(data stored in ACNUC8465 zone)

EMBL: CR761577

ID   CR761577; SV 2; linear; mRNA; STD; VRT; 1909 BP.
XX
AC   CR761577;
XX
DT   09-SEP-2004 (Rel. 81, Created)
DT   04-OCT-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Xenopus tropicalis finished cDNA, clone TGas073n08
XX
KW   .
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1909
RA   Amaya E., Ashurst J.L., Bonfield J.K., Croning M.D.R., Chen C-K.,
RA   Davies R.M., Francis M.D., Garrett N., Gilchrist M.J., Grafham D.V.,
RA   McLaren S.R., Papalopulu N., Rogers J., Smith J.C., Taylor R.G., Voigt J.,
RA   Zorn A.M.;
RT   ;
RL   Submitted (04-OCT-2006) to the INSDC.
RL   Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK. E-mail enquiries:
RL   trop@sanger.ac.uk
XX
DR   MD5; 677f4f06252b1e8d4e9e4d9ed04e9c6b.
XX
CC   Sanger Xenopus tropicalis EST/cDNA project.
CC
CC   This sequence is from a Xenopus Gene Collection (XGC) library, from a
CC   library constructed by Aaron M. Zorn. cDNA was prepared from RNA extracted
CC   from gastrula embryos. EcoRI-NotI cut cDNA was then ligated into pCS107
CC   with EcoRI at the 5' end and NotI at the 3' end.
CC   Vector: pCS107; Site_1: EcoRI; Site_2: NotI
CC   Host: Escherichia coli XL1-blue
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1909
FT                   /organism="Xenopus tropicalis"
FT                   /mol_type="mRNA"
FT                   /dev_stage="gastrula (stage 10.5-13 mixed)"
FT                   /clone_lib="XGC-gastrula"
FT                   /clone="TGas073n08"
FT                   /db_xref="taxon:8364"
FT   mRNA            1..1891
FT                   /gene="map2k5"
FT                   /locus_tag="TGas073n08.1-001"
FT                   /product="mitogen-activated protein kinase kinase 5"
FT   CDS_pept        61..1407
FT                   /gene="map2k5"
FT                   /locus_tag="TGas073n08.1-001"
FT                   /standard_name="OTTXETP00000012197"
FT                   /product="mitogen-activated protein kinase kinase 5"
FT                   /note="match: proteins: Q13163 Q62862 Q8CFM3 Q8K360 Q92961
FT                   Q92962 Q9D222 Q9WVS7"
FT                   /db_xref="GOA:Q28G43"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR034851"
FT                   /db_xref="UniProtKB/TrEMBL:Q28G43"
FT                   /protein_id="CAJ83983.1"
FT                   /translation="MLLFGFGLPLDMDSQALVIRIRIPDGGAVDWTVQPATQLLFRDIL
FT                   DVIGQVLPDATTTAFEYEDEDGDRITVRSDEEMKAMLSYYCTMVLEQQGSGPLTEPLQI
FT                   YPRACKPPGKRNIHGLKVNTRAGSSSNSSPSVPDNIAGNSLKKSSAELKKILANGQINE
FT                   LDIQCRDILGHGNGGTVYKAYHVPSGKILAVKVIPLDITVELQRQIMSELEILYKCDSL
FT                   YIIGFYGAFFVENRISICTEFMDGGSLDVYRKIPEQVLGRIAVAVLKGLTYLWSLKILH
FT                   RDVKPSNMLVNTRGHVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERIAGEQYGIHSDVW
FT                   SLGISFMELALGRFPYPQIQKNHGSLMPLQILQCIVDEECPVLPLGEFSESFVHFITQC
FT                   MRKPPKERPAPEELMDHPFIVQFNDGNTEAVSMWVCRALEERRMQSGQA"
FT   regulatory      1867..1872
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1891
XX
SQ   Sequence 1909 BP; 500 A; 396 C; 497 G; 516 T; 0 other;
     tttggttcct aggctaggta ctcctgcgtc ccaaatgatg taacccggct acggcccggg        60
     atgctgttat ttggcttcgg cctgcctctg gacatggata gccaggctct ggttattcgg       120
     atacgaatcc ctgatggggg cgccgttgac tggacagtac agccggccac tcagttgctg       180
     ttccgggaca tcttggatgt gattggtcag gttctcccag atgcaacaac cactgccttt       240
     gagtatgaag atgaggatgg tgatcggatt acagttcgga gtgatgaaga aatgaaggcc       300
     atgttgtcat attattgcac catggtcctt gagcaacagg ggagtggccc tctgactgaa       360
     cctctgcaga tctatccacg tgcctgcaag cctcccggga agcggaacat acatggcctc       420
     aaggtgaaca ccagagccgg atcttccagt aacagcagtc cgtctgtgcc agacaatatt       480
     gccggcaata gcttaaagaa gtcctctgct gagctgaaga agattttggc taatggacag       540
     attaatgagc ttgatatcca gtgccgtgac attctggggc atggaaatgg agggaccgtg       600
     tataaagcat atcatgtgcc aagtgggaag attctggctg taaaggtcat cccattagat       660
     attactgtgg agctgcagag acagattatg tcagagctgg aaatcctgta caagtgcgat       720
     tctctgtaca taattgggtt ttacggagca ttttttgtgg aaaaccggat ttccatctgt       780
     actgaattta tggatggtgg atccctggat gtgtaccgga agattccaga acaggtcctt       840
     ggaagaattg ctgttgctgt attaaaaggc ttgacttacc tgtggagctt aaagatttta       900
     cacagagatg taaagccttc taacatgctg gtgaacacac gtggccatgt gaagttgtgc       960
     gactttggtg tgagcacaca gttggtgaat tctatcgcca agacgtatgt gggaacaaac      1020
     gcttatatgg cgccagagcg tattgcagga gaacagtatg gaatccactc tgatgtctgg      1080
     agtttgggca tctcttttat ggagttggcg cttggaagat tcccttatcc acagattcag      1140
     aaaaaccacg gatctttaat gccgctccag atattgcaat gcattgttga tgaggagtgt      1200
     cccgtgctcc ctttgggtga attctcagag tccttcgtac acttcattac acagtgtatg      1260
     agaaagccac caaaggagag accagcacct gaagagctaa tggatcaccc tttcattgtc      1320
     cagtttaatg atggcaacac agaagcagtg tccatgtggg tgtgccgggc actggaagag      1380
     cggaggatgc aaagtggaca ggcgtgatcc gtgtccatag tgaggatgtg aacctaatag      1440
     cgagacgcac agagatcagc gggtgcagag gatcaacttg atttgtgaca cgttcagcgc      1500
     agagacttgt gtagttcttt ctgtgcagtg ccttcagcca tgccttaagg gatacgtggt      1560
     cactaacagc ggccttttga gccttccgct gataacattt gtctgtttca ttttggcagc      1620
     tttatactgt gcccagaaaa agtgcttgca gaagagtggg catatgggag agatgactgt      1680
     tacatatcac aaaagcttct agatagctca gattaggaag gggcagagat atcacttcac      1740
     cttggctagg gagttccctc ctcacctttg ttttttggtg gtatccaact tgtaggaacc      1800
     tttctactga gctacacata tacattttgt aattattggt cttgcacaga tctctgcttc      1860
     ttctgtaata aatgttttta caaaaaaaaa caaaaaaaaa aaaaaaaaa                  1909
//

If you have problems or comments...

PBIL Back to PBIL home page