(data stored in ACNUC27670 zone)

EMBL: CR858445

ID   CR858445; SV 1; linear; mRNA; HTC; MAM; 647 BP.
XX
AC   CR858445;
XX
DT   12-NOV-2004 (Rel. 81, Created)
DT   01-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Pongo abelii mRNA; cDNA DKFZp468K0511 (from clone DKFZp468K0511)
XX
KW   HTC.
XX
OS   Pongo abelii (Sumatran orangutan)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pongo.
XX
RN   [1]
RP   1-647
RG   The German cDNA Consortium
RA   Poustka A., Albert R., Moosmayer P., Schupp I., Wellenreuther R.,
RA   Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (12-NOV-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 100ad8bdb1fee25abc915e75ba302feb.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by DKFZ (German Cancer Research Center, Heidelberg/Germany)
CC   within the cDNA sequencing consortium of the German Genome Project.
CC   This clone (DKFZp468K0511) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp468K0511
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..647
FT                   /organism="Pongo abelii"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="468 (synonym: phrt1). Vector pSport1_Sfi; host
FT                   DH10B; sites SfilA + SfilB"
FT                   /clone="DKFZp468K0511"
FT                   /tissue_type="heart"
FT                   /note="S100 calcium binding protein A1 (Homo sapiens)"
FT                   /db_xref="taxon:9601"
FT   CDS_pept        74..358
FT                   /codon_start=1
FT                   /gene="DKFZp468K0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q5RC36"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028486"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5RC36"
FT                   /protein_id="CAH90674.1"
FT                   /translation="MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGF
FT                   LDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS"
XX
SQ   Sequence 647 BP; 217 A; 178 C; 144 G; 108 T; 0 other;
     gacatttgca gccttggccg tctgtccaga acctgctccc acctcaggcc caggccaccc        60
     gtgcactgct gcaatgggct ctgagctgga gacggcgatg gagaccctca tcaacgtgtt       120
     ccacgcccac tcgggcaaag agggggacaa gtacaagctg agcaagaagg agctgaaaga       180
     gctgctgcag acggagctct ctggcttcct ggatgcccag aaggatgtgg atgctgtgga       240
     caaggtgatg aaggagctag acgagaatgg agacggggag gtggacttcc aggagtatgt       300
     ggtgcttgtg gctgctctca cagtggcctg taacaatttc ttctgggaga acagttgagc       360
     agacagccac attgggcagc gcccttcctc tccaccctcc cagacctgcc tcttccccct       420
     gcttccacct caccccactt atccctctcc ataaccccac ccctggccac cccacccaca       480
     cacacatcaa gggcgcaaga gtagcggtcc aagcctgcaa ctcatctttc attaaaggct       540
     tctctctcac cagcaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       600
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                     647
//

If you have problems or comments...

PBIL Back to PBIL home page