(data stored in ACNUC9543 zone)

EMBL: CR848116

ID   CR848116; SV 2; linear; mRNA; STD; VRT; 1570 BP.
XX
AC   CR848116;
XX
DT   12-OCT-2004 (Rel. 81, Created)
DT   04-OCT-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Xenopus tropicalis finished cDNA, clone TGas001m02
XX
KW   .
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1570
RA   Amaya E., Ashurst J.L., Bonfield J.K., Croning M.D.R., Chen C-K.,
RA   Davies R.M., Francis M.D., Garrett N., Gilchrist M.J., Grafham D.V.,
RA   McLaren S.R., Papalopulu N., Rogers J., Smith J.C., Taylor R.G., Voigt J.,
RA   Zorn A.M.;
RT   ;
RL   Submitted (04-OCT-2006) to the INSDC.
RL   Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK. E-mail enquiries:
RL   trop@sanger.ac.uk
XX
DR   MD5; 266477e6e1838684458cb44b544d5da7.
XX
CC   Sanger Xenopus tropicalis EST/cDNA project.
CC
CC   This sequence is from a Xenopus Gene Collection (XGC) library, from a
CC   library constructed by Aaron M. Zorn. cDNA was prepared from RNA extracted
CC   from gastrula embryos. EcoRI-NotI cut cDNA was then ligated into pCS107
CC   with EcoRI at the 5' end and NotI at the 3' end.
CC   Vector: pCS107; Site_1: EcoRI; Site_2: NotI
CC   Host: Escherichia coli XL1-blue
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1570
FT                   /organism="Xenopus tropicalis"
FT                   /mol_type="mRNA"
FT                   /dev_stage="gastrula (stage 10.5-13 mixed)"
FT                   /clone_lib="XGC-gastrula"
FT                   /clone="TGas001m02"
FT                   /db_xref="taxon:8364"
FT   mRNA            <1..>1547
FT                   /gene="dhx38"
FT                   /locus_tag="TGas001m02.1-001"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 38"
FT   CDS_pept        <1..>1547
FT                   /codon_start=1
FT                   /gene="dhx38"
FT                   /locus_tag="TGas001m02.1-001"
FT                   /standard_name="OTTXETP00000009679"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 38"
FT                   /note="match: proteins: Q80X98 Q92620"
FT                   /db_xref="GOA:Q28ER0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q28ER0"
FT                   /protein_id="CAJ81606.1"
FT                   /translation="REVVTRRSDLKLIVTSATMDADKFATFFGNVPIFYIPGRTFPVDI
FT                   LFSKTPQEDYVEAAVKQALQIHLSGAAGDILIFMPGQEDIEVTSDQIVERLEELDSAPP
FT                   LAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVF
FT                   NPRIGMDALQIYPISQANANQRSGRAGRTGPGQCYRLYTQSAYKNELLHTTVPEIQRTN
FT                   LSNVVLLLKSLGVQDLLLFHFMDPPPEDNMLNSMYQLWILGALDNTGALTPTGRLMVEF
FT                   PLDPALSKMLIVSCDMGCSSEILIVVSMLSVPAIFYRPKGREEESDQVREKFAVPESDH
FT                   LTYLNVFLQWKNNNYSSGWCNQHFIHAKAMRKVREVRAQLKDIMVSQRMSLSSCGSDWD
FT                   IVRKCICAAYFHQAARLKGIGEYVNVRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTT
FT                   KEYMQCVTAVDGEWLAELGPMFYSIKHAGKTRQENRRRAKEEVSAMEEEMMLAEKKKT"
XX
SQ   Sequence 1570 BP; 445 A; 339 C; 380 G; 406 T; 0 other;
     cgggaggttg ttacccgacg ctctgatttg aaactgatag tgacttcagc cacaatggat        60
     gctgataaat ttgcaacttt ctttggcaat gttccaattt tttatatacc aggacgtaca       120
     ttccctgttg acatcctgtt tagcaagact ccccaggagg attatgtgga agctgctgta       180
     aaacaagctc tacaaatcca cttatctgga gctgcaggtg atatactgat cttcatgcct       240
     ggtcaggagg acattgaggt gacatcagat cagatagttg aacgcctgga ggaactggac       300
     agtgcaccac ctctggctgt gttaccaatc tactctcagt taccatctga cttgcaagcc       360
     aagatcttcc aaaaggctcc agatggtgtg agaaaatgca ttgtggccac aaatattgca       420
     gagacatccc tgactgtaga tggcatcatg tttgtgatag attcaggcta ctgcaaatta       480
     aaggtattta atccccgcat tggaatggat gctctgcaga tttaccctat tagccaggca       540
     aatgccaacc agcgctcagg tagagcaggc agaacaggcc ctggacagtg ctataggctg       600
     tacacacaga gtgcctataa gaatgagctg ctccacacta cagttccaga aatccagcgc       660
     acaaatctct ctaacgtcgt tctgttgctc aagtcactgg gggttcagga cttgcttctc       720
     tttcacttta tggatcctcc cccagaggac aacatgttga attccatgta ccagctttgg       780
     attcttggag ctcttgataa tacaggtgcc cttacaccta ccggtcggct catggtagaa       840
     tttcctttgg acccagctct ctctaaaatg cttattgtat cttgtgatat gggctgcagt       900
     tctgaaatcc ttattgtggt gtctatgctg tctgtgccag caatattcta tagacctaag       960
     ggacgcgagg aggagagtga ccaggttaga gagaagtttg ctgttccaga gagtgaccat      1020
     ttgacatatc tgaatgtctt cctgcagtgg aagaacaata actactccag tggatggtgc      1080
     aaccagcact tcatccatgc caaggcaatg cgtaaggttc gtgaagttcg ggcacagttg      1140
     aaggacatca tggtttccca gagaatgtct ctctcatcct gtggctcaga ctgggacatt      1200
     gtcagaaagt gcatatgtgc agcctatttt caccaggctg ctaggcttaa ggggattgga      1260
     gagtacgtga atgtacgaac tgggatgcca tgccatctgc acccaactag ctcactgttt      1320
     gggatgggat ataccccaga ttacattgtt taccacgagc tggtgatgac cactaaggaa      1380
     tacatgcaat gtgtcacagc tgtggatggg gaatggctgg cagagctggg tccaatgttt      1440
     tatagtatta agcatgcagg gaaaacaaga caggaaaaca ggcgccgtgc aaaggaggaa      1500
     gtatctgcca tggaggaaga aatgatgttg gcagaaaaaa aaaaaacaaa aaaaaaaaaa      1560
     aaaaaaaaaa                                                             1570
//

If you have problems or comments...

PBIL Back to PBIL home page