(data stored in ACNUC22857 zone)

EMBL: CR860139

ID   CR860139; SV 1; linear; mRNA; HTC; MAM; 3352 BP.
XX
AC   CR860139;
XX
DT   12-NOV-2004 (Rel. 81, Created)
DT   01-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Pongo abelii mRNA; cDNA DKFZp469O1619 (from clone DKFZp469O1619)
XX
KW   HTC.
XX
OS   Pongo abelii (Sumatran orangutan)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pongo.
XX
RN   [1]
RP   1-3352
RG   The German cDNA Consortium
RA   Poustka A., Albert R., Moosmayer P., Schupp I., Wellenreuther R.,
RA   Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (12-NOV-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; a3c8bf8878d4a9cfbc6949ed2a8fd755.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by DKFZ (German Cancer Research Center, Heidelberg/Germany)
CC   within the cDNA sequencing consortium of the German Genome Project.
CC   This clone (DKFZp469O1619) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp469O1619
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3352
FT                   /organism="Pongo abelii"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="469 (synonym: pkid1). Vector pSport1_Sfi; host
FT                   DH10B; sites SfilA + SfilB"
FT                   /clone="DKFZp469O1619"
FT                   /tissue_type="kidney"
FT                   /note="adaptor-related protein complex 2, beta 1 subunit
FT                   (Homo sapiens)"
FT                   /db_xref="taxon:9601"
FT   CDS_pept        142..2997
FT                   /codon_start=1
FT                   /gene="DKFZp469O1619"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q5R7H7"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R7H7"
FT                   /protein_id="CAH92283.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQASIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAER
FT                   IDNADESLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQVGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYME
FT                   MNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKEC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYIYQVYDSILKN"
XX
SQ   Sequence 3352 BP; 931 A; 791 C; 772 G; 858 T; 0 other;
     ggcagtggct tagacctaga aaagaatcgt gacgggcagg aaaccatcac accaccaccc        60
     gggctgtgct ctccggctcc cgccgccacc cccgccctcg ccttcgcctc cgcctccggt       120
     gcacattaaa gatccaaagt catgactgac tccaagtatt tcacaaccaa taaaaaagga       180
     gaaatatttg aactaaaagc tgaactcaac aatgaaaaga aagaaaagag aaaggaggct       240
     gtgaagaaag tgattgctgc tatgaccgtg gggaaggatg ttagttctct ctttccagac       300
     gtagtgaact gtatgcagac tgacaatctg gaactaaaga agcttgtgta tctctacttg       360
     atgaactatg ccaagagtca gccagacatg gccatcatgg ctgtaaacag ctttgtgaag       420
     gactgtgaag atcctaatcc tttgattcga gccttggcag tcagaaccat ggggtgcatc       480
     cgggtagata aaattacaga atatctctgt gagccgctcc gcaagtgctt gaaggatgag       540
     gatccctatg ttcggaaaac agcagcagtc tgtgtggcaa aactccatga tatcaatgcc       600
     caaatggtgg aagatcaggg atttctggat tctctacggg atctcatagc agattcaaat       660
     ccaatggtgg tggctaatgc cgtagcagca ttatctgaaa tcagtgagtc tcacccaaac       720
     agcaacttac ttgatctgaa cccacagaac attaataagc tgttgacagc cctgaatgaa       780
     tgcactgaat ggggccagat tttcatcctg gactgcctgt ctaattacaa ccctaaagat       840
     gatcgggagg ctcagagcat ctgtgagcgg gtaactcccc ggctatccca tgccaactca       900
     gcagtggtgc tttcagcggt aaaagtccta atgaagtttc tagaattgtt acctaaggat       960
     tctgactact acaatatgct gctgaagaag ttagcccctc cacttgtcac tttgctgtct      1020
     ggggagccag aagtgcagta tgtcgccctg aggaacatca acttaattgt ccagaaaagg      1080
     cctgaaatct tgaagcagga aatcaaagtc ttttttgtga agtacaatga tcccatctat      1140
     gttaaactag agaagttgga catcatgatt cgtttggcat ctcaagccag cattgctcag      1200
     gttctggcag aactgaaaga atatgctaca gaggtggatg ttgactttgt tcgaaaagct      1260
     gtgcgggcca ttggacggtg tgccatcaag gtggagcaat ctgcagagcg ctgtgtaagc      1320
     acattgcttg atctaatcca gaccaaagtg aattatgtgg tccaagaagc aattgttgtc      1380
     atcagggaca tcttccgcaa ataccccaac aagtatgaaa gtatcattgc cactctatgt      1440
     gagaacttag actcgctgga tgagccagat gctcgagcag ctatgatttg gattgtggga      1500
     gaatatgctg aaagaattga caatgcagat gagtcactag aaagcttcct ggagggtttt      1560
     cacgatgaaa gcacccaggt gcagctcact ctgcttactg ccatagtgaa gctgtttctc      1620
     aagaaaccat cagaaacaca ggagctagtc cagcaggtct tgagtttggc aacacaggat      1680
     tctgataatc ctgaccttcg agaccggggc tatatttatt ggcgccttct ctcaactgac      1740
     cctgtcacag ctaaagaagt agtcttgtct gagaagccac tgatctctga ggagacagac      1800
     cttattgagc caactctgct ggatgagcta atctgccaca ttggttcttt ggcctctgtg      1860
     tatcataagc ctcccaatgc ttttgtggaa ggaagtcatg gaattcatcg taaacacttg      1920
     ccaattcatc atgggagcac tgatgcaggt gacagccctg ttggcactac cactgcaacg      1980
     aacctggaac agcctcaggt tatcccctct caaggtgatc ttctagggga tcttttaaac      2040
     cttgacctcg gtcccccagt caacgtgcca caggtgtcct ccatgcaggt gggagcagtg      2100
     gatctcctag gaggaggact agatagtctg cttggcagtg accttggcgg gggcattgga      2160
     ggaagtccgg cagtgggaca atccttcatc ccatcatcgg tgcctgcaac ctttgctcct      2220
     tcacctacac ctgctgtggt cagcagtgga ctgaatgacc tgtttgaact ctccacaggg      2280
     ataggcatgg cacccggtgg atatgtggct cctaaggctg tctggctacc tgcagtaaag      2340
     gctaaaggct tggagatttc aggaacattt actcaccgcc aagggcacat ctatatggaa      2400
     atgaacttca ccaataaagc tctgcagcac atgacagatt ttgcaatcca gtttaacaaa      2460
     aatagctttg gtgtcatccc cagcactcct ctggccatcc atacaccact gatgccaaac      2520
     cagagcattg atgtctccct gcctctcaat actttgggcc cagtcatgaa gatggaacct      2580
     ctgaataacc tccaggtggc tgtgaaaaac aatatcgatg tcttctactt cagctgcctc      2640
     atcccactca atgtgctttt tgtagaagat ggcaaaatgg agcgccaggt cttccttgca      2700
     acgtggaagg atattcccaa tgaaaacgaa cttcagtttc agattaagga atgtcattta      2760
     aatgctgaca ctgtttccag caagttgcaa aacaacaatg tttatactat tgccaagagg      2820
     aatgtggaag ggcaggacat gctgtaccaa tccctgaagc tcactaatgg catttggatt      2880
     ttggccgaac tacgtatcca gccgggaaac cccaattaca cgctgtcact gaagtgtaga      2940
     gctcctgaag tctctcaata catctatcag gtctacgaca gcattctgaa aaactaacaa      3000
     gactggtcta gtacccttca atcatgctgt gaccggtgca agtcaagaac tcttaactgg      3060
     aagaaattgt attgctgtgt agaatctgaa cacactgagg ccacctagca aggtagtaac      3120
     tagtctaacc tgtgctaaca ttagggcaca acctgttgga tagttttagc ttcctgtgaa      3180
     catttgtaac cactgcttca gttacctccc acctcttgcc acctgctgct gctatctgtc      3240
     cttacttgtg ggcttctcca tgctatgcca atggctggct ttttctacac cctcttttga      3300
     gtgtagtttg gtattttgta attgagagct catttcaaaa aaaaaaaaaa aa              3352
//

If you have problems or comments...

PBIL Back to PBIL home page