(data stored in ACNUC22857 zone)

EMBL: CR749392

ID   CR749392; SV 1; linear; mRNA; HTC; HUM; 3487 BP.
XX
AC   CR749392;
XX
DT   19-AUG-2004 (Rel. 80, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA; cDNA DKFZp781K0743 (from clone DKFZp781K0743)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3487
RG   The German cDNA Consortium
RA   Poustka A., Albert R., Moosmayer P., Schupp I., Wellenreuther R.,
RA   Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (17-AUG-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 0d1df4ce248c9d3e4bdfec8522593a8e.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by DKFZ (German Cancer Research Center, Heidelberg/Germany)
CC   within the cDNA sequencing consortium of the German Genome Project.
CC   This clone (DKFZp781K0743) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp781K0743
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3487
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="781 (synonym: hlcc4). Vector pSport1_Sfi; host
FT                   DH10B; sites SfiIA + SfiIB"
FT                   /clone="DKFZp781K0743"
FT                   /tissue_type="hippocampus"
FT                   /note="adaptor-related protein complex 2, beta 1 subunit"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        173..3028
FT                   /codon_start=1
FT                   /gene="DKFZp781K0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q68DI0"
FT                   /db_xref="H-InvDB:HIT000306428.11"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q68DI0"
FT                   /protein_id="CAH18240.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKHNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYTER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFELSTGLGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHVYME
FT                   MNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKEC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYIYQVYDSILKN"
XX
SQ   Sequence 3487 BP; 1027 A; 780 C; 811 G; 869 T; 0 other;
     gaccggcgga ggcgaggaaa tcctaagagc gtgaccgttg atgatgcagg gaaccgtcgg        60
     gtgtgaccat tgagagggaa aaggttggag aaagggtctc taccatgatg cctgtggtgc       120
     ggtgagggaa tcctcgggtg tggcagcagg tgcacattaa agatccaaag tcatgactga       180
     ctccaagtat ttcacaacca ataaaaaagg agaaatattt gaactaaaag ctgaactcaa       240
     caatgaaaag aaagaaaaga gaaaggaggc tgtgaagaaa gtgattgctg ctatgaccgt       300
     ggggaaggat gttagttctc tctttccaga cgtagtgaac tgtatgcaga ctgacaatct       360
     ggaactaaag aagcttgtgt atctctactt gatgaactac gccaagagtc agccagacat       420
     ggccatcatg gctgtaaaca gctttgtgaa ggactgtgaa gatcctaatc ctttgattcg       480
     agccttggca gtcagaacca tggggtgcat ccgggtagac aaaattacag aatatctctg       540
     tgagccgctc cgcaagtgct tgaaggatga ggatccctat gttcggaaaa cagcagcagt       600
     ctgcgtggca aaactccatg atatcaatgc ccaaatggtg gaagatcagg gatttctgga       660
     ttctctacgg gatctcatag cagattcaaa tccaatggtg gtggctaatg ccgtagcggc       720
     attatctgaa atcagtgagt ctcacccaaa cagcaaccta cttgatctga acccacagaa       780
     cattaataag ctgctgacag ccctgaatga atgcactgaa tggggccaga ttttcatcct       840
     ggactgcctg tctaattaca accctaaaga tgatcgggag gctcagagca tctgtgagcg       900
     ggtaactccc cggctatccc atgccaactc agcagtggtg ctttcagcgg taaaagtcct       960
     aatgaagttt ctagaattgt tacctaagga ttctgactac tacaatatgc tgctgaagaa      1020
     gttagcccct ccacttgtca ctttgctgtc tggggagcca gaagtgcagt atgtcgccct      1080
     gaggaacatc aacttaattg tccagaaaag gcctgaaatc ttgaagcagg aaatcaaagt      1140
     cttctttgtg aagcacaatg atcccatcta tgttaaacta gagaagttgg acatcatgat      1200
     tcgtttggca tctcaagcca acattgctca ggttctggca gaactgaaag aatatgctac      1260
     agaggtggat gttgactttg ttcgaaaagc tgtgcgggcc attggacggt gtgccatcaa      1320
     ggtggagcaa tctgcagagc gctgtgtaag cacattgctt gatctaatcc agaccaaagt      1380
     gaattatgtg gtccaagaag caattgttgt catcagggac atcttccgca aataccccaa      1440
     caagtatgaa agtatcatcg ccactctgtg tgagaactta gactcgctgg atgagccaga      1500
     tgctcgagca gctatgattt ggattgtggg agaatatact gaaagaattg acaatgcaga      1560
     tgagttacta gaaagcttcc tggagggttt tcacgatgaa agcacccagg tgcagctcac      1620
     tctgcttact gccatagtga agctgtttct caagaaacca tcagaaacac aggagctagt      1680
     ccagcaggtc ttgagtttgg caacacagga ttctgataat cctgaccttc gagaccgggg      1740
     ctatatttat tggcgccttc tctcaactga ccctgttaca gctaaagaag tagtcttgtc      1800
     tgagaagcca ctgatctctg aggagacgga ccttattgag ccaactctgc tggatgagct      1860
     aatctgccac attggttctt tggcctctgt gtatcataag cctcccaatg cttttgtgga      1920
     aggaagtcat ggaattcatc gtaaacactt gccaattcat catgggagca ctgatgcagg      1980
     tgacagccct gttggcacta ccactgcaac gaacctggaa cagcctcagg ttatcccctc      2040
     tcaaggtgat cttctagggg atcttttaaa ccttgacctc ggtcccccag tcaatgtgcc      2100
     acaggtgtcc tccatgcaga tgggagcagt ggatctccta ggaggaggac tagatagtct      2160
     gcttggcagt gaccttggcg ggggcattgg aggaagtccg gcagtgggac aatccttcat      2220
     cccatcatcg gtccctgcaa cctttgctcc ttcacctaca cctgctgtgg tcagcagtgg      2280
     actgaatgac ctgtttgaac tctccacagg gttaggcatg gcacctggtg gatatgtggc      2340
     tcctaaggct gtctggctac ctgcagtaaa ggctaaaggc ttggagattt ccggaacatt      2400
     tactcaccgc caagggcacg tctatatgga aatgaacttc accaataaag ctctgcagca      2460
     catgacagat tttgcaatcc agtttaacaa aaatagcttt ggtgtcatcc ccagcactcc      2520
     tctggccatc catacaccac tgatgccaaa ccagagcatt gatgtctccc tgcctctcaa      2580
     taccttgggc ccagtcatga agatggaacc tctgaataac ctccaggtgg ctgtgaaaaa      2640
     caatatcgat gtcttctact tcagctgcct catcccactc aatgtgcttt ttgtagaaga      2700
     tggcaaaatg gagcgccagg tcttccttgc aacatggaag gatattccca atgaaaatga      2760
     acttcagttt cagattaagg aatgtcattt aaatgctgac actgtttcca gcaagttgca      2820
     aaacaacaat gtttatacta ttgccaagag gaatgtggaa gggcaggaca tgctgtacca      2880
     atccctgaag ctcactaatg gcatttggat tttggccgaa ctacgtatcc agccaggaaa      2940
     ccccaattac acgctgtcac tgaagtgtag agctcctgaa gtctctcaat acatctatca      3000
     ggtctacgac agcattttga aaaactaaca agactggtcc agtacccttc aaccatgctg      3060
     tgatcggtgc aagtcaagaa ctcttaactg gaagaaattg tattgctgcg tagaatctga      3120
     acacactgag gccacctagc aaggtagtaa ctagtctaac ctgtgctaac attagggcac      3180
     aacctgttgg atagttttag cttcctgtga acatttgtaa ccactgcttc agtcacctcc      3240
     cacctcttgc cacctgctgc tgctatctgt ccttacttgt gggcttctcc atgctgtgcc      3300
     aatggctggc tttttctaca ccctcttttg agtgtagttt ggtattttgt aattgagagc      3360
     tcatttcaaa agcagaaaaa gacaacaaat attaaagcaa ggaaaagtgt aactgaaaaa      3420
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3480
     aaaaaaa                                                                3487
//

If you have problems or comments...

PBIL Back to PBIL home page