(data stored in ACNUC24361 zone)

EMBL: CR860277

ID   CR860277; SV 1; linear; mRNA; HTC; MAM; 2175 BP.
XX
AC   CR860277;
XX
DT   12-NOV-2004 (Rel. 81, Created)
DT   01-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Pongo abelii mRNA; cDNA DKFZp459J225 (from clone DKFZp459J225)
XX
KW   HTC.
XX
OS   Pongo abelii (Sumatran orangutan)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pongo.
XX
RN   [1]
RP   1-2175
RG   The German cDNA Consortium
RA   Ansorge W., Krieger S., Regiert T., Rittmueller C., Schwager B.,
RA   Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (12-NOV-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 9e042f81cd31453de9d4f8cf65a08676.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by EMBL (European Molecular Biology Laboratories,
CC   Heidelberg/Germany) within the cDNA sequencing consortium of the German
CC   Genome Project.
CC   This clone (DKFZp459J225) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp459J225
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2175
FT                   /organism="Pongo abelii"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="459 (synonym: pcor1). Vector pSport1_Sfi; host
FT                   DH10B; sites SfilA + SfilB"
FT                   /clone="DKFZp459J225"
FT                   /tissue_type="cortex"
FT                   /note="zinc finger protein 99 (Homo sapiens)"
FT                   /db_xref="taxon:9601"
FT   CDS_pept        199..1923
FT                   /codon_start=1
FT                   /gene="DKFZp459J225"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q5R741"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R741"
FT                   /protein_id="CAH92419.1"
FT                   /translation="MNSSLTVQRRGSDAELGPWVMAARSKDAALSQRDGVLPVKVEEDS
FT                   PGSWEPSYPAAWPDPETSRLHFRQLRYQEVAGPEEALSRLRELCRRWLRPELLSKEQIL
FT                   ELLVLEQFLTILPEELQAWVREHCPESGEEAVAVVRALQRALDGTSPQGMVTFEDMAVS
FT                   LTWEEWERLDPARRDFCRESAQKDSGSTVPPSLESRVENKELIPMQQILEEVEPQGQLQ
FT                   EAFQGKHPLFSKCGSTHEDRVEKQSGNPLPLKLENSAEAEGLNSISDVNKNGSIEGEDS
FT                   KNNELQNSARCSNLVLCQHIPKAERPTDGEEHGNKCKQSFHMVAWHVLKPHKSDSGDSF
FT                   HHSSFFETQRQLHEERPYKCGNCGKSFKQRSDLFRHQRIHTGEKPYGCQECGKSFSQSA
FT                   ALTKHQRTHTGEKPYTCLKCGERFRQNSHLNRHQSTHSRDKHFKCEECGETCRISNLFR
FT                   HQRLHKGERPYKCEECKKSFKQRSDLFKHHRIHTGEKPYGCSVCGKRFNQSATLIKHQR
FT                   IHTGEKPYKCLECGERFRQSTHLIRHQRIHQNKMLSVGRGAHACNPSPLGGQGRRII"
XX
SQ   Sequence 2175 BP; 608 A; 511 C; 634 G; 422 T; 0 other;
     ggggcacggg aagttttcgg ttgcttgacg gagggagttg taggtgcaaa gctgaggaaa        60
     gaaggaagtg tgagagaggg gcttgatgtg ataagggccg gtgtttggga ccggagggtg       120
     ttgagggctg atgagttcct tgggtttgct cttttttcac ttgaagactc caggaagagc       180
     atcacatgtc ggagaaagat gaattccagc ttgaccgtcc agaggcgcgg cagtgacgct       240
     gagttgggac cctgggtgat ggctgcgagg tccaaggacg cggcgctgtc ccaacgcgac       300
     ggagttttgc ccgtgaaagt ggaggaagac tcacccggaa gttgggagcc cagctatccc       360
     gcggcttggc ctgaccccga aacttctcga ctgcacttta ggcagctgcg ttaccaggag       420
     gtggctggac cggaagaggc gctgagccgg ctccgagaac tctgtcgtcg gtggctgagg       480
     cccgagctgc tctccaagga gcagatcctg gagctgctgg tgctggagca gttcctcacc       540
     atcctgcccg aggagctcca agcctgggtg cgagagcact gcccagagag cggggaggag       600
     gcggtggccg tggtgcgggc tctgcagcga gcgctcgatg gaacctcacc ccaggggatg       660
     gtgactttcg aggacatggc tgtgtctcta acctgggagg agtgggagcg cctggaccca       720
     gcacggaggg acttctgcag agagagtgcg cagaaggatt ccgggagcac agttccgccg       780
     agtttggaaa gcagagtgga gaacaaagag ttgattccaa tgcaacaaat tttagaagaa       840
     gtggagccac aggggcaact acaagaagcg ttccagggga agcaccccct gttttctaag       900
     tgtggcagta cccatgagga cagggtggaa aagcagtctg gaaacccctt gcccctgaaa       960
     cttgaaaatt ctgctgaagc agaaggactc aacagcatct cagatgtcaa caagaatggt      1020
     tccatagaag gggaagactc taaaaataat gaattgcaga acagtgccag atgttccaac      1080
     cttgttctat gtcagcacat cccaaaagca gagaggccca ctgacggtga ggaacacggg      1140
     aacaagtgca agcagagttt ccacatggtg gcgtggcacg tgctgaaacc tcacaagtct      1200
     gacagtggag acagtttcca tcattccagc ttttttgaga cccagaggca gctccatgaa      1260
     gagagacctt ataaatgtgg taactgtggg aagagtttca aacaacgctc tgacctcttt      1320
     agacaccaga gaatccacac aggtgagaaa ccctatggct gccaagaatg tgggaaaagc      1380
     ttcagccaga gcgctgccct gaccaagcac cagagaacac acacaggcga gaagccgtac      1440
     acctgtctga aatgtgggga gcgcttcagg cagaattcac acctaaatcg tcatcaaagt      1500
     acccacagta gagacaaaca ttttaaatgt gaggaatgcg gggaaacctg tcgtatttcc      1560
     aaccttttta gacatcagag actacataaa ggggagagac cctataagtg tgaagaatgt      1620
     aagaagagct tcaaacagcg ctctgacctc tttaaacacc acagaatcca cactggggag      1680
     aagccctatg gatgttccgt ctgtgggaaa cgcttcaatc agagtgcaac cctcattaaa      1740
     caccagagaa ttcacactgg ggaaaagcct tacaaatgtc ttgaatgtgg ggaaagattt      1800
     agacaaagta cacaccttat ccgacaccaa agaattcatc aaaataaaat gctatcggtt      1860
     gggcgcggtg ctcacgcctg taatcccagc cctttgggag gccaaggcag gcggatcatt      1920
     tgagatcagg agtttgaaac cagcctggcc aacatggtaa aaccccatct ctactacaaa      1980
     tacaaaaatg agccgggcgt ggtggtgcgt gcctgtaagc ccagctatgt gggaggctga      2040
     ggcaggagaa tcacttgaac ccaggaggca caggttgcag tgacccgaga tcacgccacc      2100
     gcactccagc ctggacaaca gagcgagact ccatctcgaa aaagaaataa agtgctatca      2160
     ttttgataaa aaaaa                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page