(data stored in ACNUC13479 zone)

EMBL: CR848115

ID   CR848115; SV 2; linear; mRNA; STD; VRT; 1625 BP.
XX
AC   CR848115;
XX
DT   12-OCT-2004 (Rel. 81, Created)
DT   04-OCT-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Xenopus tropicalis finished cDNA, clone TGas117m14
XX
KW   .
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1625
RA   Amaya E., Ashurst J.L., Bonfield J.K., Croning M.D.R., Chen C-K.,
RA   Davies R.M., Francis M.D., Garrett N., Gilchrist M.J., Grafham D.V.,
RA   McLaren S.R., Papalopulu N., Rogers J., Smith J.C., Taylor R.G., Voigt J.,
RA   Zorn A.M.;
RT   ;
RL   Submitted (04-OCT-2006) to the INSDC.
RL   Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK. E-mail enquiries:
RL   trop@sanger.ac.uk
XX
DR   MD5; 0fbd06e7770b3517ee5773fbd0a012ca.
XX
CC   Sanger Xenopus tropicalis EST/cDNA project.
CC
CC   This sequence is from a Xenopus Gene Collection (XGC) library, from a
CC   library constructed by Aaron M. Zorn. cDNA was prepared from RNA extracted
CC   from gastrula embryos. EcoRI-NotI cut cDNA was then ligated into pCS107
CC   with EcoRI at the 5' end and NotI at the 3' end.
CC   Vector: pCS107; Site_1: EcoRI; Site_2: NotI
CC   Host: Escherichia coli XL1-blue
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1625
FT                   /organism="Xenopus tropicalis"
FT                   /mol_type="mRNA"
FT                   /dev_stage="gastrula (stage 10.5-13 mixed)"
FT                   /clone_lib="XGC-gastrula"
FT                   /clone="TGas117m14"
FT                   /db_xref="taxon:8364"
FT   mRNA            1..1606
FT                   /gene="srprb"
FT                   /locus_tag="TGas117m14.1-001"
FT                   /product="signal recognition particle receptor, B subunit"
FT   CDS_pept        52..801
FT                   /gene="srprb"
FT                   /locus_tag="TGas117m14.1-001"
FT                   /standard_name="OTTXETP00000008061"
FT                   /product="signal recognition particle receptor, B subunit"
FT                   /note="match: proteins: Q6P595"
FT                   /db_xref="GOA:Q6P860"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P860"
FT                   /protein_id="CAJ81596.1"
FT                   /translation="MEFITQELQKQDPTLLSVGIALIVVVLSFVLWKILRGSRTSRRAV
FT                   LLIGVCDSGKTLLFNRLLTGTYKKTQTSITANCAAYKVKNDKGSSLTLVDLPGHESLRL
FT                   QFLEQYKASARALLFVVDSSAFQREVKEVAELFYQLLTDVAILKNVPPILIACNKQDIS
FT                   MAKSAKLIQQQLEKELNTLRVTRSAAPSILESGNSGVTQLGKKGKDFDFTQLPMKVKFL
FT                   ECSTRDSKEEDGDANISNVEGWLAKLV"
XX
SQ   Sequence 1625 BP; 461 A; 344 C; 371 G; 449 T; 0 other;
     tgaataatgg cggagcctca ggttcaacat gattctcggt ggttgccgga catggagttc        60
     attacgcagg agctgcagaa gcaagacccg accttgctct ccgtggggat cgccctaatt       120
     gttgtcgtgc ttagctttgt tctatggaag attctgcgag gcagtcggac cagccgcaga       180
     gcagtgctgc ttattggagt gtgtgactcg ggaaaaactc tactgttcaa caggttactt       240
     acaggaacat acaagaaaac ccaaacctcc atcactgcca attgtgctgc atataaagtg       300
     aagaatgaca agggttccag tttgacgctt gttgacctcc ctggccatga aagtttgagg       360
     cttcagttcc tggagcaata taaagcatca gcaagggcat tgctgtttgt agtggacagt       420
     tccgcgttcc agcgtgaggt gaaggaggtg gcagagcttt tttaccaact tttgacagat       480
     gttgcaatac tgaaaaatgt gccaccaata cttattgcgt gcaataagca agatatttca       540
     atggccaaat ctgccaaact tatacagcag cagctggaga aagagctgaa cactcttcgt       600
     gtcacccgct cagctgcccc tagcatcttg gagagtggaa actctggcgt cacgcagctt       660
     gggaagaaag gcaaagactt tgattttacc cagttgccta tgaaggtaaa attcctggaa       720
     tgcagcactc gggacagtaa agaagaggac ggtgatgcca atatcagtaa tgttgagggc       780
     tggctggcga agctggtttg agaaactttt cccaagttgt acaaggacac aggcgctaag       840
     atgatgaaac attgaatgga tttttctgca tcttgactcg taagggaaac ccttatttgg       900
     ttggtgcctt gttcatgact gctgcattgg tgaggctgcc gctttcttac tatgctttag       960
     acaaaagaaa cgtgcagctc tgaggaaaca gtgtctattt tgtcagctct tgtactccat      1020
     gtcacttgaa caataaccaa aatgtaatga attccttaca tgctggattt ccacctccca      1080
     ttctgtgctg agggaatggt taatgcagag caacctgtat ttctccagcc tttgtctagc      1140
     tacaacttcc actgtaccat ttacagcctt tggcatggac gttaggtaca tgtttagaca      1200
     tctggaggac cacaggttgt gttgtgccac caaccagtgg ctcaggggca acatgttgct      1260
     caccaacccc ttggatcttg cgctcagtgc ccccaaacca ggtagttatt tttgaattcc      1320
     tgacttagtg gcaagttttg gtttaataaa aacaagattt actcccaaat aaagcctcct      1380
     gtaagctgat agagactgcc taatagccaa tcttagccct tatttggcac cttcatgaac      1440
     ttttataatg ctttagttgc tctccaagtc tttttacatt tggctgttac tcactagtaa      1500
     gaaaggctgg gaacccctgc tctagggaca tatatttatt ttgaatttga actttcaaat      1560
     aaatcagtat taaagtggaa gttcaaaaaa aaaaaaaaga aaatataaaa aaaaaaaaaa      1620
     aaaaa                                                                  1625
//

If you have problems or comments...

PBIL Back to PBIL home page