(data stored in ACNUC8465 zone)

EMBL: CR759971

ID   CR759971; SV 3; linear; mRNA; STD; VRT; 3087 BP.
XX
AC   CR759971;
XX
DT   09-SEP-2004 (Rel. 81, Created)
DT   04-OCT-2006 (Rel. 89, Last updated, Version 7)
XX
DE   Xenopus tropicalis finished cDNA, clone TNeu054a10
XX
KW   .
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-3087
RA   Amaya E., Ashurst J.L., Bonfield J.K., Croning M.D.R., Chen C-K.,
RA   Davies R.M., Francis M.D., Garrett N., Gilchrist M.J., Grafham D.V.,
RA   McLaren S.R., Papalopulu N., Rogers J., Smith J.C., Taylor R.G., Voigt J.,
RA   Zorn A.M.;
RT   ;
RL   Submitted (04-OCT-2006) to the INSDC.
RL   Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK. E-mail enquiries:
RL   trop@sanger.ac.uk
XX
DR   MD5; ecbe6e3485d31f63eeb9895ad461310e.
DR   Ensembl-Gn; ENSXETG00000022954; xenopus_tropicalis.
DR   Ensembl-Tr; ENSXETT00000049651; xenopus_tropicalis.
XX
CC   Sanger Xenopus tropicalis EST/cDNA project.
CC
CC   This sequence is from a Xenopus Gene Collection (XGC) library, from a
CC   library constructed by Aaron M. Zorn. cDNA was prepared from RNA extracted
CC   from neurula embryos. EcoRI-NotI cut cDNA was then ligated into pCS107 with
CC   EcoRI at the 5' end and NotI at the 3' end.
CC   Vector: pCS107; Site_1: EcoRI; Site_2: NotI
CC   Host: Escherichia coli DH10B
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3087
FT                   /organism="Xenopus tropicalis"
FT                   /mol_type="mRNA"
FT                   /dev_stage="neurula"
FT                   /clone_lib="XGC-neurula"
FT                   /clone="TNeu054a10"
FT                   /db_xref="taxon:8364"
FT   mRNA            1..3071
FT                   /gene="map2k6"
FT                   /locus_tag="TNeu054a10.1-001"
FT                   /product="mitogen activated protein kinase kinase 6"
FT   CDS_pept        275..1282
FT                   /gene="map2k6"
FT                   /locus_tag="TNeu054a10.1-001"
FT                   /standard_name="OTTXETP00000011883"
FT                   /product="mitogen activated protein kinase kinase 6"
FT                   /note="match: proteins: P52564 P70236 Q5E9X2 Q8BP44 Q925D6"
FT                   /db_xref="GOA:Q6GL46"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GL46"
FT                   /protein_id="CAJ82879.1"
FT                   /translation="MAQPRGKKKNPGLKIPKEAFDQPQVSSPTPPRDLDSKACILIGEK
FT                   NFEVKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDIS
FT                   MRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLTIPEDILGKIAVSI
FT                   VRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMA
FT                   PERINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA
FT                   DKFSAEFVDFTSKCLKKNSKERPTYPELMQHHFFVLHESKNTDVASFVKRILGD"
XX
SQ   Sequence 3087 BP; 843 A; 586 C; 689 G; 969 T; 0 other;
     ctgcaaaggg gatatcagag agagagggaa aaggaaagcg acattgagaa ggggagggct        60
     gtttggccag tttgcatttg ctacttgcac ttgtgcaatt ccacagatcc agccgagcga       120
     ggagtcctgc agcagcccga tcctgcataa actagactgg gagcctgcag tttgcatctt       180
     tgttgtacaa ctagagagag agagagggga gaggcaaagt cttttgtgca cccctccccc       240
     agcccagcac aggggagaga gagagagaga gagaatggct cagccgagag gcaagaagaa       300
     aaatcctggg ctgaaaattc caaaggaggc atttgaccag ccacaagtca gctctccgac       360
     gccaccacgg gacttggact ccaaagcctg catcctcata ggagaaaaga actttgaagt       420
     caaggccgat gacttggaac caatagaaga gctaggccgg ggagcctatg gtgtcgtgga       480
     aaagatgcgc catgttccca gtgagcagat aatggcagtg aagcgcatca gagcaactgt       540
     gaacagccag gaacagaaaa ggctgctgat ggacctggat atctctatgc gcacagtgga       600
     ctgccatttt actgtcacgt tttatggggc cttatttaga gagggggatg tctggatctg       660
     catggagttg atggatacgt cactggataa attttacaag aatgtgattg acaaaggcct       720
     gaccatcccc gaggacatac taggaaaaat agcagtttcg attgttagag cattagaaca       780
     tctgcatagt aaactctcag tgatccacag agatgtgaaa ccctccaacg tactgataaa       840
     caaagaaggc caggtgaaga tgtgtgactt tggaatcagc ggttatcttg ttgactctgt       900
     agccaaaacc atggatgctg gctgcaaacc ctacatggct cctgaaagaa taaacccaga       960
     gctgaaccag aaagggtata gtgtaaaatc ggacatttgg agccttggaa taacattgat      1020
     tgaactggcc attctgcggt ttccatatga ctcctggggg acccctttcc aacagctaaa      1080
     acaagtggtc gaagagccct ccccacagct gcctgcagac aagttttctg ctgagtttgt      1140
     tgactttacc tcaaagtgct tgaagaaaaa ttccaaagag cgtccaactt atccagagct      1200
     tatgcaacac catttctttg tgctgcatga atccaagaac actgatgtgg catctttcgt      1260
     taaacgcatc ttgggagatt aagtatatgc agtatagccg gtctcacctt ctcatggact      1320
     tttcctctga caggacacac ggaatggctt aaattggctg tcctacttaa tcaagcacca      1380
     gtagaaatgc ctcatgggac tgggaaaact ggactcaata gttctttcta atggccactc      1440
     ttcgctacgg aacggttttt ccagcatgga aagatgtcta acccctatgc tgccataggt      1500
     acccttatgg ctgtacaggt gttactatag atgcctcttg ccaaagggtg taactttgac      1560
     tgctgccgta tggggtttat atttaggttt cctattcttt ttgacctttt tgtattggtt      1620
     ctaggtgcta ttttagttcc tctttaacat ggtttcttct ttattttttt ccttcctact      1680
     ttcattttgg agatatttat gttctgtatt ctgattaggt ttggttttta tgaaaggacg      1740
     tgtgtgtgat ataagaggag aacagtggca aatatttata gggttttgct ggtgagaggg      1800
     tgaaatcttt gtgtccgcta ttatttaagt tgtttttttt tttgttttgt ttctggaact      1860
     gctaaagaat tctggaattt ttctttggaa tgagaatagg tatatgtgcg gagattatga      1920
     cttggtcaca catgaataaa tagtgttggc ttgttgttga ttactgaggg gcaggcagtt      1980
     gtcccctctc agaaggaatc cagacatagt ctactgtgtt atctgaagcc ttaataacct      2040
     ttaaaagtgg agattttttc ctgtagaata atcttgaggt tctgtaataa tgttacgcct      2100
     gaaagagaag agaattaaaa tgatttacct ctcctgtggt gagcaatctt attgacagtt      2160
     tgtggttaca tgcagcaggc ccttctagtt ctcctacctc ccttcttatt tcatatatct      2220
     tgctactttg gataattata gggcgacata gggccaacca atcatttttt tttgtccacg      2280
     cagactttca ctgtaaccag taacatttga ggtttctgtt gaagtcgaac tcttcccaga      2340
     ggttgtcttc ctctttgtcc tttgcccctt atctttctca tttttcctgt tggaggattt      2400
     tgcttgtgct ttactctttt taaagtattt tacagcattt agaaattata tatatatttt      2460
     ttttctgtgt tttatacctc ttttcccctg aggggtctgc aactgattag aactttttcc      2520
     cctttctaga tctacatgag ggtgaatcca ccataaaaac acctgagtaa attgtgattt      2580
     ctaataaatt acacacagtt ttttttttgt tttgtttttt ttaatttata accatttttt      2640
     gttgctgcat gaggcacctg caggtctttg caagaggtaa accagtcatg gtatccatga      2700
     caaatagaaa tgtttgtatt gtgcagaggt gagtttattc agggcatcat ttttttctgt      2760
     ttagttcaaa tttggccatt gtatgttgta tgacttcgac agcggatact gtggggttat      2820
     aatactatgt atgtccttaa tgagcaaaac acagagaaaa ctaggagtat atttccaatc      2880
     cagtgacatg tcttgcatac caattatatt ttttaatgtc aaacaaagct tgtgtttggt      2940
     tttattttgt gcagtttctt ccttgtgtta accctctgtt atactggagt ctaacattaa      3000
     agggaccata tctatatcct taatatcaag atgtaaagag gacatttgca tagtaaaaaa      3060
     agtcagaaat taaaaaaaaa aaaaaaa                                          3087
//

If you have problems or comments...

PBIL Back to PBIL home page