(data stored in ACNUC7820 zone)

EMBL: CR860814

ID   CR860814; SV 1; linear; mRNA; HTC; MAM; 3827 BP.
XX
AC   CR860814;
XX
DT   12-NOV-2004 (Rel. 81, Created)
DT   01-MAY-2008 (Rel. 95, Last updated, Version 3)
XX
DE   Pongo abelii mRNA; cDNA DKFZp469P2014 (from clone DKFZp469P2014)
XX
KW   HTC.
XX
OS   Pongo abelii (Sumatran orangutan)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pongo.
XX
RN   [1]
RP   1-3827
RG   The German cDNA Consortium
RA   Bloecker H., Boecher M., Brandt P., Mewes H.W., Weil B., Amid C.,
RA   Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (12-NOV-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 0b1f2593f715748c1db0ddfcaf3df0f8.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by GBF (National Research Centre for Biotechnology Ltd.,
CC   Braunschweig/Germany) within the cDNA sequencing consortium of the German
CC   Genome Project.
CC   This clone (DKFZp469P2014) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp469P2014
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3827
FT                   /organism="Pongo abelii"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="469 (synonym: pkid1). Vector pSport1_Sfi; host
FT                   DH10B; sites SfilA + SfilB"
FT                   /clone="DKFZp469P2014"
FT                   /tissue_type="kidney"
FT                   /note="hypothetical protein (Homo sapiens)"
FT                   /db_xref="taxon:9601"
FT   CDS_pept        join(365..643,645..2597)
FT                   /codon_start=1
FT                   /gene="DKFZp469P2014"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R5P3"
FT                   /protein_id="CAH92923.1"
FT                   /translation="MLHFNRCHHLKKITQKCFSSIHVKTDKHAQQFLSRTFALAELRKS
FT                   WYSTHSLVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQ
FT                   DVGNEQFLEEEGKAVLNFSASGSVISLTGSNPMHDASMWHLKKNGIIVYLDVPLLDLIH
FT                   RLKLMKTDRIVGQNSGTSVKDLLKFRRQYYKKWYDARVFCESGASPEEVADKVLNAIKR
FT                   YQDVDSETFISTRHVWPKDGEQKLSAKFFSEAVIEGLASDGGLFVPAKEFPKLSCGEWK
FT                   SLVGATYIERAQILLERCIHPADIPAARLGEMIETAYGENFACSKIAPVRHLSGNQFIL
FT                   ELFHGPTGSFKDLSLQLMPHIFAHCIPPSCNYVILVATSGDTGSAVLNGFSRLNKNDKQ
FT                   RIAVVAFFPENGVSDFQKAQIIGSQRENGWAVGVESDFDFCQTAIKRIFDDSDFTGFLT
FT                   VEYGTILSSANSINWGRLLPQVVYHASAYLDLISQGFISFGSPVDVCIPTGNFGNILAA
FT                   VYAKMMGIPIRKFICASNQNHVLTDFIKTGHYDLRERKLAQTFSPSIDILKSSNLERHL
FT                   HLMANKDGQLMTELFNRLESQHHFQIEKALVEKLQQDFIADWCSEGECLAAINSTYNTS
FT                   GYILDPHTAVAKVVADRVQDKSCPLIISSTAHYSKFAPAIMQALKIKEINETSSSQLYL
FT                   LGSYNALPPLHEALLERTKQQEKMEYQVCAADVNVLKSHVEKLIQNQFI"
XX
SQ   Sequence 3827 BP; 1141 A; 717 C; 807 G; 1162 T; 0 other;
     ggccattacg gccggggact gcgcgggggc ggaaccgggg agctaggtgg aggtacggtg        60
     ctccgtctcc cgtggaggct ttagcggctc gtggacactg ctcccccatt tcctttcatt       120
     tcccccgtct tctcagtgag atttctttga ctccacgttt tgcaaagatc ggttttgcct       180
     cagagtcaac aaactcttcg gattggttcc agtgtgtcct atgtttacaa gtcagtggaa       240
     attaagcaca acacatacaa attgaaaagt caaataagga aatgaatcac ttcccttgat       300
     ggctctaatt ttacttggct aaagccaatt tttaggttgg cttgggcaga aaagtgaaaa       360
     gagaatgctc cactttaacc gatgtcatca tctgaaaaag ataacacaga aatgtttttc       420
     tagtatacat gttaaaacgg ataaacatgc acagcaattt ctttcaagaa cctttgcact       480
     tgcggaattg aggaagtcat ggtattcaac ccactctctt gttggagaca aaaatattat       540
     cctgatggga cctcctggtg ctgggaaaac aacagtaggc agaataatag gtcagaaact       600
     aggttgttgt gtcatagatg tggatgatga tatccttgaa aaaaacctgg aatatgagtg       660
     tgtctgaaaa attacaggat gttggtaatg agcaattttt agaagaggaa ggaaaagctg       720
     tgttaaactt ctctgcatct ggaagtgtga tttcccttac tggttccaat ccaatgcatg       780
     atgctagcat gtggcatctg aagaaaaatg gaataattgt atacctggat gtacctctac       840
     tagatctaat tcatcgttta aaattaatga agacggatag gattgtaggt cagaattctg       900
     gaacatctgt gaaagactta cttaaattta gaagacagta ttataagaag tggtatgatg       960
     ctcgtgtttt ctgtgaaagt ggggcttccc cagaggaggt agctgacaaa gtgctgaatg      1020
     caattaaaag ataccaagat gtggactcgg aaacattcat ttcaacaaga cacgtttggc      1080
     ctaaagatgg tgaacagaag ctttcagcaa aattctttag tgaagctgta attgaggggt      1140
     tggcttctga tggtggactc tttgttcctg cgaaggagtt tccaaaatta agctgtgggg      1200
     agtggaaaag cctagtagga gcaacctaca tagaaagagc acagatactg ttggaaagat      1260
     gtatccatcc tgcagacata cctgctgcca ggttgggaga aatgattgaa actgcttatg      1320
     gggaaaactt tgcctgctca aaaattgctc ctgtcaggca cctttcaggc aaccagttca      1380
     tcctggagtt gtttcatgga ccaacaggat catttaaaga tttgtcttta cagcttatgc      1440
     ctcatatttt tgcacactgt atcccaccaa gttgcaatta tgtgatactt gtagctactt      1500
     caggagacac agggagtgca gtcttaaatg gttttagtcg tcttaataag aatgataagc      1560
     aaaggatagc tgtggtcgca ttttttcctg agaatggagt aagtgatttt caaaaagcac      1620
     aaataattgg cagtcagaga gaaaatggat gggcagtggg tgttgagtca gattttgatt      1680
     tttgccagac agctataaaa agaatttttg acgattctga ttttactggc tttcttactg      1740
     tggaatatgg aacaatctta agttcggcta actccataaa ctggggccga ctacttccgc      1800
     aggtagttta tcatgcttcc gcatatcttg atcttattag tcaaggattt atttcttttg      1860
     gaagcccagt cgatgtctgt attcccacag gaaactttgg taacatttta gcagcagtgt      1920
     atgccaaaat gatgggaatc ccgattcgaa aatttatctg tgcctctaat cagaaccatg      1980
     ttttgactga ttttataaaa acaggacatt atgatctaag ggaaagaaaa ttagcacaaa      2040
     ccttttcgcc gtcgatagat attctcaaat cttcaaacct agaacgacat ttacacttga      2100
     tggctaataa agatggacaa ctaatgacag aattatttaa tcgattagaa agtcagcatc      2160
     acttccagat agaaaaggct ctagttgaga aacttcagca ggattttata gctgactggt      2220
     gctctgaggg agagtgccta gcagctatta actccaccta taatacttca gggtatattt      2280
     tggatccaca cactgctgtt gcaaaagtgg ttgcagatag ggtgcaagac aaaagttgcc      2340
     ctttgattat ctcatctaca gcccattact caaagtttgc acctgctatc atgcaggctt      2400
     taaagattaa agaaatcaat gagacttcat caagtcagct ctatttactg ggttcataca      2460
     atgcattacc tccactgcat gaggctttat tagagagaac aaaacagcaa gagaagatgg      2520
     agtaccaggt ctgtgcagct gatgtgaatg tcttgaagag tcatgtggaa aaacttatcc      2580
     aaaatcaatt catatgaaag ctttcagagt aaattttctt ttctagctat aagcatgcaa      2640
     taataaacct caaacactgg tttggagtac agtagcattt tgtcttttat gtaaatatct      2700
     ctatatctgt ttggaatttc aatagtctga tttctagggc tgacattaga cctccatggc      2760
     acctcctcag atctttaatc tggaagtgac aaaaggtaac acagtgcacg gacctttgag      2820
     ctatcatgct tttgccttgt gctcatgagg agtgtatcgg tttccactcc cacaccctca      2880
     ctgttacgtg gacgaaaatg tctggtatac tatttggcaa ttaaaatatt taagcccagt      2940
     tttcaggtac tacatatgta actagtgaat actctgttga ttagaaagtt aatttaccac      3000
     tcaaaatggc taacttgaat ggagaaagta gtaaactctt ctgttaggat tcgggccagt      3060
     gttttttgtt tgttgtttga tgcagtttca gctcactgca acctccgcct cccaggttca      3120
     agtgattctc ctgcctcatc ctcccaagta gctgggatta caggcatgca ccaccacaca      3180
     cggctaattt ttttattttt agtagagatg gggtttcacc atgttttcca ggctgatctt      3240
     gaacctctga cctcaggtga tccacccacc tcggcctccc aaagtgctag gattgcaggc      3300
     gtaagcctct tcacctggct agggccagtg tttttaaccc tcctcaaatt ccattttgga      3360
     ctacaactaa tgtgtatccg acgctgtcca aattaaagat gcactctgtc cttcactctc      3420
     ctttggatgt ttacggttag ggtgacgatg tttgaaaatc aagacataac tgaaatccag      3480
     gatgaaacag taagcagaac tacttagaag tgaatacaga aataaaatga tctatttcaa      3540
     gaggaaagtt ttccaaaatt aagagtactt gagtagtctc aataggagtg tatttgtaga      3600
     cagcagtttc cctatattat ttggagtcaa ttcttatata atttgttgtt tgtttcttca      3660
     ttgaacattg tctttttctg gcagctgaaa ctgcacacaa ctgatacaca tacttaattt      3720
     gtattccttt gtagtaatac attttaacca tgatttatgt ttgtgaattt actggatgtt      3780
     ttctttctga attaaagatt gtcaagaccg aaaaaaaaaa aaaaaca                    3827
//

If you have problems or comments...

PBIL Back to PBIL home page