_tag="plpl0008"
FT                   /product="hypothetical protein"
FT                   /note="similar to thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17327"
FT                   /db_xref="GOA:Q5WRZ9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ9"
FT                   /protein_id="CAH17327.1"
FT                   /translation="MERYKRQIAVIGEQSQKILSNARIMIVGLGGIGCPVAQYLAAAGV
FT                   GKLILVDNDKVDLSNLHRQILFNEADVGDYKAEKAKVALSQVNCNIVLEAYTNKFDVDF
FT                   GYSSVSDVDLIIDGTDNFETRYLINDICVLQEKVFISCSIFVNVIQLVLFDTKHCCYRC
FT                   LYPNPPPTGAIPNCSEAGVLGTVTGIAGTMAANLALNYLLKVEDGEAPQVRIVDAKNFS
FT                   ISSLTIKQNNECIACKQKKINFDYLQTSSADYGISIEDLDRNKHFLVDIRQKEEREIIK
FT                   LDDDLFFPIKDNNNYAFFLSYKDKKLVFYCASGYRSKLFASELRTLGVDAYYLKTSLSK
FT                   "
FT   CDS_pept        9733..10794
FT                   /transl_table=11
FT                   /locus_tag="plpl0009"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17328"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ8"
FT                   /protein_id="CAH17328.1"
FT                   /translation="MIIRHAETSFRARHFSETLNLLNQFKKLAGITRLADLTHLDYTSL
FT                   PVYTAIRPRAKSLTTSQGKGLTKEAAKCSALMESIEVYFAEEIIPQVTNKSELELTQSN
FT                   NLFIPINQLANSVRFTNPSQPINWVYADLVFSGKTILVPFAEYSLNSYLPEVLIYSPDT
FT                   TGLAGGNNYKEALLHGILEVIERQDAQQITEIAFVNSNLVENLSIRFDCFITYQENYYR
FT                   VPSFEVLLKSKNPFENQILFKGSGSHLNKKIALNRALTEAIQSRVTTIAGSRDDLINTK
FT                   YDSKASEFPVVMNKKNFDEVQDYSVGTIEDALSVLYEKIKENNQDILVYTYYDKEICIV
FT                   KVKLISMDLISHV"
FT   CDS_pept        10787..11821
FT                   /transl_table=11
FT                   /locus_tag="plpl0010"
FT                   /product="hypothetical protein"
FT                   /note="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17329"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ7"
FT                   /protein_id="CAH17329.1"
FT                   /translation="MYETVVFLETSLSHQEAMHLLPDAKYLPSIKKGDVLKSINDGYKR
FT                   IVIIDGNFSCVPSVWHKEILTALDYGLEVFGAASMGALRAAELDAFGMKGYGRIYEMYK
FT                   NEEIDGDDEVAIAYSKYNNEQTIPLINIRLTLERINITNKETILDSIRSIFYAERTWGR
FT                   IAQQVSEELYHLIKSNYADVKKEDAKSLLFYLNHQQILPMTLALGKKKRNFTLFEKKLI
FT                   EATLSPVWLNSHELEQIGEVAHLQRAENIVKLLSIPKTKANMLHYQSIIAMLDKQEYEI
FT                   TECELIYQVELFREERNLLKGDEFVNWLKDRGLYDSNLEQLFYDYVKLSKYFAITYDYN
FT                   SYFN"
FT   CDS_pept        11934..12119
FT                   /transl_table=11
FT                   /locus_tag="plpl0011"
FT                   /product="hypothetical protein"
FT                   /note="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ6"
FT                   /protein_id="CAH17330.1"
FT                   /translation="MNAEQEVFDILEGCILCLQKAATEIGGFDFDKHAQAAVFAYSLLK
FT                   RQQLFLIYPFENETVH"
FT   CDS_pept        12176..12334
FT                   /transl_table=11
FT                   /locus_tag="plpl0012"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17331"
FT                   /db_xref="GOA:Q5WRZ5"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ5"
FT                   /protein_id="CAH17331.1"
FT                   /translation="MLILERRVGETVAIENKVFCMVLDHQLDGQLKLAFDAPECVPFHR
FT                   FEIQEGS"
FT   CDS_pept        12468..13214
FT                   /transl_table=11
FT                   /locus_tag="plpl0013"
FT                   /product="hypothetical protein"
FT                   /note="Similar to E.coli TraT complement resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17332"
FT                   /db_xref="GOA:Q5WRZ4"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ4"
FT                   /protein_id="CAH17332.1"
FT                   /translation="MIETMKSGLTKTLLASVVIVLTGCAATHTAIEHGSLQVSTKQSET
FT                   IFLDPVPNTQKTVYVSVKNTSDEDVDIAPQLKTVLSAHGYKVVNSPSSAHYLLQANVLK
FT                   VGKMSVAASQSALGGGYGSAIAGAAAGSAAGSLTQSSTGMIVGGLAGGVIGMATDSLVK
FT                   DVNYTMITDVQISERVGKGIKINEQFQSHLKNGSSTVTSQTSSRDSQYQRYRTRVVSNA
FT                   DKVNLKFQEARPSLEQGLVKVISGIF"
FT   CDS_pept        13334..13621
FT                   /transl_table=11
FT                   /locus_tag="plpl0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17333"
FT                   /db_xref="GOA:Q5WRZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ3"
FT                   /protein_id="CAH17333.1"
FT                   /translation="MKMGKKIVSLMQKAGSAFMFAMLSKSVFANDLLARALEGDVKDSL
FT                   GSGSMFWKIFILVDIILATAMAVKSKNPMVFIGVTAVAFIPAFLLKTFVF"
FT   CDS_pept        13634..13930
FT                   /transl_table=11
FT                   /locus_tag="plpl0015"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative conjugative transfer protein
FT                   TraL"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17334"
FT                   /db_xref="GOA:Q5WRZ2"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ2"
FT                   /protein_id="CAH17334.1"
FT                   /translation="MSNMNYQFLNHIDAPKRVLTLTMDELVVTALSFILLILSNQKVLV
FT                   SMLGLGLLSGLRHLKKGEGPKVLLVLAYWYLPSYITQFFLPKLPLSHHRVYVA"
FT   CDS_pept        13940..14509
FT                   /transl_table=11
FT                   /locus_tag="plpl0016"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative conjugative transfer protein
FT                   TraE"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17335"
FT                   /db_xref="GOA:Q5WRZ1"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ1"
FT                   /protein_id="CAH17335.1"
FT                   /translation="MDFKSYQSRLSQLSARFNLMVVLVFGLLISNVLLSCFLFKAWNQH
FT                   TIEVTPFSGAPSYLKSASSVDGHYLSLMAENFVNERLSVTPETVDASHQRLLSYVGHQN
FT                   YNQMLRLLTNEAKVIKDKKMSSIFYIDKNKANPHELTVVVSGILKRFVGLQALNDERKT
FT                   YVLQFQYKDSRLSIVQFAPLKEKQDA"
FT   CDS_pept        14502..15218
FT                   /transl_table=11
FT                   /locus_tag="plpl0017"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative conjugative transfer protein
FT                   TraK"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17336"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRZ0"
FT                   /protein_id="CAH17336.1"
FT                   /translation="MHKPFSIALALLSTVAMGANSIPVKDNSDIALTLSQGNYNRLVVK
FT                   NDKIMEAVFPPNAMAIKRDEQDGSVYVMLAAANPFTLFLTTESGRHFSVTVNGEESLGK
FT                   TIELVPVLPVVAASKTHAPITNPKKITQEAVPEAIIAMLTHMEQQKPFADVKVRRQFGR
FT                   AEHWSKGLTLLPKESWDSKLLKGETIELYNGGKEPLELAQDWFAKEGTLAIKFSKPSIK
FT                   PGERAMLYRVEASHHG"
FT   CDS_pept        15211..16584
FT                   /transl_table=11
FT                   /locus_tag="plpl0018"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative conjugative transfer protein
FT                   TraB"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17337"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY9"
FT                   /protein_id="CAH17337.1"
FT                   /translation="MANWQWNKMVKGRQVRTLIVVGCGLFFLFAMMIVLLADDRPKKNL
FT                   EAKKSVNLTGIIEESFTDAVADNALTAQQTELESLKKQVSELTLNIKSMAEAHQKELQA
FT                   QKEELTSQVQELVLANQEKQSNSEQQDNPSELKEVQNPQLWHNPNVYSMNNTMNRGTVL
FT                   SDAIPRIHTVSFRPKRHITKKHHNFYLNPAHYVPSNTSVRAVILGGADADASVNGQSKN
FT                   NGVMLFKFLEDGTLPNGQRSRLRGCRVSANSYGDISSERAFATLYRLSCAHPGEPIIDK
FT                   EVTGWVFFNGKVGIKGKPLMRDNKVMTWAGVSGALSGIASAAQYAQSVQAIGPYGATSV
FT                   VPSSQIAPFAAYGGASKAADTLSQYYVKRAEQYHPVIQVGSGNVVTIVFKDGFYLEPDE
FT                   DKSQHAMQRYKAQEETQELISRGEEEKNSEMNFTVPPEVLGKINRVNTLSRNETGGLQ"
FT   CDS_pept        16566..16871
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="plpl0019"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conjugative transfer protein TraV"
FT   CDS_pept        16862..19459
FT                   /transl_table=11
FT                   /locus_tag="plpl0020"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to conjugative transfer protein TraC"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17339"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY8"
FT                   /protein_id="CAH17339.1"
FT                   /translation="MGVNFSLWRDKARDLLHRTSHLLGETSGVKPDSLCSYDKAYESCT
FT                   LDLPSIKSLLPYETVNEAGFFVNRNSMGFGLLLMPMSGADESLMNSLSQLFKNKLTVGT
FT                   DCTVLLYKHPWIGEQLAQNYEPILKQGGIYAELARETLKYHLNAIKKGYKNGRNVPAGL
FT                   SDYCGYLFVSRPMQSDVEGQLQLLLADFESELKVAGFGIRRCGEDEFKVLMRALISPDF
FT                   NELSWPIINESDGFIAEAIPCPSTVIEIGDEAIEVSITDSQAQTVRTRLVNCEVSHYPA
FT                   KPFALWQTPDLFANLLDTEQGIQCPFLISFTIRGMNQEKMKAKARARAKSLNANNNPVQ
FT                   SFINPSIREEAAEWQFVHDHASKGELHLLPTFYNVILYTTGDHEREHVAKAIASFRQMG
FT                   FTLTQSRCKQWLRFLGSLPFICTSGLFSSLELLGMTKKLSHANVANLLPVIADFKGARQ
FT                   GLIVPTYRHQLFYLNTFDDRVLPITNFNRLTVASTGAGKSFFEQAQILDGLSRGQQIFV
FT                   IDLGGSYKHLCEMVGGSYIDASTLTLNPFTLFDFDGVTEIKGEQVNDYIQIRDLLAIMA
FT                   SPSEALGEVQKAWLLDAVTECWKARGRHAKMDDVLTSLQRMLEKPQSQGDQRLKDLLIL
FT                   MSKYGSQGIYGHLFNSDTPLLNGSNLVVLEMGELESNPELLTIVMFVMIVIIQGQFYHS
FT                   DRRREKRCIIDEAWRFLARGSNPVCASFIEQGFRTARKHMGGFAVITQNLLDTMNTIQG
FT                   RAIAASSDTKIIMRQGSFKQYLEEHPKHFSPLEARVIESFGEAKTQGFSNLMIQFGNVT
FT                   TFHRYFCDPFSRVLFSTSGDEVSLIESLTKQGVSLSEAIKRVANKYYGEELCD"
FT   CDS_pept        19450..19785
FT                   /transl_table=11
FT                   /locus_tag="plpl0021"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to TrbI protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17340"
FT                   /db_xref="InterPro:IPR014115"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY7"
FT                   /protein_id="CAH17340.1"
FT                   /translation="MRLTPLFLGCALAVFGVVLGFYGVSPQKSIVIFDKKEVLSQFIRQ
FT                   LAEAKATESQVEQSTRRFNALLNKVLVDTAQQKKVIILRASDVLAGGVDITDEMRIKMS
FT                   HAMRNKL"
FT   CDS_pept        19782..20417
FT                   /transl_table=11
FT                   /locus_tag="plpl0022"
FT                   /product="hypothetical protein"
FT                   /note="similar to conjugative transfer protein TraW"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17341"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="InterPro:IPR025864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY6"
FT                   /protein_id="CAH17341.1"
FT                   /translation="MNIIFYLFLLMISMGQVHAKSFGVVGEVFPIAEKSFLRLIEERLA
FT                   SLKASGELKSLNQRWIQTAAEHANRPPALNIVRTHHSIKHEYVPEITLSQDITNEKGQI
FT                   LYSKGTHVNALQHMPSYTPCWLFFNADDDAQLNWADHQKTQCANPKLILTGGAVNKAEK
FT                   RLDSVIYFDQAGKITSKLHIGHVPAKVIRHQNSLVIHEQAIKENGDVL"
FT   CDS_pept        20407..21390
FT                   /transl_table=11
FT                   /locus_tag="plpl0023"
FT                   /product="hypothetical protein"
FT                   /note="similar to conjugative transfer protein TraU"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17342"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY5"
FT                   /protein_id="CAH17342.1"
FT                   /translation="MYFRVLLLTVLYLVSYQSSAKLCTGHFVNPITDVCWRCLFPLSIG
FT                   NAKVVNSSLPDTENASSPIGVCPASTGVRLGLNIGFWEPMALTDVTDTPYCLVNLGGTQ
FT                   LNLGLKQGRGGRHVVGNGQQRAFFHVHWYKYPLINWLNLITSSGCLQKGDFDIAYLTEL
FT                   DPTWSDSEMSFVLSPESVLFGNPVAASACAADALSSTIASKPLDSLFWCAGSQGTHYPM
FT                   TGHVNASVSPVQTAWLLTERMNYKMHREFLVSDSSPKSDAICKEHYYTVTPKSRYRYEL
FT                   VNQVADGKRCYPGGSSTLAWEAGKIKPHTPDQYGFLVWRKRNCTFL"
FT   CDS_pept        21347..21826
FT                   /transl_table=11
FT                   /locus_tag="plpl0024"
FT                   /product="hypothetical protein"
FT                   /note="similar to conjugative transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17343"
FT                   /db_xref="GOA:Q5WRY4"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY4"
FT                   /protein_id="CAH17343.1"
FT                   /translation="MGFWCGENETVRFFKQEFVMLRKGILVLIGSVIMTSSFAAQISVL
FT                   VSFSIPETLLQETLKESAQLNIPAYLNGLYRDSMSETALKVMALSKHIPNLNLAIDPTL
FT                   FERFGIQQVPAVIVDDGQTFDVIYGHLSIQEGLARMAGRGDVDFTPRDIRRVIGE"
FT   CDS_pept        21819..23510
FT                   /transl_table=11
FT                   /locus_tag="plpl0025"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative conjugative transfer protein
FT                   TraN"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17344"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY3"
FT                   /protein_id="CAH17344.1"
FT                   /translation="MSKVGLIFFCILSFSSFSQNQVDALHARDEALQNLKGFNPATALK
FT                   GYTINPQETSLQPQEGSNPFASLGLNALKNNSTAHEVYNKALNRSRVRANPNTPEMQYA
FT                   ETILGDPDGVLEGTCYKEASHCKIESTVKSCEESLQYSMVSCKEMTLSVTVKSLSMSFS
FT                   RTVVPQRYKSVTTFDLTACSPADRQCSPANTVILTQPCEEISVHVTHHGQPLRVTKQPT
FT                   CTDTTVTVQLSGNGRLSVPLQVTVTEYVSDDQWQTQVCEPIQSENLNGYCFLEESQACL
FT                   EPNQVKVIGGVAIKRPCWGRALQYQCGSVQSTTCTEYINQGCSQTASTCVKSKANRCER
FT                   YSQTFQCMQQFCMPEKTACPGKMYCIDGQCDTSRDETSDDMAEGISRLGLLAGVAGDVT
FT                   ANQVRSGTPAIFNGSAQECKKYPLGFRDCCTDSGWGDWVKHCPEALQVLQRAKHENRVV
FT                   YLGSYKNHKLGARHYTFCIFPTKLASIVQIQGRGGQLGIPYGTAQYPDCRGLTPEELER
FT                   INFASLDLSPIQEELVARMVLPKNDSLKQTNQSHIERLKQQGRAHD"
FT   CDS_pept        23503..24243
FT                   /transl_table=11
FT                   /locus_tag="plpl0026"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conjugative transfer protein TraF"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17345"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY2"
FT                   /protein_id="CAH17345.1"
FT                   /translation="MINRMLIVFLLLSGVAFADKPVGFLWYTKERETKRVEKKTSGIPF
FT                   KSLSYTERDAVLRFYTMEALHKARYTKKMEDMRVFLSLQDYWLKESSRFKSLFQKTMLA
FT                   HPEYDYAVTHPTSNLGAKITDEVRESQTIEVINRLSKSHGLLFFYRGKSPYDLKQIPII
FT                   VDFCKRFRIQLIPVSVDGATSPELLNSRMDQGQANRLGVRYFPALLLVNPASQQVSPVA
FT                   YGLTTQDVLMERIKQVVNQFKGEE"
FT   regulatory      24231..24236
FT                   /locus_tag="plpl0027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24243..24749
FT                   /transl_table=11
FT                   /locus_tag="plpl0027"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to putative conjugative transfer
FT                   protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17346"
FT                   /db_xref="InterPro:IPR014109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY1"
FT                   /protein_id="CAH17346.1"
FT                   /translation="MFARVFLIVMLAFIGLGAKAEGSQWLTNLIAEQEGLVTHQREEPQ
FT                   NTKRKGFFSTHGLILFYGSQCPHCKRFAPILKGWANRNKAEVLPLSLDNQPLPEFPKFL
FT                   PATTEWINAAFGGNSINYPALFVVNPKTKTLYPVGFGSMTNAELNDRMAVLISKIKAYE
FT                   IKGRL"
FT   CDS_pept        24749..26113
FT                   /transl_table=11
FT                   /locus_tag="plpl0028"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conjugative transfer protein TraH"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17347"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRY0"
FT                   /protein_id="CAH17347.1"
FT                   /translation="MKKAVITLFLWAFFPVVQANVSQDLDNFFNGMGYASNVTSPDAFE
FT                   SQAAGFFGGGSLYARNQVRQYQLVQLDLPSYRAGCGGIDLYTGSMSFLSEQKLVDLGKS
FT                   VMTNAGAYAVDVMLASTVPELKQVRDYLQQLEQMANQASINSCQLSQNMVGGIWPKTAE
FT                   SQQKICKDQAAMGKEGLFSDYVKARMVCAGTGFDNVMSKASQDPERKKQVVLNKNLVWS
FT                   LLQAKSFLNSDRELAEMVMSLTGTLIIDKEGKVTNVPSLAGNADLVNALIGTGNGPRSA
FT                   KIWRCKDAGSNSQCMQVSLQDITIQETSTLTYKVREIIRTINTKLINDEKPGNRELNFL
FT                   SMTSLPVMKFLSVLNSMHYGSSAVDIEEYSMLIAQDLLTNYLIELLREVSVATAGSELN
FT                   TDLVKEIQKRINEATTHVESLDPKVGRKLQEKLNLIERMAQIEKQVSSQMNSTAG"
FT   regulatory      26113..26118
FT                   /locus_tag="plpl0029"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26125..28932
FT                   /transl_table=11
FT                   /locus_tag="plpl0029"
FT                   /product="hypothetical protein"
FT                   /note="Similar to sex pilus assembly and mating pair
FT                   protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17348"
FT                   /db_xref="GOA:Q5WRX9"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX9"
FT                   /protein_id="CAH17348.1"
FT                   /translation="MITIHVLAGGELFQHVLNAISAFMKQDSFLGLLRITALIGIVMAT
FT                   IGFIKTRDPMAFARWFLGYVLFVNLVILPKTSVMIDDISSQTPKLVDNVPVVFALSSSL
FT                   VTTIGYGLAQSYDALLTMPNDLQYTKTGALFGSRLVSASTSFRIKDPVLKEEMNEYFRI
FT                   CVVGDIRLNRKYSVSDLAHSTDIWNLITVKASPLRMLSVNGKLVSCLEASKPDGQYSLR
FT                   KKLDAEIKKAYTFFGVNLFGKPKNTTYEALFATHLKSAFEYYQGLTDSSSNIFLQSMMI
FT                   NAIGDGVAHYQAFTDATAGIVNQQFTKSQVQHRWSWEVLGQKALWILPITHTCLTLILF
FT                   GVFPLIIALTTLPGGIRILYGYMQFFMSLQFWPVLFAILNAGMTIYGASSSGEYGQFTM
FT                   VNLDKIDELHADISGACGYLMMLIPFLSHGLVSNLGGAFSNLATSMMSHMQGSSMSVAA
FT                   EAASASFGLGQTSFYNTTANNFSANKHDSNWTHLHGMRTSQLGSGVLKTITGSGDRVFD
FT                   VSPGMTRSAVSINALEGLSASLNQAYEQSTQAARNESAHYQNSLSNFAHRALQLSQLAG
FT                   HDMRLGDSISESETGQYSKALSTISHIAEDVARRLGVSKEDALTHLTSGGLSAQVGFKS
FT                   QGSIWGKLAQWGTGFHASADAHLKFDRNSTSQDKYHTGMDGSLSSRESRDFNDAISYVK
FT                   QFSQNHHFDDSHSQAASLSNQLGADLREAETASRNVDASLAKATRIQNAKNFVESHSSQ
FT                   ITTDLNQAFQAYVAARLNESERDELYSHPGDLRALNKLQALGHDFIASKRDELIAQFGN
FT                   TEHKSQIESFYQKEKSGFIAKENQLGSHYQKNSEEFLHQAQSMKVGINDKELGVFHQEV
FT                   HQQKSTLPQNLKQGEQLIKSGSRDLMNEKDLRLQEGMMNAQKNVVVPENMHLPFEDKKL
FT                   HKKGE"
FT   CDS_pept        28934..29521
FT                   /transl_table=11
FT                   /locus_tag="plpl0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17349"
FT                   /db_xref="GOA:Q5WRX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX8"
FT                   /protein_id="CAH17349.1"
FT                   /translation="MDPKQLKQAIAEDMKTIKMLNPEIIPARFYYGGLLKGVFNGVWRM
FT                   SIILFLTLCYVMSDDKEPISFSSLFIDSGITALFLSIVAMLILLTPISFFVQFQFHLEK
FT                   KLKTSALIRKKCNHISMVFFGMFAFLCILFGSYASGQQIFFMLVVSFFLSLGATHIAVH
FT                   MELSRIGFSSLFTLCNEFFSKGKTVSIEEAQK"
FT   CDS_pept        29613..31448
FT                   /transl_table=11
FT                   /locus_tag="plpl0031"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conjugative transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17350"
FT                   /db_xref="GOA:Q5WRX7"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX7"
FT                   /protein_id="CAH17350.1"
FT                   /translation="MREEPNFKHYTRGGQISFHNLRMWDQITKTLVWVCLFLWVVLTGL
FT                   ITWLVISPEKFHQAIAYYYASFLNLVGQKHTFTLPFHGKNYQQNVETILHYPYYKENAD
FT                   HMVDLLGKSSLAAFVFSFVLGLCFAFYFIHRGKAQRANQFIRGSRIDTKENVIQQILDK
FT                   KENSDITIDGFPLKANSEVQHLLVHGTVGTGKSQLIMKIMDALRKRGDRVIVYDKGCAF
FT                   IPHYFDSNQDVILNPFDARCPNWDMWLEAPRDSDFENMAESLIPMHGDSEPFWVNAART
FT                   VFSSVAAKMRKDKDRSVEKLLKLLLTGEFSHLEDYLKGTAAATLVSGKIEKTAISIRSV
FT                   ITTYLKSLSTLSGLDSEGASPFSIRDYILNEQHSGWLFISSNGEQHKSLKPLMSMWLAM
FT                   ASLTLLSLTPNPDRRIWFICDELPSLHKLPLLGETIAEVRKFGGCFLLGMQSFSQLTKV
FT                   YGQSGGAKELFDLLNTRFFFRSPSADMARLVASELGEEEIEESRENYSYGANSIRDGIS
FT                   LGSQRVTRPIVSYPQILELEDLRCFVRLPGSYPITQLTLELENRPKYLKGFVERQFIID
FT                   EMLQKLVKETESTEDEAIAKRKCHNKKSVEIEFEV"
FT   CDS_pept        31463..34411
FT                   /transl_table=11
FT                   /locus_tag="plpl0032"
FT                   /product="hypothetical protein"
FT                   /note="similar to conjugative transfer protein TraI"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17351"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX6"
FT                   /protein_id="CAH17351.1"
FT                   /translation="MLSVEPLKSAQGAADYYSKAFNYYSGDATAMQWLGQGSQKLKLSG
FT                   VVQKEQMLALLEGRLPDGQVLQNLEGEHRPGFDMTFSAPKSVSVLVGLGLAPELVRFHD
FT                   EAVQLTIRQIEKEFAETRVSRRGEISFEKTNNLLVAAFRQPSSRANDPALHTHCVTMNI
FT                   TFHEGKARSLSSDPSREHGVIEQIQNNAHYCGLIYRQHLANKLKETGFHLRLTGKGLFE
FT                   IDGVPDEVLHEFSTRRMDILGYMDEKGWNGAKSASTATVLTRKNKEEHDINLLTEDWKQ
FT                   RAKDIGFDAQAFMQHRDKSQSISWLSGVKDRLLALVNKYKKDSSPSEIEAAHACVVVAI
FT                   ETLSQRTSIFSERMLTQEAMKHSLIYPKAVSRQSIIESIQQEIKSQTLYEARCFDRGER
FT                   LLTTPWLLTLETETIARIDRNKGAVPAIAHLNAVTAFQKMRSSLLPYPMTNSQKESMKV
FT                   LLTSKDRYLAIQGYAGVAKTSMLSEARIFIEAQGHKLRGITVASSAAHELQEKAGIKAD
FT                   VFPLVHQELKEAQTASLTKTLFIIDEASMLSSHQGHELMKQIERVGARLVLVGDRAQLP
FT                   SVNAGRIFGLTQEYGIETAVMDEVVRQKNEILRQAVIATTKGFVQEALDNLDVKTLATH
FT                   KERIAWIANHWLSLSASARDETLLFAPTHANREEITTFIRSGLKQEGTLKGEQFSQIIL
FT                   KTKMMEPIQSRFVAYYQKGDMVRFNQSFKRNKIHAGSYYTVGEISKKHRQDNVLPLIDE
FT                   SGNLIKFNLNNLPNYKTHTAPFERTIEVYETKSLELLVGDKVMWTRNFKANDIRNGQCA
FT                   TLHEIKNNSFMFITKEGRLLTLEKSHPALKHLDYSYVLTNYKVQGKDAPYGIGLMESFH
FT                   RFGSTLNNFYVQISRAIHGMTLVTDNKEELVHAIRRNSNEKPASMDITSSAQLIHHERR
FT                   FGAQNQLSIQSVIDKKKSLEIQEISKSMNQDDLIIEKKGPHLTKQLSKELEL"
FT   CDS_pept        34428..34751
FT                   /transl_table=11
FT                   /locus_tag="plpl0033"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with eukaryotic proteins"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17352"
FT                   /db_xref="GOA:Q5WRX5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX5"
FT                   /protein_id="CAH17352.1"
FT                   /translation="MSRLTISLPDNLHQHISALAIKNNDSMSNMINQLIQVGLHHWFKN
FT                   DGNFKANPAVEKYCHQLIIQMNALIKNMSIELLKLDREDFEKLQQAAAIKYSELKNSAH
FT                   ENL"
FT   CDS_pept        complement(35323..35727)
FT                   /transl_table=11
FT                   /locus_tag="plpl0034"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17353"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX4"
FT                   /protein_id="CAH17353.1"
FT                   /translation="MRYPVVIHKDEHSDFGVIVPDIPGCYSSGSTYDEALTNVIEAIEC
FT                   HLEGLLIDNEPLPVGTTIDRWINDEEFQGGVWAFVDIDLSQISGKAKRINITMPERILS
FT                   LIDLYAKNHAIKNRSSFLADAALSYMESHK"
FT   CDS_pept        complement(35724..35921)
FT                   /transl_table=11
FT                   /locus_tag="plpl0035"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17354"
FT                   /db_xref="GOA:Q5WRX3"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX3"
FT                   /protein_id="CAH17354.1"
FT                   /translation="MKSAEIIKIIERDGWVQCHQKGSHCQFKHPTKKGRVTVPHPKKDL
FT                   PIKTVASIFKQAGINKEDIK"
FT   regulatory      complement(35735..35740)
FT                   /locus_tag="plpl0034"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(36007..36225)
FT                   /transl_table=11
FT                   /locus_tag="plpl0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17355"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX2"
FT                   /protein_id="CAH17355.1"
FT                   /translation="MFSEYWSPKIVGEANDLQIKQVKFKGELKWHKHDNQDELFQVVNG
FT                   NLLIRSRDKGINLIVDEILSSYFPVFF"
FT   regulatory      complement(36237..36242)
FT                   /locus_tag="plpl0036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(36793..37656)
FT                   /transl_table=11
FT                   /locus_tag="plpl0037"
FT                   /product="hypothetical protein"
FT                   /note="Similar to antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17356"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX1"
FT                   /protein_id="CAH17356.1"
FT                   /translation="MKSYQEFCALNARRLFAIIEKHGGLLQWKKEWSGEGLNALPQGIN
FT                   GIYRGGNLFSLFFAQMENGFKSNQWLTFNQIKKGGGQVLNGSKAEEIYFWSLKDQIELN
FT                   QKTNESEKKSSFIFKTYYVFNLEQTTLFKKEGGQNEQFQCNQLLNYIKPSISHFGNHAF
FT                   YTPVNDTIVLPHREQFTDKAAYEATLLHELTHWTGVEYRLNRESLKAYGTEKGRAEEEL
FT                   VAEFGAFFLCAFFKIKSDIENHASYVNSWKTLLNEKEIMRATNMAAKAFHYLVEPLQKE
FT                   QAQIAA"
FT   regulatory      complement(37664..37669)
FT                   /locus_tag="plpl0037"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(37966..38127)
FT                   /transl_table=11
FT                   /locus_tag="plpl0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17357"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRX0"
FT                   /protein_id="CAH17357.1"
FT                   /translation="MFVLHFNKEFASLIDLVLKAMGLGIRSINKIIENARNAKKKNEKK
FT                   QRAKRKIY"
FT   CDS_pept        complement(38700..39233)
FT                   /transl_table=11
FT                   /locus_tag="plpl0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW9"
FT                   /protein_id="CAH17358.1"
FT                   /translation="MTSLIEFKKQAKILRDFLGQKNHDITHSSCLEAIAIMNGFKNWNT
FT                   MSGIFAKNGNALEKRSKTWICDTCGGLIQKPEEGWVEWIVSVPKNEAYGLRLAHRAGYG
FT                   SNGSSCQYNEELVYKQYGGIINDGELSWYLGDGGLMLLLTLLEEQQIPQDQVLEMIKRL
FT                   HIPEYEHARRHFNE"
FT   CDS_pept        39807..40790
FT                   /transl_table=11
FT                   /locus_tag="plpl0040"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW8"
FT                   /protein_id="CAH17359.1"
FT                   /translation="MFMRISKILCLSLFIISSIAFAKPAETIPSIQVINYKNDLAYIIT
FT                   AGPEVVHGSNYEEACSKLASYGYTWKIVPHKSADPACYSPTDNVLMGANTWYCADSTLA
FT                   YYNTPWWLCSESFTTCPNPTWTRSNDGLSCSRPNSTCTETPATVSEVKLLAAIVYGEAS
FT                   ATNSTYEEKAAIANAVVRYKNSNGYPTVNQLILDNPAYSAAASNKVVRYRQVMCSDVAI
FT                   EYPDLYNAAMNALDPEGVDYANGGCFWDGNDLVTKGAKHRHYRKGYKFTDPTHDVLSVG
FT                   DSAPANLTGKFGTYNYTYESTAGYGQTVFWKLTQEFLTAQRGKQCH"
FT   CDS_pept        40781..41305
FT                   /transl_table=11
FT                   /locus_tag="plpl0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17360"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW7"
FT                   /protein_id="CAH17360.1"
FT                   /translation="MSLNQLNIILFGMLISQFVLADVPVEVIGSCKNSRAVNASVTYTK
FT                   IIPPAGVDDSPGCTNHIESTEGSFNYGAITCNHENYLILKSDRINLNTAQNHSVNPSIT
FT                   PGNRITQLSDWSKIVFDNNEYLCIDVELSQSGEGADVSQYYIVENAFNTSTPVLHFYFF
FT                   NKDIMPMTDAN"
FT   CDS_pept        41534..41965
FT                   /transl_table=11
FT                   /locus_tag="plpl0042"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17361"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW6"
FT                   /protein_id="CAH17361.1"
FT                   /translation="MSHIPLSNYGTSPFEKLLGYVPEILNNWSNLENAFLQSKTFEPNF
FT                   LEQIRRALVFDNLCYYYIAKARPPDQRPEDILLTAALKFANKFAIDHKIINEQDIDELK
FT                   QCFLTNEISELISYCSFITASQRFGSVLGLQPALKYDQK"
FT   CDS_pept        42194..42760
FT                   /transl_table=11
FT                   /locus_tag="plpl0043"
FT                   /product="hypothetical protein"
FT                   /note="Similar to site-specific recombinases"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17362"
FT                   /db_xref="GOA:Q5WRW5"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW5"
FT                   /protein_id="CAH17362.1"
FT                   /translation="MSSSGKTIGYVRVSSFDQNPDRQLEGIILDKKFIDHISGKNIKRP
FT                   QLEKLLDYVRDGDEVVVHSMDRLARNLDDLRQLVKSLTQRDVTLRFIKENLVFKGDDSP
FT                   MSNLLLSIMGAFAEFERALIRERQLEGIAIAKQKGKYRGRKPSLNKDQAAILQERAKAG
FT                   EQKTSLAKEFGISRETLYQYLKNNQ"
FT   CDS_pept        complement(45122..45241)
FT                   /transl_table=11
FT                   /locus_tag="plpl0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17363"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW4"
FT                   /protein_id="CAH17363.1"
FT                   /translation="MMKAVNVHCRTGSLEMSAVSPPPEPNVHCRTGSLEKLNR"
FT   CDS_pept        complement(45347..45472)
FT                   /transl_table=11
FT                   /locus_tag="plpl0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17364"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW3"
FT                   /protein_id="CAH17364.1"
FT                   /translation="MGNVHCRTGSLETLDGVFGESFSVHCRTGSLENYHFFNLLR"
FT   CDS_pept        46027..46149
FT                   /transl_table=11
FT                   /locus_tag="plpl0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW2"
FT                   /protein_id="CAH17365.1"
FT                   /translation="MYIFLSCLYGSELGKWDKPYMQKFLSCLYGSERNSTAGPF"
FT   CDS_pept        complement(46715..47269)
FT                   /transl_table=11
FT                   /locus_tag="plpl0047"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17366"
FT                   /db_xref="GOA:Q5WRW1"
FT                   /db_xref="InterPro:IPR013396"
FT                   /db_xref="InterPro:IPR042564"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW1"
FT                   /protein_id="CAH17366.1"
FT                   /translation="MDHYLDISILPDSEFTTPVLMNAIYTNLHKALHTLASTNIGVSFP
FT                   KYSSTLGNLLRIHGKKEALQELQNLNWIGGMIGYCEASLIKTVPADTKFRTVSRKQPTM
FT                   SQSKLRRLIKRNSLTEDEIRQYKAKMFSKGLDNPYIELVSVSNGQRHRRYIEFGELFNE
FT                   PIPGLFDQFGLSNSATVPWFD"
FT   CDS_pept        complement(47280..48305)
FT                   /transl_table=11
FT                   /locus_tag="plpl0048"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17367"
FT                   /db_xref="InterPro:IPR013399"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRW0"
FT                   /protein_id="CAH17367.1"
FT                   /translation="MTKKEHIASVLAFEKKLVPSDGYMYGCKWEHKDKATPLRLNEKSV
FT                   RGTISNRLKPALQKDPAALNNEVEKPNLQTVDTCSLGSEEDTLKLYFTLKVLGGLKHPS
FT                   ACNNAAFKQSYQQAVSNYLETKGMRELAKRYALNIANARFLWRNRFGAENIQVEVMALN
FT                   EGAEKSWNFNALDFNPRDLETTTNEVDSLADRIADALASENDFLMLQITCYARIGKAQD
FT                   VYPSEELVLDKGKGKKSKILYAVDGIAAMHSQKIGNALRTIDTWYPEFSDPVSSAGPIA
FT                   IEPYGAVTNLGKAFRIPADKQDFYTFFDTWARGGELSRVEDEHYMMAVLVRGGVFGESD
FT                   K"
FT   regulatory      complement(48312..48317)
FT                   /locus_tag="plpl0048"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(48321..49262)
FT                   /transl_table=11
FT                   /locus_tag="plpl0049"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17368"
FT                   /db_xref="InterPro:IPR013398"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV9"
FT                   /protein_id="CAH17368.1"
FT                   /translation="MRSNLILLPSIRVQNANALSSPFTIGFPAMTGWLGGVHALQRKLN
FT                   TNSIAVMFSAVGVVVHRFDLQTYKGPGDFVHSIIGTGNPLEPKSEKDKPKGNAVRPSFI
FT                   EEARCHLEVSLLVEYSGIEAQDEQLMLERVYQLMLGNMKLAGGDVLNCKEPEILRDFQK
FT                   AKRKLMPGYALIERRDLMQAAMEQGQDAMDAMLDYVAVHYSCTKEIVNGQERVIWQRKR
FT                   KSTGPDGQTGWIVPIATGFHGISELGTAINQRDPDTPHRFAESLVTLGEFKMPYRLESL
FT                   DDLLWRYHVESENNLYLCIQQKSISETSNDDY"
FT   CDS_pept        complement(49259..50524)
FT                   /transl_table=11
FT                   /locus_tag="plpl0050"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17369"
FT                   /db_xref="InterPro:IPR013397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV8"
FT                   /protein_id="CAH17369.1"
FT                   /translation="MFDPAITDFFAERKKSWLKKKLKSDMTELEKNNILQECEDIFALE
FT                   NWLPNAAKRAGWMSISTHPCTFSHPSSRKNKNGYVTSIIAKAPRKADGYLRSGNVHVAL
FT                   DALGNAAALDVYKFLSLVTEDGKTIIEHIQQNTEVAKSLLSIKTDSYENLRVGFLEMVS
FT                   SNEASITSSKIKQVYFPMGNEYHQLSVLSNSGMIFELRERIDALRFSDTVQREREFRRD
FT                   NIYSELGYKEIYDVTTIAYGGTKPQNVSVLNNQYGGKAYLLFSAPPMLEQREITFPTKD
FT                   FFVQSIRYYDCKEILEQLDNIFKIERYGKISLDKIRKGRDRCLSDMLDMILQKMMVLRE
FT                   ASKNQFRSQSSSLPAWQKIWLCEQYIEERGKRDDWLETLCKQIALWINSAYKNSIKHPT
FT                   MLGEAERRYFKDFIDEHREVLR"
FT   CDS_pept        complement(50517..53912)
FT                   /transl_table=11
FT                   /locus_tag="plpl0051"
FT                   /product="hypothetical protein"
FT                   /note="Similar to helicases"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17370"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR013395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV7"
FT                   /protein_id="CAH17370.1"
FT                   /translation="MMVIFVSQCEKKALARTRRVLDAFADRIGDNTWQTVITQEGLLAV
FT                   KKLLRKTASKNTAVSCHWIRSRSRTELVWVVGNKSKFDREGRVAVNSTSKNQVYRDDLL
FT                   DWKLLPVIQSLACLAALLHDWGKANARFQQKLAKNFKGIPADRLRHEWVSCLLLKALIL
FT                   NTDNPYSDSDWLGTLKDGIINEDAIKTALRMSCEKPLADLPNIAKLIAWLVVSHHKLPV
FT                   NPDNLFNGSECFSLDGLLKLIDKSWGYENKTVDEISLCLEFPHGLLTRSSKWLSQIKRW
FT                   SAKLLGIEELISQTINDGSYCVLLHHARLSLMLGDHYFSSLDVNQTSNWKCTTELIANT
FT                   QKDKSPKQALDQHLVGVSESARDVVAKLPLIENGLEFSFNTAELKRKSPPAYTWQDTAA
FT                   KKVRDWRLSCNDMRKGFFAVNIASTGCGKTFANAKVMMALSEDGDSLRYVLALGLRTLT
FT                   LQTGDEYRERIFNKNDGTDLAVLIGSKAIADLHYQSRLDQTYEQEQQGSESIESLLADS
FT                   DEIVYQGELPEEGLTTILKKHKDRQLLYAPVLVCTIDHMIAATETTRGGRYILPSLRLL
FT                   SSDLVIDEVDDFTGSDLIAIGRLIHLAGMLGRKVMISSATIPPAMAEGYFNAYREGWSL
FT                   YCKTRNANPMVGCAWIDEFSTQVEEIGMREHATQEFRKIHDKYIDRRVKHLNKQPAKRK
FT                   AIVINCEEAMKRSDEPVVKNKKEAWFNRIAQTTLDMHKLNNTVDKKTGLKVSFGVVRIA
FT                   NIQPCVQLTRYLLTYDWPEHSEARIMAYHSRQVLLLRHEQEKHLDKVLKRKEKRGEKPQ
FT                   AFYDQTIRRHLDTIAANRPDVKNLLFILVATPVEEVGRDHDFDWAVIEPSSYRSIIQLA
FT                   GRVMRHREDTIEYPNIAILQYNWRTIKYGDAERKPRFYFPGYEPDPRKRQTNKLSNGKN
FT                   DCLNSHDIFKIVDINLIKDRLDSIPRIQERPENSKTPMALLEHSVIESLLTYYEGKGPE
FT                   TLQGYIQGYWRLTALPQYLNRFRQSTKTTQLYRVANETGEAWFTERDTRGYFSYVNTGE
FT                   FARQDDAYQISTLPLTAEQSQRLWIQRDYLHLLREQMEISEMSIDKAAIHYGEISLDVY
FT                   PDGINTEYEYNDQLGLYKKESNHV"
FT   CDS_pept        complement(53909..54877)
FT                   /transl_table=11
FT                   /locus_tag="plpl0052"
FT                   /product="hypothetical protein"
FT                   /note="Similar to uncharacterized protein predicted to be
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17371"
FT                   /db_xref="GOA:Q5WRV6"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019857"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV6"
FT                   /protein_id="CAH17371.1"
FT                   /translation="MEILTDLKAILHSKRANIYYLEKCRIMQKDGRVLYLTEAKNENQY
FT                   WNIPIANTTCLLLGTGTSITQAAMRMLAQAGVLVGFCGGGGTPLLMANEVEWLTPQSEY
FT                   RPTEYMQGWMKFWFDEQKRLYAAKQFQLSRIEYLRVHWKKSRDLAAEGFNSDDLQPELL
FT                   SSELKIKKAKEVGKLMQNEAELTKQLYRYAANRTQYGKFIREREAIDKANIFLNHGNYL
FT                   AYGLAATTLWVLGIPHGFAVMHGKTRRGALVFDVADLIKDALILPWAFICAKENSSEQE
FT                   FRQQCLQAFIDHKALDYMFEQVKAMALNTDWESENSEENLL"
FT   CDS_pept        complement(55064..55336)
FT                   /transl_table=11
FT                   /locus_tag="plpl0053"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17372"
FT                   /db_xref="GOA:Q5WRV5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV5"
FT                   /protein_id="CAH17372.1"
FT                   /translation="MRITLESISTCVQYPHVFGVLSEFERNLIKERTRAGLEAARGRQG
FT                   GRPEKLSDEHKELVKTLYSNKKHSIQSTCKMVGVGKTTLYKYINQ"
FT   CDS_pept        complement(55406..56383)
FT                   /transl_table=11
FT                   /locus_tag="plpl0054"
FT                   /product="hypothetical protein"
FT                   /note="Simlar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV4"
FT                   /protein_id="CAH17373.1"
FT                   /translation="MVTKQELIENPKDLKPHVVLLGAGASKAAFPNGDKSGNELPVMND
FT                   LAKILSLNNLLTKNNINPSENFETIYSQITDDGLKKEIESRIIDYFSKLSLPEHVTIYD
FT                   QLLLSLREKDAIFTFNWDPFLFDAYKRNSDIVSLPQIFFLHGNVRIGACEACDKWGEKN
FT                   TYCPECDIRFKDVPLLYPIKNKSYFQSSKYTALSWKKAESWFSEAFTITIFGYSAPTSD
FT                   IEAVSLLNKAWLHISERQFEHVEVIDILSTNILSEKWKSFTPTHHLSSQNSFENSRLWR
FT                   WPRRSCESLLYPMARGIPCEDFPLSKTKKLDQLHVEIQSISNYE"
FT   CDS_pept        complement(56808..58085)
FT                   /transl_table=11
FT                   /locus_tag="plpl0055"
FT                   /product="hypothetical protein"
FT                   /note="Similar to DNA repair UmuC"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17374"
FT                   /db_xref="GOA:Q5WRV3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV3"
FT                   /protein_id="CAH17374.1"
FT                   /translation="MSLPEMFALIDCNNFYASCERLFRPDLKDVPIVVLSNNDGCCIAR
FT                   SNEAKALGIAMGEPYFKIKHLCKQHGVKAFSSNYTLYGNMSHRVMCTIEEAWPHIEIYS
FT                   IDEAFLDLRSLPVNSHNLFCEQLQKKILKYTGIPTSIGIGPTKTLAKAANHLCKKVYKI
FT                   PVFNITSSRERLLQQISVGDIWGVGRQWANKLISRGIHTAYDLAMTNPHLLKKCFNVVL
FT                   MRTAMELQGIACGGLEAIEPKQSIMSSKSFGQMQTQLASIEESISSHCARAVEKMRRQQ
FT                   LVAKRMVVFVNTNRFREDLAQHFQSIEFKLINPTDDLRLITKIAKRCLQRIFKPGYYYK
FT                   KAGVWLEDLIPKSPRQLDMFHQPSDEHLKHTEQLMGVFDQINQKYGRSTIRLAAEGYSK
FT                   PWAMRAELKSPAYTTRWSEVPQVRLF"
FT   CDS_pept        complement(58072..58578)
FT                   /transl_table=11
FT                   /locus_tag="plpl0056"
FT                   /product="hypothetical protein"
FT                   /note="Similar to SOS-response transcriptional repressors"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17375"
FT                   /db_xref="GOA:Q5WRV2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV2"
FT                   /protein_id="CAH17375.1"
FT                   /translation="MSPRGGKREGAGRPRGEPTKAVRIPLSQLAKLERLKSHESYQLPV
FT                   FASKIQAGFPSPADDYIEGYLDLNTKFIKHPSSTFVLQATGESMVDAGIFSGDWLLVDR
FT                   SIEPSDGRIVIAAVNGELTVKRLSKKGGRVQLLPANPKFQPIDITEDSEMVIWGVVTLV
FT                   LHELA"
FT   CDS_pept        complement(58714..59382)
FT                   /transl_table=11
FT                   /locus_tag="plpl0057"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:plpl0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAH17376"
FT                   /db_xref="GOA:Q5WRV1"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRV1"
FT                   /protein_id="CAH17376.1"
FT                   /translation="MCGRFAYIASYDKLKYQFHLANAIEIPPRFNISPGADVVCLVETV
FT                   GHEIQCVLLRWGLIPSWTTDRKKLGNLINARAETVFEKPTFRQSIKSKRCLIPMSGFYE
FT                   WRQEDGVKQPYFFQKKNHDLLAVAAIRDIWQQNEEVIHSCCLITTDANAFMQPVHNRMP
FT                   VILGEEAQAIWLNNTQCDKAQLMALMKPYPYEDLEGYRVTTLVNKANFDHPLAMEPLSE
FT                   "
XX
SQ   Sequence 59832 BP; 18419 A; 11222 C; 11745 G; 18446 T; 0 other;
     aagataccct ttagatatct ttataggtat cttttggata acaaaatggt ttaatactct        60
     ccttttagat atcttataag atcacacttt aagtatccat ttagatatca cttagatatc       120
     attcatatgt gattatgatt tacaaaaaaa atccatcttg atcggaaggt aaaaacatta       180
     taaacatttg taaaacgtca acattaaata atattgaaat cttcgtaaaa ttgcattttt       240
     atcattactt tatagtttac atggtttacg ttttatgatt aaaatcatac aaaacatcaa       300
     ccacataatg agattcaata tggatataca aaacaatgtc actcaaaatc accaacccaa       360
     aagagcaata tctgatgttg cagattttct cggcatctca atgcaagccg tccataaaca       420
     attaaaaaat aaaaatataa attgcgaaaa aataggtaac aaatcttttt taacatttga       480
     atcagctaga gagttattta attttaagtt caagcgaaaa aaaatcgccg ttcaaattgt       540
     taaaggtgga actggaaaaa ctacaacaat caataatata gctagttgtg ccaatactta       600
     tggagcaaga gtgctattga ttgatgcaga tccacagggt aatttaacag acgcaaatgg       660
     gattgacgcg gaagaatatc ctgtattaat agatctattg aaagatggag catcaattca       720
     agaaagcata gtaacagttt cacaaggatt agatctaata ccaagccgca ttgagaatgt       780
     aattctcgat aatgaaattg tcaacggaag gtatccatta gagaagcttt ataataattt       840
     attaagtaaa gtcgagaact attatgactt tatattgata gattgcccgc caactatggg       900
     acaagccgta actgccgcta gtctgtacgc tgatattatt ctagcccctt taaatcctga       960
     taaatttagc gctaaagggt taaaaatatt aaagcaagaa gttgatacat taaataaaca      1020
     tttccataaa aaaattgaat ataaggtatt tttgaataaa ttcagttcaa aaacaatttt      1080
     atctgataaa gcaatcgtat cacttatttc tgacccagaa ttagaaggga aggtattatc      1140
     tactacagta cagtatgcgc aagagatacc taatattaca gatgataaca aaagctcatt      1200
     tagtaatttg aaaaaatcct tggtaagaga tgattttgat agattgacac gagagttact      1260
     tgaaataaac gcagaaactt ttgctaaaga cgaacgagca ttatccaaaa atttaaaaga      1320
     agaatcttta gcatagggag agctataata tgcctgattt agaggaactt ctacagtcgc      1380
     gtagtaaaaa gaaattcatg aagaaatcct acagaccatg ggacttatca ggtggaccca      1440
     catccttgac cgagaaaaat gaattcggaa caacaacttt agaaaatcta gttcatcaaa      1500
     aggattctgt tgttaaaaac aatctatcgg tagttgccca atgcataagt caagaaaata      1560
     cacattccac attagataac gataaagata tcggaaagat aacaaacaaa tatcaatcag      1620
     gtaccgattc ggaaaaccat gggatatcta atgaatacca gatggataac tcaactgata      1680
     ccattaagga aactacaagg aaccatttag ataacaactt agataacaaa gagacatcaa      1740
     acaatcaatc aattttagaa aaatttataa aagaaacatc cgagattaca aacaatttca      1800
     atgaaaatct tgaatatgat cataatgaaa tagacttaat ttcaccttca aaaatagaac      1860
     aagaaattat acgcctttcg ggaaagcaaa aacttatatt tgatatggtc atagagatat      1920
     gctcagcaag aaaatgcttt gaaactgggc cagtacaaac attgactttg gcaacattgg      1980
     cacaaacaac cactggaaca gcaaaaacca cgattaaaag attaatagac aagggtttaa      2040
     tatttagaca tcagggaaaa aatgcaaaag gcggctatat taacttaggc attaatcagg      2100
     ttatctggga acatgttaaa aacataaaaa ataataataa aacttcgatt tttactagcg      2160
     aagctatatt gaataataga tatcaaaaag atatcaatcc agatgatata aatagtagta      2220
     tttataatat taatactact actttatcta aaagacatga acaaatacct ccggaatggg      2280
     aaaaaattaa ttttgaacca ttgtcacata taggattttc taaaacacag ataaaacaat      2340
     taatcggaaa gaatgatcca acgatagtcc aggaatcaat ttatcatttt gcatttggtt      2400
     tggaatataa tcaaaaaact aagaagtatg atgatccctt gaatgtattg atgggagttt      2460
     taagaaaagg acaagcttgg atagaaggcg attatcgttc agcgatagaa atagcacaag      2520
     agaaactgtt agaaagcaaa aaagcagaaa ttgaacgtaa gaagagtctt gaggaaaagg      2580
     cttttaaatt agctttccac gaatgggaaa gtgaaataac tgaaagtgaa ttacagaagt      2640
     taaccgagcg aaaaaatgga gaccttacgc ctcctaaggc aaagttaact atgtacttta      2700
     gagaaaatat ttggccttca aaaaaagggg agtatctttt gttttaaatt cagagagata      2760
     tgttaaattt acctgcaagt aaattatcag agcatatcta cattttccgt taaatattgc      2820
     tatacctgct gggaaaatgg atttagctat atgtgcaaaa atatattgag ttggttctat      2880
     aaatttatcg ctattcttaa acattcttta ttattggttc caataataca cttaaaaaaa      2940
     ttagtgatgt aaaatttatt agcttttgat tgtaggtttt attcgaaaat aatttgcatt      3000
     atgcaagtta ttactacctg aggataggat attaaatgga ttctgtaaaa atgaatagga      3060
     aaggggtagt ttatttacac tggttaaacg gaataagtac attcagtttt gctatcttat      3120
     tttcatcatt atcactctac ttgactaaaa atattggttt aagtcaagtg caatctaatg      3180
     gggttgtagg tttttttctg gcttcaaatt tcattcttca ttttatagca ggttatctcg      3240
     gtgataagtg gttaagtaat cgattgctat ttgccacttc gacaattgta caaagtattg      3300
     gcctcatagt gctgaatttt tccgaatcat ttgtatattt aggattaagt ttatttgtta      3360
     ttggatgtgg tttaggctcc acctgcatta attgccttat tacacaacaa tttaatagtc      3420
     aagaggatga attaagagaa aaagcctttt ttcataatta cggcgcaatg aatatagggt      3480
     ttctttccgg ctatatctta agtggataca ttgacatcaa tgataaatat gaacatttat      3540
     ttgaaatgag taatctgatt aacctgatta cagtattttt cattattaaa tcatggaagc      3600
     attttgctaa aaaaacagta gctatcagaa aagagatcgg ggatggtaaa ttgggattat      3660
     tattaatttt attaataata cctattctct ttgcgggatt ttattactat tggttggcaa      3720
     atggactcat actttctata ggagctgcgg ctttatttta cataacgcta ttggcacatg      3780
     gttttaaaaa taataatgag agaaaaaaaa tttattcttt tatatttttg actgtaagtt      3840
     ctattgtatt ttggatgctt tactttgtcg ggccgatggg agttactcaa tttttgaagt      3900
     ataacgtgaa tatatacgta ggcacatatt atattccccc tcagtggttg atgaatttaa      3960
     attcactttt tgtgattatt ggttcacctt taatgatctc tttattagag cgactaagaa      4020
     agaaacacat aattatttct atcccgaaac aatttatttg ttccctagtg tttatcgcat      4080
     tgtccttttc agtgttagct cttggcatat taaaatcaag ccctgatggg ttaactagtg      4140
     tgaattggat tgttgcacat tatttttttc aagcggtagg agagttgctc attgctccgg      4200
     tgggttatgc tatgatagga catctcgcgc cggagaaact gcaggggctt atgatgggaa      4260
     tatggatgat ggcttctggt gtatcggtca cattgtccaa ttatttttcc aatttaatga      4320
     ctcaatccga gtcattaaat cctttcatta gcaatgagca ctacatgagc gtatttaatc      4380
     aactaggtct ttatgctgtt cttggagcgt tgatactgtg gttattttct aagactattg      4440
     aaaacagtat acaaaaaacg tcaaatcgaa caattgaagg aatcgcataa tctattggag      4500
     tgataattcc ccctgtattt tggatagttg tatttcttct tgagctaata tttttaagaa      4560
     attttccaat atagtaggat tttttatcgt tttaatatct tttttaattc cattaacaag      4620
     actttgttgc agttgaagtg aattttgtaa gttaatatta gaacaagctc gacgattcaa      4680
     atcatacaca ttatgtagac gtttatttgt tgaaatttca tttaaccctg aataagtaca      4740
     ttcgtccttt ttgattttca atcgagcagt attttcctga tcacattgtt cttgataacg      4800
     tttagcttca ggtgagtatt tgttaaatcc tttcggtgtt ctccagcggt tgttacgaag      4860
     gagttgagaa atgatattaa ttttatgttg aaaagtgtca atattttgaa attgctcttt      4920
     attgcttaat gaaaatacaa tttcgtctaa aaccttttga ggggatgata gctttactcc      4980
     atggcttttt tgaacattca ataacatccc cttaacgata ttgagttcgt ttataggtag      5040
     tttatcgtct aattgattaa gagtaatatt attaattact ctattttttt ctttattatt      5100
     ggtatctgct gaaacaagat aatccattct ctcgtttata tcatttctag atgtaggttt      5160
     tttttctttt atttctatag tgttttcttt ctcttttgag agaaattgta atttgctttg      5220
     aagtgtttct gtaattgcta taaaagatcg aggtacaccg taatatttaa atctttttcg      5280
     gataatcagt ccttcttctt ctaaattttt taggtagata taaatcctgc tttcactaaa      5340
     accgagttcc gcagcaagat caggaatttt ttttgtaaac cataatttat tttcgcgttt      5400
     taaaagagtg ccttgataat gaaatatgat tttatctaaa agcagagctt ctttagggca      5460
     gttagttaat gaaagaagct tgttaaatct atgatagtaa attgaattat tcataaaaca      5520
     tccatgtggt gaaattactt aattaaccct gacgtggcca acatatagat tagctgaggc      5580
     gtggttttgc aattaaagct agtctttaag tcactaagtc tatagaggat gtatcttttt      5640
     gattttttgg tatcttcagc gatttcggta acttggctac cgtttattat catttttatt      5700
     atctggctat caacatggtc aattaccatt aaaagctcca tttttattta aatgcatccc      5760
     aagtgatata atttataact tgaaatgcat ttaagcaaga aatattatta tttttagcaa      5820
     taaattttat tgcatgaaat acaggttcat tgaatacact aatgttctct tgtatgattc      5880
     ggttaattaa taggatttta gattgatgtc atatgagtga attatcttgg gatagggtaa      5940
     aaacggacat agctcgtgtt aataaacgcc tctatgaaat attagaaacc atagatggca      6000
     ttcaaaatat gctttttact gtccttgaat atcagtatgg acaaatcatt gcggatgagg      6060
     actattttta tttgccaaat acttgtggaa agctatcctc ggttccattt tcaatggttt      6120
     tagaaaaaaa tcttgaaatg tttattgaat ttaaagggaa gtcaagcaca caccaagtct      6180
     ataaagaagg ggatttttta agcgttagtt cactttataa tgcttcaaat actcatcatc      6240
     ccacagatat actgcaaata tcatcaggtg caagaaatac ctttttactt tgtcctgtgg      6300
     cagacgcaag gccacatgcc agtttagaaa aatattttaa ggctgacatt cctgtgccag      6360
     atgagcttgg aaatcattat ttaaccttta agagtttatg tgaggcagcc aactgtaagt      6420
     ggcgttcaaa attattggtg tttccttctg aaattgtaac gttaattaaa gagaataaat      6480
     tgccaactct tttgagttta gtcatggaat ttgattctaa tcagacaggt tattatgcaa      6540
     acttaccttt ttataattat ctaatggcct acgtccgagc caataatcct gaaatatctc      6600
     aaaatgaatt tactaataac gccattagtc aattgattac tataggtacg ggacaagttc      6660
     ccggttacgg tttagccgta ggggatgatt tattgccctt agattttatt gttgagacgt      6720
     atcgcgatat atataaatcc aaatacactc cttttgttat ggagcctgtt cattttgaca      6780
     aaaataaaaa caaccctgtt ttttattcga tcctcaaaga agagatggct tttaagccta      6840
     cctcattttc aaataaacca cagcgttgtg aattaatata cgatacttat tttcagtacg      6900
     ctgatcatat aaagaaatta ggccatctta agaatacgcc attttttgaa agtgcaacaa      6960
     tgctcgattt aacacttttt catgaaaaga acaatcaagt gactaataac ttatttaaac      7020
     tacctaggga gacgattttt tcttacgatc ctcgattttt ggaagtaaca aataaacttg      7080
     ggtattcagt tgatcaattc ccttcgaaaa caacgttttt agtaggatgt tttggtatta      7140
     aatataatga gaataacgac actgttatgc attgatcctc ttcaggacta tgaattaatc      7200
     gattgtgaga tgcttcttca attgggcatt actccctttt ttttgattaa agatgcatct      7260
     aaggctgtta aggatcggga aaatgtatta gtaaactcat tttcatatga agatatccta      7320
     gcaatttgtg attcaattcg tccaaagtat atcgtgtgtt tttctgagga tatgttcgtg      7380
     gatatagcaa aaatccgaga acatctaaag attgctggta tgagttcgaa tacggcaatg      7440
     ctattaagcc acaaggatct tatgtatcaa aagttggatg gttcatttcc atttcctaaa      7500
     acaaccacat tgattgaatc tccaaattta aaatcaattc aagaaaagat aggtgttcaa      7560
     gagatttttg ttaaacctat taattcctct ggttcctatg agacctatca tattaagact      7620
     gagagagagt tttctaattt tttagccaat aagaaagagg atgaggaaaa ctatatcgct      7680
     caagcttatg tggcagatga tttatatcat tcggagttgg tagtttttga tgggaacatt      7740
     ttgtttgtag aagccaggaa atatacccat ccaaaccatt taatggttag taaaaatttt      7800
     cctatattta gtttgaatat tttagaagcg cctcaacgac aatcaattat tgatgcttca      7860
     gttaaggtga gccagttatt gggattccat aatggggtac ttcatactga attcttcatg      7920
     aatgaggatg gttatattca atttatcgaa accaatgcta gaccaccagg tattggttta      7980
     aataagttgt accagaggaa atattccata agccttgaaa caattttatg ttgtattgtt      8040
     tgtggagttg aacctcctag catggtagaa aataaaagtc acttcgtatg tggttacttt      8100
     cctacaaaga tgggggttat aaaaaagata aacaaacctg aacttcatgt tcaaaatgaa      8160
     tggacttttt ttgttaagcc tgatgataca agcgaacaaa tggcacatat gtctaagtca      8220
     gcgatggttc tttgttggga tgactctgta actgaaataa ataagactgg taactttctt      8280
     gcagagcaag atattgtaga ggtttattga attaaaaata gattatagcc tcattttggc      8340
     tgctgatgag tttttagtaa gatctttaaa cagttgttcg ttcatatttc accacaattg      8400
     ttaaaaatat aaataaatta tatatatcgt ttatataaaa atctacaggt tataagaatg      8460
     catgaatacc aattaataga gtttagttcg tccaaaaaag aaatccaatt ggtttctaat      8520
     caatcaaact tgcaacaagt attattagaa ttttataaag agaagtttga aaagatgttt      8580
     gatgaagacg gttgttcaaa gggatacatt tctgtatttg ttaactcaaa acaaattaca      8640
     tcagttaaag aaattgcact taaccctaat gatgaaatct gtattgtaac ttcgatatca      8700
     ggggggtaga ggaatggaac ggtataaacg ccagatcgca gtgatcggag agcaaagtca      8760
     aaaaatacta agtaatgcaa gaattatgat cgttggtcta ggcggtatcg gatgtcctgt      8820
     tgctcaatat cttgccgctg ctggtgttgg aaagttaatc ctagtcgata atgataaagt      8880
     agatctttct aatttacata gacagatttt atttaatgag gcagatgtcg gagattataa      8940
     agctgagaaa gcgaaagttg ctctaagtca agttaattgc aatatagttc ttgaagcata      9000
     caccaataaa tttgatgtag atttcggtta ctcatcagtc tcagatgtcg atctgatcat      9060
     cgatggaaca gacaattttg aaacgagata ccttattaac gatatttgtg tcttacaaga      9120
     aaaagtattt ataagctgta gtatttttgt aaatgtcatt cagcttgttt tatttgatac      9180
     gaaacattgc tgttatcgtt gtttatatcc taacccgcct cctacaggtg caattcctaa      9240
     ctgttccgaa gcgggtgttt taggcacagt aacaggaata gccggaacca tggccgctaa      9300
     ccttgctcta aattatttac ttaaggtaga ggatggggaa gcaccacaag tacgaatagt      9360
     agatgcaaaa aactttagta tctcctcttt gactataaag caaaataatg aatgcattgc      9420
     atgcaaacaa aagaaaatca actttgatta tttgcaaacc agtagtgctg attatgggat      9480
     ctccatagaa gatcttgata gaaacaagca ttttctggtt gatataaggc aaaaagagga      9540
     gagagagatt ataaagttag atgatgattt attttttcct attaaggata ataataatta      9600
     tgcgtttttt ttatcttata aagataaaaa attagtattt tattgtgctt cagggtatcg      9660
     aagtaaattg tttgcttcag agcttagaac gttaggcgtt gatgcttatt acctcaaaac      9720
     gagtctgtct aaatgattat taggcatgca gaaacttctt ttagagcacg tcatttcagt      9780
     gaaacactaa acttattgaa tcagtttaag aaactagcgg gaattactcg attagcagac      9840
     ttaacacatt tagattacac cagcctaccc gtctatactg caataaggcc tagagcaaaa      9900
     tcattaacaa cgagtcaagg aaaaggatta acaaaggaag cagctaaatg ttcggccttg      9960
     atggagtcga ttgaggtgta ttttgctgaa gaaataattc cacaagtgac taataaatca     10020
     gagcttgaat taacacaaag taataacctt tttataccaa taaatcaact tgcaaactca     10080
     gtgcggttta ccaatccctc acagccaata aattgggtat atgctgattt agtattctca     10140
     gggaagacca ttcttgtacc ttttgcagaa tattcattaa attcttattt accggaagtt     10200
     ttaatttatt ctcctgatac aacaggactc gcaggaggaa ataactataa agaagctctg     10260
     ttacacggaa ttttggaagt aattgagagg caagacgcgc aacagataac cgagattgct     10320
     tttgttaata gcaatttagt tgaaaattta tcaataaggt ttgattgttt cattacttat     10380
     caagaaaatt attatagagt tccttcattt gaagtgttgc ttaaatcaaa aaatcctttt     10440
     gaaaatcaaa tcctatttaa gggtagtgga agccatttaa ataaaaaaat agccttaaat     10500
     cgtgcactca ctgaagccat tcaatcgcga gtaactacta tagcaggttc tcgagatgat     10560
     ctaattaata ctaaatatga ttctaaggcc agtgagtttc ctgttgttat gaataaaaag     10620
     aacttcgatg aagtacagga ttattctgta gggacaatag aggatgcact ttctgtactc     10680
     tatgaaaaga ttaaagaaaa taatcaggat attttagtgt acacgtatta tgacaaagaa     10740
     atttgtattg tgaaggttaa actaatttct atggacttga taagccatgt atgaaacagt     10800
     cgttttttta gaaacctctt tatcccatca agaagcgatg catctattgc cagatgcaaa     10860
     gtatctacca tcaattaaaa agggtgatgt gcttaaatca ataaatgatg gatataaacg     10920
     aattgtcatc attgatggaa atttttcttg tgttccttct gtttggcata aagaaatatt     10980
     aactgcccta gactatggtt tagaggtatt cggagctgct tcaatggggg ctttgagagc     11040
     agcagagctg gatgcttttg gtatgaaagg gtatgggcgt atttatgaga tgtataagaa     11100
     tgaagaaatt gatggtgatg atgaagttgc cattgcttat tctaaataca acaatgagca     11160
     aaccattcct ttgatcaata ttcgtctgac gcttgaaaga ataaatataa ctaataagga     11220
     aacgatttta gattctattc gatcaatatt ttatgctgag agaacatggg gtaggattgc     11280
     ccaacaggtt tcagaggaac tttatcattt aattaagtcc aattatgcgg acgtgaaaaa     11340
     agaggatgca aaatccttat tgttttattt aaatcaccag caaatccttc caatgacttt     11400
     agccttgggt aagaaaaaaa gaaattttac cctttttgaa aaaaaattaa ttgaagctac     11460
     tttatcgcct gtttggttga attctcatga actagagcaa ataggagaag tggctcatct     11520
     tcagcgagct gaaaatattg ttaaattact atccattcct aaaacaaaag ctaatatgct     11580
     tcattatcaa tctataatag caatgctaga taaacaagaa tacgaaataa ccgaatgcga     11640
     gcttatctac caggtagaac tatttagaga ggagcgtaat ctgttgaagg gagatgagtt     11700
     tgttaattgg ttaaaggata gaggtttgta tgactccaat ctagagcaac tcttttacga     11760
     ctatgtaaaa ttatctaaat actttgcgat tacctacgat tacaatagct atttcaatta     11820
     aattccacac cctaaaaatt ttttccactt ttttattatc cttgcaccta ggtgaatgca     11880
     cctgatctta aatgatgatt caatggcatt atcgcttatc aaagaaattc attatgaatg     11940
     cagaacaaga ggtgttcgat attttagaag gttgtatttt gtgcttgcaa aaagcagcta     12000
     cagaaatcgg tggctttgat tttgataaac acgcacaagc agcagtgttt gcatattctt     12060
     tattaaagcg gcagcaattg tttttaattt atccatttga gaatgagaca gtgcattaaa     12120
     cgatgctatc aataaattac tttttctaaa taatcaatag aagaggaagg ggaatatgtt     12180
     gatattagaa cgcagggtag gggagacagt agcgatagaa aacaaagtgt tttgtatggt     12240
     actagatcat caactggatg gtcagttgaa gttagcgttt gatgcgccag aatgtgttcc     12300
     attccatcgt tttgaaattc aagagggttc atgaaaaaaa ttcaggatgg agcttataga     12360
     cgagaaatca gttgggatgg aactatgatt aatcgattaa taaaaaagtt taggaagtgt     12420
     tttactggaa ttcatgacta attgttagga caaataagga taatacaatg attgaaacta     12480
     tgaaatcagg acttactaaa accctactgg ctagtgttgt aatagtgctt acgggatgtg     12540
     cagcaactca tactgctata gagcacggtt ctttacaagt cagcaccaaa caaagtgaaa     12600
     cgattttttt ggatccagtc ccaaacactc agaagacagt ttatgtttca gtaaaaaaca     12660
     catcggatga agacgtggat attgctcctc aattaaaaac agtcttaagc gcgcatggct     12720
     ataaggttgt taatagtcca agttcagctc actatctgtt acaagccaac gtactcaagg     12780
     tgggtaaaat gagcgttgct gcaagtcaat ctgcgttggg tgggggttat ggttctgcca     12840
     ttgcgggcgc agcagcaggt agtgctgcag gaagtttgac tcaatcaagc actggtatga     12900
     tagtgggtgg ccttgctggc ggggtcattg ggatggctac tgattcttta gtcaaagatg     12960
     tgaattacac catgataacc gatgtccaaa tcagtgagag agtcggtaag ggcattaaaa     13020
     tcaatgagca gttccaatct catttaaaaa acggtagcag cacggttact tcccaaacat     13080
     catcgcgcga tagtcaatat cagcgctata gaacccgcgt ggtatctaac gcagacaaag     13140
     tcaatttaaa atttcaagag gctcgtcctt cattagaaca gggattagtc aaagtgattt     13200
     caggaatctt ctaatgagtc aaagaactta aaaagagatt ttattctcgt aataaaaaca     13260
     ttgtgatttt tgcttaaaaa ttaagcaatt taggtgctta agggattttt ataacctaaa     13320
     aacggagaaa gtaatgaaaa tgggtaaaaa gatagtcagt ttgatgcaaa aagcaggctc     13380
     ggcgttcatg tttgcaatgc tttcaaaaag tgtctttgcc aatgacttat tggctcgtgc     13440
     attagaagga gatgtcaaag attcgctggg aagtggttcg atgttttgga aaatctttat     13500
     tttggtggac atcattcttg caaccgcaat ggccgtcaaa agcaagaatc ccatggtgtt     13560
     tattggcgtg actgcggttg cctttattcc agccttttta ctgaaaacct ttgttttttg     13620
     atggaggaag gagatgagta acatgaacta tcaattctta aaccacattg atgcgcccaa     13680
     gagggtctta acgctaacca tggatgagct ggtagtgacg gccttaagct ttatcttgct     13740
     catcctctcc aatcaaaaag tattggtatc aatgttggga ttgggtttgt taagtgggtt     13800
     gcggcatttg aagaaagggg agggtccaaa ggtgctttta gtgttggctt attggtattt     13860
     acccagttat atcactcagt tttttctgcc caaattacct ttatcacacc accgtgtgta     13920
     tgtggcttaa ggagagagca tggattttaa aagttatcaa agccgcttaa gtcagctgtc     13980
     agcacggttt aatctgatgg ttgttttagt atttggcctt ttgatatcga acgttttgct     14040
     gtcttgcttt ttatttaaag catggaatca acatacgatt gaggtcactc cttttagtgg     14100
     tgcgccttct tatttgaaat cagcttccag tgttgatggc cactatttaa gcctgatggc     14160
     agaaaacttt gttaatgaac gtttaagcgt cacaccagaa acggtagatg ccagccatca     14220
     acgccttctt tcttatgttg ggcatcaaaa ctacaaccaa atgctacggc tactaactaa     14280
     tgaggccaag gtcatcaaag ataaaaaaat gtcgtccatt ttttatattg ataaaaataa     14340
     agccaaccca cacgaactga ctgtcgttgt ttcagggatt ttgaagcggt ttgtagggct     14400
     tcaagcatta aatgacgagc gtaaaactta tgttttgcag ttccaataca aagacagccg     14460
     tctatccata gttcagtttg cgcctttaaa ggagaaacaa gatgcataaa ccattcagta     14520
     ttgcgctggc cttattatca acggttgcaa tgggagctaa cagcatcccc gtgaaagaca     14580
     acagtgatat tgcattaact ttaagtcagg gtaactacaa ccgtcttgta gtcaagaacg     14640
     ataaaattat ggaagctgta ttcccaccaa acgctatggc cattaagcgt gatgagcagg     14700
     atggctcggt gtatgttatg ctcgcagccg ccaatccctt tactttattt ttaaccactg     14760
     agtcaggccg acatttttca gtgaccgtaa atggagaaga gtcactgggc aagaccattg     14820
     aactggttcc cgtgctgcca gtggttgctg catccaagac tcacgcccca ataacaaacc     14880
     ctaaaaaaat cactcaggaa gcagtccctg aagctattat tgccatgcta acccacatgg     14940
     aacaacaaaa gccatttgcc gatgtgaaag taagacgtca atttggccgc gcggagcact     15000
     ggtcaaaagg attaacgctt ttacccaaag agtcgtggga cagcaagttg ttaaagggcg     15060
     aaaccatcga attgtacaat ggcggtaaag aacccctgga attagcgcaa gattggtttg     15120
     ctaaagaagg tacgcttgcg attaagtttt ccaaaccttc cattaaacct ggagagcgtg     15180
     ccatgctgta tcgtgtggaa gcgagtcatc atggctaact ggcagtggaa taaaatggtt     15240
     aaagggcgtc aagtgcgcac cttgattgtc gtaggatgtg gtctgttttt tctctttgct     15300
     atgatgattg tgctattggc cgatgatcgt cccaaaaaga atcttgaggc taaaaaatca     15360
     gtgaatttaa caggaatcat agaggaatcg tttactgatg cggtggctga caatgcactc     15420
     acagcacaac aaacagagct tgaatcatta aaaaagcaag ttagtgaatt gacccttaac     15480
     attaaatcaa tggccgaggc acatcaaaaa gaattgcaag cgcaaaaaga agaattgacc     15540
     tctcaagtac aagaattggt tttagctaat caggaaaaac aaagtaattc ggaacaacaa     15600
     gataaccctt ccgaattaaa ggaagttcaa aaccctcagc tatggcataa ccccaacgtg     15660
     tattccatga ataatacgat gaatagaggt acggttttgt ctgatgccat tccacgtatc     15720
     cacaccgtct cttttcgtcc aaaacgacac attacaaaga agcaccacaa tttctatctt     15780
     aatcctgctc attatgtgcc ttctaataca tcagtacgtg ccgtcatttt aggtggtgcg     15840
     gatgcagatg cttcagtgaa tggccaatcg aaaaataatg gcgtgatgct ctttaagttt     15900
     ctagaagacg gtacgctacc gaatggtcag cgctcacgct taagagggtg ccgagtcagt     15960
     gccaattcct acggtgatat ttccagcgag cgtgcttttg ccacactcta tcgtttgtct     16020
     tgcgctcatc caggcgaacc cattattgac aaggaagtta caggctgggt gtttttcaat     16080
     ggcaaggtgg gtattaaagg gaaaccattg atgcgagata acaaagtgat gacttgggct     16140
     ggtgtgagtg gtgccttgtc tggtattgca agtgctgcac aatacgcgca aagcgtacaa     16200
     gccattggac catatggcgc aacatccgtt gtgccaagca gtcaaattgc accctttgca     16260
     gcttatggtg gtgcttccaa agcagctgac accttatctc agtactatgt caaacgagca     16320
     gaacaatacc atccggtgat tcaggtaggt tctggcaatg tggttaccat cgtctttaaa     16380
     gatggctttt acttggagcc cgatgaagac aagagccaac atgcgatgca gaggtataaa     16440
     gcgcaggagg aaacacagga attgatttct agaggtgagg aagagaagaa ctcggaaatg     16500
     aattttacag tccctccaga agtcttggga aaaattaacc gtgtgaatac cttaagccgc     16560
     aatgaaacag gaggtttaca atgagacact ctattgttgt cctaatgccg attatctcag     16620
     ttcttttaac tggctgtggc ccaatgaatt ctaatttcag ctgcaatgcc acggcaggtg     16680
     acagttgttt gacgattgag caggtcgatg ctatgactcg ttttgctgat gatataaagc     16740
     caacaaagca gtctttgggc atgatgaaag cggaaaataa tatcccaaat cgccaaggga     16800
     aaataatcaa acaaaataac gggcaatctt tatgggttgc acgaaacatg gaggagaaat     16860
     catgggcgta aatttctctc tttggcgcga taaagcgcga gatttattgc atcgtacaag     16920
     tcatctactt ggagaaactt caggagtgaa acctgattct ctttgctcct atgataaagc     16980
     atatgagtcg tgtactttag atttgccctc tatcaaaagc cttttaccct atgaaacggt     17040
     gaatgaagcc ggtttttttg tgaatcgcaa ctcaatgggc tttggcttgt tgttaatgcc     17100
     catgtcgggt gcggatgagt ccttaatgaa cagcctgtcg caactgttta aaaataaatt     17160
     aactgtaggg acggattgca cggtgttgtt gtataaacac ccatggattg gagaacaact     17220
     tgcgcaaaac tatgagccta ttttaaaaca aggtggtatt tatgctgagc ttgcacggga     17280
     gacgctgaaa taccatctga atgccattaa aaaaggatat aaaaatggcc gtaatgtgcc     17340
     ggcgggctta agtgattatt gtggttatct ttttgtttca agaccgatgc aatctgatgt     17400
     ggaagggcag ctccaactgt tgctagccga ctttgaatcc gaacttaaag tcgcgggttt     17460
     tggaattagg cggtgtgggg aagatgaatt taaggtgctg atgcgcgcat taatttcgcc     17520
     tgatttcaat gagttgtcct ggccaatcat taatgaatca gatgggttta ttgcagaagc     17580
     tataccctgt ccctcaaccg tgattgaaat tggagatgag gctatcgagg tatcaattac     17640
     tgactctcaa gcacaaacag tgcgaactcg actggttaat tgtgaggtga gtcactaccc     17700
     agccaagcca tttgctttat ggcaaacacc ggatttattt gccaacttgc ttgatactga     17760
     gcaggggatc caatgtcctt ttttaatttc attcaccatt cgaggtatga atcaggaaaa     17820
     gatgaaggcg aaagcacgtg ctcgtgccaa atccttaaac gcgaataata atcccgttca     17880
     atcctttatt aacccatcca ttcgtgagga agcagccgag tggcaatttg tgcacgatca     17940
     tgcatcaaaa ggcgaattgc accttttacc taccttttat aatgtcattc tttatacaac     18000
     tggcgaccac gaacgtgagc atgttgccaa ggcaattgca agttttaggc aaatgggttt     18060
     tacattaact cagagccgtt gcaaacaatg gttaagattt ttaggttccc ttccttttat     18120
     atgtacttcc ggcctttttt cgagtcttga gctcttgggc atgaccaaaa aactgagtca     18180
     cgccaatgtt gctaatcttc tgccggtcat tgctgatttt aaaggagcaa gacaggggct     18240
     cattgtacct acgtatcgcc atcaactgtt ttatttaaat acctttgatg acagggtttt     18300
     gcccataact aattttaatc gactcacagt ggcttccaca ggagctggta aatctttctt     18360
     tgagcaagca caaattttgg atggtttatc gcgaggccaa caaattttcg tcattgattt     18420
     aggcggctct tacaagcatt tatgcgagat ggttggtggc agctacattg atgcctccac     18480
     tttgacgctt aatccattta cgctgtttga ttttgatggg gtcaccgaga ttaaagggga     18540
     acaagtcaac gattacattc aaatcagaga tttgttagca atcatggcaa gcccgtcaga     18600
     ggcattaggg gaagttcaaa aagcatggct tttagatgct gtgactgaat gctggaaagc     18660
     gcggggccgt cacgcaaaaa tggatgatgt tttaacctca cttcaaagga tgctagaaaa     18720
     acctcaatcc caaggtgacc aacggcttaa ggatttgctg attttgatga gtaaatatgg     18780
     aagtcagggc atttacggcc acctctttaa cagcgataca cctctactca atggttccaa     18840
     tttggtggtt cttgaaatgg gtgagctgga atctaaccct gaactgctca ccattgtcat     18900
     gtttgtcatg atcgtgatta tccaggggca attttatcac tcggatagaa ggcgcgaaaa     18960
     acgatgtatc attgatgaag cctggcgttt tttggctcgt ggttctaatc cagtgtgtgc     19020
     cagctttatc gagcagggct ttcgtactgc aagaaagcat atgggtggtt ttgcagtcat     19080
     cacacaaaac cttttagaca ccatgaacac tattcaggga cgtgctattg cggcaagtag     19140
     tgatactaaa atcattatgc gccagggttc gtttaagcaa tacctagagg aacatccaaa     19200
     gcattttagt ccgcttgaag cacgtgtcat cgaatctttt ggtgaggcaa aaactcaagg     19260
     gttttccaat ctgatgattc agtttggaaa tgtcaccacg tttcatcgtt atttttgcga     19320
     tcccttttcc cgcgtgctgt tttcaacctc aggggatgaa gtaagtctca ttgagtcgtt     19380
     aaccaaacaa ggggtcagct taagtgaggc aataaaacgc gttgcaaaca aatattatgg     19440
     ggaggaatta tgcgattaac tcctctattt ttaggttgtg cattagcggt ttttggtgtg     19500
     gttttgggtt tttatggtgt atcacctcaa aaatcgattg ttatttttga taaaaaggaa     19560
     gtcttaagtc aattcattcg ccaattggcc gaagcaaaag cgacagagtc ccaagtggag     19620
     caatcaacaa gaagatttaa tgcattactg aataaggtat tggttgatac agcacagcaa     19680
     aagaaagtca tcattttaag ggcgtctgat gttcttgccg gaggtgttga tattacggat     19740
     gagatgcgaa ttaagatgag ccacgccatg aggaacaaat tgtgaacatt attttttact     19800
     tgtttcttct tatgatttca atggggcaag ttcacgccaa atcctttggt gtagtcggtg     19860
     aagtgtttcc tattgctgaa aagagctttt taaggctcat tgaagaacgg ttagcctcat     19920
     tgaaggcaag tggtgagctt aagtctttga atcagcgctg gattcaaacg gcagccgagc     19980
     atgcgaatag gccaccagca ttgaacattg tgcgcacaca ccattcaatt aaacacgagt     20040
     acgttcctga gattacctta agccaagaca taaccaatga aaaaggccag attctgtatt     20100
     caaaaggaac tcatgtgaat gcgttacaac atatgccttc ctatacaccg tgttggttat     20160
     tctttaatgc tgatgatgat gctcagttaa attgggcaga tcatcaaaaa actcagtgtg     20220
     caaaccctaa attgattctg actggcggtg ccgtcaataa agctgaaaaa aggttggact     20280
     cggtgattta tttcgaccag gcagggaaaa ttaccagcaa actgcacatt ggtcacgttc     20340
     cagcaaaggt gatacgtcat caaaacagcc ttgtcattca tgaacaagca atcaaggaga     20400
     atggcgatgt actttagagt actgcttcta actgttttgt accttgtgtc ctatcaatct     20460
     tctgcgaagc tttgtacagg acattttgtg aaccctatta ctgatgtatg ctggcgatgt     20520
     ttattcccct tatctattgg caacgcaaag gttgtgaatt catcacttcc tgatactgaa     20580
     aatgcatcca gccctatagg cgtttgtcca gccagcaccg gtgttcgctt gggcttgaat     20640
     atcggatttt gggagccgat ggcgcttacc gatgtcacgg atacacctta ttgtctggtg     20700
     aatcttggtg gcactcaatt aaatctggga ttaaagcagg gaagaggtgg acgccatgtg     20760
     gttggtaatg ggcagcagag agcatttttt catgtgcatt ggtataaata tccgctcatt     20820
     aactggctta atttgattac ctcttcaggt tgcctgcaaa aaggtgattt tgacattgct     20880
     tatctgaccg aacttgaccc gacatggtct gattcagaga tgagctttgt gttaagtcct     20940
     gagtcagtat tgtttggcaa ccctgtggcc gcaagtgcgt gtgctgcgga tgcactctca     21000
     tctaccatcg ctagtaaacc actggatagc cttttttggt gtgctggcag tcagggaacg     21060
     cattatccga tgacaggaca cgttaatgcg tctgtatcac ccgtgcaaac agcgtggctt     21120
     ctgactgagc gcatgaatta caaaatgcac cgtgagtttt tagtgtctga ctcaagccct     21180
     aaatctgatg caatttgcaa agagcattat tacaccgtaa cccctaaatc acgttatcgc     21240
     tatgagctgg tgaatcaggt ggctgatggc aagcgttgtt atccaggggg ttcaagcact     21300
     ctagcctggg aagccggaaa aatcaagccg catacacctg accaatatgg gtttttggtg     21360
     tggcgaaaac gaaactgtac gtttctttaa gcaggagttt gttatgttaa gaaaaggaat     21420
     tttggtattg attgggtctg taatcatgac ctcatccttt gcagcacaaa tatctgtatt     21480
     ggttagcttt tccataccgg aaactctttt gcaagagaca ttaaaagaga gcgctcaatt     21540
     aaacattcca gcctatttaa acggacttta tcgtgactcg atgagtgaga cggcactgaa     21600
     ggtgatggca ttaagcaagc atattcctaa tttgaacttg gcaattgacc ccactctgtt     21660
     tgagcgtttc ggaattcagc aagtacctgc tgtaattgtt gatgatggtc agacctttga     21720
     tgtgatttat ggccatttga gcattcaaga aggattagct cgtatggcag gaagagggga     21780
     tgttgatttt acaccaaggg atatcaggag ggtaatcggt gagtaaagtc ggactaattt     21840
     tcttctgcat cctatctttc tcttcttttt ctcaaaacca ggttgatgca cttcatgcac     21900
     gtgatgaagc cttgcaaaac ttaaaaggat ttaatccagc aactgcatta aaaggctaca     21960
     caataaatcc tcaagaaact tcgcttcaac cgcaagaagg aagcaatcct tttgcttctc     22020
     ttggattaaa tgcacttaaa aacaactcga ctgcccatga ggtttataat aaggccttaa     22080
     acagatctcg agtgcgtgcg aatcccaaca ctcctgaaat gcagtatgct gaaacaattc     22140
     ttggtgatcc agatggcgtc ttggaaggta cctgctataa agaggcaagc cactgcaaaa     22200
     tcgaatcaac agttaaatcc tgcgaagaat ccctgcagta ctccatggtt tcttgcaaag     22260
     agatgacatt gagtgtgaca gtaaaatcac tcagtatgag cttttctcga actgtggtgc     22320
     cacaacgata taagtcagtg acaacatttg atttaacagc ttgttcccca gctgataggc     22380
     agtgctcacc ggctaatacc gttattctga cacagccttg tgaagagatt tctgttcatg     22440
     tcacacacca cggccaacct ttgcgtgtga ctaaacaacc gacttgtacc gacacaactg     22500
     ttacagtgca actttcaggc aatggaaggc tgtctgttcc attgcaggta acagtcacag     22560
     aatacgtgag cgatgaccaa tggcaaacac aggtttgtga acctattcaa tcagagaacc     22620
     tgaatggcta ttgttttttg gaagagagtc aagcgtgttt agagcctaat caggtgaaag     22680
     tgattggagg agttgctatt aaacgacctt gttggggtag ggcattacag tatcaatgtg     22740
     gatcagttca atccaccact tgtactgagt acattaatca gggttgctcg caaactgcat     22800
     ccacctgtgt aaagtcaaaa gctaatcgct gtgagcgtta ttcccaaaca ttccaatgta     22860
     tgcagcaatt ttgtatgcca gaaaaaactg catgcccggg aaaaatgtat tgcatcgatg     22920
     gacagtgcga cacctcaaga gatgaaacca gtgatgacat ggcagaaggt atatcaaggc     22980
     ttgggctact cgccggcgtg gctggagacg tgactgcaaa ccaggttagg agcggaactc     23040
     ctgcaatttt taacggaagt gcgcaagaat gtaaaaaata tcctctgggt tttcgcgatt     23100
     gttgtactga ttcaggatgg ggtgattggg taaaacattg tccggaagca ctgcaggtgc     23160
     ttcaacgtgc aaaacatgaa aaccgtgtgg tgtatttagg ctcttataaa aaccataaat     23220
     taggtgctcg acattatacc ttttgcatat ttcctactaa attagcatca attgttcaaa     23280
     ttcaggggcg tggggggcaa ttaggtattc cgtatggaac agcacagtat cctgattgtc     23340
     gaggacttac ccctgaagaa ctcgaacgca ttaatttcgc ctcattggat ttatcaccca     23400
     tccaggaaga gctggtggct cgcatggtct tgcctaagaa tgattctctt aaacagacca     23460
     accaatccca tattgaacga ttaaagcaac aggggcgtgc tcatgattaa taggatgcta     23520
     attgtttttt tgctacttag tggggttgcg tttgctgata aaccggtggg ttttctatgg     23580
     tatacaaaag aaagggaaac aaaaagagtc gagaaaaaaa cctcgggtat tccttttaag     23640
     agtctaagct atacagagcg cgatgctgtt ctgcgcttct acaccatgga agcgcttcat     23700
     aaagcacggt acaccaaaaa gatggaggac atgcgcgtat ttttaagtct gcaagattac     23760
     tggcttaaag agtcctcccg atttaagtca ttgtttcaga aaacgatgtt ggcacatcca     23820
     gaatatgatt atgcagtgac tcatccgact tctaatctgg gcgcaaaaat caccgatgag     23880
     gtgcgcgaat cccaaaccat agaagttata aaccgcttgt ccaaatcaca tggcttgttg     23940
     tttttttatc gtggaaaaag cccttatgac ttaaagcaaa tacccattat tgttgatttt     24000
     tgcaagcgat ttcgcattca actgatccca gttagtgttg atggcgcaac ctctcccgaa     24060
     ctgctgaatt ctcgaatgga tcaagggcaa gctaatcgat tgggtgttcg ttattttcca     24120
     gcactgctgt tggtgaatcc tgcaagccaa caggtttcac ctgtggcata tggcttaact     24180
     acgcaggatg tcttgatgga acgtataaaa caagtggtca accaatttaa aggagaggaa     24240
     taatgtttgc ccgtgtattt ttgattgtga tgctcgcttt tattggcttg ggtgctaagg     24300
     ccgaaggatc tcaatggcta actaacctga ttgccgaaca agaaggttta gtaacgcacc     24360
     aacgagaaga gccacaaaat acaaaaagaa agggattttt tagcacccat ggattgattt     24420
     tgttttatgg aagccaatgc ccacattgca agcggtttgc accgatatta aaagggtggg     24480
     caaatcgcaa caaagcagaa gtcttgcctt tgtcgttgga taatcaacca ttgcctgaat     24540
     ttccaaaatt tttaccggca actacagagt ggattaatgc ggcatttggt ggtaattcca     24600
     ttaattatcc ggcacttttt gtggttaacc ctaaaacaaa aacattatat ccagtgggtt     24660
     ttggttccat gacgaacgct gaactgaacg accgaatggc tgtactcatt tcaaaaatca     24720
     aagcgtatga aatcaagggg agactgtaat gaaaaaagcc gttataactc tgtttttatg     24780
     ggcttttttc cctgttgttc aggctaatgt aagtcaagat ctcgataatt tctttaacgg     24840
     gatgggctat gcgtctaatg tgacttcgcc cgatgccttt gaatctcaag ctgcaggatt     24900
     ttttggtggg ggttcactct atgctcgtaa tcaggtacgt cagtatcagt tggtgcaatt     24960
     ggatttgccc agttaccgtg ctggatgtgg aggcattgat ttatatactg gcagtatgag     25020
     ttttttaagt gagcaaaagc ttgttgattt gggaaaatcg gtgatgacca atgctggtgc     25080
     ttatgcagtg gatgtgatgc ttgcctctac ggttcctgaa ctgaaacagg taagggatta     25140
     tttgcagcaa ttggaacaaa tggctaacca ggccagcatt aactcctgtc agctctcaca     25200
     aaacatggtg ggaggcattt ggccaaaaac cgcagaaagt caacaaaaaa tctgtaaaga     25260
     ccaggcggcc atgggaaaag agggattgtt cagtgattat gtgaaggcgc gaatggtttg     25320
     cgcaggtact ggctttgata atgtgatgag caaagcatct caagatcctg agcgtaaaaa     25380
     gcaggtggtt ttaaataaaa atcttgtatg gtcactgttg caagccaaat cattcttaaa     25440
     cagtgacaga gagttggctg aaatggtgat gagtttaact gggacactga ttattgacaa     25500
     agaaggtaag gtaaccaacg taccttccct tgctggaaat gctgatttag tgaatgcgct     25560
     aattggtact ggaaatggcc cgagatctgc aaagatatgg cgttgcaagg atgcgggcag     25620
     caatagccaa tgtatgcagg tgagtttgca agatatcacc attcaagaaa cttcaacgct     25680
     tacctataaa gtacgcgaga ttattcgcac catcaatacc aaactcatta atgacgaaaa     25740
     acctggtaat cgtgagctta attttttaag tatgacatcg ctgcctgtga tgaagttttt     25800
     gtcggtatta aacagcatgc actatggcag tagtgcggta gacatagaag agtattcaat     25860
     gctgatagcc caggacttgt taactaatta cctaatcgaa ttactgcgtg aggtcagtgt     25920
     agccacagca gggtctgaat taaataccga tttggtcaaa gaaattcaaa agcgcattaa     25980
     tgaagcaacc acacacgtgg aatcacttga tccaaaggta ggtcgcaaac tacaagaaaa     26040
     actcaacctg attgagcgta tggcgcaaat tgaaaaacag gtctcttctc aaatgaacag     26100
     tactgcgggt taaggagaca atagatgata acaattcatg tcttggctgg aggtgaatta     26160
     ttccaacacg tactaaatgc cattagcgcc tttatgaagc aggacagttt tttagggctt     26220
     ttacgaatta ccgcattaat tggaatcgtc atggccacca tcggttttat taaaacccgt     26280
     gatccgatgg catttgctcg gtggttttta ggttatgtgc tgtttgtgaa tttggtgata     26340
     ttacctaaaa cctccgtaat gattgacgat atttcttctc aaacaccaaa actcgtagat     26400
     aatgtacccg tggtatttgc gttaagctcc agtttagtca caaccattgg ctatggtttg     26460
     gctcaatcct acgatgcatt acttaccatg cccaatgatt tgcaatacac caaaacagga     26520
     gctctttttg gttcccgtct ggtttcagca tcaacctcat ttcgtattaa agatcccgtg     26580
     cttaaagaag aaatgaatga gtatttccgt atctgtgtcg taggagacat tcgattaaat     26640
     cgaaagtaca gtgtcagtga tttagcgcat tccacggaca tttggaatct tattactgtg     26700
     aaagcttcac cgcttcgtat gctctctgtg aatggcaaat tagtttcatg cttggaggcc     26760
     tcaaaacctg atgggcagta cagtttgcgc aaaaagctgg atgctgaaat taaaaaagcc     26820
     tacacatttt ttggcgtgaa tttgtttgga aagcctaaga ataccactta tgaagcgtta     26880
     tttgctactc atcttaaatc agcctttgag tattaccagg gattaaccga ctcatccagt     26940
     aacatttttt tacaaagcat gatgattaac gccataggcg atggcgtggc gcattatcag     27000
     gcgtttaccg atgcaaccgc aggaattgtg aaccaacaat ttacaaaatc ccaggtacaa     27060
     caccgctgga gctgggaagt attagggcaa aaagccttat ggattttgcc gattacccac     27120
     acctgcttaa cacttatatt atttggtgta tttccgttga ttattgcatt aaccacatta     27180
     cctggcggga tacgaattct ttatggctat atgcagtttt ttatgtcgct gcaattttgg     27240
     ccagtgctct ttgcaatact caacgcagga atgaccattt atggcgcttc ctcatcgggt     27300
     gaatatggtc aatttacgat ggtgaatctt gataagattg atgagttgca tgcggatatc     27360
     tcaggagcat gtggctattt gatgatgctt attccttttc tctcgcatgg tttggtttct     27420
     aatctaggcg gcgcattcag taatctcgca accagcatga tgagtcatat gcaaggctcc     27480
     agcatgtcag tggcagcgga ggcagccagc gcctcttttg gtcttggtca aaccagtttc     27540
     tataacacta ctgctaataa tttctcagcc aataaacacg attccaattg gactcacctg     27600
     cacggcatgc ggacttccca attgggaagt ggtgtgttaa aaaccattac gggcagcggt     27660
     gatagagtgt ttgatgtcag tccaggaatg acgagaagtg ctgtatctat aaatgcactg     27720
     gaaggtttaa gcgcatcact gaaccaggct tatgagcaat cgacacaagc tgctcgaaac     27780
     gaatctgcac actatcagaa ttcattatca aattttgccc atcgagccct gcaattatca     27840
     caattggcag ggcatgacat gcgtttggga gatagcatat cggaaagtga gacaggtcaa     27900
     tactccaaag ccttatcaac cattagccat attgcagagg atgtggcgcg acgcttaggt     27960
     gttagtaaag aagacgcact aacacatttg acaagcggtg gtttaagtgc gcaagttggt     28020
     tttaaaagcc agggtagtat atggggtaag cttgcacaat ggggaactgg ttttcatgca     28080
     agcgctgatg cgcatcttaa attcgatcgt aattctacaa gtcaagataa atatcacacc     28140
     ggtatggacg gttccctttc gtctcgtgaa tcgcgtgatt ttaatgacgc gataagttat     28200
     gtgaaacagt tttctcaaaa tcatcatttt gatgatagtc attcacaagc ggcttcattg     28260
     tctaatcaat tgggtgctga tctgagagag gcagaaacag ccagccgtaa tgtggacgct     28320
     tcccttgcca aagccacacg cattcagaat gccaaaaact tcgtggaatc tcattcatct     28380
     caaattacca ctgatttaaa tcaagcattt caagcttatg tagctgctag gcttaatgag     28440
     tcagagcgcg atgaattgta tagtcaccca ggggatctgc gagcgcttaa taaacttcag     28500
     gcattaggcc atgactttat tgcatccaaa cgagacgagt taattgccca attcggtaat     28560
     acagaacata aatcacagat agaatcgttt tatcaaaaag aaaaaagcgg ctttattgcc     28620
     aaagaaaacc aattaggatc ccattatcaa aaaaacagcg aagagtttct tcatcaggca     28680
     caatcaatga aggttggcat aaatgataaa gagcttggag tatttcatca agaggtgcat     28740
     caacaaaaga gtactttgcc tcaaaatcta aaacaaggag agcaattgat taagtcaggg     28800
     agccgtgatc taatgaatga aaaagatttg aggttacaag aaggcatgat gaatgctcaa     28860
     aaaaatgtag tagtgccaga gaatatgcac ctgccttttg aggacaagaa attacataaa     28920
     aaaggagagt agagtggatc caaaacaatt aaagcaagcc atagcagagg acatgaaaac     28980
     tattaaaatg ctaaacccag agattattcc tgcccgtttt tattacggag ggctcttaaa     29040
     aggagttttt aatggggtat ggcggatgtc tataatcctt tttttaacgc tatgctatgt     29100
     tatgagtgat gacaaggagc cgatctcttt ttcctccttg tttattgatt caggcattac     29160
     cgctctattc ttaagcatcg ttgcgatgct tatcttgcta actcccatta gtttttttgt     29220
     tcaatttcag tttcatctgg agaaaaaatt aaagactagt gcattaataa gaaaaaaatg     29280
     taaccacatt tcaatggtgt tttttggcat gtttgcattc ttgtgtattt tgtttggcag     29340
     ttatgcttct ggacagcaga ttttttttat gttggtagtg tcattcttcc tgagtttagg     29400
     agcgactcat attgcggtcc atatggaatt aagccgaatt ggctttagca gcctatttac     29460
     tctatgtaat gaattctttt ctaaaggaaa aactgtctca atagaagaag cccagaaata     29520
     aaaaataaaa cgcaaaaaga ataaatttta accattttac aggcaatggt agctactgct     29580
     ttgcctaaaa aagaggataa ggagtaaata ttgtgcgtga agagccgaat ttcaaacact     29640
     atactcgtgg cgggcaaatc agttttcaca atctgcggat gtgggatcaa attactaaaa     29700
     cgttggtatg ggtttgtctt tttctttggg tcgtattaac cggcttaatt acctggttgg     29760
     ttatatctcc cgaaaaattc caccaagcca ttgcttatta ctatgcaagt ttcttaaatc     29820
     tcgttgggca aaagcatacc ttcacgcttc cctttcacgg aaaaaactat caacaaaacg     29880
     tggagacaat tctgcattat ccttattaca aagagaatgc cgatcatatg gtagatctat     29940
     taggaaaatc ttcattggca gctttcgtat tttcatttgt tttgggactt tgctttgcct     30000
     tttattttat ccacagggga aaagcgcagc gtgctaatca gtttattcgt ggcagccgta     30060
     ttgatacaaa ggaaaatgta atccaacaaa tcctggacaa aaaagaaaac tctgatatca     30120
     ctattgacgg gtttcccctc aaagcgaaca gcgaagttca acatctgttg gtgcatggaa     30180
     ctgtaggtac tggaaaaagt cagctcatta tgaaaatcat ggatgcctta cgcaagaggg     30240
     gagatagagt tattgtctat gataagggat gtgcctttat tccgcattat tttgattcaa     30300
     atcaggatgt cattctaaat ccctttgatg cgaggtgtcc taattgggat atgtggcttg     30360
     aagcacctcg ggattctgat ttcgaaaaca tggcagaaag ccttattccg atgcatggcg     30420
     attctgagcc cttctgggtg aatgccgcga gaactgtatt ttcttcggtt gctgctaaaa     30480
     tgcgaaaaga taaagatcga tccgttgaaa aattgcttaa gttgctgttg accggtgagt     30540
     tttctcattt agaggattat cttaaaggaa cagctgctgc aactctagtt agcggtaaaa     30600
     ttgaaaaaac ggctatttcc attcgttcag ttattaccac ttatttaaaa tcgctttcta     30660
     ccttatcagg acttgattca gaaggggcaa gcccattttc tattcgtgac tacattttaa     30720
     atgaacagca cagtggttgg ctttttattt catccaatgg cgaacaacac aaatcattaa     30780
     agcctttaat gtctatgtgg ttagccatgg cttccctcac attgttaagt cttacgccta     30840
     atccagatcg ccggatttgg ttcatttgtg atgaattgcc aagtcttcat aaattaccgc     30900
     ttttaggtga gaccattgca gaagtccgaa aatttggtgg ttgcttttta ttaggaatgc     30960
     aaagtttctc tcagctcacc aaagtgtatg gtcaatcagg cggtgctaag gaattgtttg     31020
     acttgctgaa cacccgtttt ttctttagaa gcccaagcgc tgatatggct cgtttggttg     31080
     ccagcgagct gggagaagaa gaaattgaag aatcacgaga aaattattcc tatggagcta     31140
     atagtattcg agatggaata tctcttggta gccagcgtgt gacacgtccc attgtatcct     31200
     atccacaaat tttggaactg gaagatctaa gatgttttgt gcgtcttcca ggaagttatc     31260
     ccattactca actcacgctt gaacttgaga atcggcctaa atatttgaaa gggtttgttg     31320
     agcgccaatt cattattgat gaaatgctac aaaagctcgt taaagaaact gagagcacag     31380
     aggatgaagc tattgcgaag cgcaaatgcc ataacaaaaa atccgtggaa atagaatttg     31440
     aagtttagaa taaggaatag gcatgctcag tgtagaaccg cttaaatcag ctcaaggtgc     31500
     tgctgattat tactctaaag cattcaatta ttattcaggc gatgccacag ccatgcagtg     31560
     gctagggcag ggtagtcaaa aattgaagct ctctggtgtt gtgcaaaaag aacagatgct     31620
     ggctttatta gaaggtagat tgccagatgg ccaagtttta caaaatcttg aaggagaaca     31680
     tcggcctggt tttgatatga ccttttctgc tcctaaatca gtgtcagttt tagtaggatt     31740
     aggtttagca cctgaattag tacggtttca tgatgaggcg gtgcaattga ctatccgaca     31800
     aattgaaaag gaatttgcag aaaccagggt ttcccgtcgg ggtgaaattt cttttgagaa     31860
     gaccaataac ttattggttg cagcattcag acagccaagt tctcgtgcta atgatccagc     31920
     attacatacc cactgtgtca ccatgaatat tacatttcat gaaggtaaag cgcgatcatt     31980
     gtcaagtgat ccttcaagag aacatggggt aatcgagcag attcaaaata atgctcacta     32040
     ttgtggttta atttatcgtc aacatttggc caataagctt aaggaaacgg gctttcattt     32100
     gcgattaaca ggaaaaggtt tgtttgaaat tgatggtgtt cctgatgagg ttttacatga     32160
     attttcaaca aggcgaatgg atattttggg gtatatggat gagaagggtt ggaatggtgc     32220
     aaaaagtgca tccactgcta ctgtactgac tcgcaagaat aaagaagaac atgatatcaa     32280
     tctccttaca gaagattgga aacaacgcgc aaaagatata gggtttgatg ctcaagcgtt     32340
     tatgcaacat cgagataaat cgcaatctat ttcttggctc tcaggggtta aagatagatt     32400
     attggcttta gtaaacaaat ataaaaaaga ttctagccca tcagagatag aagcagcaca     32460
     cgcttgtgtt gtcgtcgcaa tagaaacgtt aagtcagcga acttcaattt tttcagaaag     32520
     aatgttaact caagaagcga tgaaacatag tcttatttat ccaaaagcgg tttcaaggca     32580
     atcaattatt gaatctatcc aacaagaaat aaaaagtcaa acgctatatg aagcaagatg     32640
     cttcgatcgt ggagaacgct tgctcacaac accttggctt ttaactttgg aaacagaaac     32700
     tatagccaga attgatcgca ataaaggtgc agttcccgct attgcccacc ttaatgcagt     32760
     tacagctttc cagaaaatgc gcagctcttt gttaccttac cccatgacca attcacaaaa     32820
     agaatccatg aaggtgttgt taacgagcaa agatcgatat ttggctattc aaggttatgc     32880
     aggagttgcc aaaacttcta tgctttcaga ggcgagaatt tttatcgaag ctcaagggca     32940
     taagctccgt gggattacgg ttgcaagctc tgcagcacat gagttgcaag aaaaagcagg     33000
     gattaaagct gatgtattcc ccttggtgca tcaggaattg aaagaagcac aaacagcttc     33060
     cttaactaaa acactattta ttatcgatga agcatccatg ctttcttctc accaaggcca     33120
     tgagttgatg aagcaaattg agcgtgttgg tgcacggctc gtattagttg gggatagagc     33180
     tcagctaccc agtgtgaatg cagggcgaat ctttgggtta acccaagaat atggtattga     33240
     aaccgctgtc atggatgaag ttgttcggca aaaaaacgag atcttaaggc aagctgtaat     33300
     agcaaccacg aaaggttttg tgcaagaagc attagataat ttggatgtta aaacgcttgc     33360
     gactcataaa gagcgtattg cttggattgc caatcattgg ctttctttat ccgcatccgc     33420
     gcgagatgaa acgttgctat ttgcgccaac acacgccaat agagaagaaa ttaccacatt     33480
     tattcgcagt ggattaaaac aagaggggac cttaaaaggc gagcagttta gtcaaattat     33540
     tcttaaaaca aaaatgatgg aacctatcca gagccgattt gtggcctatt accagaaagg     33600
     cgatatggtg cgttttaacc aaagttttaa aaggaataaa attcacgctg gtagttatta     33660
     cacggtagga gaaattagta aaaagcatcg tcaagataat gtgttaccac tgattgatga     33720
     gagtggtaat ttaatcaaat ttaatctaaa caatctgcca aactacaaaa ctcatacagc     33780
     cccttttgaa cgaaccattg aagtatatga aacaaaatcc ttggagcttt tggttggtga     33840
     taaggtcatg tggacgcgaa attttaaagc taacgatata cgaaatggtc aatgtgcgac     33900
     tcttcatgaa ataaaaaaca actcttttat gtttatcacg aaagaagggc gtttattaac     33960
     actcgaaaaa tcccatcccg ccttaaaaca tcttgattat agctatgttc ttactaacta     34020
     caaggttcaa gggaaagatg caccctatgg cattggttta atggaatcat ttcaccgatt     34080
     tggcagtacc ttaaacaatt tttacgtcca aatttccaga gcaattcatg gtatgacttt     34140
     ggtaacggat aataaagaag aattagttca tgctattcga agaaattcga acgaaaaacc     34200
     agcctcaatg gatattacct caagcgcaca attaattcat catgagcgtc gattcggggc     34260
     gcaaaatcaa ttatccatac aatcagtaat tgataagaaa aaatcccttg aaattcaaga     34320
     aatatctaaa tcaatgaatc aagatgatct cattattgag aagaaaggac ctcatttaac     34380
     caagcaatta agtaaagaat tagaactata agataggagg agtttatatg tcacgtttaa     34440
     ccatttcatt gccagataat ttgcatcaac acatatcagc attagctata aaaaataatg     34500
     attctatgtc caatatgatc aatcaattaa ttcaagttgg attacatcac tggtttaaaa     34560
     atgacggaaa cttcaaagca aatccagctg tcgaaaagta ctgccatcaa ctaattattc     34620
     agatgaatgc gcttattaaa aatatgtcaa ttgagttgtt gaaattggat agagaggatt     34680
     ttgagaagct acagcaggct gcggctatta aatatagcga acttaaaaac agtgcgcatg     34740
     aaaatcttta gaagataaaa tggtgaacct atggtgcaag agatggtgaa gattatacaa     34800
     gttgatgtta gaggccatga aaaataaaga actttcaatt attttacttc accattaccc     34860
     ttcaccagct attcaccatc tttttaggta aaaaaatgaa taaaaataac caaaattacc     34920
     tataaataaa ggacttataa cgcatatttt aatgatgcga aaggtgtgtc tctgctttta     34980
     gaactggatg ttttgtttat ttattgggcg tttggttttt actcttttat tcactgctta     35040
     agtagcgcat tacgattgcg cgtttgtgat tgattcaatt agtgatgttg tatagcatgc     35100
     tacttaatag tttaaaaaga agttttaaat gcaaagactt ccaatgcaga aataaaggat     35160
     tatagctcat gaacaggtat tgatgatgtt aaccatcttt ggaagagtca tcgaccatga     35220
     tttttgggtt aaattataga tatgggataa acataaactg aattgatgtt tctgtaattt     35280
     aacccaatta attgaaacga agcctataca gcacactttt cattacttat gactttccat     35340
     ataactcaga gctgcatcgg ccaaaaagga ggaacgattt tttatcgcat ggtttttggc     35400
     atacagatcg atgaggctta aaatgcgctc tggcatagtg atattaatgc gttttgcttt     35460
     acccgatatt tggcttaaat caatgtcaac aaatgcccat accccgccct gaaactcttc     35520
     atcattaatc catcggtcaa ttgttgtacc aactggaaga ggctcattat ctattaataa     35580
     tccttccaaa tggcattcaa ttgcctcaat tacgttagtt aaagcttcat cataagtgct     35640
     accagaagaa tagcatccag gaatatcagg gacaattaca ccaaaatcac tatgttcgtc     35700
     tttatgtatt actacaggat atctcatttt atatcctcct tattaatacc agcttgttta     35760
     aagatactgg ccactgtttt tataggtaaa tcttttttag gatgaggtac tgtcacccta     35820
     ccctttttgg tgggatgttt aaattggcaa tgacttcctt tctgatgaca ttgcacccaa     35880
     ccatcgcgtt caattatttt tattatttct gcgcttttca tattttatat tatacacact     35940
     atacacacat ttgcaagaaa aggctttcat atcactaaat gagaccttgt gatatctaat     36000
     taagcatcaa aagaatactg ggaaataact tgatagaatt tcatctacta tgaggttaat     36060
     acccttatcc ctcgatctta ttaatagatt accatttaca acttgaaata actcatcttg     36120
     attatcgtgc ttatgccatt taagctcgcc tttaaatttt acttgtttaa tttgcaaatc     36180
     attcgcctca ccaactattt taggtgacca atattcactg aacaaatcaa aaatttccta     36240
     caagcaaact ttaaataata caaattaact cttaattaaa actacctaat tccttttcga     36300
     ataaaaattg tatcagtcaa gactgttttt tttaattttt tttgttatca taatgaggtg     36360
     ctcacaaaca gtgaccagca tattttcctc tgtggataac cacacccatt tttcagcctt     36420
     attacaaatt gatagcataa tttttttatt aaaccccttg tcctgtaagg acttatcaaa     36480
     atattttgca ttgattactt atccccattt tctgtggata agtctgtgaa tacactgggc     36540
     ttatactcta aaatccagta cttagagaga tgcttgttct tttagcaaag cgcaataaaa     36600
     aagcatgaga attagagtta aaatagatcc cacttaagta ttaaaagaga gttatttttt     36660
     tatccttaat cccctttcga acttaaaaat atattattca ataacaacag aagccaagct     36720
     ttaaccaaca caaaatcaag atcttttgct caaccaggtc tcaattttga agcccctctt     36780
     cggggcacta gactacgctg caatttgagc ctgctctttt tgcaaaggct caacaagata     36840
     atgaaatgct tttgctgcca tattagtagc tcgcataatt tccttttcat ttaatagagt     36900
     tttccatgag ttaacatagg aggcatgatt ttcaatatca cttttaattt taaaaaatgc     36960
     acaaaggaaa aatgcgccaa attcagcaac taactcttct tccgccctac ccttttcagt     37020
     tccataggct ttcaaacttt ctctatttaa gcgatattcc acaccagtcc agtgcgttaa     37080
     ttcatgtaat agagtcgcct cataggcagc cttatcagtg aattgctctc tgtgaggcaa     37140
     cacaatagta tcatttactg gtgtataaaa agcatgattc ccaaagtggc taatagatgg     37200
     cttaatataa ttcagcaact gattgcattg gaactgctcg ttttgacccc cctccttttt     37260
     aaacaaggta gtttgttcca gattaaaaac ataataggtt ttaaaaataa aggatgattt     37320
     tttttcagac tcattagttt tttgattaag ttctatctga tcctttaaag accaaaaata     37380
     aatttcttct gcttttgatc cattaagaac ttgtccacct ccctttttaa tttggttgaa     37440
     cgtcagccat tggttggatt taaacccatt ttccatttgc gcaaaaaata aagaaaacaa     37500
     gttgccaccc cgataaatac cattgatgcc ttgaggtaac gcatttaatc cctcaccact     37560
     ccactctttt ttccattgca ataaaccccc atgtttctca ataattgcaa acaaacggcg     37620
     agcattgagt gcacaaaatt cctgatatga tttcatgata tctcatcctt tatctatttg     37680
     ttctttaacg tgtccttggc taaattgagc aatgcgttaa aggttactgt agacgatgga     37740
     atccagctga tttctggata taagcagttt taaatgattt gaaatagact tgtttatttt     37800
     tagagcgata aaaaaagatt tgatacaatg gaaaggtttt gatagattca cattagtcat     37860
     tttcactact ccaatagtgt tgatgatgag tgatattgag ctgctccaac agcttgatat     37920
     cacgacttaa ataccccttt attttaacgc taagattatg atttttcaat aaatttttct     37980
     ttttgcacgt tgttttttct catttttttt ctttgcattt cttgcgtttt ctattatttt     38040
     gttgatgctt ctgattccta aacccatcgc tttcaaaacc aaatcaatga gcgaagcgaa     38100
     ttccttgtta aaatgcaaaa caaacattta gtactgttgt tgcttcgtca tccatccccc     38160
     attcgcaatt tattgtttta atggaataaa aagacaatac aaggtggaac acagtagtaa     38220
     aatgacgagt agaccttgta ttgttttttt atgtagtcaa tattcatagc gaataggagg     38280
     atagatgacg aagattacca tttaaaatgg tgttagagtg tctttttaca agtagattat     38340
     tcaaagtaga aagggctggt cgtgtgtcgc gaccacaccc attggattga cacaaagcaa     38400
     gtccaacctc gcttgttaag caagattata caaatttatg atttggtatc aatgttatta     38460
     ttaatatttt taagaatgag aaatatctta cacaccattc agaatttata tccgtgactc     38520
     cattctggaa tttgttatga taaaaaaacg aggaggcgga attggagcat caggcaagat     38580
     ggaagccaca tggattgtgg cgttcaattc cccctcgacc aactttattg taaggctcaa     38640
     atttattaag caaaaactcg atttttctta aaaatttaaa aatttatact ttaaggatcc     38700
     tactcattaa agtgacgacg agcatgttca tactcaggaa tatgaagtcg tttgatcatt     38760
     tccagtactt ggtcttgtgg tatctgttgt tcttcaagca aggtgagtaa taacattagc     38820
     ccgccatctc cgagatacca agacagctct ccatcattta ttataccacc atattgttta     38880
     tacactaatt cctcattata ttgacaagaa cttccatttg agccatagcc agcacgatgc     38940
     gccaagcgaa gaccgtatgc ctcgttttta ggtacagata caatccattc tacccatccc     39000
     tcttctggtt tctgaatcaa tccaccacac gtgtcacaaa tccaagtttt cgatcttttt     39060
     tctaatgcat taccattttt tgcaaaaatc cctgacatag tattccaatt cttaaagcca     39120
     ttcattattg caatagcctc taaacaagaa gaatgtgtaa tatcatgatt tttttggcca     39180
     agaaaatcgc gtaagatttt tgcttgtttt ttaaattcaa taagagaagt catatttaat     39240
     tcctcaatag ttatttgctg ttgccaatgc ctacattttg gaagctaacc attaaagatc     39300
     taattatgat ttaggatagc gtagaaacta tttaccgtcc ctttaaaggg tgtaggcgga     39360
     taggtcagtt tcaaaccgaa ttgaattttg ctactaatta tgaatttatg tcaacttata     39420
     ttttggacgg agaaattaat ctgtacttta taaccaaatg aaagatgaga tggaacaaca     39480
     atattgcaaa gtaaattgca tcagtgaatg ggggaattag aaggtattat gaatgaactc     39540
     taatttaggt tgccacaaat tatgggatgt ttacatttgt atctggcgat aaaattaaat     39600
     tcaacaaatc caaataattc agattcctgt ttaatatttt tggaaatttt atctgtttaa     39660
     ttaatgatat catttcattt gatattataa ttacatgagt tgttaggata accaaatcaa     39720
     ttaattccct tccctatttc ttaagctaag aattgtaata ccaatactag atcctttatg     39780
     ctaataggaa aaattcatta acaaggatgt ttatgaggat atcaaaaata ttatgcttaa     39840
     gtttatttat tatcagctca atagcatttg caaaacctgc tgaaactatc ccgtcaatac     39900
     aggttataaa ttataaaaat gacttggctt atattattac ggcaggtcct gaggttgtgc     39960
     acggttctaa ttatgaagag gcctgtagta aattagcatc atacggatat acatggaaaa     40020
     ttgttccaca caaaagcgcc gaccctgcat gttactcccc aacagataac gtacttatgg     40080
     gagctaatac ttggtactgc gccgattcaa cattagcata ctacaataca ccttggtggc     40140
     tctgcagtga atcttttacc acttgcccta atcctacctg gactcgttct aacgatggat     40200
     taagctgctc aagaccaaat tcaacttgta ctgaaactcc agctacggtt tctgaagtaa     40260
     aattactcgc agctatagtt tatggggaag catctgctac taatagcacc tatgaggaaa     40320
     aagctgcaat tgcaaatgct gtagttagat ataaaaattc taatggctat cctactgtga     40380
     atcaattaat tctggataac ccagcttatt cagctgcagc ctctaataaa gtagtaagat     40440
     atcgtcaagt gatgtgttct gatgtagcta tcgaatatcc agatctatat aatgctgcaa     40500
     tgaatgctct tgatcctgag ggtgtcgact atgcaaatgg tggatgcttt tgggatggta     40560
     atgatttagt aactaaaggg gcaaaacata gacattatcg caaagggtat aaatttacag     40620
     atcctacaca tgatgtactg tcagttggag atagcgcccc agcaaattta actggtaaat     40680
     ttggtaccta taattacact tatgaatcaa ctgcaggata tggtcagact gtattttgga     40740
     agttaacaca agaattctta acggcgcaaa ggggtaaaca atgtcactaa atcaattaaa     40800
     tattatttta tttggaatgc taatttctca attcgtattg gcagatgtac ctgttgaagt     40860
     gattggatct tgtaaaaatt ctagagcagt taacgcttca gttacttata ccaaaataat     40920
     tccgccagca ggagttgatg attcccccgg atgtaccaat cacatagaat ccacagaagg     40980
     atcttttaat tacggtgcaa taacatgtaa tcatgaaaat tatctgattc ttaagtcaga     41040
     tcgcatcaat ttaaatacag ctcaaaatca ttcagtcaat ccctcgataa ctcctggaaa     41100
     ccgtataaca caattatcag attggtcaaa gatagtattc gataataatg agtatctttg     41160
     tattgatgtt gaattatcac aatctggaga aggcgctgat gtttcacaat attatatagt     41220
     tgaaaatgct tttaatactt ctacaccagt tctccatttt tattttttca ataaagacat     41280
     tatgccaatg actgatgcta actaaatgag aaatttttgg taagtgtatt gattcgtttg     41340
     aatgtgaaaa acttaaaaat tagtttctat caatactcgt tttcgtcatt acaagccgcc     41400
     cacttttgcg aataactaat tagtaaagcg gacggcaatt aaagtatatt tgtcattttt     41460
     aaaatagttg tcttgcaccg tatatagtta tagtgataaa aagaccaaag gataatttta     41520
     accatctatt gaaatgtccc atatcccact atcaaactat ggtacctctc cttttgaaaa     41580
     actgcttggc tatgttccgg agatcttaaa taattggtct aatttagaaa atgccttttt     41640
     gcagagcaag acttttgaac ctaatttttt agagcagata agacgcgctt tagtatttga     41700
     taatctttgc tactattata tagctaaggc aagacctcct gaccaacgac cagaagatat     41760
     tctgcttacg gccgcattaa aatttgcaaa taaatttgct attgatcata aaataatcaa     41820
     tgaacaagat attgatgagt taaagcaatg tttcttgact aacgaaatca gtgaattaat     41880
     ttcttattgt tcttttatta ccgcatcaca acgttttgga tccgtgttag gtctacagcc     41940
     agctttaaaa tatgatcaaa aatgatggtc agctataaga atcatctcat cacaaaaaat     42000
     gtttttcatt gcctgtatta ttcgaattgc tagattattg ggattttatt ggtgtcatct     42060
     tgtggtatac gctaaattga cactgggcaa agtgaaaaat tatgtcagaa tagagctcaa     42120
     tttttaataa attgacacaa tcaatttaaa atcttaaact ttatcctgac gattttatag     42180
     aaatggagtt tttatgtctt catcaggtaa aaccatcgga tatgttcgag taagctcttt     42240
     tgaccaaaac ccagatcgcc agctggaggg aattattcta gataaaaaat ttatcgatca     42300
     catttccggg aaaaatatta aacgaccgca actggaaaaa cttctcgact atgtccgtga     42360
     tggcgatgaa gtggtcgttc acagcatgga ccgattagcc agaaacctgg atgatttgag     42420
     gcaactcgta aaaagcttaa cacaacgaga tgtgactctg cgttttatta aagaaaattt     42480
     ggtatttaaa ggtgatgact cacccatgtc caacttgctt ttatctatta tgggtgcctt     42540
     tgctgagttt gaacgtgcat taattagaga gagacagctt gaaggtattg ccattgctaa     42600
     acaaaaaggg aaatacagag gtaggaagcc ctctttaaat aaggatcagg ctgcaattct     42660
     tcaagagcga gcaaaggctg gcgaacaaaa gactagctta gccaaagaat ttggaatcag     42720
     cagagaaaca ctctatcaat acttaaaaaa caatcaataa gtaactaatc agaactaacc     42780
     actatttcag taactgacga aaccaggaga gcattcaccg tatgattttg tgaaatatct     42840
     aaatttatta ttgagttttt gaggattaaa taattctcag taatgctaaa taaatttacg     42900
     attgactcag tgtgattcaa acaacgcggt agagaatatc ctagctcatc aggtagtaat     42960
     ttttagcata cgtgtataat taacgtacac cattagatta ttctcatgat tcaatagata     43020
     ctcatcaact aaatttaatt ttctcagtaa tcagacttca caatttattt tgacttcgat     43080
     ccaattacac tcatttccat ggaactagag agtttatttt tatttgttta ggttatttat     43140
     agatttgact aacggttgct gtactccata aagagaaatg gagattatag tcatgattag     43200
     actttcctaa tcaaaacaag gtcaggcctt ggtccgacct tgctgcgtag cgtgctaaca     43260
     cctttaacat aataacttct aagctgcctg tacggcagtg aacatatgtt tcgaattctt     43320
     gattaaaaat atcgctttct aagctgcctg tacggcagtg aacagaagac cttttaagcg     43380
     ccgttgtcgg cattttttct aagctgcctg tacggcagtg aacaggtctt tttgcccgtt     43440
     tttttatctt catgttttct aagctgcctg tacggcagtg aactacgtct ttagatgagg     43500
     tcataaccac gtatttttct aagctgcctg tacggcagtg aactgtctct gtttgctttg     43560
     gggcacaatc cagcatttct aagctgcctg tacggcagtg aacagaatcc tgaggattat     43620
     gttttgttcg aattgtttct aagctgcctg tacggcagtg aacgttaggt tccggaggcg     43680
     gtgacacggc ggacatttct aagctgcctg tacggcagtg aacgcgcaaa ggttagaaag     43740
     caagtcatga ggtaatttct aagctgcctg tacggcagtg aacagtttat ctgatgttga     43800
     aagattaact gttaatttct aagctgcttg tacggcagtg aacgataaaa gcggtctatg     43860
     cggccgacaa attcctttct aagctgcctg tacggcagtg aacacatttg tgttaggttt     43920
     agttgcgcct cttgttttct aagctgcctg tacggcagtg aaccttataa gccatcaaat     43980
     gctgctggaa ctgcttttct aagctgcctg tacggcagtg aactctacag aaagaaggct     44040
     atatctaaat agatatttct aagctgcctg tacggcagtg aacacaccaa gtttagggcg     44100
     tatgtcggcg gcttttttct aagctgcctg tacggcagtg aaccttgagt tgcagacccc     44160
     gggtcttgct gctgatttct aagctgcctg tacggcagtg aaccgccggt atatgacgct     44220
     gaattaaatt ttatatttct aagctgcctg tacggcagtg aacattgacg atagcgttac     44280
     ctactaagtg caagctttct aagctgcctg tacggcagtg aaccatggag taattattaa     44340
     tctaagttca gggcatttct aagctgcctg tacggcagtg aaccaggtaa aatatattcg     44400
     actgaaatct caatctttct aagctgcctg tacggcagtg aacctggtcg agctcgtcat     44460
     agctaagggc tagtatttct aagctgcctg tacggcagtg aactagcaat tacttgcttt     44520
     gcttcttcac atatctttct aagctgcctg tacggcagtg aacgaaaggg caatagttaa     44580
     gcgcatggca caagctttct aagctgcctg tacggcagtg aactgacccg tcaactaaat     44640
     ggtggagcac gtttttttct aagctgcctg tacggcagtg aactgtattt gtttttcaag     44700
     ctgctcaagc tcagatttct aagctgcctg tacggcagtg aacaataccg gcacattcac     44760
     ggtgtaggtg cacattttct aagctgcctg tacggcagtg aactcttccg tacttctcac     44820
     catactcacc acagttttct aagctgcctg tacggcagtg aacttaacga aaggtttatt     44880
     tacagttcaa aatgatttct aagctgcctg tacggcagtg aacatgctag tacctaccct     44940
     atcgttcatg aattatttct aagctgcctg tacggcagtg aactctacaa aagaggccat     45000
     aagagcaact ctcaatttct aagctgcctg tacggcagtg aacattagat gcccagcgtg     45060
     taaagggact aagaatttct aagctgcctg tacggcagtg aaccttttac tgattcttca     45120
     actatctgtt caatttttct aagctgcctg tacggcagtg aacgttaggt tctggcggcg     45180
     gcgacacggc agacatttct aagctgcctg tacggcagtg aacattaaca gccttcatca     45240
     tttccaagcc cgcagtttct aagctgcctg tacggcagtg aacaatatga tgcgtgtaaa     45300
     atattagagc tggaatttct aagctgcctg tacggcagtg aacccattat ctgagcagat     45360
     taaaaaaatg gtaattttct aagctgcctg tacggcagtg aacgctgaat gattctccga     45420
     aaaccccatc gagtgtttct aagctgcctg tacggcagtg aacgttcccc atctcttgag     45480
     cagaaaaaca atttttttct aagctgcctg tacggcagtg aacttagagc aatacatacg     45540
     agataattat acgcctttct aagctgcctg tacggcagtg aactgtttta tagtgagatt     45600
     cgtttaagtc tgatatttct aagctgcctg tacggcagtg aacagagtat aggaaattag     45660
     aagctggaac aaaaatttct aagctgcctg tacggcagtg aaccaccata taagaacaat     45720
     cgaagttccg aatgttttct aagctgcctg tacggcagtg aacttgtttt aggcagttta     45780
     aaaggattgt ttacatttct aagctgcctg tacggcagtg aaccaacatc ggggggttta     45840
     gcctcagcaa caccatttct aagctgcctg tacggcagtg aactgctagg agagttataa     45900
     atgctgatgt tgctatttct aagctgcctg tacggcagtg aactttacaa ttcagttaca     45960
     aattaattat tgcaatttct aagctgcctg tacggcagtg aactaaaggc tgaatcactt     46020
     gcggccatgt acatatttct aagctgcctg tacggcagtg aactaggcaa gtgggataag     46080
     ccttacatgc aaaaatttct aagctgcctg tacggcagtg aacgtaactc aacagcaggg     46140
     cctttctgag gccaatttct aagctgcctg tacggcagtg aacgttatgc gaatggtagt     46200
     ttgtcggatt atttttttct aagctgcctg tacggcagtg aactgttaga tttttgtatg     46260
     ggatcaggta ctacatttct aagctgcctg tacggcagtg aacgaaggat cattagaaaa     46320
     tcttttacgc aaacttttct aagctgcctg tacggcagtg aacgtaagat tgttttttct     46380
     cctaattctg cattatttct aagctgcctg tacggcagtg aaccatcgag ccacggcaaa     46440
     aattggtttt taaaatttct aagctgcctg tacggcagtg aactctgctc taaatcttaa     46500
     aaaaatagtt ataacagaaa gttagctgaa aaaaatcgat ttacccaata tctttcagct     46560
     aatttataac caattgattt taagacaaat ttttaaagaa ctaaatttat tggtcgttag     46620
     aagtatcgaa ataatcaagt attgaagcat ttgaccaaac tatatctcct tactttaacc     46680
     tatcgaactc aaggaattta ccttgttcta aaatttaatc aaaccatgga acagtagcac     46740
     tgttagaaag gccgaactga tcaaagaggc caggaattgg ctcattgaac aattcgccaa     46800
     actcaatata gcgtcggtgc ctttgcccgt ttgatacgct cacaagttca atatatggat     46860
     tatccagacc tttggaaaac atctttgcct tgtattgcct gatttcatct tctgtcaagg     46920
     agttacgttt aattaaccgc ctcaattttg attggctcat tgtaggctgt ttacgagaca     46980
     ccgtacggaa ttttgtgtcc gcaggaactg tttttatcaa gcttgcctca caataaccaa     47040
     tcataccgcc tatccagttc aaattctgca gttcttgcaa agcctctttt ttaccatgaa     47100
     tacgtaaaag gtttcccaaa gtagagctgt actttggaaa gctaacaccg atgttagtgg     47160
     aagccagagt atgtaaggct ttgtggagat tggtgtaaat tgcattcatt aacactggcg     47220
     ttgtaaattc agaatcggga agaatagata tatctaaata atgatccata acctaccccc     47280
     tatttatcac tttcaccaaa aacaccacca cgcactaaaa cagccatcat ataatgctca     47340
     tcttcaacgc gagataactc tccgccacgt gcccaagtat caaaaaaagt atagaaatcc     47400
     tgcttgtctg ccggtatcct aaacgctttt cccaaattgg taactgcacc atatggctca     47460
     attgcgattg gtccagcaga agataccgga tcactgaatt cagggtacca ggtatctatc     47520
     gttcgaagag cattgccaat tttttgcgaa tgcattgctg caataccatc tacggcataa     47580
     agaattttgc ttttttttcc tttacccttg tccagcacta actcttcact gggataaaca     47640
     tcctgagctt tgccaattct ggcataacaa gtgatttgaa gcattaaaaa gtcattctca     47700
     cttgccaatg cgtcagcaat acgatctgcc aaactgtcaa cttcgttagt ggttgtttcc     47760
     aaatcacgtg gattgaaatc aagtgcatta aaattccagg atttttcagc gccttcgttt     47820
     aatgccataa cctccacctg aatattttct gctccaaagc gattgcgcca taaaaatcgg     47880
     gcattggcga tattcagcgc ataacgtttt gccaactccc tcataccctt tgtttcaaga     47940
     taattgctta cagcctgctg gtaactctgt ttaaaagcag cattattaca agcagaggga     48000
     tgttttaatc cgcctagcac cttaagcgta aaatacaatt taagcgtgtc ctcttctgaa     48060
     cccaatgaac aagtatcaac ggtttgaaga ttaggcttct cgacttcatt attgagtgcg     48120
     gcagggtctt tttgcaacgc cggtttgagt cgatttgaaa tcgtcccccg cacagatttt     48180
     tcatttaatc gaagtggcgt ggctttatcc ttgtgttccc acttgcagcc atacatataa     48240
     ccatccgatg gtaccaattt tttttcaaac gccaataccg aggctatgtg ttctttttta     48300
     gtcataattg ttctcctaaa ttaatagtcg tcattgcttg tttcagatat agatttttgt     48360
     tgaatacaaa ggtaaagatt attttcggat tctacgtggt aacgccaaag taaatcatcg     48420
     agtgactcca aacgataagg cattttaaac tcaccaagcg tcacaaggct ttcagcaaag     48480
     cgatgaggag tatctggatc acgctgatta atcgctgttc ctaattcact aatcccatga     48540
     aaccctgtag caataggaac aatccagcct gtttggccat caggccccgt tgattttcgc     48600
     ttgcgttgcc agatcacacg ctcctgccca ttcacaattt ctttggtgca gctgtaatgc     48660
     acagccacat aatccagcat tgcgtccata gcatcctggc cttgctccat ggctgcttgc     48720
     attaaatccc ttcgttcaat taaggcataa cccggcatta gttttcgctt tgccttctga     48780
     aaatcccgaa ggatttcagg ttccttgcag ttgagaacat ctccaccagc cagtttcatg     48840
     ttaccgagca ttaattgata tactcgttcc aacatcaact gttcatcctg cgcttcaatg     48900
     cctgagtact caacaagaag gctgacttcc agatggcagc gggcttcttc aataaatgat     48960
     ggtcgaacag cgttaccttt gggcttgtct ttttcagatt ttggctccaa ggggtttccg     49020
     gttccaataa tggagtgcac aaaatcacca ggccctttgt aggtttgcaa atcaaagcga     49080
     tgcaccacaa caccaaccgc agaaaacatc acagcgatac tgtttgtatt caatttgcgc     49140
     tgcaaagcat gtacaccacc tagccaaccc gtcatagctg gaaaaccaat ggtgaaaggg     49200
     ctggataatg cattggcgtt ttgaactcga atactgggca ataaaatcag gttacttctc     49260
     atctcaatac ctcccgatgt tcatcgataa agtctttgaa ataacgacgt tcagcctcac     49320
     ccaacatagt gggatgtttg atgctgtttt tatatgcact gtttatccaa agtgcaattt     49380
     gcttgcacag cgtttcgagc caatcatcgc gtttgcccct ttcctctata tattgctcac     49440
     acagccatat tttttgccag gctggaaggc tactggattg ggatctaaat tgatttttgg     49500
     atgcctcacg taagaccatc attttctgca agatcatatc cagcatatca ctaagacaac     49560
     gatcccttcc tttgcgaatt ttatctaacg atattttccc ataacgttcg attttgaaaa     49620
     tattatcgag ttgctcaaga atttccttac aatcgtagta acgtatgctt tggacaaaaa     49680
     agtccttagt aggaaatgta atttctcgtt gctcaagcat cggcggagcg gagaataata     49740
     aatatgcctt tccaccgtat tgattattaa gcacactgac attctgaggt tttgtgccac     49800
     catacgcgat cgtagttaca tcatagattt ccttgtaacc caactcagaa tagatattat     49860
     cacgccggaa ttcgcgctct ctttggactg tatctgaaaa ccgcaatgca tcaatcctct     49920
     cacgcaactc aaaaatcatg cctgaattac ttaagacaga taattggtgg tattcgttac     49980
     ccattggaaa atagacttgt ttaattttag aacttgtaat gctggcttca ttagaagaaa     50040
     ccatttccaa aaatccgact cttaaatttt cataactatc tgtttttata ctaagtaggg     50100
     atttcgctac ctctgtattc tgttgaatat gctctataat agtttttcca tcttcagtaa     50160
     caagagatag aaacttgtaa acgtctaacg ctgcagcatt accaagagca tctaatgcaa     50220
     catgaacatt gcctgatcgg agatagccat ctgccttacg gggtgcttta gcaataatgg     50280
     atgttacata gccattttta ttttttctgg aactgggatg ggagaaagta caaggatgtg     50340
     tcgaaataga catccatcct gcacgtttgg ccgcattcgg cagccagttt tcaagtgcga     50400
     atatatcttc acattcctgt agaatgttat ttttctcaag ttcagtcata tccgatttca     50460
     gtttcttttt aagccagctt ttctttcgct cagcgaaaaa atcagtaatt gctggatcaa     50520
     acatggttgc tctccttttt atataaacct aattgatcgt tgtattcata ttctgtgttg     50580
     atgccatcag gataaacatc caaactgatt tcaccatagt gaatcgcagc cttatctata     50640
     gacatttcgg atatctccat ttgctcccgc aacaaatgta aataatcacg ctgaatccaa     50700
     agtcgttgag actgttctgc tgttaacggc agagttgaga tttgataagc atcgtcctgg     50760
     cgggcaaatt caccggtatt gacataacta aaatatcctc ttgtatcacg ttcagtaaac     50820
     caggcctcac ctgtttcatt ggctacccgg tatagctgtg tggtttttgt gctttggcga     50880
     aagcgattaa gatattgtgg caaagctgtt aaacgccagt acccttgaat ataaccttgc     50940
     aaggtttccg ggccttttcc ttcgtaataa gtgagtaaac tttctattac tgaatgctcc     51000
     agtaaagcca taggggtttt actgttttct ggccgttcct gaattcgtgg aatggaatca     51060
     agtcggtctt ttattaaatt aatatcgact atcttgaaga tatcgtgact gttcaaacaa     51120
     tcgttttttc cattacttaa tttatttgtt tggcgctttc gtggatctgg ctcataacct     51180
     ggaaaataga agcgaggttt tctttccgca tccccgtatt taattgttct ccagttatat     51240
     tgaagaatag cgatattggg atattcaatc gtatcctcac gatgtcgcat gacccgtcca     51300
     gccaattgaa taatggatcg atatgaagaa ggctcaataa cagcccaatc aaaatcatgg     51360
     tcgcggccaa cttcttcaac gggtgtggct accagaataa atagcaagtt cttaacatca     51420
     ggccggttag cagcaatggt atcaagatgc ctgcgaatcg tttgatcata aaaggcctgg     51480
     ggcttctcac cccttttttc tttacgcttt aataccttat ccagatgttt ttcctgttca     51540
     tgacgtagta atagtacttg tctgctatga taagccatga ttcttgcttc gctatgctca     51600
     ggccaatcat aagttaataa atacctggta agttgaacgc agggctgtat gttggcgatg     51660
     cgtacaaccc caaaggaaac ttttaaacct gtttttttat ctactgtgtt attaagctta     51720
     tgcatgtcca gcgttgtttg agctattcgg ttaaaccaag cctctttttt gttcttaact     51780
     actggttcat cacttctctt catagcttct tcacagttaa tgacaatggc tttgcgtttt     51840
     gccggttgct tgtttaaatg ttttactcgt ctgtcaatat acttgtcatg aatttttcga     51900
     aattcctgtg ttgcgtgctc tcgcatgcca atttcttcaa cttgtgttga gaactcatca     51960
     atccatgcgc atcccaccat aggattagca tttcgtgttt tacagtagag tgaccatcct     52020
     tcgcggtaag cattgaaata accctcagcc attgcgggtg gaatagtggc cgaagaaatc     52080
     atcaccttgc gccccagcat acctgccaga tgaatcagac gacctatggc gattaaatcg     52140
     ctgcccgtaa agtcatctac ttcatcaatg accaagtcag acgatagcaa acgcagggag     52200
     ggcaggatgt agcgtccgcc acgagtggtt tccgttgcag caatcatgtg atcaatagtg     52260
     caaaccagaa caggagcata aagtagctgc ctgtctttgt gtttctttaa gatagtggtt     52320
     aaaccttcct caggcagttc accctgataa acaatttcat cggagtctgc caacaaagac     52380
     tcaatggact ctgaaccttg ttgttcttgt tcatatgtct gatccaatct gctttgatag     52440
     tgcaagtcag caatggcttt agagccaatc aataccgcca gatcagtacc atcattttta     52500
     ttgaatatgc gttcacggta ctcgtctcct gtttgcaatg tcagtgtgcg taaaccaagg     52560
     gctaggacat agcggagact atcaccatct tctgaaagcg ccatcatcac tttggcattg     52620
     gcaaatgttt taccgcatcc ggtactagcg atgttcactg caaaaaagcc ttttcgcatg     52680
     tcgttacagg acaagcgcca atcacgtact tttttagcgg cagtatcctg ccaggtgtag     52740
     gccgggggac ttttgcgttt taactcagct gtattgaaac tgaattccaa tccgttttcg     52800
     ataagtggca atttcgctac aacatccctc gcactctcag aaacgccaac caggtgctga     52860
     tccaaagcct gctttggcga tttgtccttc tgagtattgg caatcaattc tgtagtacat     52920
     ttccaattag aagtttggtt gacatccaag gaagaaaaat agtgatcgcc taacatcagt     52980
     gataagcgag catggtgaag caatacacag taactgccat cattgatggt ttgagaaatt     53040
     aattcttcta tacccaataa cttggctgac caccgcttga tttgtgaaag ccatttactg     53100
     gagcgagtta acaatccatg ggggaactcc aaacaaaggc taatttcatc aacggtctta     53160
     ttttcatatc cccagctttt gtcaatgagt ttcagcaatc cgtcaagact gaagcattca     53220
     cttccattga ataggttgtc agggttaaca ggtaatttat gatggctaac aaccagccaa     53280
     gcaattaatt ttgcgatatt cggtaaatcg gccaaaggtt tttcacaact cattcgtagt     53340
     gctgttttaa tggcatcttc attgattatt ccgtctttta gtgttcccaa ccaatcactg     53400
     tccgaatatg gattatcagt attgagaata agtgctttga gtaataaaca tgatacccac     53460
     tcatgacgta atcggtctgc aggtataccc ttaaaatttt tggcaagttt ttgctggaag     53520
     cgggcgttcg ccttacccca gtcatgcagt aaagctgcca aacaagccaa cgattgaatg     53580
     acaggaagca gcttccaatc taacaagtca tctcgataaa cctgattttt agatgtacta     53640
     ttgaccgcta ctctaccttc gcgatcgaac ttactcttgt tccccaccac ccaaactaac     53700
     tccgttctcg atcttgatct aatccagtga caacttactg ctgtattttt actggcggtt     53760
     ttgcgcagca gtttcttaac ggcgagcaat ccttcctggg tgattacagt ttgccacgtg     53820
     ttgtcgccga tgcgatcggc aaaagcatct aagacacgac gggttctagc aagcgctttt     53880
     ttctcgcact gggaaacaaa aataaccatc atagcaagtt ttcctcgcta ttttcgcttt     53940
     cccaatctgt atttaaggcc attgctttta cttgttcaaa catatagtcc agcgctttat     54000
     gatcgatgaa tgcctgtaaa cattgctgac gaaactcttg ttcgctacta ttttccttgg     54060
     cgcagataaa tgcccaaggc agaataaggg cgtccttgat taaatccgct acatcaaata     54120
     ccaatgcacc gcgacgtgtc ttgccgtgca taactgcaaa gccgtgagga atcccaagaa     54180
     cccacagtgt tgttgccgct aaaccatagg caaggtaatt gccatgattt aaaaatatat     54240
     tggccttatc tatagcttcc cgctcacgaa taaatttgcc atactgagtt cggtttgctg     54300
     cgtaacggta tagctgtttt gttaattccg cttcattttg catcaatttg ccaacttctt     54360
     ttgctttctt aatttttagt tcactgctta ataattctgg ctgcaagtcg tcagaattaa     54420
     aaccttctgc agctaaatct cggctttttt tccagtgaac tctcaggtat tctatgcgtg     54480
     aaagttgaaa ttgttttgct gcatataaac gtttttgctc atcaaaccag aatttcatcc     54540
     acccctgcat atattctgtg ggtctatatt cgctttgagg tgtgagccat tcaacttcgt     54600
     tggccatcag taaaggtgta ccgcctccgc cacagaagcc aaccaataca ccagcctgag     54660
     ccagcatcct cattgctgcc tgtgtgatag atgttcccgt tccaagtaaa agacaagtgg     54720
     tgttggcaat aggtatgttc cagtattgat tttcgttttt tgcctcggtg aggtacaaga     54780
     cgcgcccatc cttttgcata atgcggcatt tttccaggta ataaatattg gcacgttttg     54840
     aatgtagaat agcttttaag tctgttagta tttccattga tattttgtag cttcaaaaat     54900
     taagcataat attgttatta ataataaata gcacaataat tttataagga gcgtatctgg     54960
     ggcccaccaa ataaatttgg ctattatttg ccttccttaa caaggatatc aattcgcttt     55020
     tcaatttgat attcacctat aaaaagtata atcgcatcaa caattactga ttaatatatt     55080
     tataaagcgt agtctttcct acgccaacca tcttgcaggt agattgaatt gaatgctttt     55140
     tattggaata aagtgttttt accaactctt tgtgctcatc gctaagcttc tcaggccgac     55200
     caccttggcg ccctcttgct gcttcaagac cagcacgggt acgttcctta attaaatttc     55260
     gctcaaattc agaaagcacc ccaaaaacat gagggtattg aacgcaagtg cttatggatt     55320
     ccagagtaat tctcatattt ttgtcagtcg atattttaaa aaatcttcga tagtaggtga     55380
     actaaattag tttcagttat tctgattatt cataatttga aatactttga atttcaacat     55440
     gcaactggtc cagttttttc gtcttcgaca aaggaaaatc ttcacatgga ataccccttg     55500
     ccatgggata taataatgac tcgcatgaac gtctaggcca acgccataat cttgaatttt     55560
     cgaaagagtt ttgcgatgaa agatgatgag ttggagtaaa tgacttccat ttttcactaa     55620
     gaatattagt actaagaata tcaattactt caacatgttc aaattggcgt tctgaaatgt     55680
     gaagccacgc tttattcaaa agactaacgg cctcgatatc tgaggttgga gcactatatc     55740
     caaatatggt tatagtaaat gcctcagaga accaactctc cgcttttttc caacttaagg     55800
     cagtatattt actcgactga aagtaactct tatttttaat tggataaaga agaggtacat     55860
     ctttgaatct aatatcacac tcaggacaat acgtattttt ttctccccat ttatcgcatg     55920
     cttcacaagc gcctattctt acattaccat gcaagaaaaa tatctgaggc aatgaaacaa     55980
     tatcactatt tcttttatat gcgtcaaata aaaatggatc ccagttgaat gtgaaaatgg     56040
     cgtctttttc tcgaagtgat aataacaatt gatcgtaaat agttacatgt tctggtaatg     56100
     aaagctttga gaaataatct attatcctac tctctatttc tttttttaaa ccatcatcag     56160
     tgatttgact ataaatagtt tcaaaatttt ctgatggatt gatattgttt ttagttaata     56220
     agttatttaa cgatagaatt ttagccagat cattcatcac aggtaattca ttacctgatt     56280
     tatccccatt tggaaaagca gctttgcttg ctcctgcacc tagcagaaca acatgaggct     56340
     ttaaatcctt aggattttca attaattctt gtttcgtaac cattagacca accaaaataa     56400
     gataagttaa ataaagtcta aattagtcaa accttaaaat ttcttatata aatatttaag     56460
     atgattttca tcgtacctat taacatataa catgttcatt aactcttaca caaacaaaga     56520
     taatgaactt tgatttctgt aaagagttta caaacagttt ttaagcatat attggcggct     56580
     cactcttacc ctatttattc gtccgtaaac ccatcgtttt atggaaataa gtttctaatg     56640
     ttctaacttg tttttccata tacccccatg agtacagagc atatgatgat gcggcgatat     56700
     accttcaatg cttgatagaa gttagcatgg cggggcgtac cccaaatgcc tgtgctgcct     56760
     aattccaagt tgtaataacc cttcctaaac tagcctccct ctcctattca aaacaaacga     56820
     acctgcggaa cctcagacca tcgtgtagta taggcaggcg atttcagttc agcacgcatc     56880
     gcccaaggtt ttgaataacc ctctgctgcg aggcgaattg tacttcgtcc gtatttttga     56940
     ttgatttggt caaagacccc catcaattgt tcggtgtgtt ttagatgctc atcacttggt     57000
     tgatgaaaca tatccagctg tcgtgggctt ttaggaatta aatcttcaag ccatactcct     57060
     gcctttttat agtaataccc tggtttaaaa atacgctgca gacatcgttt ggctatttta     57120
     gtaattaagc gcaaatcatc tgtgggatta atcagcttaa attcgatgga ctgaaagtgc     57180
     tgtgccaaat cttcccgaaa tcggttcgta ttaacaaata caaccatgcg cttcgccacc     57240
     aattgctggc gacgcatttt ctccaccgca cgggcacaat ggctactgat tgattcctca     57300
     atcgaagcaa gttgggtttg catctgacca aaacttttag atgacataat actttgctta     57360
     ggctctattg cctctaaacc gccacaagca attccttgaa gctccatggc ggtacgcatc     57420
     aacacgacgt taaaacattt cttcagaagg tgaggattgg tcattgccaa atcataagcc     57480
     gtatgaatac ctcgcgaaat taatttattg gcccattgcc gtcctactcc ccaaatgtct     57540
     ccaacggaaa tctgttgtaa taaccgctca cgactcgagg tgatattaaa cacagggatt     57600
     ttataaactt ttttgcataa atgattggcg gctttggcta gtgttttggt cggcccaatg     57660
     ccgatggaag tgggtattcc cgtgtacttc aagattttct tttgtaactg ctcgcaaaac     57720
     aaattatgcg agttaaccgg taaactcctt aaatcaagaa acgcttcatc aatcgagtaa     57780
     atttcgatat gaggccaggc ttcttcaata gtgcacatca cgcgatgact catgttaccg     57840
     tacaacgtat aatttgagga aaaagctttc acaccatgct gtttgcacaa atgtttaatt     57900
     ttgaagtatg gctcgcccat ggcaatgccc aatgctttgg cttcattcga gcgtgcgata     57960
     caacagccat cgttattgga tagcaccacg atggggacat cctttaaatc aggacgaaac     58020
     aaacgctcac aactggcgta aaaattgttg caatcgataa gggcaaacat ctcaggcaag     58080
     ctcatgtaga accaaagtca ccactcccca aatcaccatc tcactgtcct ctgtaatgtc     58140
     aatgggttga aatttgggat tagcaggaag taattgcacc cttccccctt ttttcgaaag     58200
     gcgttttacc gtgagttcac cgttcacagc tgcaatgaca atgcgcccat ccgaaggttc     58260
     tatgcttcta tcgactaaca gccagtcgcc agaaaaaatt ccagcatcca ccatagactc     58320
     ccctgtggct tgcaaaacaa aggtagatga tggatgttta ataaatttgg tatttaaatc     58380
     aagatacccc tcgatgtaat catcggccgg tgatggaaat cctgcttgaa ttttactggc     58440
     aaataccggc aattgatatg attcgtgact ttttaaacgc tctaattttg caagttggga     58500
     taatggtata cgaactgctt tggtaggctc accccttggg cgacctgccc cttctctttt     58560
     tccacctcgt ggtgacatga tgattctttt tttgatttac gtacaaatat catagacaag     58620
     gaaaaataag ctgtaaatcc cgcctcagaa cagcatgagt tgaaatcaac actaagtctt     58680
     cgagaatatt aggaaaatta tttttaaatt tttttattca gataatggct ccatcgccaa     58740
     gggatggtca aaattggctt tgttcactaa agtagtcact cgatagcctt ccaaatcctc     58800
     ataaggataa ggtttcatta acgccattaa ttgtgcttta tcacattgcg tgttgttaag     58860
     ccaaatagct tgagcctctt cacctaaaat tactggcata cgattgtgca ctggttgcat     58920
     aaatgcatta gcatccgttg taatcaggca acaggaatga ataacctctt cattctgctg     58980
     ccagatatcc cgaatagcag caacagccag caaatcatga ttcttttttt gaaaaaaata     59040
     aggctgtttt acaccatcct cttggcgcca ttcataaaag ccactcatag ggattaaaca     59100
     tcgtttcgat tttattgact gacgaaaagt cggtttttca aaaactgttt cggctcgtgc     59160
     attgatgaga tttcctaatt tttttctgtc cgttgtccag gaaggaatca atccccaacg     59220
     caataatacg cattgaattt catgaccaac ggtttcaaca agacatacta catcagctcc     59280
     tggagaaata ttaaagcgcg gaggtatttc aatcgcattg gctagatgaa attggtattt     59340
     tagcttgtca taagaagcaa tataagcaaa tcgaccacac atcttttcat ccaccgaaag     59400
     agttattgtc agtataatac taaatctcaa ataatgagaa aaatcaggcg aaatattcat     59460
     tcattaaaac aatatttgca acacgagcaa tgatatccaa atttagcacc ctctttagtt     59520
     cagaaaactg tattaacccg gctaaccatt tttatattaa ctcaaaattt ctaaagatga     59580
     gtaacgacat ggatatcgac aaagatatca tcacagagac cattacaggt atcacaaaaa     59640
     gaatcataat agatatattt ataggtacca tatggatatt tatatagata tccatatgaa     59700
     aacatataag atatcaacaa agataacata atgatatata attcgttatc ttagtttatc     59760
     acgcctatat tttatatagg tcacagcgca aaaggcaaat atacagatta ggtatcttta     59820
     tgggtatcta ct                                                         59832
//

If you have problems or comments...

PBIL Back to PBIL home page