(data stored in ACNUC17686 zone)

EMBL: CR936503

ID   CR936503; SV 1; circular; genomic DNA; STD; PRO; 1884661 BP.
XX
AC   CR936503;
XX
PR   Project:PRJNA13435;
XX
DT   21-OCT-2005 (Rel. 85, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Lactobacillus sakei strain 23K complete genome.
XX
KW   complete genome.
XX
OS   Lactobacillus sakei subsp. sakei 23K
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
OC   Lactobacillus.
XX
RN   [1]
RP   1-468
RA   Chaillou S., Champomier-Verges M., Cornet M., Crutz Lecoq A.-M.,
RA   Dudez A.-M., Martin V., Beaufils S., Darbon-Rongere E., Bossy R., Loux V.,
RA   Zagorec M.;
RT   "The genome sequence of the meat-borne lactic acid bacterium Lactobacillus
RT   sakei 23K";
RL   Nat. Biotechnol. 23(12):1494-1495(2005).
XX
RN   [2]
RP   1-1884661
RA   Chaillou S., Champomier-Verges M., Cornet M., Crutz Lecoq A.-M.,
RA   Dudez A.-M., Martin V., Beaufils S., Darbon-Rongere E., Bossy R., Loux V.,
RA   Zagorec M.;
RT   ;
RL   Submitted (16-FEB-2005) to the INSDC.
RL   Unite Flore Lactique et Environnement Carne, Institut National de la
RL   Recherche Agronomique (I.N.R.A), Domaine de vilvert, Jouy-en-Josas 78350,
RL   FRANCE.
XX
DR   MD5; 6522b83c09aae43d8cf34ac3def4112c.
DR   BioSample; SAMEA3138223.
DR   EnsemblGenomes-Gn; EBG00000039886.
DR   EnsemblGenomes-Gn; EBG00000039887.
DR   EnsemblGenomes-Gn; EBG00000039888.
DR   EnsemblGenomes-Gn; EBG00000039889.
DR   EnsemblGenomes-Gn; EBG00000039890.
DR   EnsemblGenomes-Gn; EBG00000039891.
DR   EnsemblGenomes-Gn; EBG00000039892.
DR   EnsemblGenomes-Gn; EBG00000039893.
DR   EnsemblGenomes-Gn; EBG00000039894.
DR   EnsemblGenomes-Gn; EBG00000039895.
DR   EnsemblGenomes-Gn; EBG00000039896.
DR   EnsemblGenomes-Gn; EBG00000039897.
DR   EnsemblGenomes-Gn; EBG00000039898.
DR   EnsemblGenomes-Gn; EBG00000039899.
DR   EnsemblGenomes-Gn; EBG00000039900.
DR   EnsemblGenomes-Gn; EBG00000039901.
DR   EnsemblGenomes-Gn; EBG00000039902.
DR   EnsemblGenomes-Gn; EBG00000039903.
DR   EnsemblGenomes-Gn; EBG00000039904.
DR   EnsemblGenomes-Gn; EBG00000039905.
DR   EnsemblGenomes-Gn; EBG00000039906.
DR   EnsemblGenomes-Gn; EBG00000039907.
DR   EnsemblGenomes-Gn; EBG00000039908.
DR   EnsemblGenomes-Gn; EBG00000039909.
DR   EnsemblGenomes-Gn; EBG00000039910.
DR   EnsemblGenomes-Gn; EBG00000039911.
DR   EnsemblGenomes-Gn; EBG00000039912.
DR   EnsemblGenomes-Gn; EBG00000039913.
DR   EnsemblGenomes-Gn; EBG00000039914.
DR   EnsemblGenomes-Gn; EBG00000039915.
DR   EnsemblGenomes-Gn; EBG00000039916.
DR   EnsemblGenomes-Gn; EBG00000039917.
DR   EnsemblGenomes-Gn; EBG00000039918.
DR   EnsemblGenomes-Gn; EBG00000039919.
DR   EnsemblGenomes-Gn; EBG00000039920.
DR   EnsemblGenomes-Gn; EBG00000039921.
DR   EnsemblGenomes-Gn; EBG00000039922.
DR   EnsemblGenomes-Gn; EBG00000039923.
DR   EnsemblGenomes-Gn; EBG00000039924.
DR   EnsemblGenomes-Gn; EBG00000039925.
DR   EnsemblGenomes-Gn; EBG00000039926.
DR   EnsemblGenomes-Gn; EBG00000039927.
DR   EnsemblGenomes-Gn; EBG00000039928.
DR   EnsemblGenomes-Gn; EBG00000039929.
DR   EnsemblGenomes-Gn; EBG00000039930.
DR   EnsemblGenomes-Gn; EBG00000039931.
DR   EnsemblGenomes-Gn; EBG00000039932.
DR   EnsemblGenomes-Gn; EBG00000039933.
DR   EnsemblGenomes-Gn; EBG00000039934.
DR   EnsemblGenomes-Gn; EBG00000039935.
DR   EnsemblGenomes-Gn; EBG00000039936.
DR   EnsemblGenomes-Gn; EBG00000039937.
DR   EnsemblGenomes-Gn; EBG00000039938.
DR   EnsemblGenomes-Gn; EBG00000039939.
DR   EnsemblGenomes-Gn; EBG00000039940.
DR   EnsemblGenomes-Gn; EBG00000039941.
DR   EnsemblGenomes-Gn; EBG00000039942.
DR   EnsemblGenomes-Gn; EBG00000039943.
DR   EnsemblGenomes-Gn; EBG00000039944.
DR   EnsemblGenomes-Gn; EBG00000039945.
DR   EnsemblGenomes-Gn; EBG00000039946.
DR   EnsemblGenomes-Gn; EBG00000039947.
DR   EnsemblGenomes-Gn; EBG00000039948.
DR   EnsemblGenomes-Gn; EBG00000039949.
DR   EnsemblGenomes-Gn; EBG00000039950.
DR   EnsemblGenomes-Gn; EBG00000039951.
DR   EnsemblGenomes-Gn; EBG00000039952.
DR   EnsemblGenomes-Gn; EBG00000039953.
DR   EnsemblGenomes-Gn; EBG00000039954.
DR   EnsemblGenomes-Gn; EBG00000039955.
DR   EnsemblGenomes-Gn; EBG00000039956.
DR   EnsemblGenomes-Gn; EBG00000039957.
DR   EnsemblGenomes-Gn; EBG00000039958.
DR   EnsemblGenomes-Gn; EBG00000039959.
DR   EnsemblGenomes-Gn; EBG00000039960.
DR   EnsemblGenomes-Gn; EBG00000039961.
DR   EnsemblGenomes-Gn; EBG00000039962.
DR   EnsemblGenomes-Gn; EBG00000039963.
DR   EnsemblGenomes-Gn; EBG00000039964.
DR   EnsemblGenomes-Gn; EBG00000039965.
DR   EnsemblGenomes-Gn; EBG00000039966.
DR   EnsemblGenomes-Gn; EBG00000039967.
DR   EnsemblGenomes-Gn; EBG00000039968.
DR   EnsemblGenomes-Gn; EBG00000039969.
DR   EnsemblGenomes-Gn; EBG00001065218.
DR   EnsemblGenomes-Gn; EBG00001065222.
DR   EnsemblGenomes-Gn; EBG00001065223.
DR   EnsemblGenomes-Gn; EBG00001065225.
DR   EnsemblGenomes-Gn; EBG00001065226.
DR   EnsemblGenomes-Gn; EBG00001065227.
DR   EnsemblGenomes-Gn; EBG00001065229.
DR   EnsemblGenomes-Gn; EBG00001065230.
DR   EnsemblGenomes-Gn; EBG00001065231.
DR   EnsemblGenomes-Gn; EBG00001065233.
DR   EnsemblGenomes-Gn; EBG00001065235.
DR   EnsemblGenomes-Gn; EBG00001065237.
DR   EnsemblGenomes-Gn; EBG00001065239.
DR   EnsemblGenomes-Gn; EBG00001065240.
DR   EnsemblGenomes-Gn; EBG00001065241.
DR   EnsemblGenomes-Gn; EBG00001065242.
DR   EnsemblGenomes-Gn; EBG00001065243.
DR   EnsemblGenomes-Gn; EBG00001065244.
DR   EnsemblGenomes-Gn; EBG00001065246.
DR   EnsemblGenomes-Gn; EBG00001065247.
DR   EnsemblGenomes-Gn; EBG00001065248.
DR   EnsemblGenomes-Gn; EBG00001065249.
DR   EnsemblGenomes-Gn; EBG00001065251.
DR   EnsemblGenomes-Gn; EBG00001065252.
DR   EnsemblGenomes-Gn; EBG00001065253.
DR   EnsemblGenomes-Gn; EBG00001065254.
DR   EnsemblGenomes-Gn; EBG00001065255.
DR   EnsemblGenomes-Gn; EBG00001065256.
DR   EnsemblGenomes-Gn; EBG00001065257.
DR   EnsemblGenomes-Gn; EBG00001065258.
DR   EnsemblGenomes-Gn; EBG00001065259.
DR   EnsemblGenomes-Gn; EBG00001065260.
DR   EnsemblGenomes-Gn; EBG00001065261.
DR   EnsemblGenomes-Gn; EBG00001065262.
DR   EnsemblGenomes-Gn; EBG00001065263.
DR   EnsemblGenomes-Gn; EBG00001065264.
DR   EnsemblGenomes-Gn; EBG00001065265.
DR   EnsemblGenomes-Gn; EBG00001065266.
DR   EnsemblGenomes-Gn; EBG00001065267.
DR   EnsemblGenomes-Gn; EBG00001065268.
DR   EnsemblGenomes-Gn; EBG00001065269.
DR   EnsemblGenomes-Gn; EBG00001065270.
DR   EnsemblGenomes-Gn; EBG00001065271.
DR   EnsemblGenomes-Gn; EBG00001065272.
DR   EnsemblGenomes-Gn; EBG00001065274.
DR   EnsemblGenomes-Gn; EBG00001065275.
DR   EnsemblGenomes-Gn; EBG00001065276.
DR   EnsemblGenomes-Gn; EBG00001065277.
DR   EnsemblGenomes-Gn; EBG00001065278.
DR   EnsemblGenomes-Gn; EBG00001065279.
DR   EnsemblGenomes-Gn; EBG00001065280.
DR   EnsemblGenomes-Gn; EBG00001065281.
DR   EnsemblGenomes-Gn; EBG00001065282.
DR   EnsemblGenomes-Gn; EBG00001065283.
DR   EnsemblGenomes-Gn; EBG00001065284.
DR   EnsemblGenomes-Gn; EBG00001065285.
DR   EnsemblGenomes-Gn; EBG00001065287.
DR   EnsemblGenomes-Gn; EBG00001065288.
DR   EnsemblGenomes-Gn; EBG00001065289.
DR   EnsemblGenomes-Gn; EBG00001065291.
DR   EnsemblGenomes-Gn; EBG00001065292.
DR   EnsemblGenomes-Gn; EBG00001065293.
DR   EnsemblGenomes-Gn; EBG00001065294.
DR   EnsemblGenomes-Gn; EBG00001065295.
DR   EnsemblGenomes-Gn; EBG00001065297.
DR   EnsemblGenomes-Gn; EBG00001065298.
DR   EnsemblGenomes-Gn; EBG00001065299.
DR   EnsemblGenomes-Gn; EBG00001065300.
DR   EnsemblGenomes-Gn; EBG00001065301.
DR   EnsemblGenomes-Gn; EBG00001065302.
DR   EnsemblGenomes-Gn; EBG00001065303.
DR   EnsemblGenomes-Gn; EBG00001065305.
DR   EnsemblGenomes-Gn; EBG00001065307.
DR   EnsemblGenomes-Gn; EBG00001065308.
DR   EnsemblGenomes-Gn; EBG00001065309.
DR   EnsemblGenomes-Gn; EBG00001065310.
DR   EnsemblGenomes-Gn; EBG00001065311.
DR   EnsemblGenomes-Gn; EBG00001065313.
DR   EnsemblGenomes-Gn; EBG00001065314.
DR   EnsemblGenomes-Gn; EBG00001065315.
DR   EnsemblGenomes-Gn; EBG00001065316.
DR   EnsemblGenomes-Gn; EBG00001065317.
DR   EnsemblGenomes-Gn; EBG00001065318.
DR   EnsemblGenomes-Gn; EBG00001065319.
DR   EnsemblGenomes-Gn; EBG00001065320.
DR   EnsemblGenomes-Gn; EBG00001065321.
DR   EnsemblGenomes-Gn; EBG00001065323.
DR   EnsemblGenomes-Gn; EBG00001065324.
DR   EnsemblGenomes-Gn; EBG00001065327.
DR   EnsemblGenomes-Gn; EBG00001065328.
DR   EnsemblGenomes-Gn; EBG00001065330.
DR   EnsemblGenomes-Gn; EBG00001065332.
DR   EnsemblGenomes-Gn; EBG00001065333.
DR   EnsemblGenomes-Gn; EBG00001065334.
DR   EnsemblGenomes-Gn; EBG00001065336.
DR   EnsemblGenomes-Gn; EBG00001065338.
DR   EnsemblGenomes-Gn; EBG00001065339.
DR   EnsemblGenomes-Gn; EBG00001065340.
DR   EnsemblGenomes-Gn; EBG00001065341.
DR   EnsemblGenomes-Gn; EBG00001065343.
DR   EnsemblGenomes-Gn; EBG00001065344.
DR   EnsemblGenomes-Gn; EBG00001065345.
DR   EnsemblGenomes-Gn; EBG00001065346.
DR   EnsemblGenomes-Gn; EBG00001065348.
DR   EnsemblGenomes-Gn; EBG00001065349.
DR   EnsemblGenomes-Tr; EBG00000039886-1.
DR   EnsemblGenomes-Tr; EBG00000039887-1.
DR   EnsemblGenomes-Tr; EBG00000039888-1.
DR   EnsemblGenomes-Tr; EBG00000039889-1.
DR   EnsemblGenomes-Tr; EBG00000039890-1.
DR   EnsemblGenomes-Tr; EBG00000039891-1.
DR   EnsemblGenomes-Tr; EBG00000039892-1.
DR   EnsemblGenomes-Tr; EBG00000039893-1.
DR   EnsemblGenomes-Tr; EBG00000039894-1.
DR   EnsemblGenomes-Tr; EBG00000039895-1.
DR   EnsemblGenomes-Tr; EBG00000039896-1.
DR   EnsemblGenomes-Tr; EBG00000039897-1.
DR   EnsemblGenomes-Tr; EBG00000039898-1.
DR   EnsemblGenomes-Tr; EBG00000039899-1.
DR   EnsemblGenomes-Tr; EBG00000039900-1.
DR   EnsemblGenomes-Tr; EBG00000039901-1.
DR   EnsemblGenomes-Tr; EBG00000039902-1.
DR   EnsemblGenomes-Tr; EBG00000039903-1.
DR   EnsemblGenomes-Tr; EBG00000039904-1.
DR   EnsemblGenomes-Tr; EBG00000039905-1.
DR   EnsemblGenomes-Tr; EBG00000039906-1.
DR   EnsemblGenomes-Tr; EBG00000039907-1.
DR   EnsemblGenomes-Tr; EBG00000039908-1.
DR   EnsemblGenomes-Tr; EBG00000039909-1.
DR   EnsemblGenomes-Tr; EBG00000039910-1.
DR   EnsemblGenomes-Tr; EBG00000039911-1.
DR   EnsemblGenomes-Tr; EBG00000039912-1.
DR   EnsemblGenomes-Tr; EBG00000039913-1.
DR   EnsemblGenomes-Tr; EBG00000039914-1.
DR   EnsemblGenomes-Tr; EBG00000039915-1.
DR   EnsemblGenomes-Tr; EBG00000039916-1.
DR   EnsemblGenomes-Tr; EBG00000039917-1.
DR   EnsemblGenomes-Tr; EBG00000039918-1.
DR   EnsemblGenomes-Tr; EBG00000039919-1.
DR   EnsemblGenomes-Tr; EBG00000039920-1.
DR   EnsemblGenomes-Tr; EBG00000039921-1.
DR   EnsemblGenomes-Tr; EBG00000039922-1.
DR   EnsemblGenomes-Tr; EBG00000039923-1.
DR   EnsemblGenomes-Tr; EBG00000039924-1.
DR   EnsemblGenomes-Tr; EBG00000039925-1.
DR   EnsemblGenomes-Tr; EBG00000039926-1.
DR   EnsemblGenomes-Tr; EBG00000039927-1.
DR   EnsemblGenomes-Tr; EBG00000039928-1.
DR   EnsemblGenomes-Tr; EBG00000039929-1.
DR   EnsemblGenomes-Tr; EBG00000039930-1.
DR   EnsemblGenomes-Tr; EBG00000039931-1.
DR   EnsemblGenomes-Tr; EBG00000039932-1.
DR   EnsemblGenomes-Tr; EBG00000039933-1.
DR   EnsemblGenomes-Tr; EBG00000039934-1.
DR   EnsemblGenomes-Tr; EBG00000039935-1.
DR   EnsemblGenomes-Tr; EBG00000039936-1.
DR   EnsemblGenomes-Tr; EBG00000039937-1.
DR   EnsemblGenomes-Tr; EBG00000039938-1.
DR   EnsemblGenomes-Tr; EBG00000039939-1.
DR   EnsemblGenomes-Tr; EBG00000039940-1.
DR   EnsemblGenomes-Tr; EBG00000039941-1.
DR   EnsemblGenomes-Tr; EBG00000039942-1.
DR   EnsemblGenomes-Tr; EBG00000039943-1.
DR   EnsemblGenomes-Tr; EBG00000039944-1.
DR   EnsemblGenomes-Tr; EBG00000039945-1.
DR   EnsemblGenomes-Tr; EBG00000039946-1.
DR   EnsemblGenomes-Tr; EBG00000039947-1.
DR   EnsemblGenomes-Tr; EBG00000039948-1.
DR   EnsemblGenomes-Tr; EBG00000039949-1.
DR   EnsemblGenomes-Tr; EBG00000039950-1.
DR   EnsemblGenomes-Tr; EBG00000039951-1.
DR   EnsemblGenomes-Tr; EBG00000039952-1.
DR   EnsemblGenomes-Tr; EBG00000039953-1.
DR   EnsemblGenomes-Tr; EBG00000039954-1.
DR   EnsemblGenomes-Tr; EBG00000039955-1.
DR   EnsemblGenomes-Tr; EBG00000039956-1.
DR   EnsemblGenomes-Tr; EBG00000039957-1.
DR   EnsemblGenomes-Tr; EBG00000039958-1.
DR   EnsemblGenomes-Tr; EBG00000039959-1.
DR   EnsemblGenomes-Tr; EBG00000039960-1.
DR   EnsemblGenomes-Tr; EBG00000039961-1.
DR   EnsemblGenomes-Tr; EBG00000039962-1.
DR   EnsemblGenomes-Tr; EBG00000039963-1.
DR   EnsemblGenomes-Tr; EBG00000039964-1.
DR   EnsemblGenomes-Tr; EBG00000039965-1.
DR   EnsemblGenomes-Tr; EBG00000039966-1.
DR   EnsemblGenomes-Tr; EBG00000039967-1.
DR   EnsemblGenomes-Tr; EBG00000039968-1.
DR   EnsemblGenomes-Tr; EBG00000039969-1.
DR   EnsemblGenomes-Tr; EBT00001668232.
DR   EnsemblGenomes-Tr; EBT00001668233.
DR   EnsemblGenomes-Tr; EBT00001668234.
DR   EnsemblGenomes-Tr; EBT00001668235.
DR   EnsemblGenomes-Tr; EBT00001668236.
DR   EnsemblGenomes-Tr; EBT00001668237.
DR   EnsemblGenomes-Tr; EBT00001668238.
DR   EnsemblGenomes-Tr; EBT00001668239.
DR   EnsemblGenomes-Tr; EBT00001668240.
DR   EnsemblGenomes-Tr; EBT00001668241.
DR   EnsemblGenomes-Tr; EBT00001668242.
DR   EnsemblGenomes-Tr; EBT00001668243.
DR   EnsemblGenomes-Tr; EBT00001668244.
DR   EnsemblGenomes-Tr; EBT00001668245.
DR   EnsemblGenomes-Tr; EBT00001668246.
DR   EnsemblGenomes-Tr; EBT00001668247.
DR   EnsemblGenomes-Tr; EBT00001668248.
DR   EnsemblGenomes-Tr; EBT00001668249.
DR   EnsemblGenomes-Tr; EBT00001668250.
DR   EnsemblGenomes-Tr; EBT00001668251.
DR   EnsemblGenomes-Tr; EBT00001668252.
DR   EnsemblGenomes-Tr; EBT00001668253.
DR   EnsemblGenomes-Tr; EBT00001668254.
DR   EnsemblGenomes-Tr; EBT00001668255.
DR   EnsemblGenomes-Tr; EBT00001668256.
DR   EnsemblGenomes-Tr; EBT00001668257.
DR   EnsemblGenomes-Tr; EBT00001668258.
DR   EnsemblGenomes-Tr; EBT00001668259.
DR   EnsemblGenomes-Tr; EBT00001668260.
DR   EnsemblGenomes-Tr; EBT00001668261.
DR   EnsemblGenomes-Tr; EBT00001668262.
DR   EnsemblGenomes-Tr; EBT00001668263.
DR   EnsemblGenomes-Tr; EBT00001668264.
DR   EnsemblGenomes-Tr; EBT00001668265.
DR   EnsemblGenomes-Tr; EBT00001668266.
DR   EnsemblGenomes-Tr; EBT00001668267.
DR   EnsemblGenomes-Tr; EBT00001668268.
DR   EnsemblGenomes-Tr; EBT00001668269.
DR   EnsemblGenomes-Tr; EBT00001668270.
DR   EnsemblGenomes-Tr; EBT00001668271.
DR   EnsemblGenomes-Tr; EBT00001668272.
DR   EnsemblGenomes-Tr; EBT00001668273.
DR   EnsemblGenomes-Tr; EBT00001668274.
DR   EnsemblGenomes-Tr; EBT00001668275.
DR   EnsemblGenomes-Tr; EBT00001668276.
DR   EnsemblGenomes-Tr; EBT00001668277.
DR   EnsemblGenomes-Tr; EBT00001668278.
DR   EnsemblGenomes-Tr; EBT00001668279.
DR   EnsemblGenomes-Tr; EBT00001668280.
DR   EnsemblGenomes-Tr; EBT00001668281.
DR   EnsemblGenomes-Tr; EBT00001668282.
DR   EnsemblGenomes-Tr; EBT00001668283.
DR   EnsemblGenomes-Tr; EBT00001668284.
DR   EnsemblGenomes-Tr; EBT00001668285.
DR   EnsemblGenomes-Tr; EBT00001668286.
DR   EnsemblGenomes-Tr; EBT00001668287.
DR   EnsemblGenomes-Tr; EBT00001668288.
DR   EnsemblGenomes-Tr; EBT00001668289.
DR   EnsemblGenomes-Tr; EBT00001668290.
DR   EnsemblGenomes-Tr; EBT00001668291.
DR   EnsemblGenomes-Tr; EBT00001668292.
DR   EnsemblGenomes-Tr; EBT00001668293.
DR   EnsemblGenomes-Tr; EBT00001668294.
DR   EnsemblGenomes-Tr; EBT00001668295.
DR   EnsemblGenomes-Tr; EBT00001668296.
DR   EnsemblGenomes-Tr; EBT00001668297.
DR   EnsemblGenomes-Tr; EBT00001668298.
DR   EnsemblGenomes-Tr; EBT00001668299.
DR   EnsemblGenomes-Tr; EBT00001668300.
DR   EnsemblGenomes-Tr; EBT00001668301.
DR   EnsemblGenomes-Tr; EBT00001668302.
DR   EnsemblGenomes-Tr; EBT00001668303.
DR   EnsemblGenomes-Tr; EBT00001668304.
DR   EnsemblGenomes-Tr; EBT00001668305.
DR   EnsemblGenomes-Tr; EBT00001668306.
DR   EnsemblGenomes-Tr; EBT00001668307.
DR   EnsemblGenomes-Tr; EBT00001668308.
DR   EnsemblGenomes-Tr; EBT00001668309.
DR   EnsemblGenomes-Tr; EBT00001668310.
DR   EnsemblGenomes-Tr; EBT00001668311.
DR   EnsemblGenomes-Tr; EBT00001668312.
DR   EnsemblGenomes-Tr; EBT00001668313.
DR   EnsemblGenomes-Tr; EBT00001668314.
DR   EnsemblGenomes-Tr; EBT00001668315.
DR   EnsemblGenomes-Tr; EBT00001668316.
DR   EnsemblGenomes-Tr; EBT00001668317.
DR   EnsemblGenomes-Tr; EBT00001668318.
DR   EnsemblGenomes-Tr; EBT00001668319.
DR   EnsemblGenomes-Tr; EBT00001668320.
DR   EnsemblGenomes-Tr; EBT00001668321.
DR   EnsemblGenomes-Tr; EBT00001668322.
DR   EnsemblGenomes-Tr; EBT00001668323.
DR   EnsemblGenomes-Tr; EBT00001668324.
DR   EnsemblGenomes-Tr; EBT00001668325.
DR   EnsemblGenomes-Tr; EBT00001668326.
DR   EnsemblGenomes-Tr; EBT00001668327.
DR   EnsemblGenomes-Tr; EBT00001668328.
DR   EnsemblGenomes-Tr; EBT00001668329.
DR   EnsemblGenomes-Tr; EBT00001668330.
DR   EnsemblGenomes-Tr; EBT00001668331.
DR   EnsemblGenomes-Tr; EBT00001668332.
DR   EnsemblGenomes-Tr; EBT00001668333.
DR   EnsemblGenomes-Tr; EBT00001668334.
DR   EnsemblGenomes-Tr; EBT00001668335.
DR   EnsemblGenomes-Tr; EBT00001668336.
DR   EuropePMC; PMC1489637; 16751526.
DR   EuropePMC; PMC1994166; 17708761.
DR   EuropePMC; PMC2519355; 18539796.
DR   EuropePMC; PMC2565949; 18689509.
DR   EuropePMC; PMC2827410; 20078865.
DR   EuropePMC; PMC2918964; 20581187.
DR   EuropePMC; PMC2962554; 20847124.
DR   EuropePMC; PMC3146418; 21702908.
DR   EuropePMC; PMC3416364; 22544250.
DR   EuropePMC; PMC4703478; 26843981.
DR   EuropePMC; PMC4866855; 27174278.
DR   EuropePMC; PMC4920774; 27407290.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01767; SMK_box_riboswitch.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CR936503.
DR   SILVA-SSU; CR936503.
XX
CC   Clone requests: stephane.chaillou@jouy.inra.fr
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1884661
FT                   /organism="Lactobacillus sakei subsp. sakei 23K"
FT                   /strain="23K"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:314315"
FT   regulatory      192..205
FT                   /gene="dnaA"
FT                   /locus_tag="LCA_0001"
FT                   /old_locus_tag="LSA0001"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        210..1556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LCA_0001"
FT                   /old_locus_tag="LSA0001"
FT                   /product="Chromosomal replication initiation protein A"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54303"
FT                   /db_xref="GOA:Q38ZS4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZS4"
FT                   /protein_id="CAI54303.1"
FT                   /translation="MPDLQELWNYLQEKFQTDLTTVGFNAWIKTAKPLAFRANELLIEV
FT                   PSVLHKEYWENNLATKVVEGAYEFAEIELTPIFVLPGESDNLTPLEPEEEHVLTKAETP
FT                   TFLRETHLNSKYTFDTFVTGKGNQMAHAAALVVSEEPGVLYNPLFLYGGVGLGKTHLMQ
FT                   AIGHQLLESKPETNVKYVTSEAFANDFINSIQTKNQEKFRQEYRNVDLLLVDDIQFFAD
FT                   KEGTQEEFFHTFNDLYNDKKQIVLTSDRLPNEIPKLQERLVSRFKWGLPVDITPPDLET
FT                   RIAILRNKADAEHLEIPEDTLSYIAGQIDSNVRELEGALVRVQAYATMQNAEITTSLAA
FT                   DALKGLKLNGKSSQLSIAKIQSVVAKYYSLTVADLKGRKRVKEIVLPRQIAMYLAREMT
FT                   DSSLPKIGQEFGGKDHTTVMHAHERISQSLTTDQNLKDAILDLKNTMKS"
FT   regulatory      1717..1730
FT                   /gene="dnaN"
FT                   /locus_tag="LCA_0002"
FT                   /old_locus_tag="LSA0002"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1734..2873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LCA_0002"
FT                   /old_locus_tag="LSA0002"
FT                   /product="DNA-directed DNA polymerase III, beta subunit"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54304"
FT                   /db_xref="GOA:Q38ZS3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZS3"
FT                   /protein_id="CAI54304.1"
FT                   /translation="MKFSINRALFIKTLNDVQRAISAKTTIPILTGLKLVLSQEGLTLT
FT                   GSDADISIEATLSASDEKNQLVVEEVGEIVLPARFFSEIVKKLPEDQMRIAVGNNFQTT
FT                   IRSGKSEFTINGLDANSYPHLPEIAGQNTFSISTDVLKQLIHQTVIAVSNQESRPILTG
FT                   VHLVLANGEMLAVATDSHRLAQRKLPVALPSDANYDVIIPGKSLVELSRTLADDAEDVE
FT                   IRIAENQVLFKAGNLAFYSRLLEGNYPDTARLIPTSSSTQIEFNAPVLLAAIERASLLS
FT                   HESRNNVVRLTLDTEANTAIIYGNSPDVGNVEEALQFENLTGESLEISFNPDYMKDALR
FT                   SFGQTTIVINFTAALRPFTLVPSEDQEHYIQLITPVRTF"
FT   regulatory      3101..3114
FT                   /locus_tag="LCA_0003"
FT                   /old_locus_tag="LSA0003"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3116..3343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0003"
FT                   /old_locus_tag="LSA0003"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54305"
FT                   /db_xref="GOA:Q38ZS2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZS2"
FT                   /protein_id="CAI54305.1"
FT                   /translation="MTQEIKLEAEFVTLGQLLKEAGIIETGGKAKWFLRENTVLVNGKP
FT                   DDRRGRKLYPEDVIEVPDNGQFIVKQQERL"
FT   CDS_pept        3350..4477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LCA_0004"
FT                   /old_locus_tag="LSA0004"
FT                   /product="DNA repair and recombination protein RecF
FT                   (Recombinational DNA repair ATPase)"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54306"
FT                   /db_xref="GOA:Q38ZS1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZS1"
FT                   /protein_id="CAI54306.1"
FT                   /translation="MYLSELQLNHYRNYESVDVHFSPDTNVLIGENAQGKTNLLEAIYV
FT                   LALARSHRTNTDRELIQWHEDFAKITGLVQRSAGKTPLELVLSQKGKKAKVNHLEQAKL
FT                   SQYIGQLNVVLFAPEDLNIVKGSPAVRRHFIDMEFGQMSSKYLYNISQYKSILKQRNQY
FT                   LKQLQRRQAKDLVYLGVLSDQLAAYGAEVTVARRQFLQQMEKWAQKLHQEITKDREVLT
FT                   FKYQSQIPEEQLDQSVEELYQQFQTLYEKQQIREVEQGTTLIGPHRDDVQFLVNDKDVQ
FT                   AFGSQGQQRTTALSVKLAEIDLMKAQTGEYPILLLDDVLSELDDLRQTHLLKTFQNKVQ
FT                   TFLTTTSLENVKKEIIATPRVFTVTNGVVIEEQAE"
FT   regulatory      4497..4510
FT                   /gene="gyrB"
FT                   /locus_tag="LCA_0005"
FT                   /old_locus_tag="LSA0005"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4514..6490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LCA_0005"
FT                   /old_locus_tag="LSA0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54307"
FT                   /db_xref="GOA:Q38ZS0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZS0"
FT                   /protein_id="CAI54307.1"
FT                   /translation="MADDQLNKETEAQIEAKEERAKSYDASQIQVLEGLEAVRKRPGMY
FT                   IGTTSSQGLHHLVWEIIDNGIDEALAGFATEINVVVEPDNSITVTDDGRGIPVGIQAKT
FT                   GKSALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDAVVTQGGKRYYIDF
FT                   KRGKVQTPMKMIGDAPEHEHGTKVHFVPDPDIFTETTIYDDKILTTRIRELAFLNKGLK
FT                   LTFTDKRADTHEKLEFHYEGGIKSYVEFLDEKKETLLDEPIYVEGEQNGITVEVALQYT
FT                   NDYRTNLLTFANNIHTYEGGTHESGFKTALTRVINDYATKQNIFKASDANLSGEDVREG
FT                   LTAVVSVKHPDPQFEGQTKTKLGNADARSVTDRMFSDHFTKFLMENPSIARQIVDKGSL
FT                   AARARLAAKRAREVTRKKNGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKSGR
FT                   SRLTQAILPIRGKILNVEKASMEKILANEEIRTLFTAMGTGFGQEFDVEKARYHKLIIM
FT                   TDADVDGAHIRTLLLTLFYRYMRPIVEAGYVYIAQPPLYRVKQGKMMRYIDSDEELQDV
FT                   LGTLQPSPKPEVQRYKGLGEMDASQLWETTMDPENRRMLRVNVEDAEEADQIFEMLMGD
FT                   RVEPRRLFIEENAVYMDPKSIDA"
FT   regulatory      6518..6531
FT                   /gene="gyrA"
FT                   /locus_tag="LCA_0006"
FT                   /old_locus_tag="LSA0006"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6538..9111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="LCA_0006"
FT                   /old_locus_tag="LSA0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54308"
FT                   /db_xref="GOA:Q38ZR9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZR9"
FT                   /protein_id="CAI54308.1"
FT                   /translation="MANENGQDGRIENVNLSKTMRKSFLEYAMSVIVARALPDVRDGLK
FT                   PVQRRILYGMSELGVTPEKPYKKSARIVGDVMGKYHPHGDSAIYEAMVRMAQEFSYRYM
FT                   LVDGHGNFGSVDGDGAAAMRYTEARMSKMAVEMLRDINKNTIDYVPNYDESEREPAVLP
FT                   ARFPNLLVNGATGIAVGMTTNIPPHNLAEVISAIHILMDNPDATTADLMDALPGPDFPT
FT                   GGLVMGKSGIRHAYESGKGTITLRAKVDVEVKKNGRERIIVTEIPYMVNKAKLVERIAE
FT                   LARDKRLEGITDLNDESDRDGMRIVIDVRRDMSASVILNNLYKLTPLQTSFSFNMVAIV
FT                   NGAPKVLSLKSILEHYLVHQEEVIRRRTEFDLKKAEARAHILAGLRIALDHIDAIIQII
FT                   RSSKTGDTAKVLLMERYDLSDKQAQAILDMRLVRLTGLERDKVENEYNNLMALITDLKD
FT                   ILAKPERIKKIIYDELLEIQSKFGDKRRTELLVGEVLSIEDEDLIEEEDVVIALTHNGY
FT                   IKRLPASEFKVQNRGGRGIQGMGVHDDDFIEHLISTSTHEVLLFFTNTGKVYRAKGYEI
FT                   PEYGRTAKGIPIINLLGINSDERVQTVVNIGKEVKPEQALFFITRLGTVKRTAVGEFAN
FT                   IRSNGLKALTLHEDDELSNVLMTDGQQNIFIGTHNGYAVSFSETAVRSMGRTAAGVRGI
FT                   RLREGDYVVGSDLLIPGQEILVISEKGYGKRTAVSDYPIKGRGGKGVKTANITEKNGPL
FT                   AGIAAVTGEEDILLITDTGVLIRFKVANVSQTGRATLGVRLIRVDDEAKVATMATVEAE
FT                   PDEPETQTATTEPTVPTENVTDTGLAQVDDLLARAEADQNEPNND"
FT   regulatory      9330..9343
FT                   /gene="rpsF"
FT                   /locus_tag="LCA_0007"
FT                   /old_locus_tag="LSA0007"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9348..9644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="LCA_0007"
FT                   /old_locus_tag="LSA0007"
FT                   /product="30S Ribosomal protein S6"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54309"
FT                   /db_xref="GOA:Q38ZR8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZR8"
FT                   /protein_id="CAI54309.1"
FT                   /translation="MAQSKYEVTYIISTTLDEESKTALVNRFDGILKDNGAEVVDSKDW
FT                   SKRRLAYEINNQHEGIYHIVNVLADNDEALNEFDRLAKIDGAILRHMIVKRED"
FT   regulatory      9667..9680
FT                   /gene="ssb"
FT                   /locus_tag="LCA_0008"
FT                   /old_locus_tag="LSA0008"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9683..10195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LCA_0008"
FT                   /old_locus_tag="LSA0008"
FT                   /product="Single-stranded DNA binding protein (Ssb)"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54310"
FT                   /db_xref="GOA:Q38ZR7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZR7"
FT                   /protein_id="CAI54310.1"
FT                   /translation="MINRVVLVGRLTRDVDLRYTSSGAAVGTFSMAVNRQFTNANGDRE
FT                   ADFINCVIWRKSAENFANFTKKGSLVGVDGRLQTRNYENQQGQRVYVTEVVVDNFSLLE
FT                   SRTTTEQRQGDGASQNFNSNQSNGSQQSGFTSPQQTGNAPAANNTQADPFANNGQAIDI
FT                   SDDDLPF"
FT   regulatory      10209..10222
FT                   /gene="rpsR"
FT                   /locus_tag="LCA_0009"
FT                   /old_locus_tag="LSA0009"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10226..10465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="LCA_0009"
FT                   /old_locus_tag="LSA0009"
FT                   /product="30S Ribosomal protein S18"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54311"
FT                   /db_xref="GOA:Q38ZR6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZR6"
FT                   /protein_id="CAI54311.1"
FT                   /translation="MAQQRRGGNRRRRKVDFIAANHIEYIDYKDTDLLKRFISERGKIL
FT                   PRRVSGTSAKNQRRLTIAIKRARIMGLLPFVTED"
FT   regulatory      10480..10509
FT                   /gene="rpsR"
FT                   /locus_tag="LCA_0009"
FT                   /old_locus_tag="LSA0009"
FT                   /regulatory_class="terminator"
FT   regulatory      10667..10680
FT                   /locus_tag="LCA_0010"
FT                   /old_locus_tag="LSA0010"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10683..12716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0010"
FT                   /old_locus_tag="LSA0010"
FT                   /product="Putative nucleotide-binding phosphoesterase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54312"
FT                   /db_xref="GOA:Q38ZR5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZR5"
FT                   /protein_id="CAI54312.1"
FT                   /translation="MKNKIKQLKLPQFLDDARLRMVALVLLGLTAVSLIFAAMLNWLIA
FT                   LILFVLLIGTLITVLYAIETVTENTAKYVSDLSYRIKRGEQEALIKMPIGILLYNEKGE
FT                   IQWTNPYLQQYLGNKEVLGKTIKEVDPELAELVVQNEDSNETKLVHWGDNQFQIIIQES
FT                   IGVVYLLDITRYAAIEDRYEDEQVAIGQVFLDNYDEITQTMDDQAISNLNNYVTNELSR
FT                   WANQFQMFLKRVDDDHFFVLAYAKSLHAAEKEKFKILDEIREETSKQNFPLTLSVGFAY
FT                   GESDLAVLATTSQSNLDLALGRGGDQVVVKANDGQARFYGGKTNPMEKRTRVRARMISQ
FT                   ALQEVFKQVDSIFVMGHIRPDMDALGASFGIRRIAEMNGKKCYVVVDQNNIHTDIQRLL
FT                   EEVKGYPEIAVEVLSPEEAVEKATANSLLVMVDHSKPSITMAPKLYEKLAQRTIVLDHH
FT                   RRGEEFPENPMLVYIEPYASSTCELVTEMFEYQPQNVANINKFEATTMLAGITVDTQSF
FT                   SMRTGTRTFDAASYLRSVGADASMVQHLLKENVDNYIQKNHLIETIEMVEDNMALCMGE
FT                   DNRSYDPVIAAQAADTLLSLSGIEAAFVIVKRPDGMIAISARSLGDVNVQVIMEKMGGG
FT                   GHLSNAATQLKDATVSEAKAKLLAVLAELFDPEEAEENATND"
FT   regulatory      12720..12733
FT                   /gene="rplI"
FT                   /locus_tag="LCA_0011"
FT                   /old_locus_tag="LSA0011"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        12737..13189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="LCA_0011"
FT                   /old_locus_tag="LSA0011"
FT                   /product="50S Ribosomal protein L9"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54313"
FT                   /db_xref="GOA:Q38ZR4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZR4"
FT                   /protein_id="CAI54313.1"
FT                   /translation="MKVIFLEDVRGKGKKGQVKDVPDGYAQNFLIKNGKAKPATTAAVS
FT                   ALKGQQHAEAKNAAAELAEAKVLKTKIEDDKTIVEVKSKAGEDSRLFGSIPSKQIAQAL
FT                   EQQYKIKVDKRKIDLPEPIKALGYRNVDVRIHPDVTATIRVHIVAE"
FT   regulatory      13209..13236
FT                   /gene="rplI"
FT                   /locus_tag="LCA_0011"
FT                   /old_locus_tag="LSA0011"
FT                   /regulatory_class="terminator"
FT   regulatory      13307..13320
FT                   /gene="dnaC"
FT                   /locus_tag="LCA_0012"
FT                   /old_locus_tag="LSA0012"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13323..14717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="LCA_0012"
FT                   /old_locus_tag="LSA0012"
FT                   /product="Replicative DNA helicase C"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54314"
FT                   /db_xref="GOA:Q38ZR3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZR3"
FT                   /protein_id="CAI54314.1"
FT                   /translation="MNNELIEHTPPQNNEAEQAVLGAVFINSDALVEAMEYVTADDFYR
FT                   KAHRLIFETMVELNERGEGIDAVTIKSELDACNQLEDIGGIGYLAELADAVPTAANVVY
FT                   YAKIVSEKAMLRRLIQTAQNIVAKGYAQDEDVTDILDTAEQEIMAVSEQQNKAGFKSIS
FT                   DVLTTSIEHIDKLYQEEESITGLSTGYPDLDKITAGLHEDELIILAARPGVGKTAFVLN
FT                   IAQNIGKMTNENVAIFSLEMGAEQLVNRMLCAEGSIDANHLRTGQLEESEWQNLIIAMG
FT                   SLSKANIYIDDTPGVKMAEIRAKCRRLAKEKDGIGLIVVDYLQLIEGSGQENRQQEVSA
FT                   ISRQLKKLAKELRVPVIALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDD
FT                   YYRDEPGEDGEDGGSQPAPDPENADVGEVEVIIEKNRAGARGTVKLLFVKTYNKFSSIS
FT                   YSQGEY"
FT   regulatory      15027..15056
FT                   /gene="dnaC"
FT                   /locus_tag="LCA_0012"
FT                   /old_locus_tag="LSA0012"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(15027..15056)
FT                   /locus_tag="LCA_0013"
FT                   /old_locus_tag="LSA0013"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(15068..16408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0013"
FT                   /old_locus_tag="LSA0013"
FT                   /product="Putative nucleobase: cation symporter"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54315"
FT                   /db_xref="GOA:Q38ZR2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZR2"
FT                   /protein_id="CAI54315.1"
FT                   /translation="MADFQSDSARTIEPAPKLSHIKAAILGLQHLLAMYSGDVLIPLLV
FT                   GAALHFNAAQMTYLVSVDIFMCGIATLLQLKRTPLTGIALPVVLGCAVEYVGPLTAIGT
FT                   NSQLGIDVMYGSIIGAGVFILLISGVVARLRWLFPPIVTGSLITLIGFTLIPVAFQNLG
FT                   GGDITAKSFGSVPNLIAGFSTIVLILIFSIWGRGFIQQIAILIGIIGGTLVGAAVGLVS
FT                   LDPVGQASWFKLPELFYFGTPRFEWTSIASMSLAALTTMIESIGVFFALGEIVGRNITS
FT                   NDLKRGFRAEGLAAILGGLFNTFPYSTFSQNVGIVQLSGIKTKKPVYYSAFFLIFLGLL
FT                   PKIGAVATIIPTSVLGGAMVVMFGIVGIQGIKMLHKVDLEDNRNLLVATLSIGMGLGIA
FT                   IHPTLLQALPASVQTILGNGLVVGSLTAVILNLLVNYRSLIEAKHQQ"
FT   regulatory      complement(16411..16424)
FT                   /locus_tag="LCA_0013"
FT                   /old_locus_tag="LSA0013"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      16761..16774
FT                   /gene="gidB"
FT                   /locus_tag="LCA_0014"
FT                   /old_locus_tag="LSA0014"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16777..17517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="LCA_0014"
FT                   /old_locus_tag="LSA0014"
FT                   /product="Methyltransferase GidB (Glucose Inhibited Cell
FT                   Division protein B)"
FT                   /function="1.7 Cell division"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54316"
FT                   /db_xref="GOA:Q38ZR1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZR1"
FT                   /protein_id="CAI54316.1"
FT                   /translation="MTPKTFVATLKEHQIDVSQKQLDQFEIYFERLVATNQNVNLTAIT
FT                   EKEAVYLKHFFDSVAPTLYLESLRTMPLNICDIGAGAGFPSLPMKILFPQLKVTIVDSL
FT                   NKRIHFLEELVAELGLTDVTLVHDRAELFSQVKRPYREQFDMVTARAVAPMNVLAEFCL
FT                   PAVKVGGQFVALKASQSDTELAEAAFAIETLGGQLKEDIAFNLPETNDPRHLVIIDKVQ
FT                   STPDKYPRRAGVPVKKPLMAKEEK"
FT   CDS_pept        17517..18416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB1"
FT                   /locus_tag="LCA_0015"
FT                   /old_locus_tag="LSA0015"
FT                   /product="Chromosome partitioning protein, DNA-binding
FT                   exonuclease"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54317"
FT                   /db_xref="GOA:Q38ZR0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR023705"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZR0"
FT                   /protein_id="CAI54317.1"
FT                   /translation="MAISFFGKKKEETSSSVNQVVMVPVAAIVPNRFQPRKVFNTDHIG
FT                   ELASTIEQHGLLQPIVLREYEDQKFEIIAGERRFRAIQTLKWAELPAIVQKMDDHETAS
FT                   MALIENLQREELTAVEEADAYQNLMKLNGFTQASLAEKMGKSQSFVANKLRLLKLSQPV
FT                   QEAIMNHEISERHGRSLLKLDEFNQQMVLHQILAEQLTVKDTEALVASIINPEPAVEEE
FT                   VADVEEEPATIEESTETPKKAGKKKAPKKEMTTADTKVAVNTIKKSIELIEQSGIPVSA
FT                   VEDDQKDVYRITIEIPKK"
FT   CDS_pept        18428..19195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="LCA_0016"
FT                   /old_locus_tag="LSA0016"
FT                   /product="Chromosome partitioning ATPase"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54318"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ9"
FT                   /protein_id="CAI54318.1"
FT                   /translation="MAHIISIANQKGGVGKTTTTINLAVCLADAGNRVLIIDSDAQGNA
FT                   TSGIGIQKSQVEKDIYDVLVDEIPIKEAILKTNHQHVDIVPATIQLAGAEIELTAQMAR
FT                   EMRLKLGLEAVLNDYDYVLIDCPPSLGQLSINAFTASNSILIPVQSEYYALEGLSQLLN
FT                   TVRLVQKHFNPNLAIEGVLLTMYDARTNLGAQVIEEVRKYFGDRVYDTIIPRNTRLAEA
FT                   PSHGVSIIDYDPKSRGAEVYQELAKEVLAANGQ"
FT   CDS_pept        19185..20060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB2"
FT                   /locus_tag="LCA_0017"
FT                   /old_locus_tag="LSA0017"
FT                   /product="Chromosome partitioning protein, DNA-binding
FT                   exonuclease"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54319"
FT                   /db_xref="GOA:Q38ZQ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ8"
FT                   /protein_id="CAI54319.1"
FT                   /translation="MVNKNGKGLGRGLEAVFSAFEGPNKNRADELVEELALEDIRPNPY
FT                   QPRKTFDEAALAELAASIKKSGVFQPIIVRKSINGYELIAGERRFRASKLAGKTTIPAI
FT                   TRQFDEEAMMEIAVLENLQREDLTPLEEAQAYDTLLKKLNLTQAEVSERLGKSRPYIAN
FT                   YLRLLGLPADVKQLLQEGQLSMGQARTLLSLKKKSQISALAKRTIAESLTVRQLEQLVN
FT                   QMNQTKAAKVAKTKIKSPYIQASENQLVDKFDTKVNIAMNSKGRGKIEIDYGTVEDLNR
FT                   ILALLDVNID"
FT   regulatory      20062..20075
FT                   /locus_tag="LCA_0018"
FT                   /old_locus_tag="LSA0018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20079..20327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0018"
FT                   /old_locus_tag="LSA0018"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54320"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ7"
FT                   /protein_id="CAI54320.1"
FT                   /translation="MYALGDLVQMKKQHACGTNRFEVVRLGMDIRIKCMGCGHAVLLPR
FT                   REFEKKQKKVLVAAADVDTTTEPHYQLLSKGPNQTNF"
FT   regulatory      20334..20347
FT                   /locus_tag="LCA_0019"
FT                   /old_locus_tag="LSA0019"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20351..21451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0019"
FT                   /old_locus_tag="LSA0019"
FT                   /product="Putative GTP-binding protein"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54321"
FT                   /db_xref="GOA:Q38ZQ6"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ6"
FT                   /protein_id="CAI54321.1"
FT                   /translation="MSLTAGIVGLPNVGKSTLFNAITKAGAEMANYPFATIDPNVGMVE
FT                   VPDKRLDRIQEIIPAKKIVPTTFEFTDIAGIVKGASKGEGLGNKFLENIRQVDAIVHVV
FT                   RAFDDDNITSVTGTVDPLDDIDTINLELSLADLESVTKRYARVEKIARTKDKEALAEFE
FT                   VLKKIKPVLEEGGSVRSIEFNEDEAKMVKGFFLLTSKPVLYVANIAEDAMGDPDSVDYV
FT                   KQIQDFAAKEGAEVIAISARTEEEIASLDDADKAEFLEAEGVTESGLDKLIRASYHLLG
FT                   LATFFTAGGKETRAWTFRQGMKAPQTAGVIHSDFERGFIRAETVSFADLDQYGSMQAVK
FT                   EAGRLRLEGKEYMVEDGDIIEFRFNV"
FT   regulatory      21453..21466
FT                   /locus_tag="LCA_0020"
FT                   /old_locus_tag="LSA0020"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21469..22143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0020"
FT                   /old_locus_tag="LSA0020"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54322"
FT                   /db_xref="GOA:Q38ZQ5"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ5"
FT                   /protein_id="CAI54322.1"
FT                   /translation="MAKTEPAVETEQVDVDALSKQLSKKNADYLFKFKRALKEENVSDE
FT                   KQAEMLAEMLPEMLEAQHKGQPATQIYGPVSTKINQLLHAPKAPVKTSLQLQMLDNALI
FT                   FLIMYLAFNGIAAQFSSKNSNAMIGITSIVITAAMAGVIMTYPMRYTQMPKEQRPPFWK
FT                   MALIVVGLTLAFVAAYGVTILIPGFMNPVLPAWIQIVIAALLIVVRIYIKRRYKITGTF
FT                   FG"
FT   regulatory      22164..22177
FT                   /locus_tag="LCA_0021"
FT                   /old_locus_tag="LSA0021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22180..22944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0021"
FT                   /old_locus_tag="LSA0021"
FT                   /product="Putative lipase/esterase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54323"
FT                   /db_xref="GOA:Q38ZQ4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ4"
FT                   /protein_id="CAI54323.1"
FT                   /translation="MISIEERQFGAVSTLIVTPGGQEQTLLPTVFVYHGWTHRKESELM
FT                   LANFLAKAGFRVVLPDAKYHGKRHGSQMFSELMFEFWQIVMQSVDEFGPLVAALQAEAL
FT                   VDPERLGVTGTSMGGITTDAILARYPNVKVGVDKIGSPMPVAFAKWQTSQLPQSIQERY
FT                   QNQIETTLADLAEYDLALNAERLAGRPLHFYHGTADPMVPYQFTADFITQITEDETPAT
FT                   SQVTLTTENNGQHKVSDEAQLDTVTFMQAHLK"
FT   regulatory      22950..22988
FT                   /locus_tag="LCA_0021"
FT                   /old_locus_tag="LSA0021"
FT                   /regulatory_class="terminator"
FT   regulatory      23309..23322
FT                   /locus_tag="LCA_0022"
FT                   /old_locus_tag="LSA0022"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23325..23993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0022"
FT                   /old_locus_tag="LSA0022"
FT                   /product="Putative hydrolase, haloacid dehalogenase family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54324"
FT                   /db_xref="GOA:Q38ZQ3"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ3"
FT                   /protein_id="CAI54324.1"
FT                   /translation="MTKGTVLFDLDGTIADSQKGIINALEYMIEELALPTQTTAQLISF
FT                   IGPPLNETIMKVFSLDEAATQQAIKTFQAYYAPKGLYENELYPGMHETLAALQAQDLQL
FT                   AIATSKPEPFAKKIIDHLELTPYFSGVYGASVDATTRVKKADVITYALAELGLSTKTEP
FT                   LLMVGDRQNDILGAKQNEMAAVGVSYGFGSIAELKKAGAVQIVTQPTDLITTLPANLKL
FT                   "
FT   regulatory      complement(23922..23953)
FT                   /locus_tag="LCA_0023"
FT                   /old_locus_tag="LSA0023"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(23990..24457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0023"
FT                   /old_locus_tag="LSA0023"
FT                   /product="Putative ribonucleotide reductase (NrdI-like)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54325"
FT                   /db_xref="GOA:Q38ZQ2"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ2"
FT                   /protein_id="CAI54325.1"
FT                   /translation="MMTNLSILYISLAGNTRSFVTDLQDYAQQQHTTNPALPTIKLTEI
FT                   SDATPLKDETAPFYAFVPTYLDGGNGIDNGVKELMTNSLGEYIAYGHNADLCYGVIGSG
FT                   NRNFNEQYCLTAKRYAEQFNVPFIADYELRGNSRDVGRIYMLLVANAQKHA"
FT   regulatory      complement(24460..24473)
FT                   /locus_tag="LCA_0023"
FT                   /old_locus_tag="LSA0023"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      24550..24563
FT                   /locus_tag="LCA_0024"
FT                   /old_locus_tag="LSA0024"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24565..25422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0024"
FT                   /old_locus_tag="LSA0024"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54326"
FT                   /db_xref="GOA:Q38ZQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ1"
FT                   /protein_id="CAI54326.1"
FT                   /translation="MTNMSRLDQTPKTTRPNKGLSRFLTFLIFCCAFFGNGGIILNQTV
FT                   LKESFTQEQLNQPKTLKLVTNEFNTVLLDAAQKNGLPQSVQVQLLSTADVKTDMTKTVK
FT                   NIYAFKDRPLDSDQMVEQMAGNLTAAIPSNPIEQALVKTAVAAVQPPLKTYLNDQIQTP
FT                   YLAPMVSELAIMTSVVNIGMWIAIIMGIVLLIVQYAVSGKFRYLFGSLGAALAWSGLFL
FT                   LLGTETAKFSGLIEEVAQRAGEFNTVIIDYATSVLGYAWQISLITLVCGVVLWILAKIF
FT                   QKVR"
FT   regulatory      25432..25466
FT                   /locus_tag="LCA_0024"
FT                   /old_locus_tag="LSA0024"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(25432..25466)
FT                   /locus_tag="LCA_0025"
FT                   /old_locus_tag="LSA0025"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(25476..26102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0025"
FT                   /old_locus_tag="LSA0025"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54327"
FT                   /db_xref="GOA:Q38ZQ0"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZQ0"
FT                   /protein_id="CAI54327.1"
FT                   /translation="MPSYLDITVKLILGFFCLVLQINLSGKGNLAPSSGIDQLQNYVLG
FT                   GIVGGMIYNADISFIQFFLVLLIWTLIVFTMKFLTTHNQRIKRWVIGVPQTIITNGHID
FT                   AQTAAKNSLSAQDLAFKLRIAGISDIRTVQRAILEQNGQLTITQKGDATIKYPLIMDGQ
FT                   INVDALSLIDKDEDWLLADIAQQGYELQQIYMANYLDHQIVITAY"
FT   CDS_pept        complement(26115..26558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0026"
FT                   /old_locus_tag="LSA0026"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54328"
FT                   /db_xref="GOA:Q38ZP9"
FT                   /db_xref="InterPro:IPR021707"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP9"
FT                   /protein_id="CAI54328.1"
FT                   /translation="MLFYRYSYFINQNDFEFYFKILLSLLVGSLILIFFVQYLRHRSDS
FT                   KYRDLLIIFVLVGVLLGGIQYTRVEQLNTAHSQQAQMTQFMKSIAQAQKVPVKSVSVNA
FT                   TSLQQNMVVKIHQHYYQVVFDNNFTSYQLKKAQVINPKITYQQ"
FT   CDS_pept        26675..27040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0027"
FT                   /old_locus_tag="LSA0027"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54329"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP8"
FT                   /protein_id="CAI54329.1"
FT                   /translation="MVLKITAAAQEKIQKQMTTDQALLLDLNDGVGPFSKVGFCSLDTD
FT                   FRLLIVPNDADLKSYTETFDSEMGPIHYKAYTADYFDGHEVLDLDEKRQVLTLVNNSGV
FT                   VDNRVPIIVFDHEKITE"
FT   regulatory      27056..27078
FT                   /locus_tag="LCA_0027"
FT                   /old_locus_tag="LSA0027"
FT                   /regulatory_class="terminator"
FT   CDS_pept        27150..28010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0028"
FT                   /old_locus_tag="LSA0028"
FT                   /product="Hypothetical protein, DegV family"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54330"
FT                   /db_xref="GOA:Q38ZP7"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP7"
FT                   /protein_id="CAI54330.1"
FT                   /translation="MKTAIVTDSAAYLDPQVAQANQIIVVPITVIFSQQTYLENIEIST
FT                   TEFYEKMRTTDKLPTTSQITMGQMQMVFDQLIEDGFDEVICIHLSSGITSFINNLQAYA
FT                   RQVEGITVYPFDSKVTSAGEAFLALEAARLVAQGEDAETIMPKLAALRETIGVYFVVDD
FT                   LSHLMRTGRISNGAAFVGNLLRIKPILSFDTAGKIVALTKERTKKRAFQKVLTDFEAAV
FT                   AAADYPIRACVIDGNNPEESAQWVETLTTKFPGMPIETSHIGPVVGVHTGEKVMGIIWS
FT                   RDYLI"
FT   regulatory      28023..28046
FT                   /locus_tag="LCA_0028"
FT                   /old_locus_tag="LSA0028"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(28023..28046)
FT                   /locus_tag="LCA_0029"
FT                   /old_locus_tag="LSA0029"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(28058..29401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0029"
FT                   /old_locus_tag="LSA0029"
FT                   /product="Putative ion Mg(2+)/Co(2+) transport protein,
FT                   hemolysinC-family"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54331"
FT                   /db_xref="GOA:Q38ZP6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP6"
FT                   /protein_id="CAI54331.1"
FT                   /translation="MSSGQIFTNLFVMLVTFFLAAFFVAAEFALVQTRPSALEDAIHSG
FT                   NGSPKKLKLALKMTQNLNEYLSTTQVGVSVAGIILGWIGESTVETVLVDLLGLTHLVSE
FT                   SGLHIIGAVAGVLVLTYLEVVFTEIVPKNISIDIPMQMLMAVAKPLHYCHIIFYPFVWL
FT                   LNVSANGVVKLIGFAPADESSDVLSQAEIISLSKNAVTGGELDRNDLVYMQRAFDFNDR
FT                   IAKDVMVDRTSLYVVDITDTVKDVVKDYLQQGFSRFPVVAENDKDKILGYVYAYDLVRQ
FT                   AQVDDSIRVSKLLRSIISVPETTPIHSLLTQMINKQTPIVVVVDEYGGTSGIVTDKDIY
FT                   EELFGTVKDEIDDVSDEYIIKEDDNRYRVSGKTTLYDFERFFKADIEAFEASDSVTVAG
FT                   YVLENFANLHQDSVVSIDRFDLTVAEFNRGYIDWFEVSVNPQRADTTL"
FT   CDS_pept        complement(29633..30484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0030"
FT                   /old_locus_tag="LSA0030"
FT                   /product="Putative aldo/keto reductase (oxidoreductase)"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54332"
FT                   /db_xref="GOA:Q38ZP5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP5"
FT                   /protein_id="CAI54332.1"
FT                   /translation="MTTLTTTYTLANGVQIPVLGFGTWQTPDGDTAIKSVKAALEAGYR
FT                   HIDTAQAYQNEASVGTAIQESGVARQDLFLTTKIWNANHSYDLTMQSFEESLQKLQTDY
FT                   VDLLLIHWPNPIDFRDNWETANAETWRAMEELYNAGKAKAIGVSNFRAHHLEALKKTAK
FT                   VQPMVNQIFLAPGELEAETVQYSRDNGLLLEAYSPLGTGKIFDVPEMKTLAAKYQRSIP
FT                   QIASRWSLQHGFLPLPKSVHANYIQENTQLFDFELTPEDMQTIDQLDGVVGKAKDPDTA
FT                   TF"
FT   CDS_pept        complement(30568..31800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0031"
FT                   /old_locus_tag="LSA0031"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54333"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP4"
FT                   /protein_id="CAI54333.1"
FT                   /translation="MPNAQRQNSALYKLTRPANQLTTEQQQLKTAIIQFCEQNRDADHA
FT                   TFLIQGAAGTGKSVILNSVFSTLQELARKTPTSPLYQTNNKLLVNHPEMLKLYQNNVQP
FT                   TNALLKKDFQRPTTFINQAIKQETRADIVLVDEAHLLLTHSDPYNHFRQDNQLDEIRRH
FT                   SRITILIFDEQQVLKVKSYWQQQQLLTKLQTGPYELAQLHHQFRIQANPSVESWLQAFH
FT                   KMQIEALPQDPHFEFKIFADAAQLYAAIRQRNQDSGLARLLATYDFPATLNDPHDHYVT
FT                   APHFKLRWDRYQPTAKTYWADREDSIDEVGSVYTIQGFDLNYAGVILGPSIGYDPAQDC
FT                   LLIKPEYYEDQAAFAGANRFDNPTQIKTQIILNSLYVLMSRARNGLYLYALDPALQKRL
FT                   LALQTATFPGQ"
FT   CDS_pept        complement(31874..32239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0032"
FT                   /old_locus_tag="LSA0032"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54334"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP3"
FT                   /protein_id="CAI54334.1"
FT                   /translation="MKLYQALTQVTLNAQMVDDLAGFQIKPILEKPLNFDPTDLYHYID
FT                   TTLKAGSRHDENNLLFVTDAIFITENFNFKGTVFEAYAQSFEERVTLAHQIVADLNRHV
FT                   SVNIDLAKHEFQLVFVD"
FT   CDS_pept        complement(32333..33472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0033"
FT                   /old_locus_tag="LSA0033"
FT                   /product="Putative transport protein, Major Facilitator
FT                   Superfamily"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54335"
FT                   /db_xref="GOA:Q38ZP2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP2"
FT                   /protein_id="CAI54335.1"
FT                   /translation="MAFITGVAVSNLYYIQPIQSLVAQTFHVNTGAIGTVAMLTQVGYA
FT                   LGLLLIVPFGDVMSRYHLIIRMLILSLLSLLVAFLAPNFILFALSGLLIGLTSVVPQII
FT                   IPYAAVLAAPQKRGAVLGTILSGLLMGVLLSRSFSGIISSYVNWRWVYLLAVIAIGCLI
FT                   ILAAIKLPKDSRPKNGPSYWQTISSLPGLVRAQPLLREAAINGFFMFGTLSIFWSTLVF
FT                   YMASPAYHLGSGTVGLLAILGAAGALAAPVIGRFADQKTPRFIIAVGLLMMTGSYLLFL
FT                   FWGQYLPVMMLGIVLLDVGNQCGQVSNQTRVQALGEATSSRNNTVFMFAYFIGGASGSF
FT                   FGALAWSLGGWAAVCYLALGCQIAALLVHFVLYRPKATR"
FT   CDS_pept        complement(33536..34693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0035"
FT                   /old_locus_tag="LSA0035"
FT                   /product="Putative Iron-sulfur cluster-binding protein"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54336"
FT                   /db_xref="GOA:Q38ZP1"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP1"
FT                   /protein_id="CAI54336.1"
FT                   /translation="MPTLKEQVIAASREIGIDKIGFTSAAPFDYLEASLIEQKKNGHSS
FT                   GFEHKVLEERLYPELIFDQPKSIIAIALAYPTKIHNKPARTGAKRGSFARASWGIDYHD
FT                   ILRDKMAQLIDAIKELADEDDEVTFKPMVDTGELSDVAVAQRAGLGFIGLNGLLITPEF
FT                   GSFVYLGEIITNIPFEPDTPMANQCGSCTRCIDYCPPKALLGDGRLNATRCLSYQTQTK
FT                   GFMPEEYRPKIRSVIYGCDICQQVCPFNKGKDFHFHPDMEPDPEVVMPELQPLLTISNK
FT                   EFKVKFGHLSGSWRGKKPIQRNAIIALANVKDRTAIPQLLQLIDNDPRPVIRGTAAWAL
FT                   GQLVRDVTPEMLDFLQQAADKEEEPEAQVEFHKALLILNERFEER"
FT   CDS_pept        complement(34718..35506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0036"
FT                   /old_locus_tag="LSA0036"
FT                   /product="Putative serine/tyrosine protein phosphatase"
FT                   /function="1.3 Signal transduction"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54337"
FT                   /db_xref="GOA:Q38ZP0"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZP0"
FT                   /protein_id="CAI54337.1"
FT                   /translation="MTQRILPLEKGHNFRELGGYQTTDGRTLKWHKLLRSANLAHLTDA
FT                   DLNYLDQYGLRYDIDLRSEDEKAKAPDRLPANATYEFLPVFAVDETANSASQDELYQLF
FT                   SKDPLSGHTRMQKVYDNLINQPHSKQAYRRFFELLLANDQDHQTALFHCTAGKDRTGMA
FT                   AVFLLSALNVPAETIQADYLLTNLASADFVQKSLQRLQQKTADQGIYQSIQSLLTVHLD
FT                   YLQTAQMAIRQESGTIQNYLKTELQLTNHDLTDLQKIYLM"
FT   CDS_pept        35628..36572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0037"
FT                   /old_locus_tag="LSA0037"
FT                   /product="Putative ion Mg(2+)/Co(2+) transport protein"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54338"
FT                   /db_xref="GOA:Q38ZN9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN9"
FT                   /protein_id="CAI54338.1"
FT                   /translation="MITYFELQTTGEIHENRSEKAANWIHFEDPSKHEMQHFARKYHLP
FT                   RMLFEVAQDINEVARYETFTTETGETLSHICLLVPVKTHDSEKHAEYITRPFSFIISGQ
FT                   TLLTVGHQQSELVAEMQRITGTDQQVESIVLQSISLIYQRYLTALDVVAQQIHQLEKNV
FT                   HISTRNQILYALKALKKSVVYLDLGLKSNQQSLPQIKETALFEEVADQKDRLYRIDLQF
FT                   AKSDKAITTYRALLEQLSDLLSDIISNRLNNIMKTLTSISIVLTVPTIIGGFWGMNVPV
FT                   PLTHSGKGFILLLGLSGIVSALVGWWLKKKDYF"
FT   CDS_pept        36678..37160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usp5"
FT                   /locus_tag="LCA_0038"
FT                   /old_locus_tag="LSA0038"
FT                   /product="Similar to universal stress protein, UspA family"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54339"
FT                   /db_xref="GOA:Q38ZN8"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN8"
FT                   /protein_id="CAI54339.1"
FT                   /translation="MNSMVQEYKRILVPVDGSEEAELALNKAVQVAKMNHAQVDILNVL
FT                   DTKQYAGSYSGMLSGDAIFQISEDAQNYLNSLKYDIQTNDNLMDVEIHVRFGNPKNVIA
FT                   RDFPSEYKTDLIMMGSTGLNAVERMLMGSVTEYVNRTAICDVLIVKTDVNNNPYKK"
FT   regulatory      37179..37204
FT                   /gene="usp5"
FT                   /locus_tag="LCA_0038"
FT                   /old_locus_tag="LSA0038"
FT                   /regulatory_class="terminator"
FT   CDS_pept        37243..37788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag1"
FT                   /locus_tag="LCA_0039"
FT                   /old_locus_tag="LSA0039"
FT                   /product="3-methyl-adenine DNA glycosylase I"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54340"
FT                   /db_xref="GOA:Q38ZN7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN7"
FT                   /protein_id="CAI54340.1"
FT                   /translation="MASDNWMNATAELLTYYEQEWGQPEHDDQRLFELLCLETYQAVLS
FT                   WQTVLAKRAAFRTAFYQFEIQKVAQMTTTDIDRLLQNPAIIRNRRKLAATVNNAQVVLA
FT                   IQQEQESFAHYLWAFVDGQPIVNRPKTWADVPAQSALSVAVSRDMKRRGFQFVGPVTVY
FT                   SYLQGAGLIDDHPQHLKG"
FT   CDS_pept        37871..38365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0040"
FT                   /old_locus_tag="LSA0040"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54341"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN6"
FT                   /protein_id="CAI54341.1"
FT                   /translation="MAQDNVRQLADWLEENMTAIIDRKVSLNVSEIFAVLDGFGVLNNP
FT                   VAKYLDITEETYYQSESDHKLTLSDDRKLLMDVTDRIMVTHVDGILADNKVNFEYSHEA
FT                   VYEDQYLVKRDLEVLTYGLAVIGAVAATVKHNLIQADLSKDAVLSLALAAQNIANWQAN
FT                   Q"
FT   regulatory      38378..38406
FT                   /locus_tag="LCA_0040"
FT                   /old_locus_tag="LSA0040"
FT                   /regulatory_class="terminator"
FT   CDS_pept        38535..39473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="LCA_0041"
FT                   /old_locus_tag="LSA0041"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54342"
FT                   /db_xref="GOA:Q38ZN5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN5"
FT                   /protein_id="CAI54342.1"
FT                   /translation="MTKIAIAGSGAMGSRFGYMLQAAGNDVVLLDNWVEHVQAINTKGL
FT                   TVAIAGQDVQHVQIPAALPTAIKDVQDVIIIFTKSMQLGAMLQSIKPLIGEKTKVVCLL
FT                   NGLGHPETIERYLPKHNIFVGITLWTAGLTGPGEISLSGSGSVELQNVAPEAKGAAEEL
FT                   VAMLSAAGLHATYSADVLFSIWRKACVNGTLNSLCALLDCNIAQLGRTSQVNSLLASIV
FT                   AEFSAVAATEAVDLDVPTTIAHIDQLFDPTQAGEHYPSMHQDLIQHHRLTEIDYLNGYV
FT                   ARKGQERGIPTPVNQLITQLVHTKEALVIEK"
FT   CDS_pept        39487..39954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usp1"
FT                   /locus_tag="LCA_0042"
FT                   /old_locus_tag="LSA0042"
FT                   /product="Similar to universal stress protein, UspA family"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAI59970"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q38UE2"
FT                   /protein_id="CAI59970.1"
FT                   /translation="MTEKQPLNIEVTSMHYQKLLIAIDDDDPTSSKRAFNYACTVAKMY
FT                   QIPMGIVSILETSDLNIYQSLSPNVVAKRREEIAADLDIFVQKAQEFGVQEVTPILGEG
FT                   NPGHVIVEEIIPEFKPDLVICGSKTKPSKHLIGTHASYLSKYAPSSVMVVR"
FT   regulatory      39965..39997
FT                   /gene="usp1"
FT                   /locus_tag="LCA_0042"
FT                   /old_locus_tag="LSA0042"
FT                   /regulatory_class="terminator"
FT   CDS_pept        40035..40763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0043"
FT                   /old_locus_tag="LSA0043"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54343"
FT                   /db_xref="GOA:Q38ZN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN4"
FT                   /protein_id="CAI54343.1"
FT                   /translation="MLECPQCHIKYGRKLQQCPNCGAAAINHETTQAKPTALKYHQFLQ
FT                   ASWRQPLQTPWRWVNPQFGWVTFAILLLVNTATISLLRAGWSEQVGAVAGVTGTQVILR
FT                   QPVALWPLELRLFLIQLGGLLVLVGTGYLLKRYLLKQKNLRFDRYLTEISAYGSFVLLL
FT                   TMAALLVTFMAGLMALWLVVILLVLGYLWLNMAIVVSLIRQPMAGFDQFYTVILFEIIV
FT                   HLLLLVMSSQVVMMGLANLF"
FT   CDS_pept        40849..41064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0044"
FT                   /old_locus_tag="LSA0044"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54344"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN3"
FT                   /protein_id="CAI54344.1"
FT                   /translation="MAVGTATLVLDMKMSEAFDWSDDATIVREALWDHYMESNGHNTDQ
FT                   TVAAMKPYLSMSDSEVRTKAEALLKK"
FT   regulatory      41079..41110
FT                   /locus_tag="LCA_0044"
FT                   /old_locus_tag="LSA0044"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(41079..41110)
FT                   /gene="cfa"
FT                   /locus_tag="LCA_0045"
FT                   /old_locus_tag="LSA0045"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(41152..42339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="LCA_0045"
FT                   /old_locus_tag="LSA0045"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54345"
FT                   /db_xref="GOA:Q38ZN2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN2"
FT                   /protein_id="CAI54345.1"
FT                   /translation="MLEKTFYKKLLQHSFDFPVAVHFWDGSTDVYGTGEPEIAITFKKL
FT                   IPIKSLTSNASLALGEAYMAGDIEVTGKGDAPLQKLLTAAYNSSESFMRSHSYIHFLPK
FT                   QSHSEKASKKDIQSHYDLGNDFYQLWLDKTMTYSCAYFEQPTDDLETAQINKVHHILQK
FT                   LNPQPNRTLLDIGCGWGTLMLTAAKEYHLKVVGITLSQEQYNFVQQRIDEEGLSDVASV
FT                   ELVDYRELKHAPFDYITSVGMFEHVGQENLAEYFKDVADYLTDDGVALIHGITRQQGGA
FT                   KNAWINKYIFPGGYVPGLVENTQHIVDAGLQIADMEPLRRHYQKTLEIWDANFNAHRDE
FT                   IQQQTSLEFVRMWDLYLQACASSFESGNIDVIQYLVSKGASARDLPMTRAYMYNV"
FT   CDS_pept        42504..43517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0046"
FT                   /old_locus_tag="LSA0046"
FT                   /product="Putative transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54346"
FT                   /db_xref="GOA:Q38ZN1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN1"
FT                   /protein_id="CAI54346.1"
FT                   /translation="MTLYQRFVANEQLRRLVVLMGMIGVIFAVRSMMNIILLTFIFTFL
FT                   VTQLVRHVQRYVRIPPAAVVVPLYILVILLVYLGVTIYVPQIAKQTIKLGESVYNFYQS
FT                   PSFDANKFMQLISQYMKQFNLTDQLKHGVSTLVNYITGIGTMGVTIVLSFILSFFYTIE
FT                   LDKLPQFGGLFLKSTYGWLFQDIAYFAKKFVNTFGVVIEAQIFIAVVNTVLTTITLTVM
FT                   KMPNIPSLAIMIFLLSMVPVAGVILSCIPLCIIAFSVGGVQYVIYILVMITVIHALEAY
FT                   VLNPRFMSSKTQLPIFFTFVVLFVAERFLGTWGLIVGLPIFTFFLDVLGVKTIKTK"
FT   regulatory      43523..43545
FT                   /locus_tag="LCA_0046"
FT                   /old_locus_tag="LSA0046"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(43523..43545)
FT                   /locus_tag="LCA_0047"
FT                   /old_locus_tag="LSA0047"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(43574..43819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0047"
FT                   /old_locus_tag="LSA0047"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54347"
FT                   /db_xref="GOA:Q38ZN0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZN0"
FT                   /protein_id="CAI54347.1"
FT                   /translation="MFGQLLHDKRVSRNLTMWQLADLLTQKYNIKVSSSMIFRWEKGAA
FT                   PSLKALFIVATELQVDLNQLAIMIADSNLTRPETLS"
FT   CDS_pept        43989..44186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0048"
FT                   /old_locus_tag="LSA0048"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54348"
FT                   /db_xref="GOA:Q38ZM9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM9"
FT                   /protein_id="CAI54348.1"
FT                   /translation="MAEKLFVLSGYLKSHDIKQQEVADVLNKTLTTANRKIRGKIPFTV
FT                   KEIQLLHDQLDVPILIFFES"
FT   regulatory      44253..44274
FT                   /locus_tag="LCA_0048"
FT                   /old_locus_tag="LSA0048"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(44253..44274)
FT                   /gene="ddl"
FT                   /locus_tag="LCA_0049"
FT                   /old_locus_tag="LSA0049"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(44293..45345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="LCA_0049"
FT                   /old_locus_tag="LSA0049"
FT                   /product="D-alanine--D-alanine ligase (D-alanylalanine
FT                   synthetase)"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54349"
FT                   /db_xref="GOA:Q38ZM8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZM8"
FT                   /protein_id="CAI54349.1"
FT                   /translation="MKIVVLAGGRSTERNVSLTSGHKITHALQTKGHDVAFVDLFLGNE
FT                   LKDGATIDSLYSSDPVEKDYDIDDEVLTDDDINKLREDGSTQLFGPNVLEICKTADIVF
FT                   LALHGGDGENGKVQAVLDVFEIPYTGSDTLAAGITMSKKVSKEILLFNNIPTARFVAAY
FT                   RHQPMPEMPFEYPVVVKPSNGGSSVGTHIVHNEAELKPAVEDALRFDNEALIEEFIKGR
FT                   EFSLGVINEQPLPAIEIEVNDGWYDFEHKFVTGNTTKFVTPPNNLPDDVHEAMKQMALD
FT                   AMHALGLTNYARIDFFWSPETGLYVIEGNTLPGMTPLSLIPQEAEVLGISYPDLCEMIV
FT                   NGKLALLNEK"
FT   CDS_pept        45540..45980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0050"
FT                   /old_locus_tag="LSA0050"
FT                   /product="Putative molecular chaperone, small heat shock
FT                   protein, Hsp20 family"
FT                   /function="3.9 Protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54350"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM7"
FT                   /protein_id="CAI54350.1"
FT                   /translation="MANELMDRRQDWLDSLVGDDFFKNFGKQFFAMSPETDNLLKTDVK
FT                   ETDKDYQLTVDLPGLNKQDIHVDYQNNTLKISAKRDSFNDHSDSEGNLIQSERHYGRFS
FT                   RQYYLPEVDRQGISAKYEDGVLQLVLPKMAEDTQSTSQIEIQ"
FT   regulatory      45992..46017
FT                   /locus_tag="LCA_0050"
FT                   /old_locus_tag="LSA0050"
FT                   /regulatory_class="terminator"
FT   CDS_pept        46103..46999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0051"
FT                   /old_locus_tag="LSA0051"
FT                   /product="Putative Na(+) ABC exporter, ATP-binding subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54351"
FT                   /db_xref="GOA:Q38ZM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM6"
FT                   /protein_id="CAI54351.1"
FT                   /translation="MLTLTHLEKSFGAMKAVDDVSFTVQPGEILGLIGQNGAGKTTTFR
FT                   MILNFLTPDSGTILWQGHAFTSRDYDQLGYLPEERGLYPKMTVEQQILYFAQLRGRTAA
FT                   EIKPQIDEWLARFAVKGQRTDKIKDLSKGNQQKVQLIATLIHKPALIILDEPFSGLDPV
FT                   NAGLLEDGILWLKSQGSAIIFSSHDMTNVAKISDRIVMLRNGQVVLSGSVDEVRAQFGR
FT                   TKLFLESPLTQSELEQIEGVSRVTRHGHQFELTLADEAVGKEIFERATQAGYIPEFSQQ
FT                   APSLDEIFRLKVGEQHD"
FT   CDS_pept        46992..48236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0052"
FT                   /old_locus_tag="LSA0052"
FT                   /product="Putative Na(+) ABC exporter,
FT                   membrane-spanning/permease subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54352"
FT                   /db_xref="GOA:Q38ZM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM5"
FT                   /protein_id="CAI54352.1"
FT                   /translation="MTKFKIIFKQVFFKNIKSPAYIIMIIMPIILLGVVLGIGKLMDQS
FT                   TEPAKIAVLSQQPAEQAALQQMRGQDYVIDTQIKTQPQAAQALKQEKIDGYLIIQQGNS
FT                   QYFERKDSRDFDPSGIQNQLNEMNIVTLARQANVPADQIQKLTTPMTVKSVTVQFEAGQ
FT                   QKIDQSNQKQVGEGISLAITVLMFVFIVNYAGIIAQEIATEKGSRIMEIILSSVSATTQ
FT                   FFAKIAAVLALVLTQIVFYILIGVVGYHYLKQQLPLSAILKQVGPNLWTPPVWYAISFL
FT                   IVGVLLYTVIAAMLGSVVSRMDQVQQAISPLLILSTISYMCGFILTTRSDIGFLKILSY
FT                   VPLFSQIMLPVRFASGDLTATAATLGLGLAIITLIGLTYLALIIYRMNILVYSDKGVMR
FT                   SFMRSFAMLKAERQK"
FT   regulatory      48242..48275
FT                   /locus_tag="LCA_0052"
FT                   /old_locus_tag="LSA0052"
FT                   /regulatory_class="terminator"
FT   CDS_pept        48377..50272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepO"
FT                   /locus_tag="LCA_0053"
FT                   /old_locus_tag="LSA0053"
FT                   /product="Endopeptidase O"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54353"
FT                   /db_xref="GOA:Q38ZM4"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM4"
FT                   /protein_id="CAI54353.1"
FT                   /translation="MTNVRMQDDFYTAVNQEWLKTAEIPADKPATGGFVALVDEIDQQL
FT                   MTDFKQLKQTDNALLQHFLDYYALAADFKTRDELGINPILPFIARVRSINNLTEYNQGL
FT                   ADWVLSSLPTPFGLSVDADMKDTAHHALYAEAGSLILPDKTYYDEGNKSAEQLLAVFTD
FT                   MMVQLLQKVGFAPVVATKTVKEALAFDRSLAPFVKSAEEAADYAKLYNPKPLSDFIAQQ
FT                   QTIDFKKLFSRVLPVQPDKIIVTEPAYFEQLNELVNDDHFDQFKAWLLVMTIRDWSGYL
FT                   NEEMRQISSIYSRALSGSKEAKPQQKSAYYLALGMFNQVVGDYYGRRYFGATAKADVEA
FT                   MVKKMIGVYQNRLEQNDWLTTETREKAIVKLNHLGIHVGYPEKIAPIFEKLVTVPQADD
FT                   GTLFENTADFIRTIETENFAKLTQPVDRAKWEMGAATVNAYYSPSKNVIVFPAAILQAP
FT                   FYSLQQSSSANYGGIGAVIAHEISHAFDNNGAQFDEFGNLHNWWQATDLDHFKALSQAM
FT                   ITEFDGLAFADQKVNGKLTVSENIADAGGLSCALEAAKGEDDVDLEAFFVNWATIWRMK
FT                   ATQQYQQLLLNIDVHAPNALRANVQVQNLADFYTTFDVQSADKMYLAPDKRVTIW"
FT   CDS_pept        50525..51142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="LCA_0054"
FT                   /old_locus_tag="LSA0054"
FT                   /product="Maltose O-acetyltransferase (Maltose
FT                   transacetylase)"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="2.3.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54354"
FT                   /db_xref="GOA:Q38ZM3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM3"
FT                   /protein_id="CAI54354.1"
FT                   /translation="MTEKERMVNGQIYRANDAELRADMKRARVLTRLFNQTTEEQQAYR
FT                   RELTHQLFAQSGADLYIEPPFRTDYGCQTTIGQRVYMNYDCIIIDVAPVTIGDNVFFGP
FT                   RVGLYTAGHPISAQGRRDDLEYGKPITIGNDVWLGGNTAVNPGVTIGNNVVIGSGSVVT
FT                   KDIPDNVIAVGNPCRVLRPIDQAEEDYWAREKEQYFAEIAND"
FT   CDS_pept        complement(51132..52298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0055"
FT                   /old_locus_tag="LSA0055"
FT                   /product="Putative thiamine/thiamine precursor:cation
FT                   symporter"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54355"
FT                   /db_xref="GOA:Q38ZM2"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM2"
FT                   /protein_id="CAI54355.1"
FT                   /translation="MKVNHNQFLLWFGAAISIAEIITGTLIAPLGLVKGSLAIIIGHLI
FT                   GAFLLLLPASFLGGTRHQNAIELTAPIYGKIGFILFAILNVIQLIGWTGIMIANAAQAM
FT                   QQLKLTHLSYLMNAIIVAGLIIFWLAIKTQFFFKLNNSIVLLLVVACLGLFWQLSQFAG
FT                   HATHLSANPLSFGAAIELSIAMALSWLPLIADYTKDSKKPLALSLWSTSGYFLGSLMMF
FT                   FLGFLTVITTGYTDFNQFLATSRFGFLILFIIIFSTITTTFLDAYSAGVNLKNLFPKIR
FT                   YSENGLGIVVTLIGLGLIANQQLFKYELFLTLISAAFTPLYTIVFFNYFYRRLPIAVNF
FT                   SGWLLGAIAYYGLQRFDFPLGTTVLLMICLWLILCCIAQVVGHRKINR"
FT   CDS_pept        complement(52288..52962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="LCA_0057"
FT                   /old_locus_tag="LSA0057"
FT                   /product="Thiamine-phosphate pyrophosphorylase
FT                   (Thiamine-phosphate synthase)"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54356"
FT                   /db_xref="GOA:Q38ZM1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZM1"
FT                   /protein_id="CAI54356.1"
FT                   /translation="MTNIAQEILQTYLVAGTQDTGRENFLPILDQALQAGITCFQFRDK
FT                   GPNSLPTDAMRSDYAKKAQALCRTYHVPFIIDDRLELALDLQADGLHVGQSDQPWPKIE
FT                   VAKQHGLITGLSCHTAQEILSSHQQPALDYIGVGPIFPTNSKEDAKTPLGLAQLKAFTQ
FT                   LSQLPVVAIGGISLKNCQQVAETGVAGAAVISAITQAKNIPQAIQLLNQPWQSSEGNNH
FT                   ES"
FT   CDS_pept        complement(52955..53767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="LCA_0058"
FT                   /old_locus_tag="LSA0058"
FT                   /product="Phosphomethylpyrimidine kinase (HMP-phosphate
FT                   kinase)"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54357"
FT                   /db_xref="GOA:Q38ZM0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZM0"
FT                   /protein_id="CAI54357.1"
FT                   /translation="MNNFPQTLTIAGSDSGGGAGMQADIKTIQERHVFATNVVVAITAQ
FT                   NTIGVQDSFPLPLELVTKQFESLAADFKIRACKTGMLADAEHVAVVAQNLRHFDFGPLT
FT                   LDPVMIAKGGASLLADSAIDTLRSELLPLATVLTPNLPEAEVLTGQKIQTTADFKIAAT
FT                   QLQKMGAKNIIIKGGHLDNSDQACDYVLYADGSDDWLNTPRIATVRTHGTGDTFSACLT
FT                   AELAKQVPLKKAIQISKAFIQVAIANPIAVGHGHGPTNHWAYQEVEHD"
FT   CDS_pept        complement(53760..54569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="LCA_0059"
FT                   /old_locus_tag="LSA0059"
FT                   /product="Hydroxyethylthiazole kinase
FT                   (4-methyl-5-beta-hydroxyethylthiazole kinase)"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.7.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54358"
FT                   /db_xref="GOA:Q38ZL9"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZL9"
FT                   /protein_id="CAI54358.1"
FT                   /translation="MSKTLLDQIKQANPIITNVANSVTVDQVANVQNIIGASPIMSSDP
FT                   EEAPEMVAIAQALSINIGTLSTEPIHQMKTLMAEAYRQAKPVVIDPVAVSSIHYRQKII
FT                   DELLALGTPQIIRGNAGEIAYLAGLDWQANGIDAGSGEIDLVKVAQTAAKKQQTTILLS
FT                   GPTDIITDGHHTTKVANGTPLFQVHVGSGDMLTGLCAAFVAVSPDNPYQAAIDAATTFA
FT                   VAGQLVAEAMPTPLPGSFYPQLLDCLFNITAADVQTHAQVTEVLTHE"
FT   regulatory      complement(54573..54586)
FT                   /gene="thiM"
FT                   /locus_tag="LCA_0059"
FT                   /old_locus_tag="LSA0059"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      54959..54972
FT                   /gene="nagE"
FT                   /locus_tag="LCA_0060"
FT                   /old_locus_tag="LSA0060"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        54975..56993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="LCA_0060"
FT                   /old_locus_tag="LSA0060"
FT                   /product="N-acetylglucosamine and glucose-specific
FT                   phosphotransferase system, enzyme IIABC"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54359"
FT                   /db_xref="GOA:Q38ZL8"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZL8"
FT                   /protein_id="CAI54359.1"
FT                   /translation="MKNYLQRMGRSLMLPVAVLPAAAILIGIANWVGNGDSNANVFTIF
FT                   LAAGGGAILNNLPLLFAVGLALGMSKDQDGAAALAGLVAFLVPKTILAPASIQAMQGLS
FT                   DIAEVNPAFGKIEGNVLIGIIAGLIAAAMYNRFHNVKLPMALSFFSGKRLVPIMAATAM
FT                   MVVSAILYFVWPAVFTVLVSFGEAISKLGWVGAGLYGFFNRLLIPTGLHHALNSVFWFD
FT                   VANINDIGNFLGGAKSLANGTAVIGKTGMYQAGFFPVMMFGLPAGAYAIYKNARPERRK
FT                   ATASLMLAAGFASFFTGVTEPLEFSFMFVAWPLYVLHAAFTGISLAVAAFFHWTAGFAF
FT                   SAGLVDYVLSLKNPVANQPLMLLVEGLVMAVIYYFGFNFAIKKFNLMTPGREADDTVDE
FT                   DTAGVETDATDDKFMIQAKRIYAAIGGKDNIKVIDNCTTRLRLQLEDTANVNQPAIKAA
FT                   GAAGINVLDKTNIQIIIGTEVQFVADALKELYNHNTPIATSAPEPAAAPVEAPVDSDIN
FT                   SGETDVFYAVANGELIDIENVDDPTFAQKMLGDGYAVVPTDGKIVAPVDGTIMTIFPTK
FT                   HAIGIKTTNGLEVLVHMGIDTVELNGAPFEVAVEEGQTIKHGDLLATVDLDQIVAAGKQ
FT                   TAMMVIITNMPAVAYMKFNNMGQSVQADTVAVKATTK"
FT   regulatory      57006..57032
FT                   /gene="nagE"
FT                   /locus_tag="LCA_0060"
FT                   /old_locus_tag="LSA0060"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(57006..57032)
FT                   /locus_tag="LCA_0061"
FT                   /old_locus_tag="LSA0061"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(57053..57997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0061"
FT                   /old_locus_tag="LSA0061"
FT                   /product="Hypothetical extracellular protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54360"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZL7"
FT                   /protein_id="CAI54360.1"
FT                   /translation="MFNKLKYILPIVMTAILGLSAHSVFADSNAWDKPVATLGTSLSST
FT                   QKSETLSTLQNAANITDSDELTVTGSTLVKYLDQNQQTFNADSNVYSSALIQKNNSNTG
FT                   INVKIVDFNGSNNITTITANQYKNAALTAGVTNATIYVTSAVPIDGSGALAGVYAAFAE
FT                   NGETLNQSQVTAAQDEMSTLSDITQANKGTDGYTDSQLNNAVTGAKKDMANKGDNLTVN
FT                   QITNIVNNQLEQNNLTTIINNNQKTQIINLLVKIQDSGALKSDDFKNQAGKLMDNIQSN
FT                   AKNVFDKLNTESNRNFIQKLFDSIGNFFKNLFG"
FT   regulatory      complement(58000..58013)
FT                   /locus_tag="LCA_0061"
FT                   /old_locus_tag="LSA0061"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(58097..59245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0062"
FT                   /old_locus_tag="LSA0062"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54361"
FT                   /db_xref="GOA:Q38ZL6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="InterPro:IPR021192"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZL6"
FT                   /protein_id="CAI54361.1"
FT                   /translation="MLYLDNIITAATIFPFVAIALTIPVLIYHYRRSGALTFWRSLVIY
FT                   SFIFYLLAAYCLIILPLPPKSVVAHLTTPRYNLLPFTFVREFINTTHWVWNQPATYLAT
FT                   LKQAATIQPLFNIVLTIPFGVYLRYFFRTSFKQTLLLSFGLTLFFELTQLSGLYGIYPR
FT                   PYRLFDVDDLLLNTSGGLIGFGLAPLLTYFLPTRDALDQAAYINGQKVGYLRRLLALGI
FT                   DYCLLTLIGMIVTAIWRLLKLPTFGNDVFYYCLENGLYFVLLPVLWRGQTPGKALLRLK
FT                   ITAENAVAWRIFSRQFLLFFIILPSFQLWRITIDALVASGQTHLDIYLLLGGLAALPPV
FT                   LFTGNFLLSWLFKKPQLFYEKLTKTQEMSLVQPQADHPLKNN"
FT   regulatory      complement(59247..59260)
FT                   /locus_tag="LCA_0062"
FT                   /old_locus_tag="LSA0062"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      59496..59509
FT                   /gene="purA"
FT                   /locus_tag="LCA_0063"
FT                   /old_locus_tag="LSA0063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        59513..60793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="LCA_0063"
FT                   /old_locus_tag="LSA0063"
FT                   /product="Adenylosuccinate synthetase (IMP-aspartate
FT                   ligase)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54362"
FT                   /db_xref="GOA:Q38ZL5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZL5"
FT                   /protein_id="CAI54362.1"
FT                   /translation="MTSAVVVGTQWGDEGKGKITDFLGQNADAIARYQGGDNAGHTIKL
FT                   GEDTYHLQLIPSGIFNSDKVSVIGNGVVVNPKSLVGELRGLADKNVDTSQLKLSDRAHV
FT                   ILPYHIKLDSLQEAAKGDQKIGTTNRGIGPAYMDKAARSGIRVADLLDKDLFATKLKQN
FT                   LAEKNALFTKIYEVEALDFDSIFEEYYQYGQELKQYVCDTSVVLNDVLDQKGNVLFEGA
FT                   QGILLDIDQGTYPFVTSSNPAGGVSTGSGVGASRIDEVVGVAKAYTSRVGDGPFPTELF
FT                   DETGDFIRQAGHEYGTVTGRPRRIGWFDTVVLRHSKRVAGLTQLCLNCVDVLTGLKTLK
FT                   ICVAYELDGERIDRYPASLSELARCTPIYEELPGWDEDITGVKTLEELPVNARRYVERL
FT                   QELVDLPLATFAVGPDRDQTNILKAIW"
FT   regulatory      60948..60961
FT                   /locus_tag="LCA_0064"
FT                   /old_locus_tag="LSA0064"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60964..62274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0064"
FT                   /old_locus_tag="LSA0064"
FT                   /product="Putative nucleobase:cation symporter"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54363"
FT                   /db_xref="GOA:Q38ZL4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZL4"
FT                   /protein_id="CAI54363.1"
FT                   /translation="MEKVSRFFGIEEQHSTVQREILAGFTTFISMVYILFVNPSVLGAS
FT                   GMDKGAVFAATALASAIGCFLMGLYAKYPIATAPALGINAFFSYSVVIGMGVSWQTALA
FT                   GVFVASLIFMVITIFKLREIIIDAIPRDLKLAISAGIGMFVAFIGLHGGGLIVANKSTV
FT                   VGLGDFSQGTTWLTVFGLIITIILMVKKVPGAIFIGMVLTSILGAVTGLIKLPTHFVAA
FT                   APSLKPTFLAGLNHVGDINTVQMWVVVLTFLLVTFFDTAGTLVGLAEQAGFMKDNKMPR
FT                   VGKALMSDSSAMLAGSLLGTSPVGAFVESSAGIVVGGRTGLTAVVTGILFVFSLFFSPL
FT                   LTVVTSQVTAPALVIVGVLMAQSLKKIDWEKLEIAIPAFLIVLGMPLTYSISDGIALGF
FT                   IVYPITMITAGRRKEIHPIMYVLFFVFVIFMYILNVG"
FT   regulatory      62284..62308
FT                   /locus_tag="LCA_0064"
FT                   /old_locus_tag="LSA0064"
FT                   /regulatory_class="terminator"
FT   regulatory      62381..62394
FT                   /locus_tag="LCA_0065"
FT                   /old_locus_tag="LSA0065"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        62398..62856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0065"
FT                   /old_locus_tag="LSA0065"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54364"
FT                   /db_xref="GOA:Q38ZL3"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZL3"
FT                   /protein_id="CAI54364.1"
FT                   /translation="MKIQILFLKLVCGLASLPLIFIGLIGPRLTHKIAQNFPQIPGGLW
FT                   LVVLLVYGSLILALWGLYQLQRILREVDLVGHFGQKTQQALRQIQKVASINGAAYLLSL
FT                   PLFYLIAVRQATPGVMLIDLGLVVISLAIAITANLFRNLMHPAIIVEK"
FT   regulatory      62913..62926
FT                   /gene="srtA1"
FT                   /locus_tag="LCA_0066"
FT                   /old_locus_tag="LSA0066"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        62931..63593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtA1"
FT                   /locus_tag="LCA_0066"
FT                   /old_locus_tag="LSA0066"
FT                   /product="Putative surface protein transpeptidase 1
FT                   precursor (Sortase 1)"
FT                   /function="1.6 Protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54365"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042007"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZL2"
FT                   /protein_id="CAI54365.1"
FT                   /translation="MQKKTKNRLINSLLALLLLIGLILVFIGPIRNQMVKSMANRRMNT
FT                   VTAAQIKKNEHKKANFDFNSVKTLDTKQIVSAAVKGDVIVLGKVAVPSVGIALPVMKGV
FT                   SEATMAQGGGTMKPDQKMGADNNYALAGHSFTNIFLPLENVKVGDMVYLTDLQNVYSYR
FT                   VNVKKSIAPEEVKVIDDVPGHKMVTLITCDQTVRRWCVQGELVKTEKANKTNLKVFG"
FT   regulatory      63606..63638
FT                   /gene="srtA1"
FT                   /locus_tag="LCA_0066"
FT                   /old_locus_tag="LSA0066"
FT                   /regulatory_class="terminator"
FT   regulatory      63781..63794
FT                   /locus_tag="LCA_0067"
FT                   /old_locus_tag="LSA0067"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        63798..64829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0067"
FT                   /old_locus_tag="LSA0067"
FT                   /product="Putative ornithine carbamoyltransferase (OTCase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54366"
FT                   /db_xref="GOA:Q38ZL1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024903"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZL1"
FT                   /protein_id="CAI54366.1"
FT                   /translation="MKRDFIDTKDYTQAEIQYLIDLGLQIKKDIKAGDYPQLLSNRTLG
FT                   MLFEESSTRTRVSFETAMTQLGGHAQYLAPGQIHLGSAESESLGDTAIVLSRLVDILMA
FT                   RVATHDTIETIANAATVPVLNGMTDYNHPTQEIGDIITMAEHLPAGKKLSDCKVVFVGD
FT                   ATQVCVSLMFVATKMGMQFVQYGPKGYQIKPETLAIGQKNAEVSGGSVLITEDTDQAMR
FT                   DADFVYTDVWYGLYESPLSYDERMAIFYPKYQVNDELMAKAAKHAKFMHCLPANRGEEV
FT                   TDSVLDSDASVAWDEAENRLTAMRALLVYLMAPIIDYSDDTLNNLKDPALKDLLNNRID
FT                   STK"
FT   regulatory      64852..64865
FT                   /locus_tag="LCA_0068"
FT                   /old_locus_tag="LSA0068"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64869..65849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0068"
FT                   /old_locus_tag="LSA0068"
FT                   /product="Putative amino acid/polyamine antiporter
FT                   (N-terminal fragment), authentic frameshift"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54367"
FT                   /db_xref="GOA:Q38ZL0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZL0"
FT                   /protein_id="CAI54367.1"
FT                   /translation="MEKKKFKLFDAVLMSVVVVLVVESAAPAAAIGPSQFFWWGALLLF
FT                   FFLPYGLISAELGTTYDDEGGIYDWVKRAFGRKWGGRADWLYWINFPIWMASLAVLFNE
FT                   VLAQIFQIKIATPVGIIIELVFIWLVTLISCYPIADSKWILNLAAVAKVVIMLSVGALG
FT                   IYHAATQGLANDFSGTAMLPKFDATSLGYISVILFNFLGFEVVATMASDMENPKKQIPQ
FT                   AIIWGGVLIAVFYLFAAFGMGAAIPSSQLSTSGGLMDSILLLVGHHNWFVVLIGILFMY
FT                   TLAANLISWSPVLTMLHYMLLRTMIYPVFSKKRALKMECQSEQRS"
FT   CDS_pept        65735..66229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0069"
FT                   /old_locus_tag="LSA0069"
FT                   /product="Putative amino acid/polyamine antiporter
FT                   (C-terminal fragment), authentic frameshift"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54368"
FT                   /db_xref="GOA:Q38ZK9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK9"
FT                   /protein_id="CAI54368.1"
FT                   /translation="MVAGVNYVALYVAKNNDLPRVFQKTSAKNGMPVGATFLNDIIATI
FT                   LVVAAPFIPNPNIFWAFFSLNVVALLGSYMLMFPSFLKLRKIDPDRNRPFKIHGNAVVI
FT                   RLMTYVPLVLLGLTLILTAFPLNGSHAELSSKLPILIGTIVTIIIGEICIRHAEKQVDQ
FT                   K"
FT   CDS_pept        66216..67343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0070"
FT                   /old_locus_tag="LSA0070"
FT                   /product="Putative peptidylarginine deiminase
FT                   (Amidinotransferase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54369"
FT                   /db_xref="GOA:Q8RPX2"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RPX2"
FT                   /protein_id="CAI54369.1"
FT                   /translation="MIRNRKEVSTMKTLQTSPKKDGYRMPGEFEAHKDVYLLWPERPDN
FT                   WREGAKPAQATFAKVAETIAQFESVTVGVSDRQYTNARHMLADNIQVVEMSNNDSWIRD
FT                   CGPTFVVNDKGDSRGVDWTFNAWGGLVDGLYFPWDKDDRVAQKVCEIEGRDRYRLDDLV
FT                   LEGGSTHVDGEGTLLVTEECLLSDGRNPQLSKEQIESILKEYLNVEKIIWLKKGIYLDE
FT                   TNGHVDNIANFVKPGQVVLAWTDDQSDPQYAISKENYDMLINETDAKGRKLQVEKLYLP
FT                   KPILITEAESQGVDTVDGTLPRLAGDRLAASYVNYYTANGGIVFPLFNDPMDEKAQEIL
FT                   QKLYPDRKIVGVPAREILLGGGNIHCITQQIPAGR"
FT   CDS_pept        67359..68294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0071"
FT                   /old_locus_tag="LSA0071"
FT                   /product="Putative carbamate kinase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54370"
FT                   /db_xref="GOA:Q38ZK7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK7"
FT                   /protein_id="CAI54370.1"
FT                   /translation="MAKIVVALGGNAILANDASDTAQKKAVKATVKALINFVENGGQLI
FT                   ITHGNGPQVGNLLLQQQAADSDKNPAIALDTCGAMTQGSIGYWFQNAMQEELVLRKIDK
FT                   SVVAMVTQTIVAADDPAFHQPTKPIGPFYEEAALKGLQEKPPDWQMMEDAGRGYRRVVP
FT                   SPQPVEIKEYPAIKKVIEAGIIPIISGGGGIPVVKSGDQLIGTEAVIDKDFSAAKIAEL
FT                   VEADQLIILTSVGGVFYRFGKPDQEEIFDVTAKEIQKHIDADEFAKGSMMPKVKAAVQF
FT                   VKKTGNPAVIGALDDVRQIITGDKGTVIHQ"
FT   regulatory      68306..68329
FT                   /locus_tag="LCA_0071"
FT                   /old_locus_tag="LSA0071"
FT                   /regulatory_class="terminator"
FT   regulatory      68364..68377
FT                   /locus_tag="LCA_0072"
FT                   /old_locus_tag="LSA0072"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        68379..69482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0072"
FT                   /old_locus_tag="LSA0072"
FT                   /product="Putative peptidylarginine deiminase
FT                   (Amidinotransferase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54371"
FT                   /db_xref="GOA:Q38ZK6"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK6"
FT                   /protein_id="CAI54371.1"
FT                   /translation="MKIVGTTPKEDQYYLPAETKRHRESIMMWPERSDNWRNGAKPAQK
FT                   TFAEIAAIINRYEPVTMLVSKEQYQNARHALPAEIRVIEMSYNDAWIKDIGPTYLLNQK
FT                   NQIRAVDWRFNAWGGLVDGLYFPWDMDDQVAQKLCELTGIDYYHLEKFILEGCAFHTDG
FT                   EGTLIVTEESILSEGRNGMLTKTEVEAVLKAYLGIEKVIWLKLGYFMDETNGDVDNMLS
FT                   FVRPGELLLTWTDDQSDPQYASSEEAYRILEAATDTKGRHFKIHKLQMPKPMFATQEES
FT                   AGVDPINGLLPRYPGDRLTASYVNYYALNDAIILPIFDDPQDTVAIQTLTQLFPDRKIE
FT                   PVYARELLLGGGDVHCVVAAVPAHTEA"
FT   regulatory      69505..69518
FT                   /locus_tag="LCA_0073"
FT                   /old_locus_tag="LSA0073"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69522..70268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0073"
FT                   /old_locus_tag="LSA0073"
FT                   /product="Putative transcriptional regulator, RpiR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54372"
FT                   /db_xref="GOA:Q38ZK5"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK5"
FT                   /protein_id="CAI54372.1"
FT                   /translation="MNKNEQILLDYVIKNMDDIKNRSIRELAAECFVSTTTFLRFVRKI
FT                   GFSGYSEFITVIKYTILNQDQTEEVNPFVVNQVANRTEYLKNINETVRVLDNDKLNAIV
FT                   TLMTKKPKLYFFAKGFSKYAAEYIEYLYTLKGFIVIFPKNYEQRQLAYRNINQDDILFV
FT                   FNYEGEDKELIEILQIIERKCQYAKLVSITSANNNTIQNMSDINLYLFTDELYQHKVEM
FT                   TSHVSLIAIMELLLYQYNEVEENQIL"
FT   regulatory      70283..70324
FT                   /locus_tag="LCA_0073"
FT                   /old_locus_tag="LSA0073"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(70283..70324)
FT                   /locus_tag="LCA_0074"
FT                   /old_locus_tag="LSA0074"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(70360..70929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0074"
FT                   /old_locus_tag="LSA0074"
FT                   /product="Putative DNA-binding protein, XRE family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54373"
FT                   /db_xref="GOA:Q38ZK4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK4"
FT                   /protein_id="CAI54373.1"
FT                   /translation="MLATTLKKRRIDLHLTQQAVADQLHTSRQTISNWENGKNYPDVPM
FT                   LVAISNLYDLSLDDMLKQDTNYLNKVANDYQLINQQKKTHLLDYALLLTLSGLVIIILP
FT                   TIFFKSLVNEQLTGLLVLVFTTILVILSYFKTVQFYSKQPRNKQPLLIPKVVGIGLTIN
FT                   PNHPIGQIIWLFILIFVVGSLLTVIF"
FT   regulatory      complement(70932..70945)
FT                   /locus_tag="LCA_0074"
FT                   /old_locus_tag="LSA0074"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      71298..71311
FT                   /locus_tag="LCA_0075"
FT                   /old_locus_tag="LSA0075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71315..71341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0075"
FT                   /old_locus_tag="LSA0075"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54374"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK3"
FT                   /protein_id="CAI54374.1"
FT                   /translation="MGLGGVVR"
FT   regulatory      71425..71438
FT                   /locus_tag="LCA_0076"
FT                   /old_locus_tag="LSA0076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71444..71998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0076"
FT                   /old_locus_tag="LSA0076"
FT                   /product="Putative DNA invertase (Plasmidic Resolvase)"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54375"
FT                   /db_xref="GOA:Q38ZK2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK2"
FT                   /protein_id="CAI54375.1"
FT                   /translation="MKYGYARVSTMGQNLDTQIEQLKQADCDKIYSEKFTGTTTDRPKF
FT                   KLLLKKLKPGDTLIVTKLDRFARNTIGALSITKELFARNIKVTILNMGTIEDTPTGNLM
FT                   LMMLSAFAQFERDMIVTRTQEGKEAARMNNPLYHEGRRQKYTDQQIEGALKDVEKGLTI
FT                   QEISLKTGISISTLRRRAVKA"
FT   regulatory      72006..72033
FT                   /locus_tag="LCA_0076"
FT                   /old_locus_tag="LSA0076"
FT                   /regulatory_class="terminator"
FT   tRNA            complement(72122..72197)
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:72162..72164,aa:Lys)"
FT   regulatory      72421..72434
FT                   /locus_tag="LCA_0077"
FT                   /old_locus_tag="LSA0077"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72438..73151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0077"
FT                   /old_locus_tag="LSA0077"
FT                   /product="Two-component system, response regulator"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54376"
FT                   /db_xref="GOA:Q38ZK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK1"
FT                   /protein_id="CAI54376.1"
FT                   /translation="MAKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQVEEV
FT                   VPDLILLDLMLPKVDGLEVARQVRKSHDMPIIMVTAKDSEIDKVIGLELGADDYVTKPF
FT                   SNRELVARVKANLRRQGSTSQSDKEANEENHEINIGDLTIHPEAYIVSKRGTKIELTHR
FT                   EFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPEWLV
FT                   TRRGVGYYLRNPEQE"
FT   CDS_pept        73161..75059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0078"
FT                   /old_locus_tag="LSA0078"
FT                   /product="Two-component system, sensor histidine kinase"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54377"
FT                   /db_xref="GOA:Q38ZK0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZK0"
FT                   /protein_id="CAI54377.1"
FT                   /translation="MNKKIRLFQSIHFKIAIVFVLLLLVTLEVIGASFVKQLEYQNVKD
FT                   FKQSLQVTPYVQNQLSNELMSNSGNANKNIKDIIGDMGNSAEIQVVDNKGTIRGVTNLN
FT                   TQSTVGQKTRNPRVKQAIYSGHTEQEVAYSESQGSYYTAIQPLTDPNGDSNTVVGAVYI
FT                   RASMEEVYKGISSITVIFLTSSLVAGLLGMALSIVISRAITRPIDEMKKQAIQMARGDY
FT                   SGQVRIYGQDELGQLAIAVNNLSVRVEEAQEASESERRRLDSVMSHMTDGVIATDRRGN
FT                   ITIINETGQDFLNVTSDGVLGQSLLKVLKISEEYTLRDLLETQQVMVLDFSDQQDHDLI
FT                   LHVDFSLIQRETGYITGLVCVLHDVTEQQKNEREQREFVSNVSHELRTPLTSVRSYIEA
FT                   LNDGAWQDPEVAPNFLKVTQEETDRMIRMINDLLSLSRMDQGTAKMNLEFVNLNEFFGY
FT                   VLDRFDMMIKRDQEHDNNASPRGTGKLPTDDPNKKYSITRDFTKRDLWVEIDTDKFMQV
FT                   VDNIMNNAIKYSPDGGVITCRLLETHRHVILSISDQGLGIPRKDLGKIFDRFYRVDKAR
FT                   SRKQGGTGLGLAISKEVIEAHNGRVWVDSQEGKGSTFYISLPYEPIDSDGGDWDEI"
FT   CDS_pept        75049..76380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0079"
FT                   /old_locus_tag="LSA0079"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54378"
FT                   /db_xref="GOA:Q38ZJ9"
FT                   /db_xref="InterPro:IPR009996"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ9"
FT                   /protein_id="CAI54378.1"
FT                   /translation="MKFNSFVMRVILIASIVLSIILSWKIWTNNTHYERRTDSQTTTKA
FT                   VSRKSDRKISDIFLPTQILWRTNQQSQLVYNSKESLVPKLKEAMKLTKSARFKASKLSE
FT                   ANYYQAITTDDTLTLLYPDNISYAVFKKVFDDSNNQLSRNTTFNRIKITMGNKPQLTLM
FT                   NDKSHMTYQTTMRQFSEAQVKRILDHSDVHLNVKESLLNHKPFIYVAADQSLLPYSYLV
FT                   NQQPENYYITTLLDQKNTDNIDAKEQGDNVIYTDGANNDLYKRLTINHKTGEIAFVKYE
FT                   DTKSPTGLTKSFETSFAALLKTGNSLSGMRFYSYDEDTNSTTYRTYVEGFPVFYQTNFG
FT                   SVKVQLLPTGQRVDFSNYSLQVPVPAGDKPVTLPSTQAVLNQMTKNGFLLENIDNIQVG
FT                   YEWTQETSNDQVIDLNPTYFIQYKGAWRSLSALLAQKAELTEGS"
FT   CDS_pept        76385..77206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0080"
FT                   /old_locus_tag="LSA0080"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54379"
FT                   /db_xref="GOA:Q38ZJ8"
FT                   /db_xref="InterPro:IPR018604"
FT                   /db_xref="InterPro:IPR042274"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ8"
FT                   /protein_id="CAI54379.1"
FT                   /translation="MDFRRIEMIFIAIFIALDIYLFMSLSGSQTTNSASITNRSQTSQI
FT                   LKDLKDDQITVKRLSNQKRESYYLASRQADQTGLATASAKLTGQTVSFDKTRLTLTSVL
FT                   DKPLSYKKGRATAVINTFLKGNNNVYQANQYRYSKALSNNQQAVYVQKVPGGQMMDEHG
FT                   QLIFTLDNGQISQYTQTYINKVQILREKEMTKISAQGAVVDLYTDNEIPNNSKILWVQL
FT                   GYSALLDANSSTVYVPAWQIAIENKSTKNVVVKRINAFTGTLIKNRSEVTS"
FT   regulatory      77224..77237
FT                   /locus_tag="LCA_0081"
FT                   /old_locus_tag="LSA0081"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77241..78047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0081"
FT                   /old_locus_tag="LSA0081"
FT                   /product="Putative metal-dependent hydrolase,
FT                   beta-lactamase superfamily"
FT                   /function="4.2 Detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54380"
FT                   /db_xref="GOA:Q38ZJ7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ7"
FT                   /protein_id="CAI54380.1"
FT                   /translation="MVEKDEMRVSVLASSSSGNTTFIETPTQKILVDAGMSGKRVQDLM
FT                   HSIGRDLKEVDSLLVTHEHRDHSSGVGVLARRYGIDVYANQPTWDAMASIIGTVPDEHK
FT                   HVFEMGKTKTLGDIDVESYGVSHDAAAAQFYQFHHNNRAFAILTDTGYVSDQIRGTIEN
FT                   ADAYLVECNHDLEMLRMGKYPWSLKQRILSDTGHLSNEDGASALMAFMGQQTKRVFLGH
FT                   LSQENNMKELAHLTVASILEQHDYGVGTDFEILDTDPAIADPLFVV"
FT   regulatory      78165..78178
FT                   /gene="htrA"
FT                   /locus_tag="LCA_0082"
FT                   /old_locus_tag="LSA0082"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78181..79404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="LCA_0082"
FT                   /old_locus_tag="LSA0082"
FT                   /product="Serine protease HtrA precursor, Trypsin family"
FT                   /function="3.9 Protein folding"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54381"
FT                   /db_xref="GOA:Q38ZJ6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ6"
FT                   /protein_id="CAI54381.1"
FT                   /translation="MNQNSGLMKTAIVVVISALIGGGAAYAGFSRLGNSANDVTTATQT
FT                   PTKAGATKISNIKVNSSSQTTTAFQKVNTSVVSVVNLQKQQQSTGDLSSLFGSGSTDSN
FT                   SSSSKSSSSDLEESSEGSGLIYEKKDGKAYIVTNNHVVAGSDKIEVILSDGTKLEASLV
FT                   GTDAVSDLAVLKINGTKVKKTATFGDSDSIKAGESVLAIGSPLGSEYATSVTQGIISAK
FT                   KRTIDVTDETTGQTTGQATVIQTDTAINPGNSGGPLVNMAGQVIGINSMKLASNGETSV
FT                   EGMGFAIPSNEVVKIINQLVANGKVVRPALGISVIDLTNISSTQQSSVLKLPSSVNSGV
FT                   VVASVTSNSVAKKAGISKYDVIVGLGGKTVSSVADLHTILYSYAMNSTTEIQYYHNGSL
FT                   KKANVKLT"
FT   regulatory      79459..79486
FT                   /gene="htrA"
FT                   /locus_tag="LCA_0082"
FT                   /old_locus_tag="LSA0082"
FT                   /regulatory_class="terminator"
FT   regulatory      79578..79591
FT                   /locus_tag="LCA_0083"
FT                   /old_locus_tag="LSA0083"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79596..79643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0083"
FT                   /old_locus_tag="LSA0083"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54382"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ5"
FT                   /protein_id="CAI54382.1"
FT                   /translation="MSVDKSVDCGYNTEK"
FT   regulatory      79968..79981
FT                   /locus_tag="LCA_0084"
FT                   /old_locus_tag="LSA0084"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79985..80464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0084"
FT                   /old_locus_tag="LSA0084"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54383"
FT                   /db_xref="GOA:Q38ZJ4"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZJ4"
FT                   /protein_id="CAI54383.1"
FT                   /translation="MNIKIITVGKLKEKYLKAGIAEYAKRLSKFCKFEIIEVSDEKAPE
FT                   SLSEAEMTTVKDKEGERILAKVKDKEHVIVLAIHGKQRASEEFAKEIQDLATYGTSDIT
FT                   FIIGGSLGTSDAVNKRANDALSFGKLTLPHQLMRLVLTEQIYRAFMINQGSPYHK"
FT   regulatory      80475..80502
FT                   /locus_tag="LCA_0084"
FT                   /old_locus_tag="LSA0084"
FT                   /regulatory_class="terminator"
FT   regulatory      80587..80600
FT                   /locus_tag="LCA_0085"
FT                   /old_locus_tag="LSA0085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        80604..81251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0085"
FT                   /old_locus_tag="LSA0085"
FT                   /product="Hypothetical lipoprotein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54384"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ3"
FT                   /protein_id="CAI54384.1"
FT                   /translation="MNKKLTVGLATATLLLLAACGQQADSTKTSSNSHSTAQSEKRTKK
FT                   QSESKLRAQSSAKKQASKASAKAMSESREKAALAASTAAAQAAEAASSASASEQAADGS
FT                   SASAVQQASAMTASKASESQQAAEQAIKPVTQAEAIEAAKKAFNGIDIIVSHNGTFSSQ
FT                   PDGSMTAHDYSGAQGEDFWTFTPNADGTITVLSKFGSVKGGEQQIETHVVPR"
FT   regulatory      81267..81295
FT                   /locus_tag="LCA_0085"
FT                   /old_locus_tag="LSA0085"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(81267..81295)
FT                   /gene="add"
FT                   /locus_tag="LCA_0086"
FT                   /old_locus_tag="LSA0086"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(81314..82333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="LCA_0086"
FT                   /old_locus_tag="LSA0086"
FT                   /product="Adenosine deaminase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54385"
FT                   /db_xref="GOA:Q38ZJ2"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ2"
FT                   /protein_id="CAI54385.1"
FT                   /translation="MTQLATRDFIDGLPKAELHLHLEGTLEPELKLALAQKNGVDIGQS
FT                   TIEEVQASYNFNSLASFLAVYYPAMNVLQTEDDFYQLALTYLKKAHQENVRYAELFFDP
FT                   QAHMTRGVAFEAVVNGFYRACVDARAFNVDAHLIMCFLRDLSAESARQLLEIAKPYQAK
FT                   ILGIGLDSDEHHNPPLKFLREYGDAVAQGYRITMHADIDQVDSIQHIQQALEIIRVERL
FT                   DHGTNIVENPDLVDWVEQLKIGLTFCPLSNRLVADDMKDREVLELIDHNVKVSINSDDP
FT                   AYFGGYINDNYEANTTKNDLTIDQVVQLAKNSFETAWISDFQKQTYLAEIDAYVADYL"
FT   regulatory      complement(82337..82350)
FT                   /gene="add"
FT                   /locus_tag="LCA_0086"
FT                   /old_locus_tag="LSA0086"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      82485..82498
FT                   /locus_tag="LCA_0087"
FT                   /old_locus_tag="LSA0087"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82503..83846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0087"
FT                   /old_locus_tag="LSA0087"
FT                   /product="Putative adenine/adenosine:cation symporter"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54386"
FT                   /db_xref="GOA:Q38ZJ1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZJ1"
FT                   /protein_id="CAI54386.1"
FT                   /translation="MAPMKQSGIQASADRMFKLQESGTTMKREIFAGLTTFVSMAYILF
FT                   VNPQILGEAGMDKGAVFTATALSAIVGSLLMAFLANYPIAIAPGLGDNAFFTYSVVIAM
FT                   GISWQTAMAGVVVASLIFMVITLFKVREYIIDAIPHDLKLAMAAGIGLFIAFVGLQGGG
FT                   LVVASKSTLVQMGSFTVPTTWLTIFGLVVTGVLMAKKVNGAIFIGMIATTILGLVTKLI
FT                   PLPAQLMSVAPSMKPTFGVGIQHLGDINQPQLWAVVLIFLLVAFFDTAGTLIGLAEQAG
FT                   FMKNGKMPRIGQALMADSVSMMAGSVMGTTPTAAYVESSAGIAMGGKTGLTSLVVSILF
FT                   GFSMLFSPLLTVVTSQVTAPVLIIVGVLMASSLSKIDWSRFEVALPSFLTIIAMPLTYN
FT                   IAYGIAFGFLVYPVTMLAAGRRKEIHPAMYALFVVFVILLYVINILPK"
FT   CDS_pept        83856..85640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adeC1"
FT                   /locus_tag="LCA_0088"
FT                   /old_locus_tag="LSA0088"
FT                   /product="Adenine deaminase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54387"
FT                   /db_xref="GOA:Q38ZJ0"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZJ0"
FT                   /protein_id="CAI54387.1"
FT                   /translation="MIMSDRLTAFKELIQAGGAKRPADLIIKNGQLVNVMTAEIYPAEV
FT                   AIYQGKIVAVDPDVSAYQGTETRVIDAKQQYIVPGLIDGHIHVECSKLSMTSFAEAVVP
FT                   HGTTSIISGLDEYISVIGVDGLSEIFKEVDQLPMRVFWGAPFKTPYTIPASTIADNIDS
FT                   TVQAQLQKRSDVYGVWETVREAVETLDEDTLKTLLNAQDNHVPVWGCAPMATGTKLNEY
FT                   LMSGVRVDHESYDHQELLEKVRKGINVVIRESSVTHFLAENIRAITETNGQIARHVSFC
FT                   TDDVNAMDIVNKGHLDHLVRLAIAAGVAPMTAIQMATINSAEAYRIDDQVGLIAPGRNA
FT                   DILLVSDLEAFEIKRVLAKGQPVATDGHINQSIERPVRPASLANTIIREAVQASDFEYH
FT                   VAADASQVTVQTIASEGPFVRHAKTKTLTVEDGIVQIDPAKDVALISVLERFGKNGNQS
FT                   LGFTSGWTLKKGAMASTAAPDDNNIIVMGVNPDDMALAVNTLIERDGGQVVVADGQILS
FT                   FLPLPIAGIVSDVTPAELAVQEEGILKASQAIGSEVVDPMFYMTFLPITAIPDLAITDL
FT                   GNVDCNELRLFDPILTIQ"
FT   regulatory      85651..85681
FT                   /gene="adeC1"
FT                   /locus_tag="LCA_0088"
FT                   /old_locus_tag="LSA0088"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(85651..85681)
FT                   /locus_tag="LCA_0089"
FT                   /old_locus_tag="LSA0089"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(86081..87007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0089"
FT                   /old_locus_tag="LSA0089"
FT                   /product="Putative drug transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54388"
FT                   /db_xref="GOA:Q38ZI9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI9"
FT                   /protein_id="CAI54388.1"
FT                   /translation="MTNQLKPQNIAKGMFWATMASALWGVSGTILEFISQGQKVPATWF
FT                   LSVRTLGAGLILLLIGAIKFKQDIFSIFKSKRLTAWLIAYALFGIMGNQYTFFMSIQTG
FT                   NAAAATILQYLSPLFIVIGTLAFVRKWPNRIDLISFGIALVGVFLSITKGNIHTLTIPF
FT                   NSLIWGILSGVTAAFYVVLPRPIVNEKSPILVLGWGMFISGILFNINRPFWQAPPHLNG
FT                   SGIIAILAVILIGTVFAYLCLLHSLNFAPSTVISIVDAVQPVITFILSIIFFHSKFSWV
FT                   EMSGAILVILAIYILQRYQEADGEPLA"
FT   regulatory      complement(87012..87025)
FT                   /locus_tag="LCA_0089"
FT                   /old_locus_tag="LSA0089"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      87169..87182
FT                   /locus_tag="LCA_0090"
FT                   /old_locus_tag="LSA0090"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        87186..88481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0090"
FT                   /old_locus_tag="LSA0090"
FT                   /product="Putative extracellular arylsulfate
FT                   sulfotransferase (N-terminal fragment), authentic
FT                   frameshift"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="2.8.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54389"
FT                   /db_xref="GOA:Q38ZI8"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI8"
FT                   /protein_id="CAI54389.1"
FT                   /translation="MKKRLKQGTIILLGIILAGLLLFKLVGSSSLFNKDILSTSQIIKN
FT                   IGSQTIKTRQTSQEKLTATYKKALNSDQYTSAKPYVKVNPYGTSPLSALVLFKTNTATK
FT                   VTVEVVGKTAKTSIKSEVGKNYTKSHTISVLGLYANYQNKVRLTLTDKAGHKTYQTITV
FT                   KTAALPKAIASMSLKVKKADKTKMSIGNSSLTFLVRSTQYPVGVDADGEIRWYSTNYVQ
FT                   HIFKVLSNGHLLYLTKPDNKDLVYNDLLETDFMGRVYREYQFSTETRNNESANDKTETT
FT                   IIHHDAIELPNHNLLLTVSDGGSKYVEDTMVELSRKTGKVVKVIDLKKLLPAELYETYK
FT                   ATKRADGKLDWFHQNSIDYDTSDDSIVISSRNQDLVMKLDYKTSKIKWLFSSKSASKWP
FT                   LKYRKLLLKAADSQTGNTPPQFGRPAKRTRSN"
FT   CDS_pept        88481..88849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0091"
FT                   /old_locus_tag="LSA0091"
FT                   /product="Putative extracellular arylsulfate
FT                   sulfotransferase (C-terminal fragment), authentic
FT                   frameshift"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="2.8.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54390"
FT                   /db_xref="GOA:Q38ZI7"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI7"
FT                   /protein_id="CAI54390.1"
FT                   /translation="MLFNNDMAVSNGDKKTSGKYSEGVSYLIDEQDKTIKKTWSYGKTL
FT                   GKTNFSEVIGCTRKLTNGDYLIDFGFNDQGKTSRIVEVDPKTNKVVYNLTFTNFTTIGY
FT                   AYRAERFSLYSQNYQFKL"
FT   regulatory      88867..88880
FT                   /locus_tag="LCA_0092"
FT                   /old_locus_tag="LSA0092"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88883..89425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0092"
FT                   /old_locus_tag="LSA0092"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54391"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI6"
FT                   /protein_id="CAI54391.1"
FT                   /translation="MQYIALLRGINVGGKRKVQMNLLRIAFEDAGFTNVRTYINSGNVL
FT                   FETPETELAELVAVCDQLMVTTFGFSVRIAIVTADSLIAAVEQAPNWWGAAAGTSHNLI
FT                   VAIAPKTAAELSEQLGPVKADYEQVAVTGQFVFWSAPVKTHGRTRWATIVKNKALYQWI
FT                   TIRNANTARKLAALAQD"
FT   regulatory      89494..89507
FT                   /locus_tag="LCA_0093"
FT                   /old_locus_tag="LSA0093"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89509..90345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0093"
FT                   /old_locus_tag="LSA0093"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54392"
FT                   /db_xref="GOA:Q38ZI5"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI5"
FT                   /protein_id="CAI54392.1"
FT                   /translation="MRLSNLKQTMLQMGLILIALEIIAIGIQLFFAPHEVAAGGATGVG
FT                   ILLEELMGWRISTVVLVINIGMLILAYFLLDKKTTLRILFGSFMLPVCLAITPQAMVVE
FT                   DKLLAIIIGSVVYAAGIALLYRIDASSGGSTVPPLIFKKYFNIKPALSLLVVDLLVCFA
FT                   NVFVSGFETFMLATCSSILTLITMNYIETGLNRKKVLYVMSNEQLATIKEHLVEEADVG
FT                   VTIFDVTDGYSNEDKQMLMLVVENQAYQHIINKIHEVDPLAFTIVGNIAEVRGGSL"
FT   regulatory      90376..90410
FT                   /locus_tag="LCA_0093"
FT                   /old_locus_tag="LSA0093"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(90376..90410)
FT                   /locus_tag="LCA_0094"
FT                   /old_locus_tag="LSA0094"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(90563..91786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0094"
FT                   /old_locus_tag="LSA0094"
FT                   /product="Putative transport protein, Major Facilitator
FT                   Superfamily"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54393"
FT                   /db_xref="GOA:Q38ZI4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI4"
FT                   /protein_id="CAI54393.1"
FT                   /translation="MKTITAHSQHRLTSYQSKVVASTTAGFGLENMDVMFLSFALSSII
FT                   AELHLSGTQAGLIATITNIGMLLGGVFFGVLADRVGRIKTFTYTIFIFAFATAAMYFAN
FT                   SLTLIYLCRFLAGIGAGGEYGIGMTVLAESFPKKQLGRVSSYVGVAGQLGAIAASLLAA
FT                   WVLPQYGWHALFLFGLFPVIITFFIRHHLVESRNFDTDQARPKGQIKALFKTRQLTHQT
FT                   LALMVMAVVQIAGYFGLMNWLPTMMQQQLHLSVAGSSTWMLATIVGMSAGMLTFGWILD
FT                   RIGPRIAFSSFLLASAAGVYVLTLPKNMTGLLIVGALVGYFSNGMFAGYGAIVSRLYPA
FT                   EVRATANNVIMNVGRCVGGFSSVIIGWLLDHYSILTVMLFISTLYLISFVVMLTVQNLK
FT                   AERYFNHL"
FT   regulatory      complement(91792..91805)
FT                   /locus_tag="LCA_0094"
FT                   /old_locus_tag="LSA0094"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      91965..91978
FT                   /locus_tag="LCA_0095"
FT                   /old_locus_tag="LSA0095"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91981..93513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0095"
FT                   /old_locus_tag="LSA0095"
FT                   /product="Putative transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54394"
FT                   /db_xref="GOA:Q38ZI3"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI3"
FT                   /protein_id="CAI54394.1"
FT                   /translation="MATKKPTSFFTFPSAYTVILLVLLLVMILTYFMPSGKYASLQYNT
FT                   QSNNFTITSPTGRESTAPGTQATLKKYHVNTSLAKFKDGSVYKPVAIPNTYQHLKKANT
FT                   GLFGAVKQFLNAPIQGLAETIDIITFVLILGGIVGVVNKTGAFAAGMAALSKKLKGREA
FT                   WLIVIVTSLIALGGTTFGLAEETIAFYPILVPIFMAAGYDALVAIAAIYLGSSIGTMAS
FT                   TVNPFSVVIASNTAGISFTEGMGLRLVMLVIGTAMCIFYTIRYAEKVKKDPEKSLIYSQ
FT                   KAELEAHFLGDQENNVVPKFDFRKKLMLIIFAAGFVIMVFGVKEWGWLFNEISALFLAI
FT                   TFILAFISGLSEKDFVGEFVAGASDLLGVALVIALARGVTIIMEQAQISDTLLFWLSNG
FT                   VSHMSGVIFSTVMFFVFILLGFFIPSSSGLAVLSMPVMAPLADVVGVHRDVIISAYNWG
FT                   QGIMSFITPTGLVLASLAMVHVTFDKWLKFVLPLMLAIGLLAMILLGISVYL"
FT   regulatory      93525..93548
FT                   /locus_tag="LCA_0095"
FT                   /old_locus_tag="LSA0095"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(93525..93548)
FT                   /gene="sipA1"
FT                   /locus_tag="LCA_0096"
FT                   /old_locus_tag="LSA0096"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(93789..94400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipA1"
FT                   /locus_tag="LCA_0096"
FT                   /old_locus_tag="LSA0096"
FT                   /product="Signal peptidase I (Leader peptidase I)"
FT                   /function="1.6 Protein secretion"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54395"
FT                   /db_xref="GOA:Q38ZI2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI2"
FT                   /protein_id="CAI54395.1"
FT                   /translation="MSNKAKEFWKSTLQIVLLAAVMVGISQLLLTFVISNEQVFGPSMQ
FT                   PNFTQNDRVIALRHAKLKRGDVVILKAPDAKGEFYIKRIVGMPGDTVRFDRDQLYINGK
FT                   KVSEPYLKAYKADFSTYLAGSDYFTLNPKTNGPTFDLKDVLGQKKVPAHHYFVMGDNRT
FT                   VSKDSRYKEVGFISDDASAYNGIQGVVKLRYWPITKFKIY"
FT   regulatory      complement(94403..94416)
FT                   /gene="sipA1"
FT                   /locus_tag="LCA_0096"
FT                   /old_locus_tag="LSA0096"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(94485..94628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0097"
FT                   /old_locus_tag="LSA0097"
FT                   /product="Hypothetical extracellular small peptide
FT                   precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54396"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI1"
FT                   /protein_id="CAI54396.1"
FT                   /translation="MSKKARLLAVLVGIVCVGYLIASQSINDQSAAQSDRQERQSIHKM
FT                   AR"
FT   regulatory      complement(94631..94644)
FT                   /locus_tag="LCA_0097"
FT                   /old_locus_tag="LSA0097"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      94796..94809
FT                   /locus_tag="LCA_0098"
FT                   /old_locus_tag="LSA0098"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94813..96066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0098"
FT                   /old_locus_tag="LSA0098"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54397"
FT                   /db_xref="GOA:Q38ZI0"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZI0"
FT                   /protein_id="CAI54397.1"
FT                   /translation="MPTIEANFTPVLLGSDFNVYGMARSFYELTGKPVQAYAGAELAPT
FT                   RYTKIVDVDITPGFSEDPVFIEKMRDLILKYQTHTEPVILIGCGDGYAELIAKHKTELE
FT                   AAFVCPYIDYDLLKRLNNKEKFYQVCEEFDLPYPKTKTITQQMVLDGQVDQPFGYPVAL
FT                   KPANSVEWLDVHFEGRKKAFRIQSQAEFDMIIKKIYDNGYTSDLILQDFIPGDDSRMRV
FT                   LNAYVDQNHQVKMMCLGHPLLEDPAPSAIGNYVAIMPEYNETIYKQIQTFLEAIKFTGY
FT                   ANFDMKYDERDQTYKLFEINLRQGRSSFFVTLNGYNLAQWVVKDYVTGELKDQATVYAN
FT                   KDNDQAALWLGVSKGVFEKYARDNEDKTKALALIKAGRYGTTFQYAKDNNPKRWVLTQW
FT                   MLHNYRKNFARYFKENKG"
FT   CDS_pept        96063..96779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="racD"
FT                   /locus_tag="LCA_0099"
FT                   /old_locus_tag="LSA0099"
FT                   /product="Aspartate racemase"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="5.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54398"
FT                   /db_xref="GOA:Q38ZH9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH9"
FT                   /protein_id="CAI54398.1"
FT                   /translation="MIATMKQFFTVLGGMGTAATESYIRLLNQRTPTTKDQDFLNYIVV
FT                   NHATIPDRSTYLMDHSQPSPEPDLLEDIQQQSLLKPAFFVIACNTAHYFYDDLQAAASA
FT                   PIVHMPRETVKSIQTTYPDAKRIGILGTKGTVTDGIYDEALLAEGYEVVKPSLDLQERT
FT                   MDLIFNDIKGQSQMKPEKYHAILAEMQTQCDAIILGCTELSLAQEWAPDHDFPVVDSQS
FT                   VLVDRSIELGLKLREK"
FT   CDS_pept        96789..97496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm1"
FT                   /locus_tag="LCA_0100"
FT                   /old_locus_tag="LSA0100"
FT                   /product="Phosphoglycerate mutase"
FT                   /function="2.1.2 glycolytic pathway"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54399"
FT                   /db_xref="GOA:Q38ZH8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZH8"
FT                   /protein_id="CAI54399.1"
FT                   /translation="MANLVIVRHGESVANQLKTYTGWSDVALTAKGRQQAHQVGRQIKD
FT                   AGFQFSHVHTSLLKRAILTSYIVLEELDQLALPMTKSWRLNERHYGALRGLNKDTTRTI
FT                   FGVHQVARWRRSYTALPPLLIRSSTARRYRLVPRKSRPRGESLAQATQRLLPYWQDQVV
FT                   PGLLAGQDQLIVAHGSTLRALIKVIEQISDQAIDGVEVANGEALYYQFGTDLTVLKKGR
FT                   LALGSETDEEKEN"
FT   CDS_pept        97477..98628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0101"
FT                   /old_locus_tag="LSA0101"
FT                   /product="Putative penicillin-binding protein precursor
FT                   (Beta-lactamase class C)"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54400"
FT                   /db_xref="GOA:Q38ZH7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH7"
FT                   /protein_id="CAI54400.1"
FT                   /translation="MKRKKINIALTICVLVLGVSLTFYFRRQFGRQGQALANTQMQLKL
FT                   TKKQLDIQRAKVNKNDIDDRVVNELTTPEQAYLKQELLDNNFSGTILIVRHNHVIYQGG
FT                   RGYANSEQFTTPKTTYQIGSVQKSLTAALVMKAVENGQLKLTDHLSRFYPQIPKANQIT
FT                   LQMMLDMRSGLFETSAPKVVQTDAQRLQFAIKHLQVKKIGQHAYSPVNYVLLAGLLEQA
FT                   THKSYNDLMKQQIITPLGVQAFNFMPNFSDPQHATAYAYQKNGAYGAEIEDPAYIYTRE
FT                   LGTGNLYATASSLYQVEEAIVQGKVFKSKYLQQLRHTNNGQYSGGVYNYRDYFTSHGIE
FT                   AGFESHVQMSQNGESGIILLSNQYKSTPSLVTMSKQIYQQLLV"
FT   regulatory      98634..98669
FT                   /locus_tag="LCA_0101"
FT                   /old_locus_tag="LSA0101"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(98634..98669)
FT                   /locus_tag="LCA_0102"
FT                   /old_locus_tag="LSA0102"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(98673..99269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0102"
FT                   /old_locus_tag="LSA0102"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54401"
FT                   /db_xref="GOA:Q38ZH6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH6"
FT                   /protein_id="CAI54401.1"
FT                   /translation="MRKILEYSLAGVLSFLFSRAFIHRIVLPTLWGYPRLTRVMARFPK
FT                   TTVLLILFLTLALWLGWIQWDLKRLSPIYGYLIYSVYLLLLFIVLFTKASVYHAVSLNP
FT                   FDFISHDRRTILEALLNVIYFIPLGGLYSLKADFTETNIIALLTILGIEILQYVFYLGT
FT                   FAISDIILNWVGCLIGFTLFTIGARHFKQTIKTNA"
FT   regulatory      complement(99273..99286)
FT                   /locus_tag="LCA_0102"
FT                   /old_locus_tag="LSA0102"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(99295..99777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0103"
FT                   /old_locus_tag="LSA0103"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54402"
FT                   /db_xref="GOA:Q38ZH5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH5"
FT                   /protein_id="CAI54402.1"
FT                   /translation="MTTLSNDLFQTFNKVIHHYRHYYGMQFSSHHKSVSQIRILKLLHQ
FT                   QNGQMQSTLAQTLAIQPSSLTECLNKLAAKDYIQRQSDEHDKRVTHVFITPAGRAIIQE
FT                   AFDGRDEFTETLFSSLSSEEQATLNQLLTKLEHTLSDTQNFDFMAEFKERLHHTKL"
FT   regulatory      complement(99780..99793)
FT                   /locus_tag="LCA_0103"
FT                   /old_locus_tag="LSA0103"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(99908..99928)
FT                   /gene="tpx"
FT                   /locus_tag="LCA_0104"
FT                   /old_locus_tag="LSA0104"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(99949..100443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="LCA_0104"
FT                   /old_locus_tag="LSA0104"
FT                   /product="Thiol peroxidase (Hydroperoxide reductase,
FT                   Peroxiredoxin)"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54403"
FT                   /db_xref="GOA:Q38ZH4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH4"
FT                   /protein_id="CAI54403.1"
FT                   /translation="MQITRHDQPLETIGTPPKVGEQLPAFELVDADHQTRTTQQLLGKR
FT                   TLISIVPDINTRVCSIQTKHFNQAIDQFTDINFYTVSTNTVEQQQAWCAAEGVQLMQLL
FT                   SDEALSFGKALNLYVPSNNTLQRSIMIVEADGTISYEELIVEQTDEPNYAAALEFLKSA
FT                   H"
FT   regulatory      complement(100446..100459)
FT                   /gene="tpx"
FT                   /locus_tag="LCA_0104"
FT                   /old_locus_tag="LSA0104"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      100538..100551
FT                   /locus_tag="LCA_0105"
FT                   /old_locus_tag="LSA0105"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        100555..100758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0105"
FT                   /old_locus_tag="LSA0105"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54404"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH3"
FT                   /protein_id="CAI54404.1"
FT                   /translation="METKKIQALYAKKMFNQIVKEVNVKPLSYEVVDANGDETAVLIGQ
FT                   TQWAQIQQLLVIKNIDIADIDS"
FT   regulatory      100854..100867
FT                   /locus_tag="LCA_0106"
FT                   /old_locus_tag="LSA0106"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        100870..102144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0106"
FT                   /old_locus_tag="LSA0106"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54405"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH2"
FT                   /protein_id="CAI54405.1"
FT                   /translation="MKKLGKLMVSALAMLSISAPIAMSVGVVSADSVTDTKAAITKTSA
FT                   ENAALLTKLNDAQNKVSEINSQVSNKVIAIDDAKANIKSIDQQIVALDQSIEKAKAEVQ
FT                   ARKSVMKKQAVSLQKEAGNSVSGNVYVDFIVNSDNFSDMMSRASVVGKLNQASKEAMTA
FT                   VSDSESTLATLKTTQETKKADLVKTKSQLEADQAKLVTLKDDAEKEQKRFETEVEGHKT
FT                   QLANLQSQLDSQTAAAVEVAKQQAEADKAAKTEAPKTATKSESTSSDIKNESSDKTKTE
FT                   SVLNNNTGATTPNNNNNSASKATTKPVANTGSLVSNALQFIGTPYAWGGAQPGGFDCSG
FT                   LVMYAAKMAGISLPRTSQAQSKLGTQVSLSELQPGDLVFWGGVGSAHHVGIYIGNGSYV
FT                   HAPAPGQSVTTMSMQYYKPDFGRRI"
FT   regulatory      102173..102204
FT                   /locus_tag="LCA_0106"
FT                   /old_locus_tag="LSA0106"
FT                   /regulatory_class="terminator"
FT   regulatory      102224..102237
FT                   /gene="gmk1"
FT                   /locus_tag="LCA_0107"
FT                   /old_locus_tag="LSA0107"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102240..102800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk1"
FT                   /locus_tag="LCA_0107"
FT                   /old_locus_tag="LSA0107"
FT                   /product="Guanylate kinase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54406"
FT                   /db_xref="GOA:Q38ZH1"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH1"
FT                   /protein_id="CAI54406.1"
FT                   /translation="MVEKQLLVITGATGSGKTTVSHWLTEMYQIPQVVTHTTRPKRHNE
FT                   VDGVDYYFETESSLAQKHLIESVTYSGYHYGSSHEALELAWAKSPLISLVVDTKGAQTY
FT                   LETFGKQVTVLFLTVSEATALISRLEKRNDSPEAIQKRLASAEFKRDLMVSGPLHDQAQ
FT                   IIVNDDWQETQKTLTTIIEQLRQ"
FT   regulatory      complement(102808..102844)
FT                   /locus_tag="LCA_0108"
FT                   /old_locus_tag="LSA0108"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(102861..103049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0108"
FT                   /old_locus_tag="LSA0108"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54407"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZH0"
FT                   /protein_id="CAI54407.1"
FT                   /translation="MQLQNKTNNWYHVSLDTQTQKFIATATNNEKISASGITIEQAVQK
FT                   LTFKVKQPNRANKQQLA"
FT   regulatory      complement(103053..103066)
FT                   /locus_tag="LCA_0108"
FT                   /old_locus_tag="LSA0108"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      103322..103335
FT                   /locus_tag="LCA_0109"
FT                   /old_locus_tag="LSA0109"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        103339..103767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0109"
FT                   /old_locus_tag="LSA0109"
FT                   /product="Putative transcriptional regulator, Fur family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54408"
FT                   /db_xref="GOA:Q38ZG9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG9"
FT                   /protein_id="CAI54408.1"
FT                   /translation="MSEMTTALAVLKANGFKITKQRREMLTYLAQYENHYIPVTQIDDH
FT                   MRSIFPGMSHDTIYRNIKDFEQLGLVEQQTEGEQAHVKYQCDFEHRHHHHFICRNCGKV
FT                   IELKMCPLDFFSDQLPNCQVEGHQFELYGLCEDCQENE"
FT   regulatory      103771..103784
FT                   /locus_tag="LCA_0110"
FT                   /old_locus_tag="LSA0110"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        103786..104262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0110"
FT                   /old_locus_tag="LSA0110"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54409"
FT                   /db_xref="GOA:Q38ZG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG8"
FT                   /protein_id="CAI54409.1"
FT                   /translation="MAFHTPPIVPPAAIISLIIAMSATNVVVNTVKPVANIKTEQKTSV
FT                   SESSQSSVSNSQSASRSESDETTSSQSSSAPEESVSSSSESISTPSDQEQSSTDNTTET
FT                   SSSETTDTTQNDESADSSDTTSDTQTTTNNSSSAASSTGTSQNVAKVTSGSATQ"
FT   regulatory      104281..104294
FT                   /locus_tag="LCA_0111"
FT                   /old_locus_tag="LSA0111"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        104298..105116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0111"
FT                   /old_locus_tag="LSA0111"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54410"
FT                   /db_xref="GOA:Q38ZG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG7"
FT                   /protein_id="CAI54410.1"
FT                   /translation="MLSFLDIINHYFGYLNINNRVKNRIFSIICLIGDFYLLYKSIYYF
FT                   RAQAIGRGVINLIVFLVLLYFAVMNLYFYYRGRNAVVDVSPYVEKALGGDPTAPHPLAG
FT                   QTAKPKIISQVQPATGLFEEKDLLPAQLEVDSAHQQQLDQLVAQLIEAGYISLNYAGLA
FT                   DADIYEQAQHFQRPIYAIGERVALPFYELKQEDGQWVVHGGINAMAKAPLAVIKSVGLT
FT                   PIQELTDHYQLAIAHTWITGGPHKMAGRSGVVEGSDPYQLMVQMAYQKRV"
FT   regulatory      105122..105135
FT                   /locus_tag="LCA_0112"
FT                   /old_locus_tag="LSA0112"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        105138..105614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0112"
FT                   /old_locus_tag="LSA0112"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54411"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG6"
FT                   /protein_id="CAI54411.1"
FT                   /translation="MEIHNEFLDLNYRYQYYLLELVADHGDYYLTVNRAMKLLGLSKFK
FT                   LSQYVETVNADLAMMSPESYLRINGDGIFESGHISESIVRKIRLDYLQQSNLFKMFEFS
FT                   LLNPGKNETTDFCDALFIGKTKFYELRKEMVEVADHFNLQFKKNQLIGPEMQIR"
FT   CDS_pept        105663..106592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0113"
FT                   /old_locus_tag="LSA0113"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54412"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG5"
FT                   /protein_id="CAI54412.1"
FT                   /translation="MALFQETVDQMLVTMRDQFQINLLPTTITKLETYLKVQSLRLRGK
FT                   NALTDPLLAPDFKTQQPQLWQPVLSMLTTNYQLLRIPLEVEAEGLLTFLFTESYVPLEI
FT                   DYLTPDLKNGVSQKTGQFVNKVEHVLMKDEAHSEQAQNILANLAHDLDQIHVKHLTFYT
FT                   EPTTFIDEQQLTYFAEANPLFHQIILTFTTKQETDLDWRKQASLYYDYMFACIEDIPLE
FT                   ILKDRVYICVDFSQGRLYNQYMKKTVNYFNNLNIEVQTTVDERTDLYLSDFYSSTLTCE
FT                   QLIWKNPPTILNWQQFGDLVVAIKKGKL"
FT   CDS_pept        106589..107347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0114"
FT                   /old_locus_tag="LSA0114"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54413"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG4"
FT                   /protein_id="CAI54413.1"
FT                   /translation="MKSGKQILALTILSLGVYRFSQTFLMQQVQKVSAADTAVGKENSD
FT                   ALTGNELNITVKNYPTKVIESSSDSQSSSSSAQTEQPVSKTQPDQQTTNQSTTTAQQVP
FT                   AAQQDQSKTANTQEVAEQQRAAQKATNASDKSTAAQSVAQTTQDQAKAAEATTANTAKN
FT                   THKIAKKTIKKHANASIQEHGNQQGQDNANQDQQQADFLKHHAQVEKDIAMFQQSMSPN
FT                   TPSGGATTQVGAVFGALAGQGVYAVQNEIE"
FT   CDS_pept        107334..108104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0115"
FT                   /old_locus_tag="LSA0115"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54414"
FT                   /db_xref="GOA:Q38ZG3"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG3"
FT                   /protein_id="CAI54414.1"
FT                   /translation="MKLNEVIELKQQHYFRKLTVILTVVSLMLSLFDISALAAATDTKK
FT                   QSPIESFVIRGLDDNEQAVPNAKINLKSENGKYDYTLSSDNRGFFKTVVETLTGHTVRG
FT                   IMPGKYHVSSIAAPTGYQLEKSNELIEIAADQANFYHLYYTDASQGDLVVKTQLQDGTP
FT                   VSGVVLMAVNQKTNESYTAPASDDKGWTKLTLPTGRYQLKVIFHPDSSEPQWAPTVTVS
FT                   ANQSLTTTVDFGKTKGEMMTTVTDQTTGDPLVGV"
FT   CDS_pept        108324..108575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0116"
FT                   /old_locus_tag="LSA0116"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54415"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG2"
FT                   /protein_id="CAI54415.1"
FT                   /translation="MLKITSLSESGIALPHVSYRVTTMANEQYRTVQTDDNGQVTVGQL
FT                   PAGRYQIREVAVPDGYQLANISQEITLDQETTAVSFVH"
FT   CDS_pept        108609..110810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0118"
FT                   /old_locus_tag="LSA0118"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54416"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG1"
FT                   /protein_id="CAI54416.1"
FT                   /translation="MNASNAQGKALAGVQLKLKLMGSKESYERTVTTTATGKATLAAVP
FT                   VGDYQVTQESTVMGYQPATAVQSLTISNDHQNTVDWQLQRMVADVTFRVRDAATHQPLA
FT                   KAAFTLTTATPADNGQTVFVSQKTNQDGEVTIKQLPTGKITYEQMANAAGYEPLAAIQT
FT                   AIVGADGAQNTEVTVDNQRLKVTEKQQIIVHKTNQQGQGLDDAAFKLTNLATGQTQTQK
FT                   TVSGQLHFTELNPGRYEIQETKAPTGYQLDQTPQFVTIKVHEKRLYQVRFADKREVTAP
FT                   ISPLRIQILDNHLQGVAGVLLRLTADQPDDQGQTVWELTTDRFGQAILPNASTGHYRVE
FT                   VLQVPTGYQLSFDQSQLDVSRYGENQLQLQANRIEMPLQTLTINKTNLKGQPLSGAVFK
FT                   VESLKTGQMTKVETDQTGRAELRDQKPGRYRVTEVEAPLGYRLATEPRIVALSEKSPRA
FT                   TQLTVTDEAQMGQLLIKHTTKKGAPIAKAYFEVKDQSGREVGYYQTDSQGQIKLTQLAV
FT                   GQYTVQEIKAPTGYEINPAVTKVAITDRKTATVAIKAEQQAPDVKLGSFVLIDRDQKTQ
FT                   LAIASATYRLETLAGQAVRPEIVVGATGQVVVNDLTPGQYRLVQLTAAPSYQKQTNDQI
FT                   IEIKQDAQLKQVTIESHQSQGTVIVNQVDGNTNQALVGAKYELQNQSGKVLVENLKSDE
FT                   HGQVRITHLDPDTYRLVQVSATKGYDPLKKPIVFTITNR"
FT   regulatory      110959..110972
FT                   /locus_tag="LCA_0119"
FT                   /old_locus_tag="LSA0119"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110976..111416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0119"
FT                   /old_locus_tag="LSA0119"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZG0"
FT                   /protein_id="CAI54417.1"
FT                   /translation="MSVYYLNRKDPVSEMIKTVQAGMASLSYFDHLEEICRDVNISLDD
FT                   AILLQRINEMTTGRYVDAQIVFSAGLVEEDLYRLKDAGWLLGMRDSERTKQYVMLSPRA
FT                   QKALEAISSAYEQDGPVIAPKIDSADVQRIMQAADKVFQKYQ"
FT   regulatory      111427..111457
FT                   /locus_tag="LCA_0119"
FT                   /old_locus_tag="LSA0119"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(111427..111457)
FT                   /locus_tag="LCA_0120"
FT                   /old_locus_tag="LSA0120"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(111469..112740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0120"
FT                   /old_locus_tag="LSA0120"
FT                   /product="Putative GTP-binding protein"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54418"
FT                   /db_xref="GOA:Q38ZF9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF9"
FT                   /protein_id="CAI54418.1"
FT                   /translation="MQETKMAQKRVLITGVSNRQTNFDYTMRELGELARADNLEVVGEV
FT                   RQNIDQASHRTYFGKGKVQEIKAEAAQADADIIVVNDELSPSQIRNLEKELEMSILDRT
FT                   QLILEIFASRAKTKEAQLQVAIAEAKYQLPRLHPSENKLDQQGGGGSTNRGAGETQLEL
FT                   DRRLIEKRITKLKGELAQIDQQQEVQRRQRTKNAVPDVALVGYTNAGKSTTMNRILQRL
FT                   NPDTPEKQVFEKDMLFATLDTSVREIVLPNKQKFLLSDTVGFVTKLPHHLIQAFKSTLA
FT                   EAADADLLIHVVDYSDPNYLDMMKTTQETLDSLGVKDIPVIEAYNKADLKPDTRYPEVD
FT                   GTQIVYSARDEVAIDALIALINKQLFEQYPTLDFLIPFTEGQAVAYLSERANILEQSYE
FT                   EEGTKIRAQISPDLLGAVQKYVQE"
FT   regulatory      complement(112744..112757)
FT                   /locus_tag="LCA_0120"
FT                   /old_locus_tag="LSA0120"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(112799..112817)
FT                   /locus_tag="LCA_0121"
FT                   /old_locus_tag="LSA0121"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(112885..112926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0121"
FT                   /old_locus_tag="LSA0121"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54419"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF8"
FT                   /protein_id="CAI54419.1"
FT                   /translation="MSTQFDRPGLIIE"
FT   regulatory      complement(112931..112944)
FT                   /locus_tag="LCA_0121"
FT                   /old_locus_tag="LSA0121"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(113018..113044)
FT                   /gene="dhaT"
FT                   /locus_tag="LCA_0122"
FT                   /old_locus_tag="LSA0122"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(113055..114224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaT"
FT                   /locus_tag="LCA_0122"
FT                   /old_locus_tag="LSA0122"
FT                   /product="1,3-propanediol dehydrogenase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="1.1.1.202"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54420"
FT                   /db_xref="GOA:Q38ZF7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF7"
FT                   /protein_id="CAI54420.1"
FT                   /translation="MKTNFDFLMPSVNFFGPGVIEKIGDRTKMLNITKPLIVTDTFLEG
FT                   VPDGPVAQTLASLDQAGVQYSIFNGVEPNPKVRNIQAGKAQYLADGCDGLITVGGGSAH
FT                   DCGKGIGILLTNGDDITKLAGIETLENALPPLLAVNTTAGTGSELTRHCVITNEETHLK
FT                   FVVVSWRNIPLVSFNDPMLMLDVPAKLTAATGMDAFVQAIEPYVSTNRNAITDGQCLQA
FT                   IKLIEESLREAVANGHNIEARTKMCEAEMLAGMAFNNADLGYVHAMAHQLGGQYDAPHG
FT                   VCCALLLPIVEEFNIVACPDRFAELARAMGENTDALSTRDAAELAIKGMRQMAADVGIP
FT                   TSIKAIGAKPADFEMMAENALKDGNAFSNPRKATKAEIVALFQKAYDAE"
FT   regulatory      complement(114229..114242)
FT                   /gene="dhaT"
FT                   /locus_tag="LCA_0122"
FT                   /old_locus_tag="LSA0122"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      114433..114446
FT                   /locus_tag="LCA_0123"
FT                   /old_locus_tag="LSA0123"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        114450..115337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0123"
FT                   /old_locus_tag="LSA0123"
FT                   /product="Putative sugar kinase, ROK family"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54421"
FT                   /db_xref="GOA:Q38ZF6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF6"
FT                   /protein_id="CAI54421.1"
FT                   /translation="MANLALIDVGGTTIKFALWDGTAHKLTKQGMVATPKSLNAYYAAL
FT                   TKIVRTYQLSDQIVGVGMSTPGAVNKATGIIEGASALPYIHNFEIQSALEMRFGLPVIM
FT                   ENEINCAALAELGSGSAEGLQNVLYLAIDSDVGGAVIIDGHIQHGSHLFSGEFGAMLMS
FT                   DGHPLSEVGTITYLTQQYNQQAHAELTGTEIFALARQGNSLAHQVTTAFYQHLAQAIYN
FT                   LQYCFNPEAIILGGGLEKIDFLVPHIEIERRKLLTQVQLAPFETPLLASQYQDDANLMG
FT                   ALVDFQQCYPQKML"
FT   CDS_pept        115396..116748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0125"
FT                   /old_locus_tag="LSA0125"
FT                   /product="Putative amino acid/polyamine transport protein"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54422"
FT                   /db_xref="GOA:Q38ZF5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF5"
FT                   /protein_id="CAI54422.1"
FT                   /translation="MIDIKTQTPPQELNRTVGFTAALSTVMGTVIGAGVFFKASSVTEV
FT                   TGSTGLTILAWLLGGIITICAGLTAAELAAAIPETGGMMRYIEKTYGSVAAFLLGWAQT
FT                   TVYFPANIAALSIIFATQCLNLFGWAPSWQIPVAVIVATSLTIMNFFGSRVGGFVQSFT
FT                   TVFKLIPLAIIIIFGLINPGTNASHVSLFTVAGTGTSNNVLSALGNGVLATLFAYDGWI
FT                   HVGNIAGEMRHPEKDLPKSILLGLFGTMVVYLLVNAVFLLVLPISQIAGNENAAAEVAG
FT                   HLFGGFGGKLVTIGILVSVYGAINGYTMTGMRVPYAMATEQHLPFSKQLSCLSKAGIPI
FT                   LCGILQLVIAIGMIFVGGFNTLTDMLIFVIWIFYVMTFAAVIILRKREPEMKRPYKAVL
FT                   YPVVPLIAILGGTFIVINTLFTQTILALIGLGITLIGLPIYYYLEKKYHQD"
FT   regulatory      116758..116792
FT                   /locus_tag="LCA_0125"
FT                   /old_locus_tag="LSA0125"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(116758..116792)
FT                   /locus_tag="LCA_0126"
FT                   /old_locus_tag="LSA0126"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(116800..118236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0126"
FT                   /old_locus_tag="LSA0126"
FT                   /product="Putative amino-acid/polyamine transport protein"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54423"
FT                   /db_xref="GOA:Q38ZF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF4"
FT                   /protein_id="CAI54423.1"
FT                   /translation="MDEIEPKKKYITWQVLALMDFVTVIGFDDIIYNFQNQGMAVVFSW
FT                   IVLLFAYVLPYELMVGHLGSAFSKDGGGLSSWMRHTSGDVWGYLTAWCYWVASLPYLVD
FT                   VANSMVVSFFWIIMGNGNIEDKLSRATFALLTAAITILFIFFQHKFTASLQVLSIVGGG
FT                   AMFIMTILFVLMTFAGLFNGAPIATQPMNWHTFIPKFDLHYFSTIGLLIFAMNGAELVA
FT                   PYVSEMKDGKKDFPKAMMALALMTAFLTIFGSFAIGVFFDANHLPNDLKMNGSYYAFLA
FT                   LGQQFHMGKVLLYIFAVTQAIYMGAQLAMLLDGGTRIFLSDTAKKFLPKALTKTNKQGL
FT                   PINGYWLTTGICTFVLASSAFLPAINDIFNWLLNINGIVSPFVTCFIFVAFLRVRFNSD
FT                   KYPSEYTYIKNKPWAIIVGFWCLLITALGTIFSIFPQDATPGTSKYTHELILNVVVSVS
FT                   LMGLGVILPLIAKYQRKKTA"
FT   regulatory      complement(118241..118254)
FT                   /locus_tag="LCA_0126"
FT                   /old_locus_tag="LSA0126"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      118434..118447
FT                   /locus_tag="LCA_0127"
FT                   /old_locus_tag="LSA0127"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        118452..119210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0127"
FT                   /old_locus_tag="LSA0127"
FT                   /product="Putative antimicrobial peptide ABC exporter,
FT                   ATP-binding subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54424"
FT                   /db_xref="GOA:Q38ZF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF3"
FT                   /protein_id="CAI54424.1"
FT                   /translation="MDTPTVVSVKDVQKTYGKANEKQYTALKGVTFDVQRGEFVGIMGA
FT                   SGSGKTTLLNILSTLDKPTAGEVKINDQEISRLKGNALADFRAQEIGFMFQDFNLLENL
FT                   TAYENMALPLTLQNVTGKKVREKITTIAKTLSIDAILNKYPTELSGGQKQRVAAARALV
FT                   HNPAILFGDEPTGALDSKSARELLDTMAQLNEEQRVSILLVTHDPFSASYCQRILFIKD
FT                   GQIGQELVRGDKTCEAFYQEVLDTLGTFNH"
FT   CDS_pept        119225..121045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0128"
FT                   /old_locus_tag="LSA0128"
FT                   /product="Putative antimicrobial peptide ABC exporter,
FT                   membrane-spanning/permease subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54425"
FT                   /db_xref="GOA:Q38ZF2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF2"
FT                   /protein_id="CAI54425.1"
FT                   /translation="MLWKLSLTGIKGRFKDYLVLFSGLIMSSAIFYMFEALATNKDFVT
FT                   SNSPIGMAAIVFQIGSVLLGIITLVYIIYANSFLMSMRRRDYGMFMMLGAKGRKIAQLI
FT                   AAETLVIGTAATLIGTAIGIGLTQVVSQFLLSRLDMHIKHFSPLYLPAVITTLIFFIVL
FT                   FIIAAVVNQYQLLKTPVLQLLHDDQQPNRIKENKVTRLIQIVLGLVFLAVGYYMMIAIA
FT                   TFQVMGLVIALVTIVLGTYFLFNAFFGWLLMLLKRNEKLRNKGLNNFTLAQLSFRIKDY
FT                   TKMLALVAMLFALALGAITVGIGYQNEIPKIADSASAYDVVLNQPTQKALTLTKDLKGV
FT                   KQTATYQVKEDAKTVYYRTAQLKQTPLLTMEYGKTGSVSTETKVRQVPLRELQTGDTYL
FT                   FRSIQVPSQTAKAVKLVSNEVFAQIAAPTKVVKTYDVQDFSANLPVIKKLYQEQLKANP
FT                   ELKANPEADSSKYVSYKMANGVFSGLEFMGFFLGIAFLAMLASCLMFKILSGAASDVKR
FT                   YTMLAKIGVRQSLLKQSIAKEIGALFLLPGIVGVVHVLFGLQMFKELMIDPYNQIWIPF
FT                   SIFIVLYAVYYVVTTWLYRGIVLKETKFGE"
FT   regulatory      121054..121089
FT                   /locus_tag="LCA_0128"
FT                   /old_locus_tag="LSA0128"
FT                   /regulatory_class="terminator"
FT   regulatory      121211..121224
FT                   /gene="uxaC"
FT                   /locus_tag="LCA_0129"
FT                   /old_locus_tag="LSA0129"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        121228..122643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="LCA_0129"
FT                   /old_locus_tag="LSA0129"
FT                   /product="Glucuronate isomerase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="5.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54426"
FT                   /db_xref="GOA:Q38ZF1"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZF1"
FT                   /protein_id="CAI54426.1"
FT                   /translation="MQLLDDDFLLDNDMAKTLYHDYAAQMPIIDFHCHLNPSEIYQNKN
FT                   YTNITRIWLNEGTYGDHYKWRLMRANGVDEKYITGDGDDYLKFIEWAKTIENAYGNPLY
FT                   EWTHLELRRFFHIDERLTAESAPRIWEKANQLLQTDDFKPRQLIKNSNVQVVCTTDDPA
FT                   SDLHYHQLLKPEEAANGFKTLPAMRPDQLMQIDRDGFGDYLKTLGKVAGVEIHDFATIV
FT                   TALTQRFEFFNKMGGRLSDHSLLTYHFEEATPAELDAIVAKGINNAALSEHEINQYLTM
FT                   LLEALMKLNTQFNWTMQFHINSDRDLNRPMFAKIGPDTGYDAVGTQPDIVNHISALYTK
FT                   MQQTEDVPKSIFYSLNSNDWLELATMMGCFQGGTTQKLQLGAGWWFNDTAEGMTQQLQV
FT                   FAQQSLLPHFVGMLTDSRSFLSYPRHEYFRRVLCSFYGRLVEQGRVPNDAAELGRVVQN
FT                   IAYNNAHDYFDFF"
FT   regulatory      122660..122678
FT                   /gene="uxaC"
FT                   /locus_tag="LCA_0129"
FT                   /old_locus_tag="LSA0129"
FT                   /regulatory_class="terminator"
FT   regulatory      122738..122751
FT                   /locus_tag="LCA_0130"
FT                   /old_locus_tag="LSA0130"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122755..123780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0130"
FT                   /old_locus_tag="LSA0130"
FT                   /product="Putative transcriptional regulator, LacI family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54427"
FT                   /db_xref="GOA:Q38ZF0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZF0"
FT                   /protein_id="CAI54427.1"
FT                   /translation="MKKADKTTVTIRTIAQLANVSHMTVSRALNDSELVKPATKEKILA
FT                   IAKEIGYVPNINAKSLVTNRSYMIGIFFTNLETGTSNSFMTDVVAQAQAVLPKSYSLSI
FT                   NSVAKAMAGQYISINNYDGIIVISQSKSDYDFIEYVHNLGLPLVVLNRVIERDDINNYA
FT                   IGDRLGGELATNYAIQMGHRKLALIRGIDSFESSVQRTNGFMQAVEANGIAVDPTLIKV
FT                   GDYRPESGHELMREILASGNIPSCVICENDDMAVGAISACVELGYQIPRDISFIGFDDM
FT                   AYAKFITPSLTTIKKPTAQIIEMGVAKLMAIVEGEQSDVEQKIVDPEMVIRQSVVNLYQ
FT                   H"
FT   regulatory      123789..123817
FT                   /locus_tag="LCA_0130"
FT                   /old_locus_tag="LSA0130"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(123789..123817)
FT                   /gene="gpm2"
FT                   /locus_tag="LCA_0131"
FT                   /old_locus_tag="LSA0131"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(123831..124487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm2"
FT                   /locus_tag="LCA_0131"
FT                   /old_locus_tag="LSA0131"
FT                   /product="Phosphoglycerate mutase"
FT                   /function="2.1.2 glycolytic pathway"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54428"
FT                   /db_xref="GOA:Q38ZE9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZE9"
FT                   /protein_id="CAI54428.1"
FT                   /translation="MKRITLYLVRHGQTFFNRYNRMQGWSDSPLTEKGIADAELAGKQL
FT                   SKVNFAQAYSSDRSRAMDTAKIILKKSFYLDTPYTITPHFREEFYGYYEGEDSAKAWYM
FT                   TGASHDAKTFKEIITKYSLDASKDFMKEADPFNDAENAAEYWARVGKGFKQIRSECSDG
FT                   DNVLMVSHGTTIRSIVGKFGNGQFDVTVSPMNGSITKVVLTDEGVTVQSYNELTL"
FT   regulatory      complement(124490..124503)
FT                   /gene="gpm2"
FT                   /locus_tag="LCA_0131"
FT                   /old_locus_tag="LSA0131"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      124686..124699
FT                   /locus_tag="LCA_0132"
FT                   /old_locus_tag="LSA0132"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124702..125160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0132"
FT                   /old_locus_tag="LSA0132"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54429"
FT                   /db_xref="GOA:Q38ZE8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZE8"
FT                   /protein_id="CAI54429.1"
FT                   /translation="MANKVSTAISVDQFNEWYLKIGQIYHKINHITVSHDLSYDQYLIM
FT                   RELKRIPSIEVTKLSRMFDITSPAISRKVNVLYKKKLITKKRSDIEDQRKVFICLTPLG
FT                   EQLIEELEDDFEALFKEMIGEINQELMPLFKSTDCFYNYLSKKAQQQA"
FT   regulatory      125331..125364
FT                   /locus_tag="LCA_0132"
FT                   /old_locus_tag="LSA0132"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(125452..125482)
FT                   /gene="pepR"
FT                   /locus_tag="LCA_0133"
FT                   /old_locus_tag="LSA0133"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(125526..126428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepR"
FT                   /locus_tag="LCA_0133"
FT                   /old_locus_tag="LSA0133"
FT                   /product="Prolyl aminopeptidase"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54430"
FT                   /db_xref="GOA:Q38ZE7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZE7"
FT                   /protein_id="CAI54430.1"
FT                   /translation="MKQGTTILTLDNGYHLWTNTQGTGDIHLLCLHGGPGGNHEYWENF
FT                   GKELADLGVQVHMYDQLGSFYSDQPDYSKPGNDQLLTYDYFLDEVEEVRQKLGIDNFYL
FT                   IGQSWGGALVQMYAAKYGQHLKGAIISSMVDEIDEYVTNINKIREDIMTPEQLKFMQDC
FT                   EAKNDYDNDEYQALVDKLNAGYVDRKQPLAISHLIPTMATDVYGVFQGDNEFVVTGKLK
FT                   DWHFRDQLHKITVPTLITFGEHETMPIATAKIMAEKIPHSRLVTTPNGGHHHMIDNAPV
FT                   YFDHLKTFIKDVESGNFKD"
FT   regulatory      complement(126432..126445)
FT                   /gene="pepR"
FT                   /locus_tag="LCA_0133"
FT                   /old_locus_tag="LSA0133"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(126502..128340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0134"
FT                   /old_locus_tag="LSA0134"
FT                   /product="Putative Na(+)/H(+) antiporter"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54431"
FT                   /db_xref="GOA:Q38ZE6"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZE6"
FT                   /protein_id="CAI54431.1"
FT                   /translation="MTNLALVIVLLAALMTPLLMAKFKMSYLPTAVAEIIVGIILGTSG
FT                   FHLIVSTPTLTELSTLGVTVLIFLSGMEIDFDLFKKQPTPTDPQLKVQPSPVRLAITSF
FT                   AFILLISFGLSGLLAWSGLFKDIGLATILFSTIALGVVIAALKEKELLSQPLGQTILLI
FT                   AVLGEIIPLVALTVYSSLNNPGSKSLWLLSLIFVAAIYLLVRFKGVYHFFARIDKSTTQ
FT                   LDIRLAFFLIITLVSIAEEVGAESILGAFLAGMVMKLLRPREETTDKLTSIGYGFFIPI
FT                   FFIMTGAKLDLPALLADRKSLSLIPFFFIGFMLSKAATYWVLKRRFKQTNAIAGTFLSA
FT                   TTITLVLPILTVGLNLKTITEQQSGAFTLAAILSCILGPILFNRFYQPTPEDLPRKRVK
FT                   FIGANIMTIPIAQQLSNGLYTTQLFTDNQGNYEIYHSAADLTLLPDLSEDSLVTSGAFD
FT                   ADIIILGYLNHEQNYRLAQLALDAKVPRIIARFEAKDILDEKYDQLKEQGVEVFNTYEA
FT                   NISLLRSLIETPSTLQIIDNTDAGLFEVTVQNRRFTGLQISNLPFVDQVTISRIYRNQE
FT                   LIMPHGDTQIHLNDHLILTGNKKAVPAIRQQLETRN"
FT   regulatory      complement(128342..128355)
FT                   /locus_tag="LCA_0134"
FT                   /old_locus_tag="LSA0134"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      128455..128468
FT                   /locus_tag="LCA_0135"
FT                   /old_locus_tag="LSA0135"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        128477..128884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0135"
FT                   /old_locus_tag="LSA0135"
FT                   /product="Hypothetical integral membrane protein, similar
FT                   to CcrB"
FT                   /function="3.4 DNA packaging and segregation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54432"
FT                   /db_xref="GOA:Q38ZE5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZE5"
FT                   /protein_id="CAI54432.1"
FT                   /translation="MKIKESLAVGSFAFFGGILRYLIGLVLNQPTGFPYGTLCVNLIGA
FT                   FCLPFLMRYIVARLHLSDQLALAIGTGFFGAFTTFSSFSVDAIRLVNQQQWSAFAWYVG
FT                   ISMVGGVLLSLLADYWAVKLTHNPEEQEVSQ"
FT   CDS_pept        128881..129228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0136"
FT                   /old_locus_tag="LSA0136"
FT                   /product="Hypothetical integral membrane protein, similar
FT                   to CcrB"
FT                   /function="3.4 DNA packaging and segregation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54433"
FT                   /db_xref="GOA:Q38ZE4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZE4"
FT                   /protein_id="CAI54433.1"
FT                   /translation="MTILLVGLGAALGAILRYQLTRIGNHIASEFPLMTFLINLTGSFC
FT                   LGWLTGSQLSQPVTLFLGVGVLGGYTTFSTLNSELSQLWFRRRYHIFFGYWLLTYGLGL
FT                   LVAAAGFYAGL"
FT   regulatory      129305..129318
FT                   /locus_tag="LCA_0137"
FT                   /old_locus_tag="LSA0137"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129322..131613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0137"
FT                   /old_locus_tag="LSA0137"
FT                   /product="Putative DNA helicase, superfamily I"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54434"
FT                   /db_xref="GOA:Q38ZE3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZE3"
FT                   /protein_id="CAI54434.1"
FT                   /translation="MTDVQKSLEQSRLTEIIGLIKKAETHFEGAVKRAKSEEKEINENF
FT                   FNDVRLNFNNDSAMTETAVSIEQQRQMLQERNHSWQQSSRQLETLQKMEKTPYFARVDF
FT                   QEKGEPKSESIYIGLGSFTDTDDHFLIYDWRAPISSIYYEGKTGAVTYQTPDGPQDVNI
FT                   SLKRQFLIEDGQIKALFDTQETIGDQMLLEVLGEKSDTQMKSIVTTIQREQNQIIRNTD
FT                   ADLLFVQGAAGSGKTSAILQRIAFLLYRYRGNLDSSQVIMFSPNQLFNDYIADVLPELG
FT                   EQNMIQMTYFQYVARRLPNMAVQSLFDQFETPVNETDGRISRLKESLVFYKAVKKYAAH
FT                   LEKADMRFRDMKVKGRVLITKEHISEVYYRFNENYHLGNRLDATKESLLRTLSHKVDHE
FT                   TKADWVTEQAENMSDEEIRELMSGKDFKTGDAESKFIAKQIVLEAFKPVRRSIQRNRFL
FT                   SIQAQYIHFLRVVPQLVKLADFDITEEQWQDHVTHFVAQLKAKQMTLQDVTPYLHLYDL
FT                   MTGKKGERDMRFVFIDEIQDYTPYELAFLKLHFPKARFTLLGDLNQAIFTKGNSTNLLQ
FT                   QVQQLFDAQNTKVVQLTRSYRSTQQVTDFTKGLLKGGQAIEAFNRVGDKPNLIVRQSEA
FT                   ELVADVNRQLAANEADELSTAIITKTLVQAQELTKMLKETGTKVTLIRSENQRLAAGTL
FT                   VVPSFLAKGLEFDAIIGWQISAANYNHEDQRQLLYTICSRAMHRLTLLATDALSPLIDN
FT                   VDPEKYTLTK"
FT   regulatory      131624..131652
FT                   /locus_tag="LCA_0137"
FT                   /old_locus_tag="LSA0137"
FT                   /regulatory_class="terminator"
FT   regulatory      131704..131717
FT                   /gene="panK"
FT                   /locus_tag="LCA_0138"
FT                   /old_locus_tag="LSA0138"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        131721..132650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panK"
FT                   /locus_tag="LCA_0138"
FT                   /old_locus_tag="LSA0138"
FT                   /product="Pantothenate kinase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54435"
FT                   /db_xref="GOA:Q38ZE2"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZE2"
FT                   /protein_id="CAI54435.1"
FT                   /translation="MKNEMNYYEISREEWRYFHGRGEKYTAITDDELQQVSGLNDRISL
FT                   TDVSDIYVPLRHLLQMKYEQFRENQIKQSEFLEIKPHKTPFIIGIAGSVAVGKSTTARL
FT                   LQLLLSRVYPDKTVQMITTDGFLYSTSELKQKGILDKKGFPESYDMPQLISFLNAVKNN
FT                   VAPVKAPKYSHQIYDIIPDEFDIIDDPDILIVEGINVLQLPTTEQIYVSDFFDFSVYVD
FT                   ANPSLIEKWFLERFDLLLDLAKDDPTNYYYPYAISDRASAFKMARRVWRDIDLRNLNDY
FT                   ILPTRNRADLILHKTKHHLIDKVFLRKY"
FT   regulatory      132801..132814
FT                   /gene="guaA"
FT                   /locus_tag="LCA_0139"
FT                   /old_locus_tag="LSA0139"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        132817..134370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="LCA_0139"
FT                   /old_locus_tag="LSA0139"
FT                   /product="Guanosine monophosphate synthase (Glutamine
FT                   amidotransferase)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54436"
FT                   /db_xref="GOA:Q38ZE1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZE1"
FT                   /protein_id="CAI54436.1"
FT                   /translation="MAQKDMQDFDKIIVLDYGSQYNQLITRRIREFGIFSELLPNTTTA
FT                   AEIKKIAPKGIIFSGGPMSVYDGGAFSVDPEIFELGIPILGICYGMQLISFKNGGNVEA
FT                   STEREYGKAEITVTDKDSDLFKGLPEKQTVWMSHGDKVTAIPEGYVTVAESDNTPFTAI
FT                   ENRDKHIYGIQFHTEVQNTEFGNDILKNFAFGVCGAQDNWTMNDFIDMQIEKIREQVGD
FT                   KKVLLGLSGGVDSSVVGVLLHRAIGDQLVSIFVDHGLLRKGEVEQVMESLGGKFGLNII
FT                   QVDAKERFMSKLAGVSDPEKKRKIIGNEFIQVFDEEATKLNGIDFLAQGTLYTDIIESG
FT                   TSTATTIKSHHNVGGLPEDMQFSLIEPLNTLFKDEVRDLGEKLGMPYELVWRQPFPGPG
FT                   LGIRVLGEVTEDKLKIVRDSDLILREEFALAGLDKTVWQYFTVLPGIRSVGVMGDGRTY
FT                   DYTVGIRAVNSIDGMTADFSRIPWDILQKVSVRIVNEVDHVNRIVYDITSKPPSTVEWE
FT                   "
FT   regulatory      134386..134415
FT                   /gene="guaA"
FT                   /locus_tag="LCA_0139"
FT                   /old_locus_tag="LSA0139"
FT                   /regulatory_class="terminator"
FT   regulatory      134494..134507
FT                   /locus_tag="LCA_0140"
FT                   /old_locus_tag="LSA0140"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134511..135878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0140"
FT                   /old_locus_tag="LSA0140"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54437"
FT                   /db_xref="GOA:Q38ZE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZE0"
FT                   /protein_id="CAI54437.1"
FT                   /translation="MVNGKQLETSEKIKQGLVFAVTKLIQILPLIGLTMLHSGHTAASY
FT                   MPYILFYTALKTGLLFVNSLGHVQNSFKITSISMLLAAGALFVLAISPWLYLTDIAAFI
FT                   LGASASVIMPTYEGVYYHERVVWKWHLMGTEIKTLLAFSLVTVGLLTIASHFSYRFIFI
FT                   VIMLFVLIGFVGMQRFEPFVKQLDESVFVAQTKSLNNLELFVWATAMAFALRYLRLFEA
FT                   RFVWLLITVAVIGLVALVLRVIITRGTKTKMPGWLLIAALINGAFETFLMLYIFVAIQN
FT                   QGLMIGAYVTYGAGMILAQVIRKSVQGRFSKLSDLKVQLLGFVVGAWLMITPHLILLGI
FT                   LLISFFGSANSILLNHRAYYTGVTTPAQTLIVKYRNTYLGSILMQFILIIGLMGLAVMR
FT                   QQDMTTVIAQISGSVAMSDTTSQLIHLAGLISVGFLTLIAGLAGRYLPAMDENPLT"
FT   regulatory      135891..135909
FT                   /locus_tag="LCA_0140"
FT                   /old_locus_tag="LSA0140"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(135891..135909)
FT                   /gene="tnpA1-ISLsa1"
FT                   /locus_tag="LCA_0141"
FT                   /old_locus_tag="LSA0141"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(135980..136900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA1-ISLsa1"
FT                   /locus_tag="LCA_0141"
FT                   /old_locus_tag="LSA0141"
FT                   /product="Transposase of ISLsa1 (IS30 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54438"
FT                   /db_xref="GOA:Q38Z64"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z64"
FT                   /protein_id="CAI54438.1"
FT                   /translation="MGTSTLSRFQRGALAQLVNEGNKSYQVMADALGVAKATISYELDR
FT                   VKPYDPELAQQDADRKRRNCGRRSMLTAALATLITNHLRLTWSPETIAAAYNLSTASIY
FT                   NWLNRGWLPFKLTDLPNRNVRQHRVSENRGKFTSGTSIEQRPTTVNQRLAFGHWEVDTV
FT                   LSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGK
FT                   EFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAAL
FT                   ELINQRPLKIHHQQTAIERFRACSD"
FT   regulatory      complement(136903..136916)
FT                   /gene="tnpA1-ISLsa1"
FT                   /locus_tag="LCA_0141"
FT                   /old_locus_tag="LSA0141"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(137128..138399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0142"
FT                   /old_locus_tag="LSA0142"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54439"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD8"
FT                   /protein_id="CAI54439.1"
FT                   /translation="MTKANDAWTQLFDKYHILDQIDTNGIFNISAKQIKEFYEPRLITK
FT                   YDWSSSLPELFKKNKLVILPSSRGTYTIGRFKAYQKLKYENIRPIVKTLPSWVSTWDSF
FT                   GITSEAVALNVAKASGMIDHILMSDQNFPAIDTITGRLKSGDLNYKIAQRDGSLYDFHV
FT                   ANAQVEIDAGFESFDKLAIVEAKTHIPEDFIIRQLYHPFRVYNTLGTQKPVIPLYFTFA
FT                   DDIYTFYQYDFTDVNNYSSIKKVEQYSFILNRTLNLNSDVVKQISHQSPMLPESTEIVY
FT                   PQANTFQTVLDMMQYLATPIDKKTLAEKFNFDVRQSDYYANSLRFLGLAKREHSKYVLT
FT                   DLGQSINILPNSDFRNEKIIRQILSHITFKLVFDSYLKNNGESDDSYIDSVLAEYVPNI
FT                   SGKTIPRRRSTVKQWISWIFSVIE"
FT   regulatory      complement(138402..138415)
FT                   /locus_tag="LCA_0142"
FT                   /old_locus_tag="LSA0142"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(138418..139281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0143"
FT                   /old_locus_tag="LSA0143"
FT                   /product="Putative adenine-specific DNA methyltransferase"
FT                   /function="3.2 DNA restriction and modification"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54440"
FT                   /db_xref="GOA:Q38ZD7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD7"
FT                   /protein_id="CAI54440.1"
FT                   /translation="MNKNPLVKPFVKWAGGKRQLIPQITKYMPKTFGRYYEPFVGGGAV
FT                   FFQLQYNKSTINDFNTELFLAYNAVRDNIDELISNLKIHEANTSSDYYYEVREWDRNGI
FT                   IDTKSNVERAARFIFLNKTGFNGLFRVNSQNQINTPYGKYKNPAIVNEIVLRHVSKFLN
FT                   KSTIKIINGDFEDAVKGARRGDFIYFDPPYAPMVNDRQSFVGYTLNGFGADEQERLRDL
FT                   VDRLTAKGVKVMLSNSSVPYIHEIYANYKDTTVIVPASRSINSKATGRGKVDEVLIMNY
FT                   NYLDEN"
FT   regulatory      complement(139285..139298)
FT                   /locus_tag="LCA_0143"
FT                   /old_locus_tag="LSA0143"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(139565..140362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB1-IS1520"
FT                   /locus_tag="LCA_0144"
FT                   /old_locus_tag="LSA0144"
FT                   /product="Transposase (orfB) of IS1520 (IS3 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54441"
FT                   /db_xref="GOA:Q38Z57"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z57"
FT                   /protein_id="CAI54441.1"
FT                   /translation="MLEVVNANLLAGHRITRILSVLKIPRSTYYDYLHWQPSRTERRRH
FT                   LIKQEVLTAWLRYPMYGYPRLTILLNQQSDIHVSQRLVYQQMCELGIRSRMVKRINKPT
FT                   TQTDYDQRPNLIKQLTDQSGILLTDITYIPLNHTWCYLASVYNPVTRRVIAYQLNTQMT
FT                   KELATNVITQVMAQAVKPQIIHSDMGSQYTSDLFENTLSKYGIKHSYSRKGQPGDNARI
FT                   ESFHSILKREYVNFQDFKTIHEAIAGIDNYIRWYNSDRISLVA"
FT   regulatory      complement(140365..140378)
FT                   /gene="tnpB1-IS1520"
FT                   /locus_tag="LCA_0144"
FT                   /old_locus_tag="LSA0144"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(140383..140634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA1-IS1520"
FT                   /locus_tag="LCA_0145"
FT                   /old_locus_tag="LSA0145"
FT                   /product="Transposase (orfA) of IS1520 (IS3 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54442"
FT                   /db_xref="GOA:Q38ZD5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD5"
FT                   /protein_id="CAI54442.1"
FT                   /translation="MAIKYSNEFKESIVSLSQTGRSANSLAKEYNVSVSTVTKWIKQAD
FT                   PNNTKVLSSNERALIKENKRLKEELDILKRAAVLMAKS"
FT   regulatory      complement(140638..140651)
FT                   /gene="tnpA1-IS1520"
FT                   /locus_tag="LCA_0145"
FT                   /old_locus_tag="LSA0145"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        140791..141576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0146"
FT                   /old_locus_tag="LSA0146"
FT                   /product="Putative adenine-specifique DNA
FT                   methyltransferase"
FT                   /function="3.2 DNA restriction and modification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54443"
FT                   /db_xref="GOA:Q38ZD4"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD4"
FT                   /protein_id="CAI54443.1"
FT                   /translation="MVIIMKQVYKDELVKLICSDTFECMQRFPSNSVDVIIADPPYFLS
FT                   NGGFSNSGGKMVSVNKGEWDKINDVKPEVFYTRLIRSADRILKKDGTIWVFGSMHNIYI
FT                   LGYLLPKYGFKILNNITWQKSNPAPNLSKRMFTHSTETIIWAKKESGKQFFNYDLMKEL
FT                   NHSSQMKDVWTTPTINNYERRFGRHPTQKPLSVIDRMVKASTDSGMILLDPFVGSGTTA
FT                   VAGARNGIRTIGIDNSQDYLNIAIKRVSNFQEEKLGKIK"
FT   regulatory      141590..141609
FT                   /locus_tag="LCA_0146"
FT                   /old_locus_tag="LSA0146"
FT                   /regulatory_class="terminator"
FT   regulatory      142092..142105
FT                   /locus_tag="LCA_0147"
FT                   /old_locus_tag="LSA0147"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142108..143862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0147"
FT                   /old_locus_tag="LSA0147"
FT                   /product="Putative DNA-repair helicase"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54444"
FT                   /db_xref="GOA:Q38ZD3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD3"
FT                   /protein_id="CAI54444.1"
FT                   /translation="MEVRVIVPNNNLGLFHEKIALFYDELGDTIAINGSNNETQGSVEH
FT                   NLESFSTFRSWINGQELYIDTFKEQFEDTWQGNLNEYHMLSLQEAVDDDVLREYETDES
FT                   IKTLYSKLSRHGGLEKQNEPKNETERLGFDPYDYQKVAAETWMEKSKGIIAFATGTGKT
FT                   KTAIYAFDQLMKKEGAKVFLITVPDKTLVEQWSKELLNYWGNLVKCYSENNQWVNQLKN
FT                   KIDYWKLEPDEPLFIVTTNQTFHGEKFTRQIKKLNKDYVFLADECHRLGTDNLLNSLPS
FT                   VERRLGLSATPSIYMSEEKTDRLFNYFGGIIAEYSLEKAIEDGKLTQYEYHPVKVRLSD
FT                   DEMEKYKELTHKIVKMLGNDDENSLEGLSLEAQMLLFKRARIIYGAYDKIIKLESLLDK
FT                   LKDQRNMLIYCGATSLSEGIAGDDEGNELDQSNTEASKKQIEIVNQMLKGKGILAAQYT
FT                   KDENGNERQDRIDAFKNGVIDTLVAIKALDEGVDIPEISIGIIMASSGNPREFIQRRGR
FT                   LLRKSAGKEIAIIYDMVVLGEESEYDGINMTELKRIGEFSKAAKNRNEILDEYQELFDR
FT                   YLEEKEDE"
FT   regulatory      143991..144004
FT                   /locus_tag="LCA_0148"
FT                   /old_locus_tag="LSA0148"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144009..146051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0148"
FT                   /old_locus_tag="LSA0148"
FT                   /product="Putative DNA-repair ATPase"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54445"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD2"
FT                   /protein_id="CAI54445.1"
FT                   /translation="MIFKELKLINFRQFKGENKFVFPINDRKITLIIARNGVGKTTFLQ
FT                   AFRFCFYGESPNVLKLPKSEELLNYSVENDMSEMDEQPLSVQVKFQHNGKDYIAVRTVR
FT                   FRMFNRKMQKLTKNSDDSFELWEETENRGAIKVEDGLKRIQEMIPTGLAHVYMFDGERV
FT                   EKPIGSTEFKNDLKDSIVGVLGLKKLEQARDFLGNKSKSGSVIGQVHAKLVPIGSTEQE
FT                   VLDRYASAEENITQLKQEIVIRQNQVESLTKDIEVATEAQKSIEKLELLVQVKKIAESK
FT                   ISAQEREIEELRRRANDCAVELLLKLEVAKTYKKYEKFIAKEEEQTEVFENLYQSVVED
FT                   ILRRHKCICGREVHTGSIEAEHLRELSVLPQDNANYLNALRSLYNSLANLPSLRKSITK
FT                   YHNQLVLAKKKLEELRKEGEHAIEKVIKKEEEIGAKNQVDIEHLRATKARILYNIDINE
FT                   KSIESNQRVVNELSSELKKIQFNSQHNRNVNASLKMLNQLKLEIEEELDNKKNIARESI
FT                   EKNMNLVLTEVMDQHYEVELDSEYKLTVYKKVDDKRLQDETEVLSTGQNVMMYLSFLKA
FT                   LLMTVEQHAEFDDIQSSGVIMDAALSNLDEEHIKQISSRILNSFDQLIFLSFKAQLRNE
FT                   LITGIHNNISCAYELSKDMMGNVVSRIIDTNNVEEYVNEDDEINE"
FT   CDS_pept        146044..146589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0149"
FT                   /old_locus_tag="LSA0149"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54446"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD1"
FT                   /protein_id="CAI54446.1"
FT                   /translation="MSNNMMNPTDFSFYYQTEEYTRSDNFLSNHGLSGEGVQFLTALLG
FT                   INNSSKIALDNRPNGEVKKRSLSRTVYQRAMVEMDRDFGLLTIIDSLNEPYTEVLNKKA
FT                   FLKNTNGERYFELPNVSTFYQYFLGGIEYVDEIIFQYGDKEEDIFDSIYEYLTDKENKQ
FT                   IMDDFIDELGGEIDEPRI"
FT   regulatory      146754..146777
FT                   /locus_tag="LCA_0149"
FT                   /old_locus_tag="LSA0149"
FT                   /regulatory_class="terminator"
FT   regulatory      146825..146838
FT                   /locus_tag="LCA_0150"
FT                   /old_locus_tag="LSA0150"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146840..147691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0150"
FT                   /old_locus_tag="LSA0150"
FT                   /product="Putative deacetylase (acetyl esterase)"
FT                   /function="4.2 Detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54447"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD0"
FT                   /protein_id="CAI54447.1"
FT                   /translation="MMKSILLVGQSNMAGRGFIQDVPGLRHERVKMLRNGRWQMMAEPI
FT                   HFDREVAGVGPAASFAAAWVQAHPDEELGLIPCAEGGSSIDEWASDEMLMRHAIAEAKF
FT                   AQESSELIGVLWHQGESDSLKGGYQTYAAKLTAVFSHLRQALGQADLPIIVGQLPDFLG
FT                   QEGFGASATEFNDINREMANVVAQDPHSYLVNAAELTANPDGIHIDAASQRRFGLRYYA
FT                   AFANQEDVLAVLPDEAAQLGVLYQRPETPQEKMYRLSRAFALGQMSYPEFIAQLTGKGT
FT                   AK"
FT   CDS_pept        147688..148206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0151"
FT                   /old_locus_tag="LSA0151"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54448"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC9"
FT                   /protein_id="CAI54448.1"
FT                   /translation="MIQFLILGLLKKKPGAYGYELLADMENNYFEFFLNFTKGSFYYNL
FT                   QQLAEKQLIEKIVDDASDKREKNRYVLTAGGEAAFEKQFAHYGGQNKPITFPFYTPLLF
FT                   TDQVEPTQMRELLQSQIAQTKEKIQAIEAALNTATNLQPMFIKMMANSKRHHEVNLEWL
FT                   QEQLAEGIQ"
FT   regulatory      148387..148426
FT                   /locus_tag="LCA_0151"
FT                   /old_locus_tag="LSA0151"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(148387..148426)
FT                   /locus_tag="LCA_0152"
FT                   /old_locus_tag="LSA0152"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(148432..149178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0152"
FT                   /old_locus_tag="LSA0152"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54449"
FT                   /db_xref="GOA:Q38ZC8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC8"
FT                   /protein_id="CAI54449.1"
FT                   /translation="MSFTQLSFTLILIGVAAGIVSTVGGLASLVSYPALLALGLPPVTA
FT                   NVTNTAGLIFTGVGASLASRKELKHQKRELITLLPLTLIGCIVGALLLFKIPAETFQKI
FT                   VPFFILSAGILILLPRHLQVGQPAKWQVSLAWLGVFLVGIYSGYFGAASGVLMLSLLSV
FT                   ISQAPFQEYNATKNLTMGLANCIATLVYALQTTINWGLVLPLGIGFLIGGLIGPIIVRL
FT                   LPERLTKIGIGIAALGLAVSLFMQTY"
FT   regulatory      complement(149183..149196)
FT                   /locus_tag="LCA_0152"
FT                   /old_locus_tag="LSA0152"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(149220..149543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0153"
FT                   /old_locus_tag="LSA0153"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54450"
FT                   /db_xref="GOA:Q38ZC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC7"
FT                   /protein_id="CAI54450.1"
FT                   /translation="MKQLIMLILIMLLAVFIFLDLHFKHNKSRAYQNDERWQLITIKAA
FT                   KVMAIFLDSIVILLALAMTYFLLTDGGSEMMTISDAVSDAFYIYALKYPVEYCAYRYYD
FT                   QVL"
FT   CDS_pept        complement(149540..149746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0154"
FT                   /old_locus_tag="LSA0154"
FT                   /product="Putative DNA-binding protein, XRE family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54451"
FT                   /db_xref="GOA:Q38ZC6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC6"
FT                   /protein_id="CAI54451.1"
FT                   /translation="MIQNRIKVLRAERNWTQADLAERTGISRQAVISIEKYKYTPSLEL
FT                   AFKIAQVFGVEITTVFSPEEDSK"
FT   regulatory      complement(149749..149762)
FT                   /locus_tag="LCA_0154"
FT                   /old_locus_tag="LSA0154"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      149897..149910
FT                   /locus_tag="LCA_0155"
FT                   /old_locus_tag="LSA0155"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149914..150567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0155"
FT                   /old_locus_tag="LSA0155"
FT                   /product="Putative hydrolase, haloacid dehalogenase-like
FT                   family"
FT                   /function="2 Intermediary metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54452"
FT                   /db_xref="GOA:Q38ZC5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC5"
FT                   /protein_id="CAI54452.1"
FT                   /translation="MIKLITFDCYGTLVDTAPFYEAAGEIGVQHQIDRGLFQKAFELYE
FT                   DRMMYGEYFMPYEQVIEQALRYCAHDFNYEYENADLTQMLTVQANLKVFPEVIDFLKTM
FT                   KAKGIQLGIMTDASLPILKQNLAQIPVEFDYLYTSDQLNCYKPTLNFFGQVADQLMVTN
FT                   EEHLHIAAGYWWDIIPCQHLNWQRIWVNRKQAQALPTTVMQHEVADLTAAIDLI"
FT   regulatory      150580..150614
FT                   /locus_tag="LCA_0155"
FT                   /old_locus_tag="LSA0155"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(150580..150614)
FT                   /locus_tag="LCA_0156"
FT                   /old_locus_tag="LSA0156"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(150620..151915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0156"
FT                   /old_locus_tag="LSA0156"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54453"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38ZC4"
FT                   /protein_id="CAI54453.1"
FT                   /translation="MSLQSKHFIQALKNGVVPATGCTEPIAVAFGAATCMAQLTNREIQ
FT                   AIEVHVSPNVMKNALAVMVPGTGEPGLLVAAAAGAIAGDATVGLSVIEGLRATDLPTIL
FT                   DLAHSGKVTAKTALVPDDLYVEVTIKDLENTVTVAIAGSHTNIFSLKKDDQILIDHPRP
FT                   AAHASSESKQFLQTMNFKAVWDFAMNEPLEHLRFMKEAHTLNLALAQDGFTHDYGLQLG
FT                   QSINGAKRNHFGSGTENDLGNRMIAYAAAASDARMGGAQLPAMSNSGSGNQGITATIPV
FT                   SVAADAVQATEEQLIRAQALSHLTALYIHSFLPVLSAFCATDSAAMGAAAGVVYLYDGT
FT                   YEDACHAIQNMAGDAAGMICDGAGCACAMKVATAVSSMYRGVNLALQGIVIPNSNGIVC
FT                   PTIDETIHGIGRLGTEGLRETDPVILDIMLNK"
FT   regulatory      complement(151918..151931)
FT                   /locus_tag="LCA_0156"
FT                   /old_locus_tag="LSA0156"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(151939..153264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0157"
FT                   /old_locus_tag="LSA0157"
FT                   /product="Putative hydroxyl/aromatic amino acid symporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54454"
FT                   /db_xref="GOA:Q38ZC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC3"
FT                   /protein_id="CAI54454.1"
FT                   /translation="METTTQSTPHLSRSQKHADKAGMSLTEWQAATKFDGTDWGWVFMS
FT                   IGMAIGAGIVFLPVKVGLVGLWVFLVSAVIAYPAMYLFQKLFINTLAESEKCEDYPSVI
FT                   SGYLGKTWGFLLGVLYFLMLLIWVFVYSTAITNDSASFLHSFHVTKTVWSNNPFYGLIV
FT                   ICLLVAIASRAEKLLFKISSFMVCTKLIIVFVLGVVMIQHWDLRNVAAFPDLGYLIKQT
FT                   IILLPFTLTSILFLQSLSPMVISFRSHNKNIEVARYKSIRAMNIAFFTLFFVVFFYAIS
FT                   FNLALGHDQAVEAYEKNISTLAIAAQNMNGNSIKILSFILNIFAVMTAFFGVFLGFHEA
FT                   CQGIAVNILHRIMPKHKINKKNLSFGILIFAILVSWSAILLNAPVLSFTSLCSPIFGMI
FT                   GCLIPVYLVYRVPALNKLKGPSLYLIVFTGILLMISPFLAFI"
FT   regulatory      complement(153267..153280)
FT                   /locus_tag="LCA_0157"
FT                   /old_locus_tag="LSA0157"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(153311..153400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0158"
FT                   /old_locus_tag="LSA0158"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54455"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC2"
FT                   /protein_id="CAI54455.1"
FT                   /translation="MIKNRLLILDKLNISVVSITFKKWRHYSK"
FT   regulatory      complement(153403..153416)
FT                   /locus_tag="LCA_0158"
FT                   /old_locus_tag="LSA0158"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      153543..153556
FT                   /locus_tag="LCA_0159"
FT                   /old_locus_tag="LSA0159"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153561..154238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0159"
FT                   /old_locus_tag="LSA0159"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54456"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC1"
FT                   /protein_id="CAI54456.1"
FT                   /translation="MVSELERYQGLVHFLGQVLGSNYEVVLHWINQDDSYYIAAIENAE
FT                   ISGRNLNSPITGFALDLIRNKIYQKQDAVVNYKASSDKNQQIQGSTYFIKDDQGVLLGL
FT                   LCINFNAQPYLAAVDNLINLANLDSLMASVPTVASEHQQQRQVVTNEEVLHSSVEEIIY
FT                   AVVAPNTLQPGIKLTQDKKIEICRKLNEKGIFKIKGALSKVAEILGTSEPSIYRYLKLI
FT                   NQS"
FT   regulatory      154247..154275
FT                   /locus_tag="LCA_0159"
FT                   /old_locus_tag="LSA0159"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(154248..154274)
FT                   /locus_tag="LCA_0160"
FT                   /old_locus_tag="LSA0160"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(154294..155211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0160"
FT                   /old_locus_tag="LSA0160"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54457"
FT                   /db_xref="GOA:Q38ZC0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZC0"
FT                   /protein_id="CAI54457.1"
FT                   /translation="MQTILGSSGQIGQELAKELYKNYTHDIRLVSRNPRKVNPEDQLSP
FT                   ANLLNFEETNQAVAGSEIVYFTAGLPMNSDMWTVQFPIMIDNVIRACQINHSKLVFFDN
FT                   TYMYAKNATPQTENSPFQPDGQKATARAKMAQTVIDAMQAGQIETVICRAPEFYGPAKT
FT                   NSITNTLLFNKIKAGQKARIPVSDQFLRTLIWTPDASRAMALIGNTPDAYGQTWHLPCA
FT                   DSITYKGLVELIQEITYQPISYSIIKMWQFKLASFFNQNSRELQELLPRYQADNIFVSD
FT                   KFKTRFPEFKITSFEEGIREILTV"
FT   CDS_pept        complement(155224..155556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0161"
FT                   /old_locus_tag="LSA0161"
FT                   /product="Putative transcriptional regulator, ArsR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54458"
FT                   /db_xref="GOA:Q38ZB9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB9"
FT                   /protein_id="CAI54458.1"
FT                   /translation="MPNYKALQQDLTDVSQFLIALGDPKRQAIIIRLLEESDCDGLQVS
FT                   ELTEATGLSRPAVSHHLKVLKDAKLIDYRAEGTKNFYYLNHDTTEIVKLKQFLDKVTQI
FT                   MTTHTK"
FT   regulatory      complement(155559..155572)
FT                   /locus_tag="LCA_0161"
FT                   /old_locus_tag="LSA0161"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(155653..155679)
FT                   /locus_tag="LCA_0162"
FT                   /old_locus_tag="LSA0162"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(155691..157391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0162"
FT                   /old_locus_tag="LSA0162"
FT                   /product="Putative Bifunctional glycosyl transferase,
FT                   family 8"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54459"
FT                   /db_xref="GOA:Q38ZB8"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB8"
FT                   /protein_id="CAI54459.1"
FT                   /translation="MIIKTINVMFAADNNYADQLLIAIKSILAHIPAETTVHFLILDNE
FT                   LTPQTKCLVRQITKQSHQVDFIKINQQLLKNCPESNHINKTAYYRILAPQILLRKGISR
FT                   VLYLDVDILVQTDITPLYESHLGTNIVGAIIDPGQALALPRLGVSPEKSGNIYFNSGVM
FT                   LIDTFRWEENQISELTLRFINQHPERIIFHDQDALNAILAGKVQLLHPAWNVQNSLIFR
FT                   KHQPINATYKKLFDEAIAQPKIVHFTTHNKPWNTLKGHPFLAQYQAYSQQLGALKKDSI
FT                   NIVSAVNAAFIEPLAILYASILNHNDTQRRYSFYVLEDHLTEADKIPLKQVVAAFNADL
FT                   TFLKVDEALLANIVESDRILKSAYYRILIPQVLNGIDRALYLDCDALCNVNLERLWNID
FT                   LGEFPLAAVEDAGFHQRLEKMAIKCHSTRYFNSGMMLMDLKKWRQQAITEKTLDFINHH
FT                   PEKLRFHDQDALNAVLHDQWLHLHPKWNAQTNIIMDKTTPPQHLQQQFIEAKKAPAIVH
FT                   FCGHEKPWHAVSTHPFTPQYRYYRHRFLKPKRQASIIPFSKNTQISLEN"
FT   regulatory      157547..157560
FT                   /locus_tag="LCA_0163"
FT                   /old_locus_tag="LSA0163"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157562..157816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0163"
FT                   /old_locus_tag="LSA0163"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54460"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB7"
FT                   /protein_id="CAI54460.1"
FT                   /translation="MLKEVPINKVRLGRSTVKTPDLSLMIEKQESKLNCFLEGVTDLEL
FT                   AILKANNGEALLEGKWGPLAVDRVGNVIKNQTIKPYIQQ"
FT   regulatory      157852..157865
FT                   /locus_tag="LCA_0164"
FT                   /old_locus_tag="LSA0164"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157869..158657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0164"
FT                   /old_locus_tag="LSA0164"
FT                   /product="Putative serine/tyrosine protein phosphatase"
FT                   /function="4.6 Miscellaneous"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54461"
FT                   /db_xref="GOA:Q38ZB6"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB6"
FT                   /protein_id="CAI54461.1"
FT                   /translation="MVSRILPIENGHNFRELGGYQTLDGKTLKTKRLLRTANLADLSPK
FT                   DLALLNSYNVSVDIDLRSKDERQQAPDKVPVSAKYKSVPIFKEDQTESTTTEAELYQRY
FT                   TNNPLGGQMQMQKVYQELVQDEHSIKMYRQFFEILLQQSADNQATLFHCTGGKDRTGMA
FT                   AYYLLNALNVPEPVIRQDYLLTNTASQQHIAQRMSRLAAKHASSGFIKSTHALMSVQSA
FT                   YLDTATTTIKQNWGSTQNYLQTALKLSKSDINQLRATYLN"
FT   regulatory      158660..158673
FT                   /locus_tag="LCA_0165"
FT                   /old_locus_tag="LSA0165"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        158677..159567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0165"
FT                   /old_locus_tag="LSA0165"
FT                   /product="Putative oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54462"
FT                   /db_xref="GOA:Q38ZB5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB5"
FT                   /protein_id="CAI54462.1"
FT                   /translation="MVKADLKDPRELYKVSGFEEQEQPAPALQGKMRPKPDCGEADYQG
FT                   REQLMNRKVLITGGDSGIGRAVAIAFSREGADIALQYLPGEESDANEVAGLIESAGRKA
FT                   VLIPADYKMQEAPQQVVAQAVAQLGGLDTVVLNAAQQIAHPTLEDLPIQQVRDSFEINV
FT                   VAMYGIAKAAIAHIPAGGSILTTTSIQGFNPSSQLLDYAATKAAIRNFTINLAQQLADK
FT                   GIRVNGVAPGPIWTPLQLAQGQLEGALPKFGQNTLLKRAGQPVEVAPVYVFLASNAASY
FT                   ITGQIYGVTGGESIN"
FT   regulatory      159695..159708
FT                   /locus_tag="LCA_0166"
FT                   /old_locus_tag="LSA0166"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159710..159961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0166"
FT                   /old_locus_tag="LSA0166"
FT                   /product="Hypothetical Integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54463"
FT                   /db_xref="GOA:Q38ZB4"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB4"
FT                   /protein_id="CAI54463.1"
FT                   /translation="MLHWLWVLIIGALIGIIAGAITSRDLPAGWIGNIVGGLVGAWLGQ
FT                   SLFGSWGPQLAGMALVPSILGAVIIVFLVSMLFSRKKS"
FT   regulatory      159964..159977
FT                   /locus_tag="LCA_0167"
FT                   /old_locus_tag="LSA0167"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159980..160537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0167"
FT                   /old_locus_tag="LSA0167"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54464"
FT                   /db_xref="GOA:Q38ZB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB3"
FT                   /protein_id="CAI54464.1"
FT                   /translation="MNKLTKTVIGLASFLGLCQVAWFILLVYPLGLADQQAINFNWLSE
FT                   EWISNIGLGLGVISGLVFLYLLLLAIFSLPKKRQMIIKTNQGELALSRKAVEKTISQAI
FT                   IEKHRLKDVYVQTVFKGRQPKVSADIQAKVLDNRDIDQQARAVKETAQQALKEVFDMPI
FT                   KSVNVKLAPLVHDQGRTQSKVI"
FT   CDS_pept        160548..160742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0168"
FT                   /old_locus_tag="LSA0168"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54465"
FT                   /db_xref="GOA:Q38ZB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB2"
FT                   /protein_id="CAI54465.1"
FT                   /translation="MKRSYWGFIAGAALAAIWIGFGFVSLILILIAGLIGYIAASLTGS
FT                   KDDLEGFRAQVNRVLRQDK"
FT   CDS_pept        160758..161186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0169"
FT                   /old_locus_tag="LSA0169"
FT                   /product="Putative general stress protein"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54466"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB1"
FT                   /protein_id="CAI54466.1"
FT                   /translation="MVEQAHLDDVLANSKLTFEDAVIAKIAGKTAQNIDGLLSMNGNFF
FT                   SDIADRFRTDSDPTKGISVEVGEKQVAIDMTIILEYGRNARDVFERLTSAVTEAVESMT
FT                   GLSVVEVNSHVSDVMTKKEWQQQGSNAKKSDNDDKRVQ"
FT   regulatory      161196..161209
FT                   /locus_tag="LCA_0170"
FT                   /old_locus_tag="LSA0170"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161213..161674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0170"
FT                   /old_locus_tag="LSA0170"
FT                   /product="Putative general stress protein"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54467"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZB0"
FT                   /protein_id="CAI54467.1"
FT                   /translation="MDKPNKPMDKMMDKPNKETPDHNAQIEKELNFSDGVIEKIAGQTV
FT                   HDIDGVLELSGGMMSQLADRFRDEADPTKGVDADIDDQEVTIELDAILEYGKSAPDIFE
FT                   QTTDQIAKSVHKMTGLNVTKIKMNVSDLLTKKEWAAKQEAGKKDNKDNE"
FT   regulatory      161680..161703
FT                   /locus_tag="LCA_0170"
FT                   /old_locus_tag="LSA0170"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(161680..161703)
FT                   /gene="katA"
FT                   /locus_tag="LCA_0171"
FT                   /old_locus_tag="LSA0171"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(161722..163161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="LCA_0171"
FT                   /old_locus_tag="LSA0171"
FT                   /product="Catalase"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54468"
FT                   /db_xref="GOA:Q38ZA9"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA9"
FT                   /protein_id="CAI54468.1"
FT                   /translation="MTNQLTTNEGQPWADNQHSQTAGQRGPVLIQDYQLLEKLAHFNRE
FT                   RIPERVVHAKGAGAKGYFKVTKDMSAYTKAAVFSGVGKKTPLITRFSQVAGEAGYPDTY
FT                   RDVRGFAVKFYTEEGNYDIVGNNTPVFFVNDPLKFPDFIHSQKRDPRTHARSQDMQWDF
FT                   WSLSPESVHQVTILMSDRGIPASYRMMHGFGSHTFKWVNAQGEQFWVKYHFKTNQGVHN
FT                   LSNELADELAGKDTDYLQNDLFDAIETGDYPSWTVAVQLVPYEDGLNYPQDIFDVTKVI
FT                   SQKDYPLIEIGQMVLDENPTNNFEDIEELAFSPANLVPGIEASPDKLLQGRLFGYKDAE
FT                   RYRLGANYEQLPINRPKVPVHNYERDGVMAQKQETGVNYEPNSQDGPTEVPAAKIHSDQ
FT                   LSGTTGNFSTDPDYYSAAGKLYRLLSADEQTRLIENIRMNLGQVTKPEIQIREVKQFYQ
FT                   ADPEYGRRAATALNLDLAQFE"
FT   regulatory      complement(163166..163179)
FT                   /gene="katA"
FT                   /locus_tag="LCA_0171"
FT                   /old_locus_tag="LSA0171"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      163824..163837
FT                   /locus_tag="LCA_0172"
FT                   /old_locus_tag="LSA0172"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163840..167751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0172"
FT                   /old_locus_tag="LSA0172"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54469"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA8"
FT                   /protein_id="CAI54469.1"
FT                   /translation="MFSLALLAVMGIQLVVTTGTILAENSIKVDSNLALTSDQELSNEK
FT                   QIVIRASDQSKAQRDLALTIPEGATFDRTTSNQLNKKSAYTATLDQKNNSNQVILKQTA
FT                   QTAENIENDLVNRQATTFKKEYLLVFKLKDTGISAKQQLKVTTIMNGIRYESKPLLLKE
FT                   VVGTDGVQRQTSLTKEGEPQITFNLNQTEYIVGDTIQLKVDLDASEINEPFYINLGNKA
FT                   ILTPIKVSSDNRNINFESQNNQNTGKNILKISSNEPIKKDFTLLVKATTVGKVDITAST
FT                   ETDHLISKTATVKVVDNPTSKVLAINPNTFDDGIPNWVQKTKTEVGSKSFQRSTSRFLN
FT                   YTFGGVNGGIDAEADSKISSYNIQGSQINIFIKDNNKTIGAFFKGEDTSSKAVRTSTGF
FT                   GIVFEPNESNDGPKQAILANKLTNKAYCVGHDSEGNLVSKIIGQFERNGKTLIAEILLR
FT                   PSLSGTTAVQQELYLKNDTTQSVSYGTFIGQDTMLNGNDKVPMSSMGNNAGLYITQNPY
FT                   KLAINMKVPDGPINYAAQTWTRRNPWFDGFTPRNFSGTGLEQKNLEEGYTVLKNSDTSY
FT                   TAKWPFATLAPGESQHYRQDIGITKAPDVAPEAYKEYQNETSTDGSNRPGDNIKFTLRA
FT                   HNSGLDSSWSDVSFSDIIPSEFQINTNSIRLINKSGQEITISPSAYNEVTRELKVTVPN
FT                   SVKDNQWVSVTFEAKALTTASGRTVRNTVNVVGIDSNVNQQERSASAIVDVPFIKVQLP
FT                   ELTKKVKNISRLDAKYATETEASIGDEIGYKLVFTNTNSEEVPEAIIEDPLDSDLDEPS
FT                   AVHVSYKDSNGSEVRSEDLTFTGNQLILKAIPADGSVVLTFETILKDTKKTVINNIAMV
FT                   ADVKSNVAKVNVIKKTPPTLIKEVKNITKSDADYMTETTAEVDDEIEYRIQIVNTASGD
FT                   IKPGAILKDVFDADLGDIQQVRIDYLDKDEKIIAKQTTDWTDNQVILDHGIPIAGQGMA
FT                   IAYVKAKVKETNKSVINNSVSLDTDFGAGASEKAKLNIKQSKGRIVVRYRDRKDESHKL
FT                   AEDETFDGKIGNTRLVQPKVIPETDGNWTVVDSSNMVDPDWGSTTKPDWTLAHDHTVTY
FT                   AKDEQVITYRYEESHIGIIADKRWDFGKHDTTGTDRNYYLKAKTKDNQKQPYAVSVEDY
FT                   YTSKGWTLNVKQDDQFHTNANEKIAGDQKFLDNAVLNFHNGQIVLKESDDVGATAPVSK
FT                   VTSEFELTPKGAAVNLMTHTNKTPNPGYYAAHGFGIWAYQFGDAQQADYSIGLKVPKAT
FT                   KRFPRQYTSQLTWSLVIAE"
FT   regulatory      167753..167766
FT                   /locus_tag="LCA_0173"
FT                   /old_locus_tag="LSA0173"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        167771..168550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0173"
FT                   /old_locus_tag="LSA0173"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54470"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA7"
FT                   /protein_id="CAI54470.1"
FT                   /translation="MKFVRRLMALSLAFVGLMLCQMTQVQAAAQTQKADFEVQPILPDE
FT                   QEDLSLNYFNMSLAQGQTKKIEMRIQNFTDHAITVHSDLRNSMTQVGGGVSFQANTKGL
FT                   DPSLKVPFTKIAKLDKKSETIKLAAQETKILKMTVKMPEDRTNGMIYGDWHFIEYLHKK
FT                   GGQSSVGSNYAYSVGVALKGQHYKVYPELKYDKTEAMIYRRHAAMGIKIRNTQPMVINK
FT                   VSAKAVVSKEGLFSSKHVYTTSNQSVAPNSVLTLPQC"
FT   CDS_pept        168544..168816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0174"
FT                   /old_locus_tag="LSA0174"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54471"
FT                   /db_xref="GOA:Q38ZA6"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA6"
FT                   /protein_id="CAI54471.1"
FT                   /translation="MLTLPISWDYEQLKPGKYTIDTVVHGQNLWNKLPLTWRFKKSFTI
FT                   KADDVKTVNAQALKKPKNKWAYVATARGVLMLVSITGLIKVLRRS"
FT   CDS_pept        168813..169841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0175"
FT                   /old_locus_tag="LSA0175"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54472"
FT                   /db_xref="GOA:Q38ZA5"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA5"
FT                   /protein_id="CAI54472.1"
FT                   /translation="MKKRYLIISIMLAFWGLMRQATPQLVTAATADAKQKVTFMIYPEI
FT                   PKDNLGGNKLGYFNLKLKPNTEKTLKIKAFNPTNKPIKVKVSAKDAQTADDGRIDYLSD
FT                   DPVSKQLLPEPGSQYVHFKLQVVVPANTQKWVNVNVKMPDTAFKGKKAFAINLAAMGPT
FT                   GGSISNRYVYAVGVTLNGIKLPRKELHHLQMPTMQTGFVDKKAALQFKVNNPDPIFLKK
FT                   GQLSTKLTNQKLGFFNYKLDLKKMHIAPNSSFNANLLLGGKRLVPGRYTMIADFKSDQY
FT                   QREIKKTVQITKTDARYINDHNVAYQKKRQLTIIVISVCVVLGVILIYYIRKHGSRESK
FT                   ND"
FT   CDS_pept        169813..169989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0176"
FT                   /old_locus_tag="LSA0176"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54473"
FT                   /db_xref="GOA:Q38ZA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA4"
FT                   /protein_id="CAI54473.1"
FT                   /translation="MEVGSQRMINKLIDKYHYSTVKYTFIALTTLTTILFLVSLAFAIV
FT                   SYINFNTYTTLTM"
FT   regulatory      170145..170158
FT                   /locus_tag="LCA_0177"
FT                   /old_locus_tag="LSA0177"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        170162..171046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0177"
FT                   /old_locus_tag="LSA0177"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54474"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA3"
FT                   /protein_id="CAI54474.1"
FT                   /translation="MKFTKLTSAALTAGTILSILAPTATFAATAEHDANANGGTELPMS
FT                   DNTEVGISFGDNTDNGNTGYLRLQMVPHVLDFGNHTEFLSQYPTFDATGHNVSIDSNDR
FT                   HASYKNTDTNMTAILNTDDAKLSEVKGKAWATVVDKRITRENNDPEGETAKTTKQSGTW
FT                   QLKVKSDDVLTATKNGETINNANLLLKNTAYGRTADVFTLTNDAQDSDFQADPTIDDKD
FT                   VSTITNNVSLSLDGKGEEVLVADAADSEGQGANVFGWDHSDINLTLPKDSKVGNDIYTA
FT                   HLTWTLYTGVQAS"
FT   regulatory      171066..171087
FT                   /locus_tag="LCA_0177"
FT                   /old_locus_tag="LSA0177"
FT                   /regulatory_class="terminator"
FT   regulatory      171139..171152
FT                   /locus_tag="LCA_0178"
FT                   /old_locus_tag="LSA0178"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        171157..171573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0178"
FT                   /old_locus_tag="LSA0178"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54475"
FT                   /db_xref="GOA:Q38ZA2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA2"
FT                   /protein_id="CAI54475.1"
FT                   /translation="MSKNTLAFYEAVQMLDNTRRALNEPCEAYHISFEQFVLMKRIAAA
FT                   GGVRPTILSEDLHISRAAVSRKLTQLYYSDYLAKERSGVNEDQRVVIISLTPTGEEVVK
FT                   KIDKFYKSKLTTLIDPIEEIQATAKIFETLSQID"
FT   regulatory      171587..171618
FT                   /locus_tag="LCA_0178"
FT                   /old_locus_tag="LSA0178"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(171587..171618)
FT                   /gene="pepD1"
FT                   /locus_tag="LCA_0179"
FT                   /old_locus_tag="LSA0179"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(171633..173039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD1"
FT                   /locus_tag="LCA_0179"
FT                   /old_locus_tag="LSA0179"
FT                   /product="Dipeptidase D-type (U34 family)"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54476"
FT                   /db_xref="GOA:Q38ZA1"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA1"
FT                   /protein_id="CAI54476.1"
FT                   /translation="MKKPIKGSCTTVLVGKKASIDGSTMISRNDDGHEALDPQRFVVVN
FT                   PEDQPRDYQAVISGVQIKLPDNPMRYTSIPNSLLTNGIWPAAGINSENVTMSATETITT
FT                   NPRIQGLDPLVAGGIGEEDIVTLVLPYIHSAQEGVERLGALLEEFGTYEPNGIAFSDQD
FT                   SVWWLETIGGHHWAAVRIPDDAYVVAPNRMNINHFAFGSDNTLCSADLKALIDDNHLNP
FT                   DFEGYNLRHIFGSATIKDTVYNNPRTWYGQQYFNPEIKQDPMDHDLPFICHANRKISIE
FT                   DVKFVLSAHFENTEYDPYGSAPEDVKTRFRPIGINRNHNVHILQVRNNVPAEIAGIHWL
FT                   AYGANTFNTVVPFYANVNDTPESYKNATGTFDLNNMYWLSCTTALLGDTDYDFYVDMRN
FT                   TFELEAMSAYHEIQNATDKAFDGQKDAVAFLEEANNKLATESLQRQTKLLGEMVISGSE
FT                   HMKLRYNLND"
FT   regulatory      complement(173044..173057)
FT                   /gene="pepD1"
FT                   /locus_tag="LCA_0179"
FT                   /old_locus_tag="LSA0179"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      173241..173254
FT                   /gene="mtsC"
FT                   /locus_tag="LCA_0180"
FT                   /old_locus_tag="LSA0180"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        173256..173996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="LCA_0180"
FT                   /old_locus_tag="LSA0180"
FT                   /product="Manganese ABC transporter, ATP-binding subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54477"
FT                   /db_xref="GOA:Q38ZA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZA0"
FT                   /protein_id="CAI54477.1"
FT                   /translation="MLTVKNLTVAYDDTPVFTDVAVHFDAGKITGIIGPNGAGKSTLIK
FT                   AILGLVKAQQGSVLYQGKSMRAVQKQVAYDEQRKDLDLNFPISVFDVVLTGTYGKLGLF
FT                   RDPGKQAIAASRAALEQVALADFERRQIGQLSGGQLQRVFVARAIVQEAEIIILDEPFV
FT                   GIDLQSETAIMAIMKQWRDAGKTIIVIHHDLNKVSQYFDDLVVMNHGIVDYGPTDQVYN
FT                   AQNIERAFSADLSAVLFEKQEVDQ"
FT   CDS_pept        173993..174853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="LCA_0181"
FT                   /old_locus_tag="LSA0181"
FT                   /product="Manganese ABC transporter, membrane-spanning
FT                   subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54478"
FT                   /db_xref="GOA:Q38Z99"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z99"
FT                   /protein_id="CAI54478.1"
FT                   /translation="MTSISAFMGALGRYEFLQSALLTAIMVGIMSGVIGSFIILRGMSL
FT                   MGDAISHAVLPGVAVAYMLGINVLVGASVFGILAVVLIGFVATHSKIKTDTSIGVVFSA
FT                   FYALGFILISMAESATNLHHILFGNILAVSDQDIMTTAIVLGIVILFVSFFYKELLITS
FT                   FDETYARTYGLKTQVLHYGLMLVLTLVTVSALQTVGIILVVAMLITPAATAFLWTNKLV
FT                   TMLFLSASIGAVAAISGLYFSYTFNWASGPAIVLMAAVLFAVSFICAPKQGFLKWRSAK
FT                   GGQQR"
FT   CDS_pept        174850..175794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsA"
FT                   /locus_tag="LCA_0182"
FT                   /old_locus_tag="LSA0182"
FT                   /product="Manganese ABC transporter, substrate-binding
FT                   lipoprotein precursor"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54479"
FT                   /db_xref="GOA:Q38Z98"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z98"
FT                   /protein_id="CAI54479.1"
FT                   /translation="MKKILITLLTVAGIIGGVYGFIHQRAQAKIQANSQHTKLRVVTTN
FT                   SILEDMVANVGQDRIELYSIVKRGTDPHEYEPQPTDISKATDADVLFHNGLNLETGGNG
FT                   WFKKLVSIAHKKFGEDVFATTKGIKVQHLTTNKDEPDPHAWLDLANGMQYVENITVALQ
FT                   AKDPKNADYYRQNADQYIARLEKLHAKAQTQFADIPEKRRVLVTSEGAFKYFGAAYDVT
FT                   PTYIWEINTESQGTPTQMKSVLAKIAATDVQSLFVETSVSPKSMAKVAQETGLPIYAKI
FT                   FTDSLAQKGKPGDTYYTMMKWNIDKIHAGMSHQ"
FT   regulatory      175864..175877
FT                   /locus_tag="LCA_0183"
FT                   /old_locus_tag="LSA0183"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175881..176387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0183"
FT                   /old_locus_tag="LSA0183"
FT                   /product="Putative hydrolase, isochorismatase/nicotamidase
FT                   family"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54480"
FT                   /db_xref="GOA:Q38Z97"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z97"
FT                   /protein_id="CAI54480.1"
FT                   /translation="MVDLADCLLVIDLQNGVCKGKQPVANFKQLIEQVNARIEIYKANK
FT                   RPIIFVQHNDTTLLAPQYAWQLVPELSVPADAQFVQKTHANSFWQTNMQVLLEQKQIHS
FT                   LEICGAQTEYCVDTTVKVAHSLGYQLQMVSGLSTTVANSLMTATQTIAFYEDIWADRFL
FT                   TLIEG"
FT   regulatory      176394..176415
FT                   /locus_tag="LCA_0183"
FT                   /old_locus_tag="LSA0183"
FT                   /regulatory_class="terminator"
FT   regulatory      176579..176592
FT                   /locus_tag="LCA_0184"
FT                   /old_locus_tag="LSA0184"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176596..176835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0184"
FT                   /old_locus_tag="LSA0184"
FT                   /product="Hypothetical protein"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54481"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z96"
FT                   /protein_id="CAI54481.1"
FT                   /translation="MNDNKLTIDADQFAAAIIAGNPKQTNEDNKVYIKRQLTLYLESVL
FT                   LANDFNSLEENQFGTAKEKQRQAILEKIIEHRYH"
FT   regulatory      176849..176862
FT                   /gene="galP"
FT                   /locus_tag="LCA_0185"
FT                   /old_locus_tag="LSA0185"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176864..178279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galP"
FT                   /locus_tag="LCA_0185"
FT                   /old_locus_tag="LSA0185"
FT                   /product="Galactose:cation symporter"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54482"
FT                   /db_xref="GOA:Q38Z95"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z95"
FT                   /protein_id="CAI54482.1"
FT                   /translation="MKKLKDIKQYSSYAFGAFGHDAFYATLSTYFMIFVTSQLFDTKNA
FT                   AFNAKMIGYVTSMMVVIRIIEIAFDPIIGGVVDNTRTRWGKFKPWLLIGSLISSVGLVM
FT                   IFTNFGGLATNSPYLYLVLFAIVFVILDIFYSFKDIAFWSMLPALTVDSEKRTKFGAIA
FT                   RFGSTLGAQGVIIVIVPIVVFFSQMFSGTHGSEQTSAGWLGFAVVIGVVSFLGALATII
FT                   GTKEEKSAIRENTEKIRFRDVFKVIGKNDQLMWLSLSYFLFAFSYVITNSLLIYYFKYV
FT                   MGRAAAFSTVGVITAILGVISVALFPTLVSLIHRRAIYLGGIAMMMLGYILFLFAGSNL
FT                   VVVLIAVGLFFFPYPLVFLAALMTITDSVEYGQLKSGTRNESVTLAVRPLLDKLAGAFA
FT                   NGVVGIAAIHAGMTGNAKPSDITNGGLLQFKTYMFFVPMALLIVSALIFMAKIKLTEAK
FT                   HAEIVSELEKKLD"
FT   regulatory      178537..178562
FT                   /gene="galP"
FT                   /locus_tag="LCA_0185"
FT                   /old_locus_tag="LSA0185"
FT                   /regulatory_class="terminator"
FT   regulatory      178671..178684
FT                   /locus_tag="LCA_0186"
FT                   /old_locus_tag="LSA0186"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        178687..179700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0186"
FT                   /old_locus_tag="LSA0186"
FT                   /product="Putative transcriptional regulator, LytR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54483"
FT                   /db_xref="GOA:Q38Z94"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z94"
FT                   /protein_id="CAI54483.1"
FT                   /translation="MKKLKIVLGVIGVILVIGGGFYKIKENQAIHAIKTQNKQVSNRIN
FT                   QDKPISFLLLGADTGSDGRVDRGLSDSMMVVTLNPKTKKTLVYSIPRDSLAEMVGSKTK
FT                   NVQKINAAYELGQAKMAKKTVSEFIGVPIDYSVTIDMGALKELVDFVDGVDVKTNIDVS
FT                   FDGQTIKKGRHHLNGKQALVYTRMRYQDPRGDYGRQLRQQEVLRGVADKIQKPQYLVHL
FT                   SGLMTKLGKHISTDLTADQTKTLIENYHQCGTDITSGQIIGKEAWINGSSYQVIATDKL
FT                   QATSNKLRESLGLQTKTLSNTETELNQLNTDFFKDNTNKTFNTDGLNTTYYSDNTY"
FT   regulatory      complement(179199..179230)
FT                   /locus_tag="LCA_0187"
FT                   /old_locus_tag="LSA0187"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(179705..181216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0187"
FT                   /old_locus_tag="LSA0187"
FT                   /product="Putative drug-resistance ABC transporter, two
FT                   ATP-binding subunits"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54484"
FT                   /db_xref="GOA:Q38Z93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z93"
FT                   /protein_id="CAI54484.1"
FT                   /translation="MGTIQFKQLTFNYPDQATPLFKDVTLQFDASWRLGLIGRNGRGKT
FT                   TLLKLLQRQLDFDGQLITDLDFHYFPQTVADPSQLTRDILMTLGQLDNSTFWQIERELN
FT                   LLKVDLDCLWQPFNTLSPGEQTKALLALLFIDEHHFQLIDEPTNHLDQDGRDTVAHYLQ
FT                   QKTGFIVISHDRYFLNQVIDHVLSINRADITVQQGDYQTWQTNQEQQTQSEQHQNSLLK
FT                   SEIKRLNQTAQQKSQWSQQAERGKNAASVKNESANLDKGFIGHRAAKVMKRATTITARS
FT                   EQAATEKQSLLKNVEITAPLTINNQSLKPQQIVLTATDLVLEQDGRALNQPLSFELKAG
FT                   QQVALTGANGTGKSTFIKALLALPEMQHQVSGQLTIASRIKVSYLPQDFAQLSGSLADF
FT                   AAAKQVSLEQLLSTLRKLGFEREQFNHRLETMSMGQKRKAALARSLCEEAQFYVWDEPL
FT                   NYLDVITREQLQTLIVQTCPTLLFIEHDRDFIDGVASQRYQLIPR"
FT   regulatory      complement(181220..181233)
FT                   /locus_tag="LCA_0187"
FT                   /old_locus_tag="LSA0187"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      181555..181568
FT                   /locus_tag="LCA_0188"
FT                   /old_locus_tag="LSA0188"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181571..181639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0188"
FT                   /old_locus_tag="LSA0188"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54485"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z92"
FT                   /protein_id="CAI54485.1"
FT                   /translation="MMTMQRVAFNFFFKKPRIRLVD"
FT   regulatory      181716..181745
FT                   /locus_tag="LCA_0188"
FT                   /old_locus_tag="LSA0188"
FT                   /regulatory_class="terminator"
FT   regulatory      181915..181928
FT                   /locus_tag="LCA_0189"
FT                   /old_locus_tag="LSA0189"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181932..183323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0189"
FT                   /old_locus_tag="LSA0189"
FT                   /product="Putative amino acid/polyamine transport protein"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54486"
FT                   /db_xref="GOA:Q38Z91"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z91"
FT                   /protein_id="CAI54486.1"
FT                   /translation="MGLGTRLFRKESLERYLQQDQRLAKTLTAKDLIALGVGAVIGTGI
FT                   FILPGTIAALHSGPAITLSFMIAAVVCAVAAMCYAEFSSALPVAGSAYSYGNIIFGELI
FT                   GWLLGWALFLEYMLSVAAVSTGWSAYFVSFIEGFGVHIPKAITGSFDPAHGTYINLFAV
FT                   LIVTLISVLLMSGTRSSTRINNLMVMIKIGVVLLFLVVGIFYVKSSNWQPFMPFGVSGV
FT                   FKGASLVFFAYLGFDCVSASAAEVKNPQKNLPIGIIGTLVICTLLYILVAFVLTGMVSY
FT                   RELNVANPVAFALQVVHQNWFAGLLSLGALAGMFTMMLTMTYSSSRLVYSIGRDGLLPK
FT                   MLGKIETRHQTPINSVRVVTVIIATLGGLVSLDQLTNLVNIGTLIAFFFMSIGVIPLRK
FT                   RKDIPNKDGFKVPLYPWLPLLSGLLCLFMLFELPAVTWMAAGIWFILGLIIYFSYGLKH
FT                   SRLND"
FT   regulatory      183374..183387
FT                   /locus_tag="LCA_0190"
FT                   /old_locus_tag="LSA0190"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183391..184479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0190"
FT                   /old_locus_tag="LSA0190"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54487"
FT                   /db_xref="GOA:Q38Z90"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z90"
FT                   /protein_id="CAI54487.1"
FT                   /translation="MKHKRLWLALGGLLICMIGVLATYHDATRYKQPLIQVTAVKTIQK
FT                   TKTTDDYQNQDTEIQQKVTGRFLNTKRKGQTIQLQNTYSKSLADSYRYYRGQQVFLHHD
FT                   QDRHQWLLNEPKRDTVLVAVVLGTFSLLLVMMSKRGLMTILSVVVNLAFFIITLHFNAA
FT                   TGGRWLLPLMCGLAVVLTGLTLLLVLGPNRQMLVSFGATIGATFLALLLSVILLKISGD
FT                   QGLHYETMDYELQPYKTVFLAEVVLGILGAVMDEATDISSSLQQLAFEQPNVTRRQLFN
FT                   SGLAIGREIIGPLVNVLFFIVMAEAFPIILLYLRNGNTIAYTLSRTMTLGFTQTVISAI
FT                   GITLAVPVTSLLASQLVEVRRL"
FT   CDS_pept        184479..185222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0191"
FT                   /old_locus_tag="LSA0191"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54488"
FT                   /db_xref="GOA:Q38Z89"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z89"
FT                   /protein_id="CAI54488.1"
FT                   /translation="MLLTGVLLLLLILVCGWQGLTIFFSLGLNFVVIILALVLIAGGFN
FT                   PLVVSGLLSLILLATSIFMNTKQPLTAKTAFVTSLLVVLALLVIIVPISHWAATYGFGA
FT                   EDAEEIEGFGLAIGLSFPQVGMIMTVLASLGAIAETSIAVASGLVEILEYDEQMAPAPL
FT                   FKAGIAIGEKIIATAFNTLFFSFFGSFLSLTIWFIQLGYPLAKILNHKILIGEILTLLI
FT                   GVIGVIATVTITSWLLNHFRKLPKA"
FT   regulatory      185275..185288
FT                   /locus_tag="LCA_0192"
FT                   /old_locus_tag="LSA0192"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185293..185421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0192"
FT                   /old_locus_tag="LSA0192"
FT                   /product="Hypothetical small protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54489"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z88"
FT                   /protein_id="CAI54489.1"
FT                   /translation="MSQNLHVSVSGNRRPINQKNAKKRNAETTAVLNFLKERKSAK"
FT   regulatory      185592..185605
FT                   /locus_tag="LCA_0193"
FT                   /old_locus_tag="LSA0193"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185609..186169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0193"
FT                   /old_locus_tag="LSA0193"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54490"
FT                   /db_xref="GOA:Q38Z87"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z87"
FT                   /protein_id="CAI54490.1"
FT                   /translation="MFRHKQKQIFYNFKWLGYLALTAGVILVTIGMLIQLIPIGEAQFH
FT                   ITINGVEQPYTIENVTKMRLLFLGIMGGLGGLFLITALIIIGRSRHRAKLIGMLKQSGE
FT                   KVMAEVIDYAPSQVRINNQPARYLVCTYQNMTGENLIFKSGLLRWNPISFLSDKKVIVY
FT                   YDSRNSNRYFVDVDESMGKVVNL"
FT   regulatory      186194..186213
FT                   /locus_tag="LCA_0193"
FT                   /old_locus_tag="LSA0193"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(186194..186213)
FT                   /locus_tag="LCA_0194"
FT                   /old_locus_tag="LSA0194"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(186239..187585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0194"
FT                   /old_locus_tag="LSA0194"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54491"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z86"
FT                   /protein_id="CAI54491.1"
FT                   /translation="MKKQKMTYLSSGIVGLAGLALMGIQANEAQAATTGTVNYADGATT
FT                   IWTSPEVGQKPTRYLTNNQNVTIKNTKQVYGQTWYQLADNEWVAGEFVKTGATTPAATT
FT                   AAPAAKDTITVNYKSGATTIWTNTTAAQPTGAYLTYGKAQNVIASKTANGVTWYQLENK
FT                   GWVPSSYVVLNNPSLAGVTPITDAPAVTPVATTTATTPAASTTTTTPAATTATSESAAQ
FT                   TSTTQPAPAASQSSTTPTAPAQQQSSVATSTSTSQATQVQTQTQTQTSQTSTSVAPVAQ
FT                   SASTQQSAPAQQQSSTQTQTQNTINTASSSNTTATTPTQTPKAPAQTSGNAQTVINAAL
FT                   SQIGTPYVWGGSTPGVGLDCSGLVQYAYSRAGVKLDRVTTAQEGAGQRVSLNSLQPGDI
FT                   IFWGGAGASYHDAIYIGGGQYVHAPQPGESVKIGTISSYFMPSFAVRVF"
FT   regulatory      complement(187593..187606)
FT                   /locus_tag="LCA_0194"
FT                   /old_locus_tag="LSA0194"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(187818..187847)
FT                   /locus_tag="LCA_0195"
FT                   /old_locus_tag="LSA0195"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(187871..188863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0195"
FT                   /old_locus_tag="LSA0195"
FT                   /product="Hypothetical lipoprotein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54492"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z85"
FT                   /protein_id="CAI54492.1"
FT                   /translation="MKKLTHVLLMLMASCFVILAGCQNKTTVPAAATKTEDQIEQYVQK
FT                   VNQLYADADHKKPAKLTANKKNEIIESAQKLDHKISDNLYMSALSSKSKTAFKAAQKDL
FT                   KRIDTGAPVEKTKKKTKKTKDSDFFDADGIVKDGLQLGAESDYANDAKKLAAYKEAKAQ
FT                   QAAMTAVDNLFTNSDHTAIPATLTTEDFTYSKALVEKTTHKKFKERYLKLIKEAKAQFD
FT                   SYSASASSTATSQSSSATDTTTTDQTTQSTDNTVDNTAATTNQTTTNNNYTQPTSYSNT
FT                   TPQSTSSSSNTGNNNGNVTTNNNTSDTQSESSTSDNQISTQSQSDALLQ"
FT   regulatory      complement(188866..188879)
FT                   /locus_tag="LCA_0195"
FT                   /old_locus_tag="LSA0195"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      189066..189079
FT                   /gene="pepD2"
FT                   /locus_tag="LCA_0196"
FT                   /old_locus_tag="LSA0196"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        189082..190500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD2"
FT                   /locus_tag="LCA_0196"
FT                   /old_locus_tag="LSA0196"
FT                   /product="Dipeptidase D-type (U34 family)"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54493"
FT                   /db_xref="GOA:Q38Z84"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z84"
FT                   /protein_id="CAI54493.1"
FT                   /translation="MESACTTILVGKKASLDGSTMIARNDDTFMPLTPQRFYMNPAVKG
FT                   RKGEKIKSWLNGFEATLPEDGYRWPAVPNVDYKNKGYYDESSINEVNVAMSCTESTYGN
FT                   EKSLAYDPLVKDGLDEDCMQAMVAPYINSAREGVSYLGNLIKQYGSPAGNSVLFSDHDE
FT                   VWYMEIVTGHLWLAQRIPDDGYAVAANQVAIQQVDFSDKDNFMWAEGIQEYVEKHHLNP
FT                   DKTGWNFRHIFGTMNEKDRHYNTPRVWYAHHLFDSEFDMSPESADLPFIRKIEHKISVE
FT                   DIEMLLGSHYNETEFDPMGHGADADKYRYRPIGLNRTQNAHILQLRNDVPKEQAAIMWI
FT                   TLGMPTYTPFIPFFTNANDTDPSFSETPMKWDINSAYWMYRTISVLVEGHYSQHIQGNV
FT                   DYLTSCKQELRTMLDSIEEEAKNYQGEALTKYLTEQNYLIVNTMKDKAMGMIGELVMSG
FT                   INLSKLTFNMDHNL"
FT   regulatory      190513..190546
FT                   /gene="pepD2"
FT                   /locus_tag="LCA_0196"
FT                   /old_locus_tag="LSA0196"
FT                   /regulatory_class="terminator"
FT   regulatory      190770..190783
FT                   /locus_tag="LCA_0197"
FT                   /old_locus_tag="LSA0197"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        190786..191328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0197"
FT                   /old_locus_tag="LSA0197"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54494"
FT                   /db_xref="GOA:Q38Z83"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z83"
FT                   /protein_id="CAI54494.1"
FT                   /translation="MSSKITGKYSEDWEVITHLSLIYRWVISNLSDFVSGESLNYKVSF
FT                   DQFLIMYEIATNDDLTGSKLAKTMSVSRSAISRQCRLLKENGYVVEEHLQSDQRVKFLS
FT                   LTKQGQDVLDRLVSRYVQKYQEIETQMGREKIDGLIQFIDQFYLDVIEPSDYHDNKMGR
FT                   SFLEKVQQIQSDDQIAK"
FT   regulatory      191341..191376
FT                   /locus_tag="LCA_0197"
FT                   /old_locus_tag="LSA0197"
FT                   /regulatory_class="terminator"
FT   regulatory      191457..191470
FT                   /gene="ack1"
FT                   /locus_tag="LCA_0198"
FT                   /old_locus_tag="LSA0198"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191473..192657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ack1"
FT                   /locus_tag="LCA_0198"
FT                   /old_locus_tag="LSA0198"
FT                   /product="Acetate kinase (Acetokinase)"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54495"
FT                   /db_xref="GOA:Q9X4M1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X4M1"
FT                   /protein_id="CAI54495.1"
FT                   /translation="MEKILAINAGSSTLKWQLFEMPSETVIAKGMIDRLGLSDSVFTAK
FT                   YGDNQKFKEVQDVTTHEMAATLLLTRLKELGIVSHLDEITGVGHRVVGGGEAFSDSMVI
FT                   NPVALDEINRLAEYAPLHNPTQAYYIKIFTALLPGVPQVAVFDTSFYSTLAPENYLYSI
FT                   PQEYYQTFGARKYGAHGTSHRYVAHRAAEILGTPLESQKMITLHLGSGASITAVQDGHA
FT                   VDTSMGFTPLAGITMGTRSGDIDVSLVAFLAKKLEITMPEMIDILNHKSGLLGISELSP
FT                   DMRDLEETAATRPQSALALSIFVNRVVKYVGSYVALMNGIDTLVFTAGSGENGSELRAD
FT                   ICKQLACFGVKLDEEKNNVRSQERIISADDSKVKVLIVPTNEELMIARDVMRLK"
FT   CDS_pept        192672..192917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0199"
FT                   /old_locus_tag="LSA0199"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54496"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z81"
FT                   /protein_id="CAI54496.1"
FT                   /translation="MAQKPLFEFEVDIPRLSARLEDQPAVKTFFEALTPGYQREWARYV
FT                   YGAKAEETQQRHYADMLMILEAGYKSKRGYSQAKKK"
FT   regulatory      192928..192960
FT                   /locus_tag="LCA_0199"
FT                   /old_locus_tag="LSA0199"
FT                   /regulatory_class="terminator"
FT   regulatory      193075..193088
FT                   /gene="rbsU"
FT                   /locus_tag="LCA_0200"
FT                   /old_locus_tag="LSA0200"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193092..193976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsU"
FT                   /locus_tag="LCA_0200"
FT                   /old_locus_tag="LSA0200"
FT                   /product="Ribose transport protein"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54497"
FT                   /db_xref="GOA:Q9X4M3"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X4M3"
FT                   /protein_id="CAI54497.1"
FT                   /translation="MNAVNILIGLMPMIGWGIFPVIVGKIGGKPASQILGTTFGTLILA
FT                   IVVAIFRGTPIPETKTFIFCLISGACWALAQIITFHVFETMGVSRTMPITTGFQLVGAS
FT                   LWGVFVLGNWSSSQSKLIGFTAIALIIIGVYLTAWSEDKSSASKSGAVKGILLLLVGEL
FT                   GYLGYSAFPQAVSADGFQGFLPQAIGMTIVGIIFGLTQTKKDYKPFKEATSYKNIFSGF
FT                   FFAFAALTYLISAQPSVNGLATGFVLSQTSVIFATIGGIYILKEKKSKKEMIAVMVGLL
FT                   LVLVAGSVTAFIK"
FT   regulatory      193980..193993
FT                   /gene="rbsD"
FT                   /locus_tag="LCA_0201"
FT                   /old_locus_tag="LSA0201"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193997..194392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="LCA_0201"
FT                   /old_locus_tag="LSA0201"
FT                   /product="Ribose mutarotase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54498"
FT                   /db_xref="GOA:Q38Z79"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38Z79"
FT                   /protein_id="CAI54498.1"
FT                   /translation="MRKTKVINTQISSVISDMGHFDTLSIGDAGMPVPVGTKKIDVAIE
FT                   NGVPSFIQVLTNILSELEVQKVYLANEIKTANPEQLAAIKALIGETPIEFIDHSQMKQD
FT                   LNKAKAFVRTGEMTPYSNIILESGVVF"
FT   regulatory      194395..194408
FT                   /gene="rbsK"
FT                   /locus_tag="LCA_0202"
FT                   /old_locus_tag="LSA0202"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        194412..195320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="LCA_0202"
FT                   /old_locus_tag="LSA0202"
FT                   /product="Ribokinase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54499"
FT                   /db_xref="GOA:Q38Z78"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z78"
FT                   /protein_id="CAI54499.1"
FT                   /translation="MKKVIVLGSTNVDTILNVQRFPQPGETLAMDGRAVAGGGKGANQA
FT                   IAAVRSGAQTAFISKVGKEGAADFMIDTFKKDGMNVDHVRCSETAGTGQAYIMVDAHGQ
FT                   NSILIYGGANQDVTVEDVHEAETAIKAADRIVAQFEVPIPAIIEAFKIARANGVQTILN
FT                   PAPAIKNIPTELLAVTDMIVPNETEAEIITGIKVTDEASMQANAEAMFKLGIKVVIITV
FT                   GSKGSFYATPTATGFVPAFKVNAVDTTAAGDTFIGALSTKLELDYSNIEAAMTYANKAS
FT                   SIAVQTKGAQNSIPYEKDIQL"
FT   regulatory      195333..195359
FT                   /gene="rbsK"
FT                   /locus_tag="LCA_0202"
FT                   /old_locus_tag="LSA0202"
FT                   /regulatory_class="terminator"
FT   regulatory      195369..195382
FT                   /gene="rbsR"
FT                   /locus_tag="LCA_0203"
FT                   /old_locus_tag="LSA0203"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195385..196407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="LCA_0203"
FT                   /old_locus_tag="LSA0203"
FT                   /product="Ribose operon transcriptional regulator, LacI
FT                   family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54500"
FT                   /db_xref="GOA:Q38Z77"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z77"
FT                   /protein_id="CAI54500.1"
FT                   /translation="MGEVNVVRKVTIKDVAALAQTSVTTVSLILNNKGQRFSAETIARV
FT                   RAAREKISYEPDYFAQNMVNKETKTIAVLVPDINNPFFSQFIQGVEEVAYQYDFIPLIY
FT                   SAGQNNQKVNYYLKELVRRNVDGFILAVSHIEEETLEGHLKQRKIPYILLDQSEKQHQS
FT                   DEIAVADTEGGRMAANYLIEKGHRQIGIVLPEQRAWNIEQRFIGYQVALVSHQITVNPD
FT                   WQITTPLSKQGGYQVAQQVIDSGVSAVFAVNDELAIGLARGLAELGHAVPESISIIGYD
FT                   DIDWCEYVTPRLTTIKQPILALGQEATRLLLNRIEKPTLGMQQKMLSVELVERDSVQAQ
FT                   "
FT   regulatory      196432..196477
FT                   /gene="rbsR"
FT                   /locus_tag="LCA_0203"
FT                   /old_locus_tag="LSA0203"
FT                   /regulatory_class="terminator"
FT   regulatory      196532..196545
FT                   /locus_tag="LCA_0204"
FT                   /old_locus_tag="LSA0204"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196551..197105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0204"
FT                   /old_locus_tag="LSA0204"
FT                   /product="Putative transcriptional regulator, PadR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54501"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z76"
FT                   /protein_id="CAI54501.1"
FT                   /translation="MYELLMLSALMSRNMSGYKLRIILENAMLPRRKISNGVLYPLLDK
FT                   LENKGCIGFDEADQDSRGTKIAHITEEGRRYFAELMTKPVAHDAKWDDAYRFKMRGMHY
FT                   IDSEEQISILQDYRNELAEDLHVYLGIKNHLTDLRDEEGTNTNYYQWQVRSMDFVITTL
FT                   KAKVDWLEAQIKEIEKMEIVK"
FT   CDS_pept        197102..198661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0205"
FT                   /old_locus_tag="LSA0205"
FT                   /product="Putative drug:H(+) antiporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54502"
FT                   /db_xref="GOA:Q38Z75"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z75"
FT                   /protein_id="CAI54502.1"
FT                   /translation="MKKTTNRWIALVAMSLGVFMGLLDVTVVNVALPSMAVDFKTTFSN
FT                   LQWVLNAYTLMYAVSLLIVSKLGDMFGRKKIFIMSMILFTAASVVNGLAPNLLVLDIGR
FT                   AIQAIGGSGMMSLSMALVASNFEGRERGTALGILGSVIGFSTAIGPLVGGFLVESFGWP
FT                   SIFFVNLPVGIISVYLVIRNVKETPAYGAGESIDFMGMFLSAIGLFSGIYGLIQKEQHM
FT                   HWAWTDMRIMGWLVASVLILALFVFVELKAKAPMMNLTLLTNRHFVGVVILAFSLGAGI
FT                   FALAAYQTSLMQNYMGYSAFSTGVHQLPMSLWSLVLGPFTGVLGYKFGKKWLIAFGFTV
FT                   SALGLLIFRQVTTTDFTYMQLLPLLALTGLGNAIINPMINTAAMDNINPQEIGMASGLL
FT                   NVFRQIGITVGVVILGLSQTNAYESSLSTGFSGSSIPKAAATGIHQSLVEAGAFSGHAI
FT                   AWGQQLVKTPYAAKVQQMVVTAFDKGMIAVVTTSLVLMVIAILAALFLLKETKSVDQKP
FT                   QK"
FT   regulatory      198738..198751
FT                   /gene="gpm3"
FT                   /locus_tag="LCA_0206"
FT                   /old_locus_tag="LSA0206"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198757..199446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm3"
FT                   /locus_tag="LCA_0206"
FT                   /old_locus_tag="LSA0206"
FT                   /product="Phosphoglycerate mutase"
FT                   /function="2.1.2 glycolytic pathway"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54503"
FT                   /db_xref="GOA:Q38Z74"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38Z74"
FT                   /protein_id="CAI54503.1"
FT                   /translation="MAKLVFIRHGQSEWNLSNQFTGWVDVNLSEEGVRQAQNAGALLKK
FT                   EGILFDQAYTSVLTRAIKTLHYALEGSDQLWIPETKSWRLNERHYGALQGQNKAEAAEK
FT                   WGDEQVHIWRRSYDTLPPLLDASDEGSAANDRRYAHLDPKAIPGGENLKVTLERVIPFW
FT                   EDEIAPKLIDGQNIIVAAHGNSLRALTKYIENISDEDIMDVEMATGEPVVYDLDENLNV
FT                   VSKKKLN"
FT   regulatory      199573..199600
FT                   /gene="gpm3"
FT                   /locus_tag="LCA_0206"
FT                   /old_locus_tag="LSA0206"
FT                   /regulatory_class="terminator"
FT   regulatory      199824..199837
FT                   /gene="clpL"
FT                   /locus_tag="LCA_0207"
FT                   /old_locus_tag="LSA0207"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        199842..201965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="LCA_0207"
FT                   /old_locus_tag="LSA0207"
FT                   /product="ATPase/chaperone ClpL, putative specificity
FT                   factor for ClpP protease"
FT                   /function="3.9 Protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54504"
FT                   /db_xref="GOA:Q38Z73"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z73"
FT                   /protein_id="CAI54504.1"
FT                   /translation="MANMYGNDPFFNNDMDDIFNQVFRRMGNSESARYVINGRELSPDE
FT                   FAQYRATGKLPNREKEIEIKQNGEHALKKGGILEKLGRNLTQEARDGLLDPVIGRYNEI
FT                   QETAEILSRRTKNNPILVGDAGVGKTAVVEGLAQEIVAGKVPETIKDKEIYSIDLSSLE
FT                   AGTQYRGSFEENIKNLIKEVKAAGNVILFFDEIHQILGIGSTGGEDGGKGLADIIKPAL
FT                   SRGELTVIGATTQDEYRNTILKNAALARRFNDVLVNEPSAADTVKILQGIKGLYEKHHH
FT                   IELPDDVLKAAVDYSVQYIPQRTLPDKAIDLLDMTAAHLAAKRPETDKAKLAAELKQLE
FT                   ADKAEAVEAENYQTAEDLKVRIEKIKTQLENNDQHAAVMIATVDDIAQSVERLTGIPVA
FT                   KMGSNDIQRLKNLGQRLKDKVIGQDEAVEMVARAIRRNRAGFSEGNQPIGSFLFVGPTG
FT                   VGKTELAKQLALDMFGNKEAIIRLDMSEYADRTAVSKLIGTTAGYVGYDDNSNTLTERV
FT                   RRNPYSIVLFDEIEKADPQVLTLLLQVMDDGRLTDGQGNVIDFKNTVIIATSNAGFGNE
FT                   KLTMNDQEDAKLLDKLAPYFRPEFLNRFNGIVEFTHLTKADLSQIVDLMLTNVEQTLAK
FT                   KELTLVVSKEAKDWLMEEGYDEAMGARPLRRVIEQQIRDKVTDFYLDHADVKDLKADLV
FT                   DDQIVIQAADSEN"
FT   regulatory      201990..202003
FT                   /locus_tag="LCA_0208"
FT                   /old_locus_tag="LSA0208"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        202006..202542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0208"
FT                   /old_locus_tag="LSA0208"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54505"
FT                   /db_xref="GOA:Q38Z72"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z72"
FT                   /protein_id="CAI54505.1"
FT                   /translation="MLSKNISNKLRQATGVNGLLSLILGLLILFLPGQSAMGVTVMVGV
FT                   VFIIIGLFDILSIFKEVDENTWVRLGHLLLGLLYLIVGIFVCVNLAASATYLFLLVGIF
FT                   VGITWLVEGFVELGTVQLAVSKGWTIFSAVLSIVAGIILLMTPLYGAVMLWTLLGAILV
FT                   VLGIFKVAHYLAWQK"
FT   regulatory      202564..202601
FT                   /locus_tag="LCA_0208"
FT                   /old_locus_tag="LSA0208"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(202564..202601)
FT                   /locus_tag="LCA_0209"
FT                   /old_locus_tag="LSA0209"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(202614..203231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0209"
FT                   /old_locus_tag="LSA0209"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54506"
FT                   /db_xref="GOA:Q38Z71"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z71"
FT                   /protein_id="CAI54506.1"
FT                   /translation="MSKKVLTIHAIILLFFALILLYQSRFAFLIWNIILALIPFDLSLL
FT                   GRLFKNSRWRYLIGVVWLLFFPNALYMITDFSHLSSIGVGLSTAFQFVEYAILAGGIFI
FT                   GVTLGLTSLFILYPLFIPNHQRLINQVATFGVLSVCSSVAIYIGRFLRINSWDVFYQLH
FT                   TTIASVLSILNQSDFWIFVVAFSILQLILMLMGYQLAQSDDL"
FT   regulatory      complement(203235..203248)
FT                   /locus_tag="LCA_0209"
FT                   /old_locus_tag="LSA0209"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      203412..203425
FT                   /locus_tag="LCA_0210"
FT                   /old_locus_tag="LSA0210"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203428..204420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0210"
FT                   /old_locus_tag="LSA0210"
FT                   /product="Choloylglycine hydrolase (Bile salt hydrolase)"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="3.5.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54507"
FT                   /db_xref="GOA:Q38Z70"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z70"
FT                   /protein_id="CAI54507.1"
FT                   /translation="MCTSLTYSTVDGHHFLARTMDFSFELNGNPLFLPRQHQWQPVLEK
FT                   QAIQNQYALMGAGAKLGDQYLVADGFNEHGLGCAELYFAHAAVYEPQPVPNKLNLVAEE
FT                   FIVWVLGNHQTLEEVAADLDNVRIIESDQGVMGANQPLHWILSDRSGKTMVIEPRGNGL
FT                   QLIDDPVGVMTNTPDLDWHIKNLSNYLNLQPQPFMERPFGNYQAGLFSQGTGTQALPGS
FT                   YTPPDRFVRAAYSRQYMPEANNVAEGVNHILHILDNVTIPKGVNIGSGGSSDYTQYQGI
FT                   SGLNNLAYYMVNYDNRHVYQTNLTTDLIENQKEPLIYHLPQGQQNTILN"
FT   regulatory      204436..204459
FT                   /locus_tag="LCA_0210"
FT                   /old_locus_tag="LSA0210"
FT                   /regulatory_class="terminator"
FT   regulatory      204668..204681
FT                   /locus_tag="LCA_0211"
FT                   /old_locus_tag="LSA0211"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204683..205147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0211"
FT                   /old_locus_tag="LSA0211"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54508"
FT                   /db_xref="GOA:Q38Z69"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z69"
FT                   /protein_id="CAI54508.1"
FT                   /translation="MTTEVNAVEAPANASSETITKIAQDAISGSTPTKQSNSVIQKKAA
FT                   SDAETQTITPATSGEKATLLEAPQTKKLANPKSSNLINEQAPVWAQSPGISMIQRRPYI
FT                   YQAVYCRIKWLMILLIHLGISLTRLILRESRISALMVKLQLKMSPICFGG"
FT   CDS_pept        204946..208080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0212"
FT                   /old_locus_tag="LSA0212"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54509"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z68"
FT                   /protein_id="CAI54509.1"
FT                   /translation="MGTVTWYIDDTTATLHLSGGVLPDKVANDTTNTPWYFPNSPYIAR
FT                   IAHISIDGEITAKDVSYMFWGLTNLTTVQGLANLKGATNFTMLFASDSALQSVDATNLD
FT                   FSKVTAMNSMFSDCANLVSVGDTANWQLGQVTTMVRCFSGDKKLSQLNSTNWDTSNIQN
FT                   MNNTFFNCTALTNLDVSKWQTAKMTNLGSTFSQSGITVLDVSNWDTSHVTNLSSTFLNT
FT                   SIAELDVSNWDTSQVTTMAYTFSGCSRLETLDVSKWQLGKNTSLSYTFSGDQRLTQLDV
FT                   SKWQTANVTNMASTFSGTVGVKTLAVKDWQTTKVITMAGMFAKSGVDQLEIADWDTSNV
FT                   QSMRLMFDATKLTTLDYPDWNTASVTDMSYMLRGMTKLTDAYFTNWDTSQVTNMGGMFL
FT                   NDQQLAHLRLGSKFKFLTSTSTGPSLAEPSTETPYFGKWQRHDANDNQVGNTYTSAALM
FT                   AQYDGTTVPTGDYYWAVATPPTITKLVRNVTADGNNAPFKTATTAQKGDTVDYQVNITQ
FT                   PSGQQLDRGAVFEDVLDSHLKFNNNKELSISYSDENGDFHGEQLIKFNDQWQIALGENL
FT                   AIGQKAQVLIKAIVNDDSAPEIDNLFKLVSGSYGAGTTSNTAIVHVKKPLTLTEAIKNE
FT                   TTDTDWDTKQDVSPGDRVGFKLDYQNTTGATSNQITFNDPLVTNELTYQTGSLKVTYQD
FT                   GTTETVSDAAQTQFATTGKLTLTKSLANYEAVKLSFSATVNPLVTSGTTLHNKATLTAD
FT                   NVSQPVTSNTVDMNVVQSEHQLTIRYVDLDEDLSQPASAGTQIAAPITVSGKTGTALST
FT                   LLPGQQVAPKVIEGYTIYSVSEDPDLKPENWQKAYRDDPQIGDQDRIITYGYKKAMLSI
FT                   DAPSSWEFGDYNNKPMDRTYYLNHNQGTPQAVTVTDNYGVQNWQLQVSQAKPFVDSEQH
FT                   ELTDAKWAFSNGNVKTLSNTDVGTVTNNSEHFTLASGQSATLMTMTKSGHFQSDSPDTS
FT                   DPENPYTQVGQGQWAYRFGDEKSADYSIGLNVPATTKRYTGHYRTKLTWSLSVGP"
FT   regulatory      208138..208151
FT                   /locus_tag="LCA_0213"
FT                   /old_locus_tag="LSA0213"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208154..209191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0213"
FT                   /old_locus_tag="LSA0213"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54510"
FT                   /db_xref="GOA:Q38Z67"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z67"
FT                   /protein_id="CAI54510.1"
FT                   /translation="MRLRKWTTGLAVGLFGWLLLASNQPVSAAQEHIDFEVEKVKSNRQ
FT                   VDQENRFFDLGIEPGKKETIQVLVHNFSDKNIKVHSEIDNSLTQQGGGIIYRPTKDGII
FT                   KETSHTLMDVAKVHRADRVITLGPNEVKKVSATITMPSEQTKGMIYGAWHFIEYGQKET
FT                   DNHSNVSGSYAYNMGIVLRGKPYEIYPELKYQGVNPTVRNGHPALGIQLNNTKPMAIKN
FT                   AKVKAVVYKNGFFKDKRVYETDSVDVAPNSQWTVPISWAFDRLKPGRYNISISVKGNSY
FT                   WNQLPMSWHFRKKITINQQQADKINQASVKKPVNKWAYVATASGVLMMVSFWFVYRVLK
FT                   LTRGL"
FT   CDS_pept        209194..209346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0214"
FT                   /old_locus_tag="LSA0214"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54511"
FT                   /db_xref="GOA:Q38Z66"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z66"
FT                   /protein_id="CAI54511.1"
FT                   /translation="MQHLITKWGPKKARLATFIVSGGLTIWFVLTLYLAIKFYLDLQKI
FT                   TIITM"
FT   regulatory      209391..209404
FT                   /locus_tag="LCA_0215"
FT                   /old_locus_tag="LSA0215"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        209408..210391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0215"
FT                   /old_locus_tag="LSA0215"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54512"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z65"
FT                   /protein_id="CAI54512.1"
FT                   /translation="MKFTKLTSTVLTASTLLAILAPATIASAATPKDDAAANGGTKLPM
FT                   TDTTDAGISFGDTHDNGNSGYLRLQMVPKTLDFGNHAKYDAAHTNFDATGANLGVVGND
FT                   THASYDQQDSNKTETLTTSDANLKAVQGTAWVTVVDKQVTRQHADGMDAATTQKAGDWD
FT                   LKVSTAEPLKTTSGQEIDGANLLFKHTKYALTSGVYELTNSDQDKTFAKDLADYKASIA
FT                   TPPATPKADGDDGDPAPAPSAGDVAINETAKDAITDTFSLSLAAPTSKLGTAAGTVVGK
FT                   ADTDTGTGANVFAWAPEDIQLVMPTDAAVANAIYKTSLTWTLETGK"
FT   regulatory      210467..210475
FT                   /locus_tag="LCA_0216_0"
FT                   /old_locus_tag="LSA0216_0"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        210483..210620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0216_0"
FT                   /old_locus_tag="LSA0216_0"
FT                   /product="Putative transcriptional regulator, MarR family,
FT                   truncated"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0216_0"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ98522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1L870"
FT                   /protein_id="CAJ98522.1"
FT                   /translation="MDYLSQWYIEYRSVSSNLNAICHKHDISLEQFLYLANSIINPNRN
FT                   "
FT   regulatory      210669..210682
FT                   /gene="tnpA2-ISLsa1"
FT                   /locus_tag="LCA_0216_a"
FT                   /old_locus_tag="LSA0216_a"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        210685..211605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA2-ISLsa1"
FT                   /locus_tag="LCA_0216_a"
FT                   /old_locus_tag="LSA0216_a"
FT                   /product="Transposase of ISLsa1 (IS30 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0216_a"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54513"
FT                   /db_xref="GOA:Q38Z64"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z64"
FT                   /protein_id="CAI54513.1"
FT                   /translation="MGTSTLSRFQRGALAQLVNEGNKSYQVMADALGVAKATISYELDR
FT                   VKPYDPELAQQDADRKRRNCGRRSMLTAALATLITNHLRLTWSPETIAAAYNLSTASIY
FT                   NWLNRGWLPFKLTDLPNRNVRQHRVSENRGKFTSGTSIEQRPTTVNQRLAFGHWEVDTV
FT                   LSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGK
FT                   EFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAAL
FT                   ELINQRPLKIHHQQTAIERFRACSD"
FT   regulatory      211621..211634
FT                   /locus_tag="LCA_0216_b"
FT                   /old_locus_tag="LSA0216_b"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        211637..211906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0216_b"
FT                   /old_locus_tag="LSA0216_b"
FT                   /product="Putative transcriptional regulator, MarR family,
FT                   truncated"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0216_b"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54514"
FT                   /db_xref="GOA:Q38Z63"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z63"
FT                   /protein_id="CAI54514.1"
FT                   /translation="MEGTQSPSELAMVFKISSPIVTRKLNVLQDKKMIEKLRGERQDQR
FT                   LVNITITDEGRKIYKKVNRDITEWEEHRQSTAVPTLGRSFLGQQ"
FT   regulatory      211924..211945
FT                   /locus_tag="LCA_0216_b"
FT                   /old_locus_tag="LSA0216_b"
FT                   /regulatory_class="terminator"
FT   regulatory      212023..212036
FT                   /locus_tag="LCA_0217"
FT                   /old_locus_tag="LSA0217"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212040..212696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0217"
FT                   /old_locus_tag="LSA0217"
FT                   /product="Putative thiosulfate sulfurtransferase with a
FT                   ArsR-HTH domain, Rhodanese family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54515"
FT                   /db_xref="GOA:Q38Z62"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z62"
FT                   /protein_id="CAI54515.1"
FT                   /translation="MEEQILQYRDAVYEQVVKVGKSLGNVTRLRILDLLVQGPKTVENL
FT                   ANTIGLSVATTSRNLQILKKARLVEIERHKNFVTYRLTSDQIKQLISLLVTVAEQSQPE
FT                   LAAIQTTFKQQTGSPQALTISALKAKLTAESTYLVDLRPNDEYETQHLPGAHNIPYDEL
FT                   PQHLAELPQDKEIVVYCRGRLCAYANVASQALHDAGFKVATFNQSVWEWNQLMSS"
FT   regulatory      212767..212780
FT                   /gene="trxA1"
FT                   /locus_tag="LCA_0218"
FT                   /old_locus_tag="LSA0218"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212784..213101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA1"
FT                   /locus_tag="LCA_0218"
FT                   /old_locus_tag="LSA0218"
FT                   /product="Thioredoxin"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54516"
FT                   /db_xref="GOA:Q38Z61"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z61"
FT                   /protein_id="CAI54516.1"
FT                   /translation="MTAQILNEANFNDEIKEGVTLVDFWATWCPPCKMQGPIVEQLADD
FT                   YAGKAKIAKVDVDQNQNLAAQFGIQAIPTLLIMKDGQLQEQLVGLQRKEALATKLDATL
FT                   A"
FT   regulatory      213117..213147
FT                   /gene="trxA1"
FT                   /locus_tag="LCA_0218"
FT                   /old_locus_tag="LSA0218"
FT                   /regulatory_class="terminator"
FT   CDS_pept        213407..213964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0219_a"
FT                   /old_locus_tag="LSA0219_a"
FT                   /product="Putative DNA-binding protein, XRE family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0219_a"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54517"
FT                   /db_xref="GOA:Q38Z60"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z60"
FT                   /protein_id="CAI54517.1"
FT                   /translation="MSSNNNIVNNIGEQIKQLRQSKKISVEKLSELSGLSSLTITKIEN
FT                   GKSNPTINTLWKLTKCLEAPLMSLFKNRGSNVVFSTENHGYFLEDENHKWEVEPIVGQF
FT                   DFEVYKVRLKANSKYYLDSQTSNTLEVITVLSGTLNLRVEHDSYIVHEHNTIYFINNNS
FT                   HEYINDTNEDILMNIVVKYENL"
FT   regulatory      214226..214239
FT                   /locus_tag="LCA_0219_b"
FT                   /old_locus_tag="LSA0219_b"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        214242..215201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0219_b"
FT                   /old_locus_tag="LSA0219_b"
FT                   /product="Putative cyanate transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0219_b"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54518"
FT                   /db_xref="GOA:Q38Z59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z59"
FT                   /protein_id="CAI54518.1"
FT                   /translation="MSLEYTIGYSTIVLVIGLFIRSIPQTSTLLFGTILVGSAIAMCNV
FT                   LIPSLIKREFNHRLGLITGIYSISMNLCGAIASGVSFPLANNLNLGWNNSLRIWLILAL
FT                   IACIAWIPQLKRHDKPDKIEELPIENSIWHSKTAWQVTIFMGLQSLVFYVLVAWLPEML
FT                   IQKGFTAEQAGYLLSMMQLFLLPFTFIIPIIAGRVKRQSKIAINTSILMCLGISGLFIN
FT                   NTIIIIIGIAFIGISGGCAFGLSMMFFNLKTRNAREGAELSGMAQSIGYLLAAIGPTLF
FT                   GFMHDMTHNWNVSLIILIVTAILLGGFGFFAGEDNYIN"
FT   regulatory      215293..215337
FT                   /locus_tag="LCA_0219_b"
FT                   /old_locus_tag="LSA0219_b"
FT                   /regulatory_class="terminator"
FT   regulatory      215901..215914
FT                   /gene="tnpA2-IS1520"
FT                   /locus_tag="LCA_0220_a"
FT                   /old_locus_tag="LSA0220_a"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        215918..216169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA2-IS1520"
FT                   /locus_tag="LCA_0220_a"
FT                   /old_locus_tag="LSA0220_a"
FT                   /product="Transposase (orfA) of IS1520 (IS3 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0220_a"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54519"
FT                   /db_xref="GOA:Q38ZD5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD5"
FT                   /protein_id="CAI54519.1"
FT                   /translation="MAIKYSNEFKESIVSLSQTGRSANSLAKEYNVSVSTVTKWIKQAD
FT                   PNNTKVLSSNERALIKENKRLKEELDILKRAAVLMAKS"
FT   regulatory      216174..216187
FT                   /gene="tnpB2-IS1520"
FT                   /locus_tag="LCA_0220_b"
FT                   /old_locus_tag="LSA0220_b"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216190..216987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB2-IS1520"
FT                   /locus_tag="LCA_0220_b"
FT                   /old_locus_tag="LSA0220_b"
FT                   /product="Transposase (orfB) of IS1520 (IS3 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0220_b"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54520"
FT                   /db_xref="GOA:Q38Z57"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z57"
FT                   /protein_id="CAI54520.1"
FT                   /translation="MLEVVNANLLAGHRITRILSVLKIPRSTYYDYLHWQPSRTERRRH
FT                   LIKQEVLTAWLRYPMYGYPRLTILLNQQSDIHVSQRLVYQQMCELGIRSRMVKRINKPT
FT                   TQTDYDQRPNLIKQLTDQSGILLTDITYIPLNHTWCYLASVYNPVTRRVIAYQLNTQMT
FT                   KELATNVITQVMAQAVKPQIIHSDMGSQYTSDLFENTLSKYGIKHSYSRKGQPGDNARI
FT                   ESFHSILKREYVNFQDFKTIHEAIAGIDNYIRWYNSDRISLVA"
FT   CDS_pept        complement(217034..218332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="LCA_0220_c"
FT                   /old_locus_tag="LSA0220_c"
FT                   /product="Succinyl-diaminopimelate desuccinylase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0220_c"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54521"
FT                   /db_xref="GOA:Q38Z56"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z56"
FT                   /protein_id="CAI54521.1"
FT                   /translation="MMEKTEKIAILEKLVSIDTTDQAEGVIADYLADLFTQHGIQTEKV
FT                   ASKPGRENLVAYLGEATDKVLAVTGHMDVVSIGDRSKWTSDPFTLTARDGKLFGRGATD
FT                   MKSGLAALVIAMIELHDQNVPLNGQIKLLATVDEEKNETGAQTLTAQGYADNLTALLVA
FT                   EPSGVDKQALANSTDKFPTEMVQKLLAANQTNEQHFLIFAHNGSLDFKVTATGKTAHSS
FT                   MPELGINAIDHLLAYYNRQKQYFDQKHPIDDVLGDIVPVTTLINGGEQINSVPGHAELT
FT                   CRVRTTPALTGDQVIADLNAIIAELNQQTDMNLALTVINNQPPVKSNPQAPFIQSVQKI
FT                   GAQKLSQAYPLMHVAGGTDAAHFAKNNPNLPVAVVGPGNDTSHMIDEYVDEERLLCQES
FT                   GHKSTSKFDFQFKLLNLIFGGRSFSPVQILKTL"
FT   regulatory      complement(218335..218348)
FT                   /gene="dapE"
FT                   /locus_tag="LCA_0220_c"
FT                   /old_locus_tag="LSA0220_c"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(218438..218460)
FT                   /locus_tag="LCA_0221"
FT                   /old_locus_tag="LSA0221"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(218448..218780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0221"
FT                   /old_locus_tag="LSA0221"
FT                   /product="Putative transcriptional regulator, LysR family
FT                   (C-terminal fragment), degenerate"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54522"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z55"
FT                   /protein_id="CAI54522.1"
FT                   /translation="MAQYPLLISGQSLVRQQISNWFGANLDQLDIIGTYTLLYNASLLV
FT                   KTSNSAALCIDGIINTKDNGLKFVPFNPPLTVNTNIIWKKGQVFSSAGQVFKEALTDQT
FT                   NKEPSH"
FT   CDS_pept        complement(218880..219335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0223"
FT                   /old_locus_tag="LSA0223"
FT                   /product="Putative transcriptional regulator, LysR family
FT                   (N-terminal fragment), degenerate"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54523"
FT                   /db_xref="GOA:Q38Z54"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z54"
FT                   /protein_id="CAI54523.1"
FT                   /translation="MDLRVLNYFLTVAQEKTISKAAEVLHLSQPTLSKQLKDLEVELGV
FT                   QLFTRGNREITLTTDGIYLQKRGREILSLVDTTTNNLTHNQVVSGTISIGAGETQAFQL
FT                   IAMIINDLRQRYPDITLQLFSGTADEVKERIDQGLLDFGLVIDPVDK"
FT   regulatory      complement(219337..219350)
FT                   /locus_tag="LCA_0223"
FT                   /old_locus_tag="LSA0223"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      219441..219454
FT                   /locus_tag="LCA_0224"
FT                   /old_locus_tag="LSA0224"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        219458..220033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0224"
FT                   /old_locus_tag="LSA0224"
FT                   /product="Putative acetyltransferase, isoleucine patch
FT                   superfamily"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54524"
FT                   /db_xref="GOA:Q38Z53"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z53"
FT                   /protein_id="CAI54524.1"
FT                   /translation="MDYSLRTRIANQPIYRDSELFKEIHLVKGNNERLVMEMNTGYHDA
FT                   AEVRAYLKCITDQEIDEPVTVSLPFYTDYAKHITFGKEIFINNNVLFVDLGGITIDDHV
FT                   LIGPRASLITVNHLENPADRRGLFVKPVHIKQNAWIGAGATILPGVTVGENAIVAANAT
FT                   VTKDVPANMIVAGTPAKVIRQIKAEKEF"
FT   CDS_pept        220035..220781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0225"
FT                   /old_locus_tag="LSA0225"
FT                   /product="Putative oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54525"
FT                   /db_xref="GOA:Q38Z52"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z52"
FT                   /protein_id="CAI54525.1"
FT                   /translation="MSIQNKVVIITGASSGIGAATAKLLASKGAKVVLAARRKDRLQAL
FT                   VAEIGENAIYQATDVTNRGQMASLAQLALDRFGRVDVLYNNAGVMPQGNLSERDYDQWQ
FT                   KMLDINIMGVLNGIGAVLPTMQAQQDGLIISTDSVAGHVVYPASAVYNGTKYAVRAIME
FT                   GLRQEEKDNGIRSTIVSPGAVKTELVNTIGNTAVFEGVKQLMDAPEESALALNPEDIAN
FT                   AVLYAIDQPKHVVVSEVLIRPAKQQV"
FT   regulatory      220937..220968
FT                   /locus_tag="LCA_0225"
FT                   /old_locus_tag="LSA0225"
FT                   /regulatory_class="terminator"
FT   regulatory      221069..221082
FT                   /gene="pepN"
FT                   /locus_tag="LCA_0226"
FT                   /old_locus_tag="LSA0226"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        221085..223616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="LCA_0226"
FT                   /old_locus_tag="LSA0226"
FT                   /product="Aminopeptidase N (Lysyl-aminopeptidase-Alanyl
FT                   aminopeptidase)"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54526"
FT                   /db_xref="GOA:Q38Z51"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z51"
FT                   /protein_id="CAI54526.1"
FT                   /translation="MAELMRFYQSFQPEHYQVFLDINRAQKRFSGRTTITGTAKDAVVL
FT                   IHQNGLVIETVSAAGKSVPFTVDNDANALKVEVGQPGEVTLVISYTAILTDSMMSIYPS
FT                   YYQVDGVQKELIGTQFETNFARQAFPCVDEPEAKATFDLAIKFDEHEGETILSNMPEKE
FT                   VIDGVHHFETTVRMSTYLVAFAFGELQGAQTKTKSGVQVGVFATKAHQANELEFALDIA
FT                   KRSIEFFEDFYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYLLLDPDNTALTTKH
FT                   RVATVIAHELAHQWFGDLVTMQWWDDLWLNESFANMMEYVAIDALEPDWHIWESFQTSE
FT                   ASSALQRDATDGVQSVHVQVNNPAEIDALFDGAIVYAKGARMLVMVRTLIGDDALRAGL
FT                   KAYFAAHQFGNATGADLWAALGKAANLDVGAIMDSWLEQPGYPVVTAKVVDGQLTLSQQ
FT                   QFFIGEGQEVGRQWQIPLKSNYAATPLLMTDRKLVLGDYAQLRADNGQPFRLNVGNESH
FT                   FIVNYDQTLFDDILKDSAEMAPIAQLQLLQDLRLLAEGRQINYADVVPVLAPFAKSNSN
FT                   LVADALYTVAGNLKKFVTAGETSEQHLRTFFDKLSKAQVARLGWTVQPTDTNDDQLMRP
FT                   TVLSAALYAKNQAAIDAAHALFQANQDQLATLPAAIRVLVLMNEVQNFGNAALYSQLLE
FT                   AYRQTSDASYKNDLSAALTRTTDPELIITLISKFEDAGTIKPQDLRAWFRGLLANDASQ
FT                   QATWDWIRNDWQWLEDTVGGDMEFTTYITSIAAVFKTPERLAEFKAFFEPKLDTPGLTR
FT                   EITMDIKVIESRVALIESEKEKVNVAIAQQI"
FT   regulatory      223636..223669
FT                   /gene="pepN"
FT                   /locus_tag="LCA_0226"
FT                   /old_locus_tag="LSA0226"
FT                   /regulatory_class="terminator"
FT   regulatory      223760..223773
FT                   /locus_tag="LCA_0227"
FT                   /old_locus_tag="LSA0227"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        223777..225120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0227"
FT                   /old_locus_tag="LSA0227"
FT                   /product="Putative drug:H(+) antiporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54527"
FT                   /db_xref="GOA:Q38Z50"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z50"
FT                   /protein_id="CAI54527.1"
FT                   /translation="MKKTNKKVILAIILISYFMILLDNSIIFTGTVKIAAELNLSQTTL
FT                   SWVTNAYSLTFGGLLLLGGSIGDIIGRKRVFMIGLTVFAVGSLLVGLANSAVMIILARA
FT                   FQGIGSAILAPTTLALLMDSFSGEVRTRAIAAYGATAGIGASIGLVIGGIFASLLSWRD
FT                   GFFINVPIAIIMIGLTVLFIPTTQATQAKRLDLIGALTSIIGMTALVYSLVGQQGRLLA
FT                   LLVAVVAIAAFIWQEARTKQPMMPLRLFADCERLGGYIARFFYLDAMLSMWFLTPQIMQ
FT                   THLGFTPLQAGIGFFPLTVVNFIVALQVSKLTTRFGNTKLLTVGIATTAIGMCALGFFS
FT                   EQVGYALGIAVPMILMGIGQGLTLSPLTVAGVANTLPADAGAASGVVNMVHQIGGSIGM
FT                   SFIVAVSATFKNGLTSYHVAMGLATVLLIGALLAVIGLILPTLKKESE"
FT   CDS_pept        225117..225716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0228"
FT                   /old_locus_tag="LSA0228"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54528"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z49"
FT                   /protein_id="CAI54528.1"
FT                   /translation="MMKKILIIGATGSIGSEVTAHLLDETDAQLTLLARHVNQPNQERV
FT                   TWVQGDATNLVQLEKVMRNQDALFVAVSGQLPQVAKAVVTTMTKLQIHKLVFIASMGIY
FT                   NEIPASIGASGNLASNGMLQAYRQAADIVTESTLNYTVVRPGWFDQGSHDYEVTGRNEP
FT                   FGGHDVSRWAIADLVRRVLEDEQLYARTSVGINRPQ"
FT   CDS_pept        225731..225880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0229"
FT                   /old_locus_tag="LSA0229"
FT                   /product="Putative transcriptional regulator, MerR family
FT                   (N-terminal fragment), authentic frameshift"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54529"
FT                   /db_xref="GOA:Q38Z48"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z48"
FT                   /protein_id="CAI54529.1"
FT                   /translation="MNIKEASQQTGVTATTIRYYEKEGLIQRLIATMLACERLTTELLE
FT                   ELIS"
FT   CDS_pept        225886..226131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0230"
FT                   /old_locus_tag="LSA0230"
FT                   /product="Putative transcriptional regulator, MerR family
FT                   (C-terminal fragment), authentic frameshift"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54530"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z47"
FT                   /protein_id="CAI54530.1"
FT                   /translation="MRAAGMSIEALKEYIRLFDAQEDNTAQQFKLLNEQIAIMEEKRDD
FT                   LQTAIDHLRWKVDHYEDHMAVTEEELRAVEKNRADQ"
FT   regulatory      226140..226165
FT                   /locus_tag="LCA_0230"
FT                   /old_locus_tag="LSA0230"
FT                   /regulatory_class="terminator"
FT   regulatory      226265..226278
FT                   /locus_tag="LCA_0231"
FT                   /old_locus_tag="LSA0231"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226281..226814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0231"
FT                   /old_locus_tag="LSA0231"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54531"
FT                   /db_xref="GOA:Q38Z46"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z46"
FT                   /protein_id="CAI54531.1"
FT                   /translation="MTNETQEIMALFAKLVQSRYFVASAWMTVGKERRRDFMNTKGKSR
FT                   LLNLLAAKDGLTNAEITELLDIRPSSVSLQVKALEEDGYVTRQASAADKRVSLIFITDK
FT                   GRDSIEKGDLETDKLSETILAGLSESEINELRVILSKIANNVQQTQFDSAFFEYGHHMR
FT                   HQNHGDWNRSRFPW"
FT   CDS_pept        226827..228578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrA"
FT                   /locus_tag="LCA_0232"
FT                   /old_locus_tag="LSA0232"
FT                   /product="Multidrug ABC exporter, ATP-binding and
FT                   membrane-spanning/permease subunits"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54532"
FT                   /db_xref="GOA:Q38Z45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z45"
FT                   /protein_id="CAI54532.1"
FT                   /translation="MQQMRVAPSKSQFSFKDFLGLIKNTKPKYWQLFLGLALGLVATGV
FT                   QLAVPSYAKQLINSFSKQFNIYMLIGIVVLFILSAVISAASGSLLGFFGEDVIQKLRNN
FT                   IWHKLLHLRVSYFDDVKSGEMTSRLVNDSTQIKDLLSRSFPGLVTAIFTIVGAFAIMLF
FT                   MDWKMTLIMAFSVPLVMAVMLPIAKKSHAIGHTRQDELARFNGETDETLSEIRLVKLSN
FT                   AEQQASQQGQTAIGSLYKIGLREAIYDSVAGPIMTAVMMGLIVGILAYGSARVAQGTMT
FT                   IGAMFSFLMYLFQLMGPAATLGQFFTTLSKASGSTERIQELMQESEEDFDHGTAVDVEG
FT                   QTLKVESVDFGYEDDQTILHDLSFEAKPNTVVAFAGPSGGGKSTIFSLLERYYEPNQGA
FT                   IKIGETSINDVSLADWRKQIGFVSQDSAIMAGTIRDNLTYGLTGEYADAQLWAVLQLAF
FT                   AEKFVREMPEGLDTEVGTRGVKVSGGQRQRLAIARAFLRDPKILMLDEATASLDSESEA
FT                   MVQKALETLMEGRTTLVIAHRLSTIVDADQIYFIENGHVSGAGKHQELVANHELYREYV
FT                   ETQFNQD"
FT   regulatory      228740..228774
FT                   /gene="lmrA"
FT                   /locus_tag="LCA_0232"
FT                   /old_locus_tag="LSA0232"
FT                   /regulatory_class="terminator"
FT   regulatory      228845..228858
FT                   /locus_tag="LCA_0233"
FT                   /old_locus_tag="LSA0233"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        228861..229244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0233"
FT                   /old_locus_tag="LSA0233"
FT                   /product="Putative NA(+):H(+) antiporter (N-terminal
FT                   fragment), authentic frameshift"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54533"
FT                   /db_xref="GOA:Q38Z44"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z44"
FT                   /protein_id="CAI54533.1"
FT                   /translation="MNEFYLVALLLVGVIVVNVVKQLVPRIPEAFLLIAMGWGLSFMPV
FT                   FHNFQLEPEFFMLLIIAPLMFIDGQKQSFANIRKRFRGIFLLSVVLAGVTAAVVGVMTK
FT                   QIEARRLRWPQSSHQPMQSRSNQ"
FT   CDS_pept        229241..230914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0234"
FT                   /old_locus_tag="LSA0234"
FT                   /product="Putative Na(+):H(+) antiporter (C-terminal
FT                   fragment), authentic frameshift"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54534"
FT                   /db_xref="GOA:Q38Z43"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z43"
FT                   /protein_id="CAI54534.1"
FT                   /translation="MTGNNDMPKGVGEALELESLFNDATGLVMLDLALSVLSKGTFSVV
FT                   EGIGHFLFVAVGGVLLVMLRFNLNRHGKNPELTTIPISLLTPFAIYLLAEHFGVSGILA
FT                   VVTTGIEHNWEADRLRLTSTNVQLTSRTIWNILADILNDFVFLILGISLPEVARNVTQM
FT                   GWQGAAALLGVSVLVYVVMWIVRYVWALRGDSASISAFFGDRKSDERPFFARLFAVSGI
FT                   HGTVTLAMAFSLPNKIAGHAFPYRDELIAIATFVILISMVVSSIVLPRMLPQKTEAYTM
FT                   ADLDHIRNKMVDYVILQMRSQIEDHAVREALTDQLQSQKSNRLTVDRAQSTANYNALLS
FT                   ETKEVVDNFLHCEDVNNRYSPEIVNIYDKILRRVLVEPKRNHFTLRMKHSIKHWKKEVL
FT                   WHTSHRVITHEQQRRFRDARIAENPELSEQIKQREVMRDDLLALNNEVTDTIDHYLDTV
FT                   LENRLKQKHSDNDFVYLVRRTMNHFCAHIKHDYQKSAATVPDILYVQAFQHEYDFVQQG
FT                   INAGYINQSIAGVLYTEINQAQLLQLQQFQETEEMALIEA"
FT   regulatory      230932..230961
FT                   /locus_tag="LCA_0234"
FT                   /old_locus_tag="LSA0234"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(230932..230961)
FT                   /locus_tag="LCA_0235"
FT                   /old_locus_tag="LSA0235"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(230973..232667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0235"
FT                   /old_locus_tag="LSA0235"
FT                   /product="Hypothetical extracellular protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54535"
FT                   /db_xref="GOA:Q38Z42"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z42"
FT                   /protein_id="CAI54535.1"
FT                   /translation="MIKKKAIMIGAGLSNMAAAVYLIQEGGWSGDAITFYSLDDHGSND
FT                   GAPVSETTDEYWNKNHPLENTKGYVARGGRMLNYRTYVDLMDLLDRIPSATEPNMTAEE
FT                   DTRSFDAQHRTFDKARLLEGSKGILDAGHLGFNNKDRLLMTKLIMMPDSEEEKLDNVSI
FT                   AEYFKDDPHMFQTNFWYMWETTFAFRTQSSAQELRRYMHQMIYEFTQIEHLVGVNRTRY
FT                   NQYESIMLPLINYLKDQGCRIILNRRITDLDFKETQMTDEITVTGMTMTNTETDEVEHI
FT                   TVDDDTAVIFTNGSITDSATLGDYNTPAPENMDYGAAAGLWKQIASKFYNLGNADKFFA
FT                   DRNASEWVSFTLTTKNHILLNEIERITTQIPGNALNSFLSTKPITPLGQKDVNMSIVVH
FT                   HQPHFTTQKPNEAVIWGYFLYPRRSGEFVDKPYIEMTGKEMLQELIGQLAKVDPGPINI
FT                   REKEAEIMDSIINNIPVYMPYASALFNNRAKTDRPEVIPEHSTNLAFTGEFVEQPYQMI
FT                   FTEQSAVRSGEIAAYHFAGIPMAKLVDTPRYDRDIKTLMRATKKMFE"
FT   regulatory      complement(232671..232684)
FT                   /locus_tag="LCA_0235"
FT                   /old_locus_tag="LSA0235"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(232708..232836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0236"
FT                   /old_locus_tag="LSA0236"
FT                   /product="Hypothetical extracellular peptide precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54536"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z41"
FT                   /protein_id="CAI54536.1"
FT                   /translation="MKKFLLGSLVLAGITVTGACLVAKKMELFRDDSVDYEKFESR"
FT   regulatory      complement(232839..232852)
FT                   /locus_tag="LCA_0236"
FT                   /old_locus_tag="LSA0236"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      233141..233154
FT                   /locus_tag="LCA_0237"
FT                   /old_locus_tag="LSA0237"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        233156..233911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0237"
FT                   /old_locus_tag="LSA0237"
FT                   /product="Putative DNA-binding protein, XRE family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54537"
FT                   /db_xref="GOA:Q38Z40"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z40"
FT                   /protein_id="CAI54537.1"
FT                   /translation="MNIGHQIKQNRLKREWTQGYLAQLLNVSRSTVSSWEVGRNYPDLE
FT                   TIVAISDLFAISLDKLLREDSVMTKEVSKRMHMNKYYKIVLTMIAVILLGLVISNRRLN
FT                   QLEQRYRENLTHYGWHLDKDTSPYANNSAYELKTEDTTYYTYILPTGYNPIPLEERKVN
FT                   IITRRNGHVVDVLDSQHITVVFSKSNDAKLKYQGSGQVNLAGELIADQPRLTGAKKAYF
FT                   KAYLKQHQKTYQALIQNSLQKKQEIITKR"
FT   regulatory      233987..234000
FT                   /locus_tag="LCA_0238"
FT                   /old_locus_tag="LSA0238"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234003..234863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0238"
FT                   /old_locus_tag="LSA0238"
FT                   /product="Putative aldo/keto reductase (oxidoreductase)"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54538"
FT                   /db_xref="GOA:Q38Z39"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z39"
FT                   /protein_id="CAI54538.1"
FT                   /translation="MQKLSALTAPMALSNGVTIPGLGYGTYQTPNEETKKAVLEALSVG
FT                   YRHIDTAAVYGNEQGVGDALKESDIAREDIFVTSKLWNTERGYDATKAAFAKTIATLGV
FT                   DYLDLYLIHWPANTKQFGAKAAELNAETWRAMEDLYNEGKIRAIGVSNFMPHHLDELMK
FT                   TAVIKPMVDQIEVHPGWPQAEAVRYNQAHDILVEAWAPLGEASALSNETIAAIATKHGK
FT                   TAAQVCLRWGIQQGVLPLPKSTHQERMAQNTDIFDFELTDAEMTQISALENLGGQCMVP
FT                   DEVDF"
FT   regulatory      234870..234883
FT                   /locus_tag="LCA_0239"
FT                   /old_locus_tag="LSA0239"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234885..235310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0239"
FT                   /old_locus_tag="LSA0239"
FT                   /product="Putative transcriptional regulator, MerR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54539"
FT                   /db_xref="GOA:Q38Z38"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z38"
FT                   /protein_id="CAI54539.1"
FT                   /translation="MALSIGEVAQQYDLSIPTLRYYEEQGLLPFIKRSPAGRREFRQAD
FT                   LDCLCDIECLKKTGMQLKDIKQYIDWRTAGDETLDQRLALIQQRRQMLASEIESLQAEL
FT                   TKLDHKEWYYTKASEAGTEAIFTAGCDTEYERAHQNK"
FT   regulatory      235318..235341
FT                   /locus_tag="LCA_0239"
FT                   /old_locus_tag="LSA0239"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(235318..235341)
FT                   /locus_tag="LCA_0240"
FT                   /old_locus_tag="LSA0240"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(235365..235883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0240"
FT                   /old_locus_tag="LSA0240"
FT                   /product="Putative N-acetyltransferase, GNAT family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54540"
FT                   /db_xref="GOA:Q38Z37"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z37"
FT                   /protein_id="CAI54540.1"
FT                   /translation="MSIEKVTSKQLKALQTISIQTFTDTFGADNSEQDLADYLDSAYSD
FT                   TQLSSEIANPNSAFYFIKHNGNIAGYLKLNSNDAQTENPNPDSMEVERIYILPTFKRLG
FT                   LGTQLIEYAIKMAQEAHKAHIWLGVWEHNTAALTFYTKLGFKQIGDHIFQLGDDAQRDL
FT                   IMQKDLNLH"
FT   regulatory      complement(235885..235898)
FT                   /locus_tag="LCA_0240"
FT                   /old_locus_tag="LSA0240"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(235903..236355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0241"
FT                   /old_locus_tag="LSA0241"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54541"
FT                   /db_xref="GOA:Q38Z36"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z36"
FT                   /protein_id="CAI54541.1"
FT                   /translation="MKDILRPIGIIARSLDSIANIEFKKFDLTRGQYLYLVRIAENPGI
FT                   IQERLIELIKVDRATVTRAIQKLSRAGLITRQADETNLKIKHLYLTPAGQAIYPEIKRE
FT                   NDYSNQVALQGLTTAETQVLHELLTKVSTNVAADWEQVKKGQQRPY"
FT   regulatory      complement(236358..236371)
FT                   /locus_tag="LCA_0241"
FT                   /old_locus_tag="LSA0241"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      236645..236658
FT                   /locus_tag="LCA_0242"
FT                   /old_locus_tag="LSA0242"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        236661..237815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0242"
FT                   /old_locus_tag="LSA0242"
FT                   /product="Hypothetical extracellular protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54542"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z35"
FT                   /protein_id="CAI54542.1"
FT                   /translation="MTFKKSIISAVTVSLVGVTIASTQPAFASSSAAAKEAIQKNQDDA
FT                   KALLKQIAAANEEGIKLDQQIKDNSAKIATQEAAIKEATDEIDNLSTKIDAAKEEVAKR
FT                   TTVLEGQLISLQKTSGDAVSGNVYVDFILNSDNLTDLVARTFTVNKLNEASKEALADVN
FT                   ESKAKLTDLKDNQEKAKAKLEADKADLEKQKTNLLDLKDKATKNQNDLTKKINDNKKAL
FT                   TALKADYDKANKAETEKELKELAASAAEGEKGTDSSVGEGKKATSSAGNAYAWGQCTWY
FT                   VKAVAPWAGNSWGNGNQWGASAAAAGFTVDHNPAAGTIISFAAGQKVGSWAADPSYGHV
FT                   AYVQSYDADKNTVTISQGGLGFGNPAGPNTQTVSNARSLTYIHK"
FT   regulatory      237988..238001
FT                   /locus_tag="LCA_0243"
FT                   /old_locus_tag="LSA0243"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        238004..239818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0243"
FT                   /old_locus_tag="LSA0243"
FT                   /product="Putative glycerophosphodiester phosphodiesterase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54543"
FT                   /db_xref="GOA:Q38Z34"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z34"
FT                   /protein_id="CAI54543.1"
FT                   /translation="MRRLFRFLKANFQAFGRHWSVYVLLVVSINLVLTSLIVPGLTWGV
FT                   NRLLVVNGIGYLTYTNFVSVLTKHPLVLISLVLLVLLICGLVYIQMAFLFRQIKRIQEQ
FT                   TPASQWQLLKQSGHDLLTLKPLTMLIMIGYFLLILPFGQIIFKSVLLNKVTIPAFIIQD
FT                   MWTTPKIWGPIILVYTLALILSIRLITFLPETIFNKKLSTTRLLQKCWQTTRGRFWRLL
FT                   IKVGVLAIAITLVGVLSQLLFFNLQRYYDQNLPHYALLLAILNLFILEIISQILLAMSI
FT                   VMILQLILKQAGYLVPSETRVKVILKQRSLRIRMRQGAAMLLLILVAAGVALYDYAYLE
FT                   GAMDNRPALISHRGVDDGNGVQNTIPALQKTAREKPDYIEMDIQETKDHQFVVMHDNNL
FT                   EELAGVNRTVHELTLAELTALTVRENGYSAKIPSFDQYLTAAEKAHQRLLVEIKVSPQD
FT                   SPQMMTNFIKRYQQRLLKKGNRIHSLSYPVVAVLKKQAPRLFVSFILPYNISFPETPAN
FT                   AYTMEATTLNAAFINQAHAGNQAVYAWTVNDPDVMQRLLLTEVDGIITDNLSDLKDVVA
FT                   ENNDHPSYATRLLIYSSQLAGFSGESEN"
FT   regulatory      239832..239857
FT                   /locus_tag="LCA_0243"
FT                   /old_locus_tag="LSA0243"
FT                   /regulatory_class="terminator"
FT   regulatory      239961..239974
FT                   /locus_tag="LCA_0244"
FT                   /old_locus_tag="LSA0244"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        239981..240652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0244"
FT                   /old_locus_tag="LSA0244"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54544"
FT                   /db_xref="GOA:Q38Z33"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z33"
FT                   /protein_id="CAI54544.1"
FT                   /translation="MTEKMAISDKILYGGLLAAAGGFDSYTFLVHGQVFAGLQTGNLIL
FT                   LGTHIGQMKWAVLMQHITPILAFMLGTILTRVVQHHFKEADSINKRQRLILGVEIAVLT
FT                   VIAGISPYIPDLLASASVSMIAAAQLQEFRELNGGPFTSLMMTGNVRTLAESLYDGIFK
FT                   KNTQALDKAWEIIRIIISFTLGAVMTGLCVSLLGERTIILSAVFLLVTLLILQVNPHKK
FT                   I"
FT   regulatory      240658..240683
FT                   /locus_tag="LCA_0244"
FT                   /old_locus_tag="LSA0244"
FT                   /regulatory_class="terminator"
FT   regulatory      240726..240739
FT                   /locus_tag="LCA_0245"
FT                   /old_locus_tag="LSA0245"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        240742..241317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0245"
FT                   /old_locus_tag="LSA0245"
FT                   /product="Hypothetical lipoprotein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54545"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z32"
FT                   /protein_id="CAI54545.1"
FT                   /translation="MKKSPLLIGLLTIALLAGCSNQQAKQTASTKKATTVKQQTPTKLQ
FT                   PKVSLEKARELFKQQYPNADISELQLKKQLNKTVYHLTGLSDTEELEMQIDSQTGDISH
FT                   LTKETLDTDEQHGVARQKERFDFKSLMTLEAAQKKAQHYFDGDVLEATLEKDDGVVYWE
FT                   IEGHQKHQKMQVKIDATTGEVVDTELDD"
FT   regulatory      241331..241354
FT                   /locus_tag="LCA_0245"
FT                   /old_locus_tag="LSA0245"
FT                   /regulatory_class="terminator"
FT   regulatory      241456..241469
FT                   /gene="mntH1"
FT                   /locus_tag="LCA_0246"
FT                   /old_locus_tag="LSA0246"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        241472..243046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH1"
FT                   /locus_tag="LCA_0246"
FT                   /old_locus_tag="LSA0246"
FT                   /product="Mn(2+)/Fe(2+) transport protein"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54546"
FT                   /db_xref="GOA:Q38Z31"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z31"
FT                   /protein_id="CAI54546.1"
FT                   /translation="MNKVKGPKKHKLIEYANGPSLEEINGTVEVPEGKTFWKTLLAYSG
FT                   PGALVAVGYMDPGNWSTSITGGQSFQYLLMSVILVSSLIAMLLQYMAAKLGIVTQMDLA
FT                   QAIRARTSKSLGIVLWILTELAIMATDIAEVIGAAIALYLLFNIPLVIAVFITILDVML
FT                   LLLLTKVGFRKIEAIVVALIVVIFVVFAYEVALSNPDWAGVIVGLVPTAKTFATTPNVG
FT                   GMSPLTGALGIIGATVMPHNLYLHSAISQTRKIDRNNEEQVAQTVRFSTWDSNIQLTMA
FT                   FFVNALLLIMGVAVFKTGAVKDPSFFGLFEALSDTSTMSNGILASVARTGILSTLFAVA
FT                   LLASGQNSTITGTLTGQVIMEGFVHLRMPLWLRRLVTRLLSVIPVLICVMMTSNKPPLE
FT                   EHQALNTLMNNSQVFLAFALPFSMLPLLMFTDSRVEMGDRFKNSLVIRVLGWLSVIGLT
FT                   YLNMLGLPGQIEAFFGDQATAAQLALADHIAYVLIAAVLALLVWMIVELYKGNQRFEQQ
FT                   LAAQAAE"
FT   regulatory      243048..243061
FT                   /gene="usp2"
FT                   /locus_tag="LCA_0247"
FT                   /old_locus_tag="LSA0247"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        243064..243498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usp2"
FT                   /locus_tag="LCA_0247"
FT                   /old_locus_tag="LSA0247"
FT                   /product="Similar to universal stress protein, UspA family"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54547"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z30"
FT                   /protein_id="CAI54547.1"
FT                   /translation="MSILNMRRVLVGVDDSADALLAFEYAIKRAVKDDLELVIVSVLEN
FT                   DELNVYQALNKDYIHGQYNDLEKHVLDYQEQARAEGVKNVRAVIAEGEPGEVIIKEVIP
FT                   KVQPDLLIIGSKAKEGIAKYFGSQAAYMAKYAPVPVLVVR"
FT   regulatory      243512..243544
FT                   /gene="usp2"
FT                   /locus_tag="LCA_0247"
FT                   /old_locus_tag="LSA0247"
FT                   /regulatory_class="terminator"
FT   regulatory      243591..243604
FT                   /locus_tag="LCA_0248"
FT                   /old_locus_tag="LSA0248"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        243609..244349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0248"
FT                   /old_locus_tag="LSA0248"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54548"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z29"
FT                   /protein_id="CAI54548.1"
FT                   /translation="MDEVAEFWDDFAAEYYQIQKESQVPIVTDIEKFLVEQRLLPTNSV
FT                   VDLGGGSGRYLPALAQNSQQYTIVDISEQMLRYAQVENQALAKPRSVTYQQQSVADFSQ
FT                   QTPDQSYDLVWMALNPAVTADETLLTITQKSRQWCGFLRLTQNTDDLFAPLEQHFEIAE
FT                   ENPNIEPTIIPAVVKLLTSAGYQVRQQRFQYQTTETFDRAFLEAYYAEVPQALLSTYLD
FT                   QVFANQKTRTSTTTLEYTLLYWHV"
FT   regulatory      complement(244297..244346)
FT                   /locus_tag="LCA_0249"
FT                   /old_locus_tag="LSA0249"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(244364..245428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0249"
FT                   /old_locus_tag="LSA0249"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54549"
FT                   /db_xref="InterPro:IPR040628"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z28"
FT                   /protein_id="CAI54549.1"
FT                   /translation="MLYPDSLTQLLTDSSQPVVSLFINLDTGGQALSANKIKLNSYAKQ
FT                   IRDQLLADHPDQAGLLKQVEACLSVAPQELAHVQSIALYITENKCYHLILHYPINTEYF
FT                   TIDAHPDLRPLSSELALSLNGTILNLNKTSFSLKTIQQNVIRDYPLPADAPTTIEEGIG
FT                   TDRKGEVVQGFSSPTHSYVVKDNEQLIDQTNYFRVIDRYLTELLPQKAPIYVVTLPGNL
FT                   NLFKELATNVNYQLDQTIQTSPESLTDDELLTTLLKDGRQRLRQEALALAERATNTYHS
FT                   DPELGNPDIILSRINNRQLTALIVPTALTPSSTISADQIPVLNSLLVAAVKTGLALYPV
FT                   PVENLPTGLIALGF"
FT   regulatory      complement(245431..245444)
FT                   /locus_tag="LCA_0249"
FT                   /old_locus_tag="LSA0249"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      245565..245578
FT                   /locus_tag="LCA_0250"
FT                   /old_locus_tag="LSA0250"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        245582..246370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0250"
FT                   /old_locus_tag="LSA0250"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54550"
FT                   /db_xref="GOA:Q38Z27"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z27"
FT                   /protein_id="CAI54550.1"
FT                   /translation="MKKQTATVTPTAISKSIRTRFFVLQMVVILVLGSVTAKIVSGFNP
FT                   LMTDSEILNKTILMALGSTVVALIIWYVSYKLIAFQIKRQVMDKELEDRYTFNLSHAAS
FT                   SLSLHIVYFISIVVIVWLMMSAQSVRADLDGLNLFKTDQPTVKLVDQHSMKQINRFYKK
FT                   TDNQSVQYLGSQQDRAYFKVDQATISLPLSKVQFNGQDQGKVKNPLKIETYQLKQPANK
FT                   KYLKPTIYLSQKGLPTVPVTKMYQHYTPKSSETVQKLDIE"
FT   regulatory      246440..246453
FT                   /gene="efp1"
FT                   /locus_tag="LCA_0251"
FT                   /old_locus_tag="LSA0251"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        246457..247020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp1"
FT                   /locus_tag="LCA_0251"
FT                   /old_locus_tag="LSA0251"
FT                   /product="Elongation factor P (EF-P)"
FT                   /function="3.7.4 Translation elongation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54551"
FT                   /db_xref="GOA:Q38Z26"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z26"
FT                   /protein_id="CAI54551.1"
FT                   /translation="MIEAVNLRAGMAFEQDGKLIKVLEANHHKPGKGNTVMRVKLRDLR
FT                   TGSIVETTMRPEVKVEQAMIDTKDVQYLYTQDNVAFFMDLETYEQYEIQTSAIEAELKY
FT                   LLENMNCKIQFFGSEVIGVTLPTTVNLRVVETQPSIKGATVTGSGKPATMETGLVVSVP
FT                   DFISADEVLEINTQEGTYVKRAAK"
FT   regulatory      247052..247075
FT                   /gene="efp1"
FT                   /locus_tag="LCA_0251"
FT                   /old_locus_tag="LSA0251"
FT                   /regulatory_class="terminator"
FT   regulatory      247197..247210
FT                   /gene="iunH1"
FT                   /locus_tag="LCA_0252"
FT                   /old_locus_tag="LSA0252"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        247214..248149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH1"
FT                   /locus_tag="LCA_0252"
FT                   /old_locus_tag="LSA0252"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54552"
FT                   /db_xref="GOA:Q38Z25"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z25"
FT                   /protein_id="CAI54552.1"
FT                   /translation="MTKKIILDCDPGHDDAVAMMIAHGNPEIDLLAVTTVAANQTLTKV
FT                   TRNALAVATMIGMHDVPIAAGCSRPLIEEIKVAADIHGESGLDGVVLPKPTVELEKIHA
FT                   VDLIIDLIMSHPAKTITLVPTGALTNIAMAARKEPKIIDRVKEVVLMGGGYHEANASAV
FT                   AEFNIKFDPEAAKIVFNAGWQVTMVGLDLTHQALATPDIVSEIKAIHTETSAFVVDLLA
FT                   FFRDMYKKGQNFDAPPVHDPCAVAYVIDPTVMTTKKVPVDIELNGTLTRGMTVADFSYP
FT                   IPEDCQTSVAVKLDHAKFWGLVEDALRTIG"
FT   regulatory      complement(247988..248016)
FT                   /locus_tag="LCA_0253"
FT                   /old_locus_tag="LSA0253"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(248146..249237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0253"
FT                   /old_locus_tag="LSA0253"
FT                   /product="Putative transcriptional regulator with a sugar
FT                   kinase domain, GntR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54553"
FT                   /db_xref="GOA:Q38Z24"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z24"
FT                   /protein_id="CAI54553.1"
FT                   /translation="MTKREEEILKIIKENPLISQQELADKFGLTRSGVAAHIFNLTKKG
FT                   YIAGKGYIINEPNFVTVIGGVNIDILGLTDTTLIQQNSNPGHITFSLGGAGYNIAHNLT
FT                   KLAVPNYFITVYGDDLNGQKFEEDAQKNHLAIQHSKKIPDKSTSSYLYVNDPDGTLNVG
FT                   VDDMGIYDDITPDFLSERLATINTSAYCIIDTNLPEKTIDWLFDNCKVPIFVKTVSLNK
FT                   SYKLQNVLSKIDTLMTTDKELAMLTNSSVTDAKTAEKSAKKLLKKGIEHIYVLMPHTGL
FT                   FYIDNRNTKLIAGIPIKRVNNNGASAALTAAVVDSRLNNLGWEKTTQIAYTAALICMES
FT                   AKSVNPLLSKDYLLKTVTRYLES"
FT   regulatory      complement(249241..249254)
FT                   /locus_tag="LCA_0253"
FT                   /old_locus_tag="LSA0253"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      249390..249403
FT                   /locus_tag="LCA_0254"
FT                   /old_locus_tag="LSA0254"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        249406..250344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0254"
FT                   /old_locus_tag="LSA0254"
FT                   /product="Putative carbohydrate kinase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54554"
FT                   /db_xref="GOA:Q38Z23"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z23"
FT                   /protein_id="CAI54554.1"
FT                   /translation="MEDKYVVVVGGLNMDIAGMPGKDFIERDSNPGEVNLSVGGVGQNI
FT                   AHNLANLGVPTYLMTVYGDDQYGAILHRECETNKINLDYAAEIKGANSSTYLYVTDGSG
FT                   DMLAAINDMSIVNNITPDFLKERLAVINQATLCIVDANIPQESIEWLADHLKVPMYVDP
FT                   VSVAKARRFENVLNKIDTFKPNEMEAELLTGIKISDESSAKMAAEYLVNQGIRHVFISL
FT                   GAHGILCADESQTVLVPIIKVPIISCNGAGDCSMATIAWAYYHFGKKASLKEIGQYAQA
FT                   ASSITVGSASAVSSHLTAQNVIDRCRQAVKN"
FT   regulatory      250346..250359
FT                   /locus_tag="LCA_0255"
FT                   /old_locus_tag="LSA0255"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        250363..251058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0255"
FT                   /old_locus_tag="LSA0255"
FT                   /product="Putative phosphoribosyl isomerase"
FT                   /function="2 Intermediary metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54555"
FT                   /db_xref="GOA:Q38Z22"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z22"
FT                   /protein_id="CAI54555.1"
FT                   /translation="MIKKQIYSLITYDESVKTMEAGADHIGLVPMQDGGVPAHRVPLET
FT                   VDKIFAEAKRRGVVTVAIMLNKDPKEMLDIAKRVRPDILHIAGMEYTADQAFRDQLRAV
FT                   CPETELMQAVLVDGPEAVERAKEYAKFSDYLLTDSGLAADTGIGASGLTHDWSIDAAIV
FT                   ANVDIPVIIAGGLGPDNVEECIKEIKPYGVDSLTKTSIKYDGGRMEKDIDKVREFCERA
FT                   DKAAAEVGL"
FT   CDS_pept        251107..251370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0256_a"
FT                   /old_locus_tag="LSA0256_a"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0256_a"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54556"
FT                   /db_xref="GOA:Q38Z21"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z21"
FT                   /protein_id="CAI54556.1"
FT                   /translation="MATAIIGVFLVCVGVAINNNTQLGNDPVGIIYDGIRQAAQLSHAQ
FT                   LGVTSNYINTGLIIILFFFGRKYINVGTLIYLVPAPMSRIRT"
FT   CDS_pept        complement(251511..252308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB3-IS1520"
FT                   /locus_tag="LCA_0256_b"
FT                   /old_locus_tag="LSA0256_b"
FT                   /product="Transposase (orfB) of IS1520 (IS3 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0256_b"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54557"
FT                   /db_xref="GOA:Q38Z57"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z57"
FT                   /protein_id="CAI54557.1"
FT                   /translation="MLEVVNANLLAGHRITRILSVLKIPRSTYYDYLHWQPSRTERRRH
FT                   LIKQEVLTAWLRYPMYGYPRLTILLNQQSDIHVSQRLVYQQMCELGIRSRMVKRINKPT
FT                   TQTDYDQRPNLIKQLTDQSGILLTDITYIPLNHTWCYLASVYNPVTRRVIAYQLNTQMT
FT                   KELATNVITQVMAQAVKPQIIHSDMGSQYTSDLFENTLSKYGIKHSYSRKGQPGDNARI
FT                   ESFHSILKREYVNFQDFKTIHEAIAGIDNYIRWYNSDRISLVA"
FT   regulatory      complement(252311..252324)
FT                   /gene="tnpB3-IS1520"
FT                   /locus_tag="LCA_0256_b"
FT                   /old_locus_tag="LSA0256_b"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(252329..252580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA3-IS1520"
FT                   /locus_tag="LCA_0256_c"
FT                   /old_locus_tag="LSA0256_c"
FT                   /product="Transposase (orfA) of IS1520 (IS3 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0256_c"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54558"
FT                   /db_xref="GOA:Q38ZD5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q38ZD5"
FT                   /protein_id="CAI54558.1"
FT                   /translation="MAIKYSNEFKESIVSLSQTGRSANSLAKEYNVSVSTVTKWIKQAD
FT                   PNNTKVLSSNERALIKENKRLKEELDILKRAAVLMAKS"
FT   regulatory      complement(252584..252597)
FT                   /gene="tnpA3-IS1520"
FT                   /locus_tag="LCA_0256_c"
FT                   /old_locus_tag="LSA0256_c"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        252814..253011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0257"
FT                   /old_locus_tag="LSA0257"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54559"
FT                   /db_xref="GOA:Q38Z18"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z18"
FT                   /protein_id="CAI54559.1"
FT                   /translation="MLTLRDKTGWSIRRSKITMDVVLIIAGVLLGGRFGAITILTALTT
FT                   GPAIQYLSQLFSQLLYGERI"
FT   CDS_pept        253021..254172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0258"
FT                   /old_locus_tag="LSA0258"
FT                   /product="Putative iron-containing alcohol dehydrogenase
FT                   (oxidoreductase)"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54560"
FT                   /db_xref="GOA:Q38Z17"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z17"
FT                   /protein_id="CAI54560.1"
FT                   /translation="MDYKLVQKTKVLVTDDLPKTILSILKETQYKKPLIVMDSFLKEVA
FT                   IVKRLQVKLTENNIQFSIYDKVVSDPPTTVVDEGAEFFKAQDCDSLIAIGGGSAIDVAR
FT                   GINIVRINGGKISEYVTASNEIKDCPGLIAVPTTSGTGSELSNALIVTDTENQTKLAVL
FT                   ANNAVSEFAVLNPELVMTLPKGMTIATGLDAFSHAAEGYTSTLASPVTDAICEKIMYLL
FT                   VKYLPKVIEDGQDREARERVMVAATLGGWMLNNAGTHAGHSVAHVIGSKYHMPHGMACA
FT                   YALPGVLQFIAPVRSKKVKEIGLILGAEYPADPTDTEIGRITAIQYREFRDKVLGMKPF
FT                   TDFNISEDELLTNIESVVNERFAGNTPKQIDQEGAMMLLKNFG"
FT   regulatory      254179..254192
FT                   /locus_tag="LCA_0259"
FT                   /old_locus_tag="LSA0259"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        254195..255385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0259"
FT                   /old_locus_tag="LSA0259"
FT                   /product="Pyrimidine-specific nucleoside symporter"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54561"
FT                   /db_xref="GOA:Q38Z16"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z16"
FT                   /protein_id="CAI54561.1"
FT                   /translation="MSILMGIVGLVFIFAIGWLVSSNRKKIRYKQIGILLVTQFVISFL
FT                   CLHTSGGVKVLAGISNFFSWLMGQAAGGVDFVFGGVVIKSGASVFFLNVLMPIVFISAL
FT                   VGILNYIKVLPFIIKWLGKGINKLSGMGELESYFAVSTAVLGQPEVFLTIKERIPNLSP
FT                   QRLYTICASAMSAVSAAMLASYMKMVPGKFVVVAVFLNIFSALIISCIVNPYEPEVEDQ
FT                   KTIEAHLSTEKEPFFQVLGNYIVDGFQLALTVAAMLIGFVSLVTFLNNTFGFFFNVTFT
FT                   DIIGWVFAPVAFVIGVPADDIVKVGSLMATKLITNEFVAMGNLSQIAHSLSPKATAIIS
FT                   TYLVSFANFGTIGIISGSIKAIDKKQGAVVAKFTMKLLLGATMASMLTGTIVGMYF"
FT   regulatory      255397..255421
FT                   /locus_tag="LCA_0259"
FT                   /old_locus_tag="LSA0259"
FT                   /regulatory_class="terminator"
FT   regulatory      255484..255497
FT                   /locus_tag="LCA_0260"
FT                   /old_locus_tag="LSA0260"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255502..256488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0260"
FT                   /old_locus_tag="LSA0260"
FT                   /product="Putative aldo/keto reductase (oxidoreductase)"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54562"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z15"
FT                   /protein_id="CAI54562.1"
FT                   /translation="MYNAKETRYDDMIYRRVGHSGLKLPAISLGLWHNFGETDKVATQK
FT                   EIIFGAFDMGITHFDLANNYGPPAGSAEENFGRILHSDLKQYRDEMIISSKAGYYMWPG
FT                   PYGEWGSKKNLIASCDQSLQRMQLDYVDIFYSHRPDPETPIEETARALDLLVHQGKALY
FT                   IGISNYSAEQTKAITKIFRELGTPFIIHQPRYNMLDRWIEDGLTDVLAEEGLGAITFSP
FT                   LAQGMLTNRYLNGIPTDSRAARPDSPFLSPEKVDQTISTVQELNKIAQQRGQSLAEMAL
FT                   AWNLQQPTVASVLVGASRLSQLQDSVHALDNLTFAPEELAAIQKVLK"
FT   CDS_pept        complement(256538..257350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB1-ISLsa2"
FT                   /locus_tag="LCA_0261"
FT                   /old_locus_tag="LSA0261"
FT                   /product="Transposase (orfB) of ISLsa2 (IS150 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54563"
FT                   /db_xref="GOA:Q38Z14"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z14"
FT                   /protein_id="CAI54563.1"
FT                   /translation="MAKSTYEYIISHEPNGSSDQSVKHAIQTIKKDHPAYGYRRVTGEL
FT                   HRMNILVNHKKVLVLMREMQLLSTAFNKRTRKYNSYKGNVGTVAKNLINRRFFTDRPYQ
FT                   KLATDVTEVRWGAKTIDERAYFTCIYDLFSGEILSHQVSKHPTVEFTTTVLNRAVKKIP
FT                   KDLEYRTTIHSDQGFQYQHQNWTNILKEHRIFQSMSRKATCLDNASMESFFHIMKAEAF
FT                   YQKETDTYETLVSQISVWIDDYNFSRIKTKLGCKSPVEYRIFTTQKAA"
FT   regulatory      complement(257353..257366)
FT                   /gene="tnpB1-ISLsa2"
FT                   /locus_tag="LCA_0261"
FT                   /old_locus_tag="LSA0261"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(257392..257709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA1-ISLsa2"
FT                   /locus_tag="LCA_0262"
FT                   /old_locus_tag="LSA0262"
FT                   /product="Transposase (orfA) of ISLsa2 (IS150 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54564"
FT                   /db_xref="GOA:Q38Z13"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z13"
FT                   /protein_id="CAI54564.1"
FT                   /translation="MNVLKWTKTNKASYPKTALHFNISNVGTIWQWQYILETEGADALY
FT                   RSKGRQIIMSADKQSKKRQQTELERLREENELLQIENEYLKKLRALVQEEEDNKHKSSK
FT                   S"
FT   regulatory      complement(257919..257952)
FT                   /locus_tag="LCA_0263"
FT                   /old_locus_tag="LSA0263"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(258072..258539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0263"
FT                   /old_locus_tag="LSA0263"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54565"
FT                   /db_xref="GOA:Q38Z12"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z12"
FT                   /protein_id="CAI54565.1"
FT                   /translation="MPTNKKEGIIFTTLMCFSMVLGMSIYNLFLHGGFSFVALITGLIP
FT                   GFIVAFILDVFVIGVLAKKIAFSLPLNKDNKLVMILTISCLMILGMVTCMSLFGVLIEG
FT                   GIPNDLGGAYRHAWAMNIIVALPLQLIVVGPFSRAILGKIQTNAATAETAE"
FT   regulatory      complement(258543..258556)
FT                   /locus_tag="LCA_0263"
FT                   /old_locus_tag="LSA0263"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(258582..260111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0264"
FT                   /old_locus_tag="LSA0264"
FT                   /product="Putative glycine/betaine/carnitine/choline
FT                   transport protein"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54566"
FT                   /db_xref="GOA:Q38Z11"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z11"
FT                   /protein_id="CAI54566.1"
FT                   /translation="MLLFGIVSAFLMLGGDTLQHSISQLLDTMTSHSQWLYIGIYIINF
FT                   IFLVWLGCSHYGRIRLGQPNEKPEYNDFQWGSMVFATGIDASILMLSTTDPLQYLQNPP
FT                   FGAKPFSAAAYRYANVCGQFNWGPMAWMIFATATIAIGYALYVKNLRVQRLSAAIDLLE
FT                   GPQTYKKVLRQLIDFIVVFGIMGGIGSSIGMEIPVISKVLSTMTGFSDTIWLKLALFVV
FT                   LFVLFTLTVYAGLNKGIKKLSAWHIYTAIGFLLLVLLIGPTRHLIGAEGHNLFHLFGKF
FT                   GQLSLNATGSDSHFAQHEMLFYWGWWLSYMPVMGLFIARISRGRTIRQVLLGMATYGAL
FT                   SCMSFYAILGGYALFLQSSGQVDLVTLLNTQGQAAVIAAVITTLPWKIVMLAIFCLSCF
FT                   IFLATTISSSAFIVSSFTSLELKIGEQPNRWNRMAWVVIFILFSLGIVLVGSFQTVQAV
FT                   CVIAGFPLIFVCALLLVSIFHAVHNGEIPIEIENEETSHFLKKKLTPKFFM"
FT   regulatory      complement(260208..260247)
FT                   /locus_tag="LCA_0265"
FT                   /old_locus_tag="LSA0265"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(260348..260881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0265"
FT                   /old_locus_tag="LSA0265"
FT                   /product="Putative transcriptional regulator, PadR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54567"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z10"
FT                   /protein_id="CAI54567.1"
FT                   /translation="MAQKNILQYLLLGLLNQAPKTGYDLKRVFENEIGEFWQAKHSQIY
FT                   PELKRLETEDLITHIELISGTKLKKKQYTITPSGVSYFNEWRYSPTSEILASKDEFILK
FT                   LYFIESKNDQHLPAMFAEQTTLHTDKLTHLLARKALVFPNQATITANYGHYLILEHAIN
FT                   REQDYLKWLATADC"
FT   regulatory      complement(260883..260896)
FT                   /locus_tag="LCA_0265"
FT                   /old_locus_tag="LSA0265"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      261070..261083
FT                   /gene="rpsN"
FT                   /locus_tag="LCA_0266"
FT                   /old_locus_tag="LSA0266"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        261086..261355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LCA_0266"
FT                   /old_locus_tag="LSA0266"
FT                   /product="30S ribosomal protein S14"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54568"
FT                   /db_xref="GOA:Q38Z09"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38Z09"
FT                   /protein_id="CAI54568.1"
FT                   /translation="MAKKSKIAKLAKQRALVAKYADLRATLKAEGNYAALAELPKDSSP
FT                   VRLRNRDLIDGRPRSFMRKFGMSRINFRELAHKGQIPGVKKASW"
FT   regulatory      261511..261529
FT                   /gene="rpsN"
FT                   /locus_tag="LCA_0266"
FT                   /old_locus_tag="LSA0266"
FT                   /regulatory_class="terminator"
FT   regulatory      261604..261617
FT                   /locus_tag="LCA_0267"
FT                   /old_locus_tag="LSA0267"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        261620..261664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0267"
FT                   /old_locus_tag="LSA0267"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54569"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z08"
FT                   /protein_id="CAI54569.1"
FT                   /translation="MSYSQFIQSATVSD"
FT   regulatory      261690..261703
FT                   /locus_tag="LCA_0268"
FT                   /old_locus_tag="LSA0268"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        261705..262880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0268"
FT                   /old_locus_tag="LSA0268"
FT                   /product="Putative drug:H(+) antiporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54570"
FT                   /db_xref="GOA:Q38Z07"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z07"
FT                   /protein_id="CAI54570.1"
FT                   /translation="MKNVSKKSPSILLMIVLVGFPQISESIFTPVLPMISRAFHVSAQT
FT                   AQLTMSTYFMAFAFGVLFWGWLSDQIGRRLTMLLGIGVYLLGNGGLLLAGHFSWLILAR
FT                   LVQAFGASVGSVVTQTIMRESFSGVRGAQVFAKVGAAMALAPALGPLIGGLVQTYFGYR
FT                   QVFSVLIMMAVGAILYAGACLPETRPAGVPAQINVGAVTKRLLTDKKVWVYGAVISGIN
FT                   GILFSYYAEAPFIFINHFHLSTVQYGWLGLVLAAASILGAMTTNYGAPKFGAVMMAKIG
FT                   LVLALIGSLLLLVASYYDQLLLMVILILIVFWGLNTTLPVVLNLALVGYEAVIGTASGL
FT                   FSFGYYLAISALTYGMSLLHTGAISRLPLYIVTIVAIMALWYGLVIRNNEE"
FT   regulatory      262888..262921
FT                   /locus_tag="LCA_0268"
FT                   /old_locus_tag="LSA0268"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(262888..262921)
FT                   /locus_tag="LCA_0269"
FT                   /old_locus_tag="LSA0269"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(262933..263604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0269"
FT                   /old_locus_tag="LSA0269"
FT                   /product="Putative transcriptional regulator, TetR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54571"
FT                   /db_xref="GOA:Q38Z06"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z06"
FT                   /protein_id="CAI54571.1"
FT                   /translation="MVKQTISAAQITAAAFEIMQTGGTVEQLSIRKIAAKLHIGVATFY
FT                   WHFENKQALLQAMSDEIIAGIQFPPTTTAMPWTKQIKLIFKTIYATYLEQPYAAELMLR
FT                   TVPATKIRLSLINRLLQILLDAGFTPEQSNLAIESIDHFMSGLFADIAGKIEMKQRALS
FT                   QTDPYLAQLPLKMKTIAADNHFDAFLKTFEHHRQQQQHSAEKFMLGLDIFLAGLEQQRH
FT                   S"
FT   regulatory      complement(263609..263622)
FT                   /locus_tag="LCA_0269"
FT                   /old_locus_tag="LSA0269"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      263731..263744
FT                   /locus_tag="LCA_0270"
FT                   /old_locus_tag="LSA0270"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263747..264820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0270"
FT                   /old_locus_tag="LSA0270"
FT                   /product="Putative multidrug ABC exporter,
FT                   membrane-spanning/permease subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54572"
FT                   /db_xref="GOA:Q38Z05"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z05"
FT                   /protein_id="CAI54572.1"
FT                   /translation="MSLLKQHLKPYLGVFSLSILATIISVASSLWQPKLLQNVLEGIMK
FT                   DDQDKVMQIGIYLIVIAVVGLIAGVVNTITSAITAQGMTADIRETTFRKIQTFSFANIE
FT                   KFSVGNLSVRLTNDMTQIQNVIMMSLQTLVRIPILFVGSFILAMNSIPSLWWIIILLVV
FT                   LVFVITFLSMGSMGKHFGAIQNLIDKINNLAKENLMGTRIVKSFVQEDNEINRFSKTSD
FT                   QLEKHTAVVGMLFSVMIPSFMLVANLAVVASIYFVGNLVDTDPEAIAAIASFMNYLMQI
FT                   MMSIIMGGMMMMMASRGAVSLKRLQKILSTDPDIVYPDVPDQDLAGTLAFEHVSFRYPE
FT                   DDHDTLNDISFEIMRVK"
FT   CDS_pept        264817..265458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0271"
FT                   /old_locus_tag="LSA0271"
FT                   /product="Putative multidrug ABC exporter, ATP-binding
FT                   subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54573"
FT                   /db_xref="GOA:Q38Z04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z04"
FT                   /protein_id="CAI54573.1"
FT                   /translation="MIGIVGATGAGKSTMAQLIPRLFDPTKGEIRIGGVPIKELNEHNL
FT                   HDSVSFVLQKAILFSGTIAQNLKHGKKDAGTADMDRATGIAQAKEFIEKLADTYDAPVE
FT                   ERSANFSGGQKQRLSISRGVIGQPKILILDDSTSALDAHSEKLVKEALDRELADTTTLI
FT                   IAQKISSVVNADRILVLDEGRLVGVGTHHELLETSAVYREIFETQKGKRG"
FT   CDS_pept        265462..267255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0272"
FT                   /old_locus_tag="LSA0272"
FT                   /product="Putative multidrug ABC exporter, ATP-binding and
FT                   membrane-spanning/permease subunits"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54574"
FT                   /db_xref="GOA:Q38Z03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z03"
FT                   /protein_id="CAI54574.1"
FT                   /translation="MKEFKRAMVFFYHYLKRYKPSFAIILVMTVFATYLQVKAPEYIGD
FT                   ALNELVKYATKFQVLKAQHLPTSGASKDAFIDVIVSLVLFYVLSSAATFVSSAAFSRVN
FT                   ALSTNRMRIGLFNKLQKMQIKYFDRHSDGDILSRFTSDLDNIYNAMNQVLSQLVSGTAL
FT                   LIGLLIMMFRKDTQLAWVTIASVPISFILAWIIINKAQKYVNVQQDEVGKLNGYINEKI
FT                   TGQKVIITNSLQAETIDGFVEHNESVRKATLKGQIYSGMIFPLMQGMSLVNTAIVIFFG
FT                   GWLAVNGDIKKSVALGLVVTFVQYSQQFYNQIAQLSSSYSMIQLAITGARRVNEVFDED
FT                   DEIRPTDGQQFNGIERSVTMEHVDFSYLPGKQILHDVNIEVDKGQMIALVGPTGSGKTT
FT                   VMNLMNRFYDVDQGAVKIDGVDIRDMDLDTLRSHVGIVLQESVLFAGTIRDNIVFGKPD
FT                   ATDDEVIAAAQQAHIHDFIMTLEDGYQTKVSEEDNIFSTGQKQLISIARTIITDPALLI
FT                   LDEATSNVDTVTESHIQKAMENVIQGRTSFVIAHRLKTILNADRIIVLKDGRIIEEGNH
FT                   QELLAQEGFYAELYNNQFVFE"
FT   regulatory      267388..267423
FT                   /locus_tag="LCA_0272"
FT                   /old_locus_tag="LSA0272"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(267388..267423)
FT                   /locus_tag="LCA_0273"
FT                   /old_locus_tag="LSA0273"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(267432..268523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0273"
FT                   /old_locus_tag="LSA0273"
FT                   /product="Putative DNA helicase (C-terminal fragment),
FT                   authentic frameshit"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54575"
FT                   /db_xref="GOA:Q38Z02"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z02"
FT                   /protein_id="CAI54575.1"
FT                   /translation="MQVSDFQSLNSGLPFTIDAATSYQFFLKTPVDAPLDKRIQATQQQ
FT                   LTSYLQEQLMTIAKTPTTLTRLESLTETEQQQTFGRLIREDEPLAPLALKMVRYDYQDL
FT                   SEQLHDYQWLAFDQIIARQSTVDAVIAAQVYGYLTQRVFPKVKQVFIDEVQDYHASSLH
FT                   LFKQLFPKAQFTVFGDQHQSLTPHKIQFSKLPAIFPNLKTQALRTSYRSSGAITALFSQ
FT                   LFPDLTDVHAVQPHDVQPTYLSATNDTDYLAQIQAQIEQLPTDQTLAIITPAGQFDERL
FT                   LKLKDVHHLSTETTTLPESGAFTLPLTLAKGLEFDNVLLYDLINDYYTEPTVGRNRLYT
FT                   AISRATHRLTLSALGTLPNALNA"
FT   CDS_pept        complement(268534..269481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0274"
FT                   /old_locus_tag="LSA0274"
FT                   /product="Putative DNA helicase (N-terminal fragment),
FT                   authentic frameshift"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54576"
FT                   /db_xref="GOA:Q38Z01"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z01"
FT                   /protein_id="CAI54576.1"
FT                   /translation="MTTDFEQEQTHLTTIYQQLTATLAAINDAQSQNHQAGNTIKAQIT
FT                   GEAKLNFDSYADNLDTFAALETINKEIDMLNLKTDSLIARKDETLRLLEQPYFAKITLT
FT                   FPEETDSEDFYLGSASYTNQDGEPVIFDWRSPIADVYYQQTFGPTSYQANGRQIPVTLN
FT                   QRRQFQIQADQLIDFFDTQIAIEDPLLLATLKEAKTTQMSAITATIQKEQNTIIRQQTT
FT                   DHLLIDGIAGSGKTSVIFQRIAYLLYRQRKELALNEVLMISPNRLFQDYIAQVLPDLGE
FT                   QTPVNLTLQQLLAQLLPEELADLPIAAQPVTPSN"
FT   regulatory      complement(269485..269498)
FT                   /locus_tag="LCA_0274"
FT                   /old_locus_tag="LSA0274"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(269616..269649)
FT                   /locus_tag="LCA_0275"
FT                   /old_locus_tag="LSA0275"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(269925..270722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0275"
FT                   /old_locus_tag="LSA0275"
FT                   /product="Putative serine/tyrosine protein phosphatase"
FT                   /function="1.3 Signal transduction"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54577"
FT                   /db_xref="GOA:Q38Z00"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Z00"
FT                   /protein_id="CAI54577.1"
FT                   /translation="MQEQQRVLNLTRSYNLRELGGYPTVDGKTVKWHKLLRSGSLNALT
FT                   ATDIEDLLNYGVAYDVDFRSRHEIKVAPDPFDDSQLTYHRLSVFPFTDQADAPKKPAKK
FT                   GLFHLFGKKEPATPERSSMDRMYEQLVTDSHAQAAYRDLFTVLLNNHGNDGAVLYHCSA
FT                   GKDRTGIGTMLILSALGVDWATIADDFVLSNEVLGLTTTAPTRISSNDAQVAAMNGKSV
FT                   SKAHLELARETIEHHYGNMDNYLAQAMALKPEEIAQLKKDYLE"
FT   regulatory      complement(270725..270738)
FT                   /locus_tag="LCA_0275"
FT                   /old_locus_tag="LSA0275"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      270956..270969
FT                   /gene="guaB"
FT                   /locus_tag="LCA_0276"
FT                   /old_locus_tag="LSA0276"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        270971..272452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="LCA_0276"
FT                   /old_locus_tag="LSA0276"
FT                   /product="Inosine-5-monophosphate dehydrogenase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54578"
FT                   /db_xref="GOA:Q38YZ9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ9"
FT                   /protein_id="CAI54578.1"
FT                   /translation="MSAWESKFTKKGFTFDDVLLVPAESNVLPNEVDLGVQLAKNIKLN
FT                   TPIMSASMDTVTEAPMAIAMARQGGLGVIHKNMSIERQADEVLKVKRSENGVIIDPFYL
FT                   TADKPVSAAEDLMRTYRISGVPIVSNLDELKLVGIITNRDLRFISDFSAEIGTVMTHEA
FT                   LVTAPVGTSLEEAEQILQQNRIEKLPLVGDDGRLAGLITIKDIEKVQEFPKAAKDQYGR
FT                   LLVAAAVGVTSDTFDRAEALLKAGADAIIIDTAHGHSAGVLRKIAEIRARFPEATLIAG
FT                   NVATAEGTKALYDAGVDVVKVGIGPGSICTTRIVAGVGVPQLTAIYDAASVAREYGKTI
FT                   IADGGIKYSGDIVKALAAGGNAVMLGSMLAGTDEAPGEFEIYQGRRFKTYRGMGSLAAM
FT                   SHGSSDRYFQSGVNEANKLVPEGIEGRVAAKGALGDVIYQLLGGLRSGMGYVGAANLRD
FT                   LQDNAQFVQISNAGLTESHPHDVQITKEAPNYSAR"
FT   regulatory      272470..272504
FT                   /gene="guaB"
FT                   /locus_tag="LCA_0276"
FT                   /old_locus_tag="LSA0276"
FT                   /regulatory_class="terminator"
FT   regulatory      272594..272607
FT                   /locus_tag="LCA_0277"
FT                   /old_locus_tag="LSA0277"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        272611..273297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0277"
FT                   /old_locus_tag="LSA0277"
FT                   /product="Two-component system, response regulator"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54579"
FT                   /db_xref="GOA:Q38YZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ8"
FT                   /protein_id="CAI54579.1"
FT                   /translation="MKILIVDDDKEIVELLSIYVKNEGYEPIQAFTGKEALTKIATNPG
FT                   IDLMILDIMMPNMSGIEVIKAVRKDSQVPILVVSAKTTDMDKIQGLITGADDYVSKPFN
FT                   PLEVMARVKSLLRRSQQQVTNEVPDILEVGPLVIKRDSHEVTTIAGKQIQLTALEFGIL
FT                   YLLASHPNRVFSADDIFERVWKQESIVSAKTVMVHVSHLRDKIEEATDGEKVIETVWGV
FT                   GYKVEV"
FT   CDS_pept        273297..274496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0278"
FT                   /old_locus_tag="LSA0278"
FT                   /product="Two-component system, sensor histidine kinase"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54580"
FT                   /db_xref="GOA:Q38YZ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ7"
FT                   /protein_id="CAI54580.1"
FT                   /translation="MNEYQVGQDFKKVQLTAKEKSELFAEGIITVILLLLLNLSIMVLL
FT                   QQAIVNNPQLRGGVWMIKNAIAIGPNGWHIWSWQNWFVILMGIADVLVVYWRLIRRYHQ
FT                   MQMWHVIGELHYIADGHLEHRINLRVNRDLQRVIDSVNTLVDSTVRSMEEERKIEKSKD
FT                   ELITNVSHDLRTPLTSIIGYLGLIEDNQYQTKDELTKYTHTAYVKAQQMKVLVEDLFEY
FT                   TKVRQTSTPIAKTTFDMEQMLEQLAASFELEAQKKNMQITVECQPTPLMMEADTEKLGR
FT                   VFNNLIANALKYGKGGKQIILSAEKVGQEAIIKVSNDGQQIPSDSLNQLFDRFYRVEAS
FT                   RSQETGGTGLGLAITQSIVALHGGYIYADSTPQLTSFVIHLPLKLGRQIEPQNGAAKNS
FT                   "
FT   CDS_pept        274535..275821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="LCA_0279"
FT                   /old_locus_tag="LSA0279"
FT                   /product="D-alanyl-D-alanine carboxypeptidase precursor"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54581"
FT                   /db_xref="GOA:Q38YZ6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ6"
FT                   /protein_id="CAI54581.1"
FT                   /translation="MTGLLLVTPVAVATSATQQGVQAATATSAPQVDASAAIAIDPQSG
FT                   QVLYEKNADQVLPIASMTKMITAYVVLDQIKQGKLKWNQTTKPDAAIYKLSQDKELTNV
FT                   PLQADKAYSVRELYQAMLIASANDAAMMLANLVAGSQKNFVDLMRQQVSQWGIKDAKLY
FT                   SVSGLNNQYLTGETYPGSAADAENEMSASEVAIVAQHLLKTFPEVLETTKQTAFTFGPK
FT                   TIDETKMATWNLMLPGQNNAPKDYVVDGLKTGTTDKAGDCFTGTATKDGQRILTVVMHA
FT                   NGSDKGRRFIETNKVMQYVFDNWQQTQLVKKGATIKPFATADVKYGRTKTVALETPQAI
FT                   AMWVPKGTQVANVDWDYQVVQGGQKRQLTAPVKKAAVIGKVTPKIAGVTNRYLGTTPQY
FT                   TVQTKTADPKANVFVLIGTGVREFFTNLF"
FT   regulatory      275955..275968
FT                   /gene="murE"
FT                   /locus_tag="LCA_0280"
FT                   /old_locus_tag="LSA0280"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        275970..277511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="LCA_0280"
FT                   /old_locus_tag="LSA0280"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54582"
FT                   /db_xref="GOA:Q38YZ5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YZ5"
FT                   /protein_id="CAI54582.1"
FT                   /translation="MALTLDACTLILKEHHLLKSVALNGDSNLNMTGIAYDSRKVTADT
FT                   LFFCKGNFRPVFLTNAKEAGAVTYVAEQPIVEGNGMNALIVTNVQKAMAVLSAAFYDYP
FT                   QDDLFIVAYTGTKGKTTASYFTQSILQDATNKKTALFSTIDRVLGPKPEDRFKSDLTTP
FT                   ESLDLFHDMRQAVENGMTHLVMEVSSQAYKKNRVYGLTFDVGFFLNISPDHVGPNEHPN
FT                   FEDYLHCKLQLLVNSRHCVINAQTQNFGDVYAAATTTTEPENIYLFADTSYQPAQPVNI
FT                   DFRFENQAMTLAESRFKVTAVSKKAIQLGVSGDYQLRLIGDFNESNATAAIIGAALGGA
FT                   DLIAAQQGIRRLQIPGRMETLAVEGHGQVYVDYAHNYASMKALLSFLQKEYNQPKLLVV
FT                   VGSPGDKGVSRRAGFAQVLNEYADRAILTTDDPGYEDPATIAAEILAGIDQDKVDTTVE
FT                   IDRATAIKQAIEESQPGDIVVLAAKGADAYQKVRGVDTPYPTDMVIAKQVAQQLS"
FT   regulatory      277518..277531
FT                   /locus_tag="LCA_0281"
FT                   /old_locus_tag="LSA0281"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        277534..278157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0281"
FT                   /old_locus_tag="LSA0281"
FT                   /product="Hypothetical lipoprotein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54583"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ4"
FT                   /protein_id="CAI54583.1"
FT                   /translation="MKKSVVMSTVLVSGLLLLSACGQKQEAKSSSSSESKVTSVKKTSH
FT                   SKKAQSQSSEESVSESTSDSEVTSQSSQTPSATDSTSTVSQSASTQSSQVANSQSSQTS
FT                   QSQATQSQSAQQSSAQSSANSQSSATTNQPQTSQPTTTVDGNQAIRLVMQQVGQTQAHL
FT                   SYLNNGLITRNAQQGYLINCYAPNEDSPRAGYFVTQDGQVEQIW"
FT   regulatory      278166..278203
FT                   /locus_tag="LCA_0281"
FT                   /old_locus_tag="LSA0281"
FT                   /regulatory_class="terminator"
FT   regulatory      278290..278303
FT                   /locus_tag="LCA_0282"
FT                   /old_locus_tag="LSA0282"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        278307..279194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0282"
FT                   /old_locus_tag="LSA0282"
FT                   /product="Putative zinc/iron ABC transporter,
FT                   substrate-binding lipoprotein precursor"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54584"
FT                   /db_xref="GOA:Q38YZ3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ3"
FT                   /protein_id="CAI54584.1"
FT                   /translation="MNKKRLGIVALLLMVAMVVAGCGQTKQTTKGIQVVSSLDFYGEAA
FT                   QAVLGKHGQVTSIINSPSLDPHSYEPTTQDAKKVAQADVVIENGLGYDQWLSKVAASSD
FT                   SNQQTMITVNKLMKRTDGDNEHLWYDLETMPTLTKQLITRFSKIDPAHKADFQKNGQAY
FT                   LKKLAGLKTQLAGLKAQAKGQKVAVSEPVFDYALKEMGYQVANQHFAKAIEDGTDPSPQ
FT                   DIDAMRQLIKKHQIAFLVVNKQEESRTIKEMHQLATKEKVPVVQVTETLPAKQTYLTWM
FT                   QQQFDAVGKAQNVK"
FT   CDS_pept        279191..279871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0283"
FT                   /old_locus_tag="LSA0283"
FT                   /product="Putative zinc/iron ABC transporter, ATP-binding
FT                   subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54585"
FT                   /db_xref="GOA:Q38YZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ2"
FT                   /protein_id="CAI54585.1"
FT                   /translation="MTELVSAKNLGMTFSNRQVLKDLNFKIERGSMTSLIGPNGVGKTT
FT                   LVRILIGSLQPTAGELTFSPDKQSLNIGYVPQFRNLEAEYPLSIRSFVSLNQLTKHLPW
FT                   HTKSERQALDKILAQTHLTALQKTTVGNASGGEKQKAYLAQALISEPDLLILDESTASL
FT                   DIETKEEVMALVAELNRLHGLTVIFVTHDLDLARKYTDQYLFLKRGQYEMGPMSQLDPN
FT                   LELD"
FT   CDS_pept        279906..280682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0284"
FT                   /old_locus_tag="LSA0284"
FT                   /product="Putative zinc/iron ABC transporter,
FT                   membrane-spanning subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54586"
FT                   /db_xref="GOA:Q38YZ1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ1"
FT                   /protein_id="CAI54586.1"
FT                   /translation="MRHAFVASTFIAITCGLIGVFVVARNMSFLAHTLAEIGFAGASFG
FT                   VFLGIAPLNGMLLFTMISSITIGQMSAKESRREASISAISSLFVGLGILFLSLSNRNAS
FT                   YATNILFGSIIGISLTDVYQLITLSAVIVVGILLFYRYLVFDSYDSIGAQAQGLKTNWL
FT                   SIYFLILLAISVSIAAQIVGSLLVFILVTLPAFIAKYLAKSVPAMLAVSVGAALLGVWL
FT                   GLWLGYITNWPVTFFIATLEFIFYFIALLYHQHVSH"
FT   regulatory      280688..280706
FT                   /locus_tag="LCA_0284"
FT                   /old_locus_tag="LSA0284"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(280688..280706)
FT                   /gene="pepF1"
FT                   /locus_tag="LCA_0285"
FT                   /old_locus_tag="LSA0285"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(280719..282524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF1"
FT                   /locus_tag="LCA_0285"
FT                   /old_locus_tag="LSA0285"
FT                   /product="Oligoendopeptidase F1"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54587"
FT                   /db_xref="GOA:Q38YZ0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YZ0"
FT                   /protein_id="CAI54587.1"
FT                   /translation="MAIHKLPTRSEVPENLTWDLSTIFKNDSDFEAAVAALKQALPALE
FT                   QYNQPFKTADQLVITIEQVLTLFRQLETVYVYASMKNDQDTTNTTYQGYQAQVDALAAD
FT                   VSAAAAFLEPAILEIPVDQLTDWQTNEPALKSYQHFIQTITDSREHVLSGQEEALIAAA
FT                   GDIFGAASQTFSVLDNSDIQFPDVVDETGQTHQLSNGLYSQLLQSTDRQVRQDVFEALY
FT                   STYDQFKNTFATTLATEIKGHNYLAQVHHYDSARQAALAPKAIPESVYTTLVDQVNQHL
FT                   PLLHRYVKLRQKQLALPQLHMYDLYTPLLGKPALSYTYPQAQTTAREALAVLGPEYTPI
FT                   VDQIFDQRQIDVVENKGKRSGAYSGGAYDTNPFILLNWQDDLNNLYTLVHETGHSVHSY
FT                   LTRHNQPYVYGDYPIFVAEIASTTNENLLTEYLLKTQKDPKVQAYLLNYYLDGFKGTVF
FT                   RQTQFAEFEHYIHDAAANGTPLTADFMSTYYADLNARYYGDAVAKDPQIALEWARIPHF
FT                   YMNYYVYQYATGFAAATTLADQITTNQPGALDNYLTYLKNGSASYPIETMQKAGVDMTN
FT                   ADYLERAFDVFEQRLDQLEALLADM"
FT   regulatory      complement(282526..282539)
FT                   /gene="pepF1"
FT                   /locus_tag="LCA_0285"
FT                   /old_locus_tag="LSA0285"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      282700..282713
FT                   /locus_tag="LCA_0286"
FT                   /old_locus_tag="LSA0286"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        282718..283905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0286"
FT                   /old_locus_tag="LSA0286"
FT                   /product="Putative transcriptional regulator, lytR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54588"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY9"
FT                   /protein_id="CAI54588.1"
FT                   /translation="MQNSNFFGSREDKYKKGKRHRKLKIFLLIIVILVFSGGAYAMRVS
FT                   SQLKSAADKINKSEATSKAIKNKKAFSILLLGVDTGAEGRIDKGNSDTMIVATVNPKKE
FT                   QVKLVSIPRDTLAELQGTKSFDMQKINAAYNVGGSKMAKKTVEKMFDVPIDYYVTINMG
FT                   ALSKIVDAVGGVDVNVPFSFKYNTTFKKGKMHLTGKEALDYSRMRYDDPEGDYGRQKRQ
FT                   RQVITSLIKSAVSFKSLTNYESILKTLEDSVATDLSFDDMVAIQSDYRTAAKSITSDYL
FT                   KGRNATIDGSSYQVPTTSEIQRVSDVLRTSLGLEKTNIDNAETKQNALNTNFAATEYQD
FT                   EFTIYPESVLKDGTTTSEAASTTTTEDNTTQYSQSAPQSNWQQPQQEQSQWQSSY"
FT   regulatory      283934..283963
FT                   /locus_tag="LCA_0286"
FT                   /old_locus_tag="LSA0286"
FT                   /regulatory_class="terminator"
FT   regulatory      284032..284045
FT                   /locus_tag="LCA_0287"
FT                   /old_locus_tag="LSA0287"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        284050..285285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0287"
FT                   /old_locus_tag="LSA0287"
FT                   /product="Pyrimidine-specific nucleoside symporter"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54589"
FT                   /db_xref="GOA:Q38YY8"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY8"
FT                   /protein_id="CAI54589.1"
FT                   /translation="MYLLVNVIGLLVFIGVGFLFSKKKKDIDWRSVLIMLVINLVLAWF
FT                   LTSFSVGRDIVLGAANGFNWLVQVAYTGIAFALPSWVNVKQMDFVASVLLPILMIIPLF
FT                   DILTYIGVLPWIIKWLGRGLAKITGQPKFESFFAVEMMFLGNTEALAVSSLQLKQMKAE
FT                   RTLTLAMMSMSCVTASIIGAYTQMMPGQFILTAIPVNIINAIIVTNILNPVKVTPEEDT
FT                   IAKMGGSGSAVGEEEAADGKIEREPFFSFLGDSILNAGKLVLIITANVIAFVALAALID
FT                   KVLQLFNPWITLEHLLGIVMFPFAWLMGLDVSHAFEFAQYMGTKLVTNEFVVMGKVQNS
FT                   ITTFAPHYQAVLTVFVTSFANFSTVGMIIGAFKGLVDREKNDMIAKNVGYMLLSGILVS
FT                   LLSAATVGLFVW"
FT   tRNA            285387..285458
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:285419..285421,aa:Gln)"
FT   regulatory      285478..285503
FT                   /locus_tag="LCA_0287"
FT                   /old_locus_tag="LSA0287"
FT                   /regulatory_class="terminator"
FT   regulatory      285575..285588
FT                   /locus_tag="LCA_0288"
FT                   /old_locus_tag="LSA0288"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        285590..286321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0288"
FT                   /old_locus_tag="LSA0288"
FT                   /product="Putative transcription regulator, GntR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54590"
FT                   /db_xref="GOA:Q38YY7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY7"
FT                   /protein_id="CAI54590.1"
FT                   /translation="MADLVYQTIIADLKKAINAGAYPSMKLPDERTLTEHYQVSRSSVK
FT                   RALNVMANQGIIFKKRGSGTFINPLYLKSGSFFNYSGSNLGVTDSFKAGDRKPGIKLLD
FT                   FQVIKPSAELQRDLFLEPDDFVYEIKRLRLFDDEPFMIETGFIPIKIMPGLTEKIISGS
FT                   IFNYLETEKNQEVTRAFLSIFAEPSTQDDQDQLQLKPTEPVGIMEGIFFLDDGTPFEFS
FT                   TMRLHYQYMKYNTFVSVSGRE"
FT   regulatory      286478..286491
FT                   /gene="xpk"
FT                   /locus_tag="LCA_0289"
FT                   /old_locus_tag="LSA0289"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        286496..288859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpk"
FT                   /locus_tag="LCA_0289"
FT                   /old_locus_tag="LSA0289"
FT                   /product="Xylulose-5-phosphate phosphoketolase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="4.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54591"
FT                   /db_xref="GOA:Q38YY6"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YY6"
FT                   /protein_id="CAI54591.1"
FT                   /translation="MTDYSSKEYLAKVDAFWRAANYISVGQLYLKDNPLLQRPLEAKDV
FT                   KVKPIGHWGTISGQNFLYAHLNRAINKYDLNMFYVEGPGHGGQVMVSNSYLDGSYTEIY
FT                   PEISQDVDGMKKLFKQFSFPGGVASHAAPETPGSIHEGGELGYSLSHGVGAILDNPDVI
FT                   AAVVVGDGEAETGPLAASWLSSTFINPKNDGAVLPILNLNGFKISNPTILSRKSDEELT
FT                   KYFEGNGWAPIFVEGDDPEKMHPATAAAMDEAIEKIQAIQKAARENGDTSRPVWPMIVF
FT                   RAPKGWTGPKTWDGVPIENSFRAHQIPVPIDSTDMQHADALVDWMKSYRPEELFTAEGQ
FT                   LKPEIAAMAPKGDKRMAANPITNGGIDPKPLRLPDYRDYAVDNTEHGKVVAQDMIVLGE
FT                   YVRDIIKDNDQNKNFRIFGPDETMSNRLNHIFDVTNRQWMEPIKEPNDQFMATEGRVLD
FT                   SQLSEHQAEGWLEGYVLTGRHGFFASYESFLRVVDSMLTQHFKWLRKADEQAWRNKYPS
FT                   LNVIATSTVFQQDHNGYTHQDPGVLTHLAEKKPEFIREYLPADANTLLATMNTVFQSQE
FT                   KINLVIASKHPRQQWFSIDEATVLVKNGLKIIDWASTDQDAEPDVVIAAAGTEPTLESL
FT                   AAISILHKQYPDMKIRFINVVDLLKLRSPKVDPRGLTDEEFDMYFTKDKPVVFAFHGFE
FT                   GLVRDIFFDRHNHNLHVHGYRENGDITTPFDMRVLNQMDRYNLSKEVAIDVLGDQAGQF
FT                   AQSMDDMVAKHNQYIRDEGTDLPEVEEWQWTPLR"
FT   regulatory      288875..288896
FT                   /gene="xpk"
FT                   /locus_tag="LCA_0289"
FT                   /old_locus_tag="LSA0289"
FT                   /regulatory_class="terminator"
FT   regulatory      288974..288987
FT                   /gene="gltX"
FT                   /locus_tag="LCA_0290"
FT                   /old_locus_tag="LSA0290"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        288994..290481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LCA_0290"
FT                   /old_locus_tag="LSA0290"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54592"
FT                   /db_xref="GOA:Q38YY5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YY5"
FT                   /protein_id="CAI54592.1"
FT                   /translation="MAKNKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTFVIRIE
FT                   DTDTKRNIADGENSQLDNLKWLGMDWDEGPDKPGNYGPYRQSERREIYTPLIQELVEKG
FT                   LAYESYKTEDELTAEREAQKAAGEAPRYVYEYEGMSDDEIKASQEAARAKGLQPVVRLR
FT                   LPKDHVYKFDDIVKGEISFESDRLGGDFVIMKRDGMPTYNFAVVVDDHLMEITHVLRGD
FT                   DHIANTPKQLAVYEAFGWEPPIFGHMTLIINTETGKKLSKRDESVLQFIEQYRELGYLP
FT                   EAMFNFIALLGWSPVGESELFNRQEFIKQFDPRRLSKSPASFDQKKLEWVNNQYVKQSD
FT                   PNKIMDLSLDSLIKAGKIAANPDSKTIEWARHLIALYQDQMSYTAQIVEMSDVFFEEPE
FT                   QLDAEALEELNNETAPVVLKEFSERLKDLTLFTAPRIMQIIKGIQKDTKIKGRLLYMPI
FT                   RIATTREMHGPSLPDSIELLGKDRVLAHLEKTLAEIK"
FT   regulatory      290489..290515
FT                   /gene="gltX"
FT                   /locus_tag="LCA_0290"
FT                   /old_locus_tag="LSA0290"
FT                   /regulatory_class="terminator"
FT   regulatory      290600..290613
FT                   /gene="kdgK"
FT                   /locus_tag="LCA_0291"
FT                   /old_locus_tag="LSA0291"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        290616..291638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="LCA_0291"
FT                   /old_locus_tag="LSA0291"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54593"
FT                   /db_xref="GOA:Q38YY4"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY4"
FT                   /protein_id="CAI54593.1"
FT                   /translation="MKVLTFGEMLMRLKTPGNQRLLQADSFEASYGGAEANVAVSLALL
FT                   GDQVAYLTKLPENLLGQKGMQTLRGYGVDTTKIQYGDGRLGLYFFEKGASVRSTNVVYD
FT                   RAHSSFATMAASEFDWKTIFEDIDYFYFSGITPAISAELAQAAETACQYCQAHDIPVVC
FT                   DLNYRGKLWSPEQAQATIKRLMPYVTICIAHDEDFEATLGIQAFDGNESHGIAQKESFK
FT                   AAMQQVRQIFPNCQMVASILRNIRSVEDSEWLALLLKDDQFFETGTYQMHVMEGVAARD
FT                   AFGAGLMHGLLNNFTPDEMLQFGLAASVAKLTIAGDFNLIGEAEIEAIAQSGGGARLSR
FT                   "
FT   regulatory      291693..291706
FT                   /gene="budC"
FT                   /locus_tag="LCA_0292"
FT                   /old_locus_tag="LSA0292"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        291710..292480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="budC"
FT                   /locus_tag="LCA_0292"
FT                   /old_locus_tag="LSA0292"
FT                   /product="Acetoin reductase (acetoin dehydrogenase)
FT                   (Meso-2,3-butanediol dehydrogenase)"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54594"
FT                   /db_xref="GOA:Q38YY3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY3"
FT                   /protein_id="CAI54594.1"
FT                   /translation="MTKKVAFITGAAQGIGKAIAHRLSNDGFAVAIADFNLEGAQAVAA
FT                   EINETGRAIAVKVDVSDRDQVFAAVETTVAELGGLDVVVNNAGVGPTTPIETITPEQFE
FT                   KVYAINVGSVYWGIQAAVKAFRDLGHGGKIINASSQAGQVGNPELALYGGTKFAIRGIT
FT                   QTAARDLADQGITVNAYCPGIVKTPMMMDIAHKVGQNAGKDDEWGMQQFAKDITLGRLS
FT                   EPEDVAACVAYLAGPDSNYMTGQALIIDGGMVFN"
FT   regulatory      292493..292522
FT                   /gene="budC"
FT                   /locus_tag="LCA_0292"
FT                   /old_locus_tag="LSA0292"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(292493..292522)
FT                   /locus_tag="LCA_0293"
FT                   /old_locus_tag="LSA0293"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(292531..292842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0293"
FT                   /old_locus_tag="LSA0293"
FT                   /product="Putative DNA-binding protein, XRE family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54595"
FT                   /db_xref="GOA:Q38YY2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY2"
FT                   /protein_id="CAI54595.1"
FT                   /translation="MLDTISQMIREHRKQLGLTIEELAEKSGSSYSFISRIERGEVDNL
FT                   KIKKLNDIAEALGIELIDFFGDPALSGAQTLKLVHYLTQLPEDKREEVSAALLKIIQL"
FT   regulatory      complement(292845..292858)
FT                   /locus_tag="LCA_0293"
FT                   /old_locus_tag="LSA0293"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      293031..293044
FT                   /locus_tag="LCA_0294"
FT                   /old_locus_tag="LSA0294"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        293046..293642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0294"
FT                   /old_locus_tag="LSA0294"
FT                   /product="Hypothetical lipoprotein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54596"
FT                   /db_xref="InterPro:IPR031927"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY1"
FT                   /protein_id="CAI54596.1"
FT                   /translation="MMKKSYSLILTVAVVSLLGACSAKGEQTTKSTSTSTSHSKKVTSV
FT                   TSSQKQVRKETTSSVSRTKQQAQSQSQTKQAKALWDSSKKQALATFMSGWGTTMGQTYQ
FT                   SYDLTRDTDYAGIHFPSKLAQTDLVVDDTPVTAAWSTDGTGSADYNVVAIYCDVDGGTV
FT                   GGHLYLFTFHNGQPVVLIRGHQITGSISASLLIRI"
FT   CDS_pept        293639..293992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0295"
FT                   /old_locus_tag="LSA0295"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54597"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YY0"
FT                   /protein_id="CAI54597.1"
FT                   /translation="MKTGFANIVSGQGSGQANTSQPTTSAVSPISAAEAQAIVAAQNIQ
FT                   YREEQGEPAGNKTSLAGGGIVLKQYAGAQGIDIIKLTPKPGNKVNITVQNGSLRDGQAG
FT                   ETAPISQNITVDR"
FT   regulatory      294000..294029
FT                   /locus_tag="LCA_0295"
FT                   /old_locus_tag="LSA0295"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(294000..294029)
FT                   /gene="gntR"
FT                   /locus_tag="LCA_0296"
FT                   /old_locus_tag="LSA0296"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(294048..294890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="LCA_0296"
FT                   /old_locus_tag="LSA0296"
FT                   /product="Gluconate operon transcriptional regulator, RpiR
FT                   family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54598"
FT                   /db_xref="GOA:Q38YX9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX9"
FT                   /protein_id="CAI54598.1"
FT                   /translation="MAQAIDSLLRSYYDNFSEKYKQIADYIFQESQFNQRLTIQEFAAN
FT                   CGVSTATISRFAKILGFDNFQAFKMALLAKEANTSPLFHEINANDTFTTMAEKIFSSNS
FT                   NALKATWSLLTEEQLQKAVALINRAHLLSLFGLGASGIVAQDGYHKFLRTSIPTVFNQD
FT                   YHLQLMQATKLTNQDCAIIISHSGQNKDALELARILKERQVPLIVITSFGNSSLAKLGD
FT                   ITLLSISEETNYRAEALHALIAQISLIDSLFMMVAVNNGQETEQSFKEIRAEIDRTRQ"
FT   regulatory      complement(294894..294907)
FT                   /gene="gntR"
FT                   /locus_tag="LCA_0296"
FT                   /old_locus_tag="LSA0296"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      295022..295035
FT                   /gene="gntZ"
FT                   /locus_tag="LCA_0297"
FT                   /old_locus_tag="LSA0297"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        295038..295937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntZ"
FT                   /locus_tag="LCA_0297"
FT                   /old_locus_tag="LSA0297"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54599"
FT                   /db_xref="GOA:Q38YX8"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX8"
FT                   /protein_id="CAI54599.1"
FT                   /translation="MKLAMVGLGKMGINLVANLRRNGHEVVAFDLNQAAVEEAVNLGAT
FT                   AATDLDDVLAQLTSPRIVWVMLPAGKPTDATIQTLSEKMNAGDMVIDGGNSFFEDSERH
FT                   NALLKEQGIHFFDAGTSGGMSGANANGNFMIGGDSPEAFKTIEPIFKSIAQEDGYLYTG
FT                   KAGSGHYLKMVHNGIEYGMMQSIAEGFDVLEHGRFEYDNEAVAKVWSNGSVIRGWLMEL
FT                   AQSAFSKDPELESLKGVMHSSGEGQWTLDEALKLQVPTPVIGLSLMMRYRSLEDDTFTG
FT                   KVVAALRNEFGGHAVDKK"
FT   regulatory      295957..295970
FT                   /gene="gntK"
FT                   /locus_tag="LCA_0298"
FT                   /old_locus_tag="LSA0298"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        295972..297531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="LCA_0298"
FT                   /old_locus_tag="LSA0298"
FT                   /product="Gluconokinase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54600"
FT                   /db_xref="GOA:Q38YX7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006002"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX7"
FT                   /protein_id="CAI54600.1"
FT                   /translation="MMKYMIGADIGTTSTKAVLYDLKGNVKAYANVGYPLYQNVPDMAE
FT                   EDPDEIFEAVVEVLGKVMRKGHVQAGELQGVSFSAAMHSLILMDRNHQPLTRAITWADN
FT                   RAAKYSNELKANGLGHEIYQHTGTPIHPMAPLSKIIWLRHEQPDLFKQAAQFIDIKTYV
FT                   FQKLFHTYKMEYSIASATGLFNIFNLDWDQQALEVAGITRDQLPELVEPTAQITGLDTT
FT                   YSQETGISSDVPFIFGASDGVLSNLGVNAIDPGVLAVTIGTSGAVRVVVDKPVVDPNGR
FT                   LFCYALTKDKWVVGGPVNNGGIVFRWVRDQLFAPEKLTAEQMQVSTYDLLTQIAEKIPA
FT                   GSDGLLFHPYLGGERAPIWDSDARGSFFGLTRQHTRAHMVRAALEGIVYNLYMVMLMIE
FT                   GVAGKPKSIQATGGFARSELWRQMLADIFEQDVTIPESFESSCLGAAVLGMYSLGLVDD
FT                   LSAVKDMIGVTNVHEPKAENFDVYRELIPIWIRLTRELSPEYSAIADFQRRHMQVKEAT
FT                   KD"
FT   regulatory      297606..297619
FT                   /gene="gntP"
FT                   /locus_tag="LCA_0299"
FT                   /old_locus_tag="LSA0299"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        297622..298974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP"
FT                   /locus_tag="LCA_0299"
FT                   /old_locus_tag="LSA0299"
FT                   /product="Gluconate:H(+) symporter"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54601"
FT                   /db_xref="GOA:Q38YX6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX6"
FT                   /protein_id="CAI54601.1"
FT                   /translation="MELLVLFLGIMLLLLLIIKFKLNTFVSLVLTAMVVGVGLGMPLTK
FT                   IATSVQNGIGGQLGELSIVFGFGAMMGRLVADAGGAFRIAHTLIDKFGKKRLQIAIMLA
FT                   SFIIGIALFFEVGMVLLVPIVFAIAVEASVPILYLGIPMAAALSVTHGFLPPHPAPTAI
FT                   TSALGANAGHVLLYGVIIAIPSVIIAGPLFTKVARKMIPDAFARQGNLTALGPQKTFKL
FT                   EETPSFGISVVTSLFPVILMAITTVYQMLFNGGSLPKNPTLLDSIIGFIGTPAIAMTIS
FT                   LLLAMYTMGWGRRIKTPEIMKTIEEAVKSIAMLLLVIGGGGAFKQILIDGGVGDSVTTL
FT                   FAHASLSPLVLGWLIAVVLRIALGSATVASLTAAGLVLPLMQSAGVNPALMVLSIGAGS
FT                   LAASHVNDAGFWMFKEYFDLSVKETLATWTVLETLISIVGLIGVLLLSLVV"
FT   regulatory      298993..299024
FT                   /gene="gntP"
FT                   /locus_tag="LCA_0299"
FT                   /old_locus_tag="LSA0299"
FT                   /regulatory_class="terminator"
FT   CDS_pept        299266..300150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0300"
FT                   /old_locus_tag="LSA0300"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54602"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX5"
FT                   /protein_id="CAI54602.1"
FT                   /translation="MKSSLLATPFDVNFKGQTFKMSGIGYVASYPEFSGQGGISDLMHL
FT                   AFERMQADGVTLSYLAPFSYPFYRRFGYEQAFEQTCYQIETADLPRLKFAPDQGYVERL
FT                   SLSAAVPLISAFQQQRPHNQVGGIQRAAWWWQYNCLKHTDWEVAVYTDGDQQVAGYAIY
FT                   SREATTLEIQELLTSTVASQEQLVKFIFKHQSAYQTIRYESGLTTNLGDLLPDPTIVET
FT                   TTVPYMMARIVSLADFLARYPYEAADLEAVKIAVSDDFLPENSGVWQLSLHAGQPTVTK
FT                   LASQTADITVTIQ"
FT   CDS_pept        300163..300288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0301"
FT                   /old_locus_tag="LSA0301"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54603"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX4"
FT                   /protein_id="CAI54603.1"
FT                   /translation="MMGYRTLASQAHYGQVSGDAAKIAQLSAAFNQTQPMLWDYF"
FT   regulatory      300301..300329
FT                   /locus_tag="LCA_0301"
FT                   /old_locus_tag="LSA0301"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(300301..300329)
FT                   /locus_tag="LCA_0302"
FT                   /old_locus_tag="LSA0302"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(300337..301446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0302"
FT                   /old_locus_tag="LSA0302"
FT                   /product="Putative anion:Na(+) symporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54604"
FT                   /db_xref="GOA:Q38YX3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX3"
FT                   /protein_id="CAI54604.1"
FT                   /translation="MKNIALNIRDFFLDDKLLLAATIAAIVTSFFNRPHLSYVNFHVIV
FT                   SVFCIMTLVQVYQRLHVLDYFARELIIKSHSKRALMQMLLALTFVGAMFLTNDMTVLTF
FT                   VPLFILIARQLDFSPILPVTLITISANLGSSLTPFGSPHNIFLVSFYHMTIRHFFEYSI
FT                   PVLIVSIIMLTATTFLFPKEPIKLHGLHPVEVEKGPLWYFVPLTVVVFLAVFSLIPLWV
FT                   TPILVIIAILVFDPKLFKTVDYGLLLTFFCFFIAVGNLSHIPTIATFMRSLVGTAKQTY
FT                   LTGLISCQLIANVPTEILLSSFTNHSHAMFLAINIGGVGTMFASLANLIAYKRFKKGWG
FT                   KDIGKFLVVFTGMNFLFLIILGTFGYFLI"
FT   regulatory      complement(301456..301469)
FT                   /locus_tag="LCA_0302"
FT                   /old_locus_tag="LSA0302"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      301728..301741
FT                   /locus_tag="LCA_0303"
FT                   /old_locus_tag="LSA0303"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        301745..302095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0303"
FT                   /old_locus_tag="LSA0303"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54605"
FT                   /db_xref="GOA:Q38YX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX2"
FT                   /protein_id="CAI54605.1"
FT                   /translation="MKDAPRHTVILGIVAAVISIICGMLILYSILHVSLWLSILASVII
FT                   GLYLGYNTFYSTYLAEMIKIEVINQGLDSKDLAELMHGNAKDYPIIRGDLRLIIPRRKR
FT                   AELLAKLRDRVG"
FT   regulatory      302146..302159
FT                   /locus_tag="LCA_0304"
FT                   /old_locus_tag="LSA0304"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        302163..302246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0304"
FT                   /old_locus_tag="LSA0304"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54606"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX1"
FT                   /protein_id="CAI54606.1"
FT                   /translation="MKIERPLIMKLCSTHLKMTQRVEPNID"
FT   regulatory      302354..302378
FT                   /locus_tag="LCA_0304"
FT                   /old_locus_tag="LSA0304"
FT                   /regulatory_class="terminator"
FT   regulatory      302393..302406
FT                   /locus_tag="LCA_0305"
FT                   /old_locus_tag="LSA0305"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        302410..303954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0305"
FT                   /old_locus_tag="LSA0305"
FT                   /product="Putative drug resistance ABC transporter, two
FT                   ATP-binding subunits"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54607"
FT                   /db_xref="GOA:Q38YX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YX0"
FT                   /protein_id="CAI54607.1"
FT                   /translation="MSILKVEGLSQQFLDKQLYDDAGFQVNKGEHMGITGQNGVGKSTL
FT                   INILTGAILPDEGKVTWQKNIKIGYLDQYAKLAPGLSIFEFLKTAFADLYAQEERMSQY
FT                   YADYATSLDDQLLEKAGAIQELLEAKNFYEIDTRVMQVATGLGIDALGMDHDVSQLSGG
FT                   QRSKIILAKLLLEEPDMLLLDEPTNYLDTNHIDWLSDYLNNFEGAFITISHDYDFLERV
FT                   TTCIADIEFGKITKYTGTLQQAFRQKADNQASYMKAYENQQKKIEKTKAYIRKYKAGSR
FT                   STIAKSREKQLAHMDILTPPSNRVKANFRFPYHATASQILLTTNDLEIGYENALLPALN
FT                   FSIGRDQKVVLKGFNGIGKSTLIKTIIKEIPAISGDFEIASTVKFGYFKQDLKWPNNMA
FT                   TPLQYLQGEYPEQKQKELRQVLSRTGLTAEEAMKPLKQLSGGEQSKVKIAELLLTSSNF
FT                   LLLDEPTNHLDDDTKNALRKAIQEFEGGVLLVTHEEDFYQGDWIDKVLDVESLIKS"
FT   regulatory      304032..304045
FT                   /gene="aspD"
FT                   /locus_tag="LCA_0306"
FT                   /old_locus_tag="LSA0306"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        304048..305655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspD"
FT                   /locus_tag="LCA_0306"
FT                   /old_locus_tag="LSA0306"
FT                   /product="L-aspartate-beta-decarboxylase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="4.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54608"
FT                   /db_xref="GOA:Q38YW9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022518"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW9"
FT                   /protein_id="CAI54608.1"
FT                   /translation="MDKIDVTKLTQMSNFEVAALFYKYALTNSRGLRAINVGRGNPNWI
FT                   NTQARFAFNRIVEFGMKESLQTINLDDGNLAGYTDQTGIAERFNQFLDGDNPVDAFLKQ
FT                   ALAYTRDVMHINQDELVFEWVDGVIGNHYPEPSRSLVNVEKILNRYLEVNLYRGEHLSD
FT                   KTKVFPTEGGTAAMVYLFNELKVSHILEAGDTIAINTPIFTPYLQIPELNEFKLQEFNV
FT                   SSDESDDWQLVDHKFEELKDPNVKAFFVVNPTNPTSRAFSDHALDKLKEVVEANPNLVI
FT                   ITDDVYGTFVDDFKTIYSVVPHNTLLVYSFSKLYGATGQRIGLIAMHDDNIFDKLIEEM
FT                   TAEDPVIREAFRKRYSYVTNKPHEMSFIDRTVADSRNIGLYHAAGLSTPQQITMALFSL
FT                   TNLIYEGREDPYVTASKEIVSHRYKAFWESLGLVVKTTEENAEYYTVFSIYKLAESKYS
FT                   KDFRAYLEQNCNHLAFEWRLAAEYGVVVMDGAGMGTKAGYLRISLANRPDKDYETVGGR
FT                   ISDLLASYYTEYLQSKAQ"
FT   regulatory      305667..305701
FT                   /gene="aspD"
FT                   /locus_tag="LCA_0306"
FT                   /old_locus_tag="LSA0306"
FT                   /regulatory_class="terminator"
FT   rRNA            306178..307748
FT                   /gene="rrsE"
FT                   /gene_synonym="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            307972..310890
FT                   /gene="rrlE"
FT                   /gene_synonym="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            310982..311098
FT                   /gene="rrfE"
FT                   /gene_synonym="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   regulatory      311109..311129
FT                   /gene="rrfE"
FT                   /regulatory_class="terminator"
FT   regulatory      311152..311165
FT                   /gene="trxA2"
FT                   /locus_tag="LCA_0307"
FT                   /old_locus_tag="LSA0307"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        311169..311504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA2"
FT                   /locus_tag="LCA_0307"
FT                   /old_locus_tag="LSA0307"
FT                   /product="Thioredoxin"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54609"
FT                   /db_xref="GOA:Q38YW8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW8"
FT                   /protein_id="CAI54609.1"
FT                   /translation="MTQTITANNIEAFVAEKPLVILDFWADWCMPCKIMTPMIQELHAA
FT                   SNDAFKLGMVDVEDQPELAERYDIQSVPTLLIFKKGKAAEKVTGAFPKEKLKRYLDKKI
FT                   AESNHEG"
FT   regulatory      311511..311538
FT                   /gene="trxA2"
FT                   /locus_tag="LCA_0307"
FT                   /old_locus_tag="LSA0307"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(311511..311538)
FT                   /locus_tag="LCA_0308"
FT                   /old_locus_tag="LSA0308"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(311555..312736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0308"
FT                   /old_locus_tag="LSA0308"
FT                   /product="Putative drug:H(+) antiporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54610"
FT                   /db_xref="GOA:Q38YW7"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW7"
FT                   /protein_id="CAI54610.1"
FT                   /translation="MHYSKSRIIWLSVLLGSLSAYGPLLVDMYLPAFPIMESDFHTSAS
FT                   MIQISLTMCLAGLAIGPIFMGAWSDRVGRKTPLVIGTSLAIIACFLSLVTHNIWLFFLL
FT                   RFIQGLASSAGQVVTRAVAKDLFNGKQLTKFIALLMAINGIFPIISPLIGSLLLRYTSW
FT                   QGIFGFIGCTGLLLLLGLIFGFKETHKLSPADQKATSTRLNVQTVFKDRPFICFVLIQG
FT                   LVYGAMFCYISGSSFMLQNVFSLSKSTFSLIYGINGIGIILMAELSTVLINWFTELEQL
FT                   KLGLIGGLIGGFCILISGLGPNKLWLALIGLFLVVSTLGLINAVVTSLALQRQGKQAGI
FT                   ASSVLGLGMYVFGIFLSPLVGIMGSYTYLPLAVLILLCEFSALLLYRYVRRIV"
FT   regulatory      complement(312738..312751)
FT                   /locus_tag="LCA_0308"
FT                   /old_locus_tag="LSA0308"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      312955..312968
FT                   /locus_tag="LCA_0309"
FT                   /old_locus_tag="LSA0309"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        312970..313728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0309"
FT                   /old_locus_tag="LSA0309"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54611"
FT                   /db_xref="GOA:Q38YW6"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW6"
FT                   /protein_id="CAI54611.1"
FT                   /translation="MKIAQKNKILETCLIAGRIMIESGSEMYRVEDTMNRIAYNAGIQK
FT                   SVVFTTPTGLFIGIENQPYVQLESVAVRTINLEKVENVNTASRQFATKEITLDQLSTRL
FT                   KQIDQHTPYFPLWIQIIAAAFVSALLMIIFSGEYDWADLLPAALVGALGYAVFSEINRL
FT                   TSIRFIGEFLGAVSIGVSAYLLTKWHLGVDLDNIIIGAVMPLVPGVAITNSIRDMLAGH
FT                   LLSGMVRGVEALLSAFAIGTGIALIFRFLI"
FT   regulatory      313730..313743
FT                   /locus_tag="LCA_0310"
FT                   /old_locus_tag="LSA0310"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        313746..314213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0310"
FT                   /old_locus_tag="LSA0310"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54612"
FT                   /db_xref="GOA:Q38YW5"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW5"
FT                   /protein_id="CAI54612.1"
FT                   /translation="MPYWLQFIVQAVFSYFSTVAFGICINLPRRALVWCGIAGMLGWQV
FT                   YWVLFNLGSGRMMANLFGALAVGIVGSILARYKRMPVIIFNIPGLVPLVPGGTAYRAVR
FT                   NLVLGNISQAVTQSISVIMVAGAIAVGFMFAQILADITRKRSSVPIWLSRH"
FT   regulatory      314409..314431
FT                   /locus_tag="LCA_0310"
FT                   /old_locus_tag="LSA0310"
FT                   /regulatory_class="terminator"
FT   regulatory      314588..314601
FT                   /locus_tag="LCA_0311"
FT                   /old_locus_tag="LSA0311"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        314604..316001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0311"
FT                   /old_locus_tag="LSA0311"
FT                   /product="Putative glutamate/aspartate:cation symporter"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54613"
FT                   /db_xref="GOA:Q38YW4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW4"
FT                   /protein_id="CAI54613.1"
FT                   /translation="MTITYVVINIIIMLIMLFVLNKMARIHVKFSRRVFTALGVGILFG
FT                   AILQLIFKTDSEVVKQTADWIGIVGNGYVSFLKMIVMPLVMVSIIQAITNLESSKGLGK
FT                   MAGMVIGLLVFTTLIAATVGSVTSNVFDLNASSIQSGQVEKARSKELETKLGDVQEQTV
FT                   PEKIVSFIPENPFMDMTGARPTSTLGVVIFSAFLGLAALQLRRKKPEQAETFNKIVNAF
FT                   YAVIMRMVTLILRMTPYGVLALMTTTVAQTDVQGILNLGKFVIASYVALIIMFIVHFLL
FT                   ITFTGLNPINYIKKVIPTLIFAFTSRTSAGSIPMNIETQTKRLGVEEGIANLSASFGAS
FT                   IGQNGCAGVYPAMLAVMIAPTVGINPWSIGFLVKLILIVAISSFGVAGVGGGATFAALI
FT                   VLSSMNLPVGLAGLLISIEPLIDMGRTALNVNGSMTVGVLTAQFLGKLDKHKFNDMTLT
FT                   EDSDDIA"
FT   regulatory      316007..316020
FT                   /locus_tag="LCA_0312"
FT                   /old_locus_tag="LSA0312"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        316023..317357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0312"
FT                   /old_locus_tag="LSA0312"
FT                   /product="Putative NADH oxidase"
FT                   /function="4.6 Miscellaneous"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54614"
FT                   /db_xref="GOA:Q38YW3"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW3"
FT                   /protein_id="CAI54614.1"
FT                   /translation="MRTIIVGATAAGTSAAAKAKRMNPELEVVMYEMRDYVSFGACGLP
FT                   YFVGEHFDNPNQMIARTPEAFAKQGIDVQLEHEVVAVDFDTQMVTVRDLKTKQAKTEHY
FT                   DQLMLATGATAVMPPFENGQLDNIYHLRTLADGEVLRQLGQTPEIQSVTVIGAGFIGLE
FT                   IAEEFHQLGKKVRVIQLEDRVLPLAFDPELTAMMAADLRDNGIELRLSEAVQSFEGQSK
FT                   VTGVVTDKGRYETDLVVVAAGIRPNTQFITDDRLKKLKNGAIVVDQTGRTSIENVFAAG
FT                   DNATVINSVTGEPMYSALATGANKLGRVVGVNLAGRQAQLPGMLNSAGVKLVTLEAGRT
FT                   GLTSAEAQAAGIDYDTVLIHDKNHTDYYPGQSELTIKLVYKKADHVLIGGQIIGQKDAV
FT                   LRVDVLATAIQAQMTTEQLGLLDLVYAPPFARTWDALNVAGNVAH"
FT   regulatory      317373..317400
FT                   /locus_tag="LCA_0312"
FT                   /old_locus_tag="LSA0312"
FT                   /regulatory_class="terminator"
FT   regulatory      317550..317563
FT                   /locus_tag="LCA_0313"
FT                   /old_locus_tag="LSA0313"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        317566..319107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0313"
FT                   /old_locus_tag="LSA0313"
FT                   /product="Hypothetical cell surface protein precursor"
FT                   /function="5.1 Protein of unknown function only similar to
FT                   other proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54615"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW2"
FT                   /protein_id="CAI54615.1"
FT                   /translation="MNNTKSLIALGSGILGVAGISLLSASQANAATATVNYSAGATTVW
FT                   TSPETGQAAKRYIFKGQSVNLLASQKVGAETWYRIGNGEWVPERYLTTAKETPKAQTDA
FT                   AKTIRVAFADGATTVWSSPTYTQPTGRYMTYGQTEGVVKTQTVSGEEWYQLANGGWVPA
FT                   RFTGEGQLKSTPVVKQAATPTQTTPTQAPVQSTTAAKVVTPAAETVTSERTSVAIPAPV
FT                   ASSSVSESVASSTPVSESTAAPVASESQAESISAPAASSSVVESSSVTSESTAPVAESS
FT                   VTSESTAPAVESSIAPAQSSSASAVEVPAKETVESAPQATPIQAESATVSSTTPSTPVV
FT                   ESSTQQTTPKAPAQQSSVAESKPAVVESTKPTTPTQTTPTPAPTTPKPATPAPTTGNAQ
FT                   AVINLAMAQIGKPYVWGAHGLSSFDCSGLMDYVFQNAAGRSIGGWTVPQESAGYSVSLS
FT                   SLQPGDLLFWGAQGSSYHVALYIGGGQYVHAPQPGENVKIGSMQYYTPSFAKRVF"
FT   regulatory      319125..319145
FT                   /locus_tag="LCA_0313"
FT                   /old_locus_tag="LSA0313"
FT                   /regulatory_class="terminator"
FT   regulatory      319193..319206
FT                   /locus_tag="LCA_0314"
FT                   /old_locus_tag="LSA0314"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        319208..319861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0314"
FT                   /old_locus_tag="LSA0314"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54616"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW1"
FT                   /protein_id="CAI54616.1"
FT                   /translation="MKIGVQAFINEIQDQTYLTDEYEIATPNPFVAADFLAQLKPAVSK
FT                   AVEKQALASFSALTTYEGEQAKVTLETGVVNLPLQYIKKVNQFLELEAQAEVNIYLYVT
FT                   SPLVNRSGMRIDLIGTVADFEEQADQAWAKVEQLLTQDLEAVEAGAKLAKEAPVEVPKK
FT                   APAKKKAAPKKKTAAKKTTTKKKTTTTKKKPATKKTTTKKTAAKKTTTKKKSDA"
FT   regulatory      319878..319912
FT                   /locus_tag="LCA_0314"
FT                   /old_locus_tag="LSA0314"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(319878..319912)
FT                   /locus_tag="LCA_0315"
FT                   /old_locus_tag="LSA0315"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(319948..320589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0315"
FT                   /old_locus_tag="LSA0315"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54617"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YW0"
FT                   /protein_id="CAI54617.1"
FT                   /translation="MKIFVIGAHGNIGQLLIPKLIAAGHIVSAGIRNEAQATEMTALGA
FT                   TPVSFDLTKQPKELAPLFADHDAIVFTAGSGGKTGDDQTLLVDLDGAVKSMAAAKIADV
FT                   NRYVMVSALFVEDRAKWPESIKPYYAAKYYADHWLEFSGLDWTILRPGTLTNDAGTAQF
FT                   TMQPTGGQVARADVAAMIQAVLEKPEQTIHHKYSFVNGDLPIQQAIEQAD"
FT   regulatory      complement(320592..320605)
FT                   /locus_tag="LCA_0315"
FT                   /old_locus_tag="LSA0315"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      320946..320959
FT                   /gene="sdhB"
FT                   /locus_tag="LCA_0316"
FT                   /old_locus_tag="LSA0316"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        320963..321613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="LCA_0316"
FT                   /old_locus_tag="LSA0316"
FT                   /product="L-serine dehydratase, beta subunit (L-serine
FT                   deaminase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54618"
FT                   /db_xref="GOA:Q38YV9"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV9"
FT                   /protein_id="CAI54618.1"
FT                   /translation="MTNQYRSVFDIIGPIMIGPSSSHTAGAVAIGHVANRLFHAPIKKV
FT                   IVRYYESFAQTHQGHGTDYAIISGVLGFDPADQRVPMAVDLARRQGIEVEFIEDPGDSP
FT                   VNHPNTAELTLINSQKSLTIWGCSIGGGTIEIRKVDLNGIIFQPDGPLPIIFVEADQEI
FT                   GTALDHIFKDNYRDERISVRVPGRFLYKLELLDKPYPEQVEQVRGMSKDMIVL"
FT   CDS_pept        321630..322523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="LCA_0317"
FT                   /old_locus_tag="LSA0317"
FT                   /product="L-serine dehydratase, alpha subunit (L-serine
FT                   deaminase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54619"
FT                   /db_xref="GOA:Q38YV8"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV8"
FT                   /protein_id="CAI54619.1"
FT                   /translation="MYTKIHELVQTAQERQLPISELIIEQEIKMSHSSREIIWATMGKN
FT                   LDVMLAAEEKGVTGEGVQSATGITGGEAVLMKRYREKGQSLSGDIMLEAVQNAIATNEV
FT                   NASMGIICATPTAGSAGTLPGILSVITKQLSLDRDAQIRFLFCASAFGMVVANDAMIAG
FT                   ATGGCQAEVGSASAMGAAAAVEAAGGTPQQSSEAFAMAMSNLLGLVCDPVAGLVEVPCV
FT                   KRNVIGSVNALTSADMALAGLVSKIPADEVISAMKSIGENLPSTLRETGLGGLAATPTG
FT                   IALKMQIFGQDMSIDK"
FT   regulatory      322537..322550
FT                   /locus_tag="LCA_0318"
FT                   /old_locus_tag="LSA0318"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        322553..324490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0318"
FT                   /old_locus_tag="LSA0318"
FT                   /product="Putative oligopeptide transporter"
FT                   /function="1.2.1 Transport/binding of proteins/peptides"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54620"
FT                   /db_xref="GOA:Q38YV7"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV7"
FT                   /protein_id="CAI54620.1"
FT                   /translation="MQKKLSKSAYGGISGERYVPYVSQGNKKVGNTAILIMGSLLAIIF
FT                   AASTAYSGMKAGLTVAAGIPGSIIGSGLVGAFAKSKGILGKNIMQGMSSGGESIASGMI
FT                   YVLPAIVLIGGHINFIEGLIVGILAILFSIGTSSLVHNYLVVEEHGNLVYPEAMAISEA
FT                   LVASDTGGDSLKYMGIGFGIGGVITMLTTSVFGVVNNMMNYVGSSFYKWKLDVEVNPLL
FT                   AGIGFIVGLEVALTMFAGALLSNFAIAPLIGYFTDMAGNGAHVWNNASLAVNQMTVNDL
FT                   ASSYVKYIGAGMMLCGGLIGAIKLIPTIVTSIKKTLNAKNTTGEDKNTLGMISIVLGAV
FT                   GIFVIGIIIAQNFMMGIVGALLAVILSLLFVIVSARIAGTIGCSNLPVSGMTIASLVIM
FT                   TVVFVLFGWTSNAHTQILLMFGTFVVTAIAVGGGYMQSQKVTYVIGGSKSEMMKYFMIS
FT                   AIIGVVVVIGTISILSPQFVTDSATPAFGLPQANLIATLTSGIMSGELPWIMIIVGVAM
FT                   AIVLYFLELPIMTVAIGFYLPISTTSIILIGALIKVFIDKATGDEAVKNNRIQSGISLS
FT                   SGLIAGGSIIGLIGIILHVTGVLKDRVISGFASSNEMALILLVVMIVAIAAPLMMIKKG
FT                   GDSEDEEAKG"
FT   CDS_pept        324471..324824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0319"
FT                   /old_locus_tag="LSA0319"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54621"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV6"
FT                   /protein_id="CAI54621.1"
FT                   /translation="MRKQKAEVDLNQLIFAKVPEVKFQLKAGQVTIIRPQDHWIQRFFR
FT                   RLHVRIPAESKLTLDDYGSFVFRHVNGQRSVYQIGQALAAEYDETNDYLYERLLVYLNH
FT                   LEQTEHLIKRVTD"
FT   regulatory      324866..324879
FT                   /gene="pepD3"
FT                   /locus_tag="LCA_0320"
FT                   /old_locus_tag="LSA0320"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        324882..326303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD3"
FT                   /locus_tag="LCA_0320"
FT                   /old_locus_tag="LSA0320"
FT                   /product="Dipeptidase D-type (U34 family)"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54622"
FT                   /db_xref="GOA:Q38YV5"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV5"
FT                   /protein_id="CAI54622.1"
FT                   /translation="MTDRIELSACTSMMVGKNASIDGSTMISRNEDRFYAIHPKRFFVQ
FT                   PAVHNRHETYVSKYNGLTMPLPEEGYRYTSTPNGDLSDGLNEEDGINEKNVALSATESV
FT                   YANERVLAYDPLIKNSLAEDSMCSLVLPYINSAREGVKLMGDIVTKYGSAEGNGVQYSD
FT                   ENEVWYQEIVTGHHWVAVRIPDDCYAVAANQVAIENIDFNDPDNYMWSDGIQEFVSENH
FT                   LNPSDTEWNFRKIFGTDTEKDRHYNTPRVWYAQRYLNPEIKQEPESSDLPFIRKANRKL
FT                   SVEDVQYVLKSHYNETEYDPLGNGTEEQKTTYRAISLSRTQNSHICQIRNNVPDAVKGV
FT                   QWLGFGVPTFCPHVPFFTNANDTDETYRELPEKMTLKNAYWLHEALAMVVESHYGAFKQ
FT                   ADIDYQKALSEWARTKIAATDKAIENQTDAVAFLTAQNHEIATHYNEATTDLLAQLVTE
FT                   GTQLSKLTFVMDKNL"
FT   regulatory      326329..326355
FT                   /gene="pepD3"
FT                   /locus_tag="LCA_0320"
FT                   /old_locus_tag="LSA0320"
FT                   /regulatory_class="terminator"
FT   regulatory      326362..326375
FT                   /locus_tag="LCA_0321"
FT                   /old_locus_tag="LSA0321"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        326379..327230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0321"
FT                   /old_locus_tag="LSA0321"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54623"
FT                   /db_xref="GOA:Q38YV4"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV4"
FT                   /protein_id="CAI54623.1"
FT                   /translation="MTDLKMSSKRIVVAMIYGFLAAVSVNLFLIPAKTYSSGVTGVAQL
FT                   LTALVSHLGGSLSVAALVFILNVPLLVLAWFKINHQYAVFSIVAVFTSVIFLKIIPVPV
FT                   QPIITERFAGALFGGALIGLGVGLCFRAGFSTGGTDVIVTLVGRLTGKRVGAVNNVING
FT                   MIILAAGIFFGWGAALYSIVEIFVSSLLMDYIYTQQQKVTVTIFTKQPEALKKRMREFI
FT                   HGATELDGTGLYTNQETSVIMTVVSKYDLTALKLVVQDADPNAFVNIQSTMNLWGRFES
FT                   NE"
FT   regulatory      327235..327270
FT                   /locus_tag="LCA_0321"
FT                   /old_locus_tag="LSA0321"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(327235..327270)
FT                   /locus_tag="LCA_0323"
FT                   /old_locus_tag="LSA0323"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(327279..327494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0323"
FT                   /old_locus_tag="LSA0323"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54624"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV3"
FT                   /protein_id="CAI54624.1"
FT                   /translation="MDKENLNIGDIVTGKVNEDLESAFTGTVEKVYENSALVTITDFDA
FT                   VDKANVSELNNKIVVNLKQLKAAKTK"
FT   regulatory      complement(327497..327510)
FT                   /locus_tag="LCA_0323"
FT                   /old_locus_tag="LSA0323"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      327677..327690
FT                   /locus_tag="LCA_0324"
FT                   /old_locus_tag="LSA0324"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        327693..328016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0324"
FT                   /old_locus_tag="LSA0324"
FT                   /product="Putative hydrolase, haloacid dehalogenase family
FT                   (N-terminal fragment), authentic frameshift"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54625"
FT                   /db_xref="GOA:Q38YV2"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV2"
FT                   /protein_id="CAI54625.1"
FT                   /translation="MEPYLVFSDIDGTLVIDHQIVTPFTKRVIRELQQRDVIFYIATGR
FT                   MYNLGKVIARQINDDARIIASNGAVFENEQGSVQHHLGYAALKAAYEITQSDPRLSAHF
FT                   FYD"
FT   CDS_pept        328051..328536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0325"
FT                   /old_locus_tag="LSA0325"
FT                   /product="Putative hydrolase, haloacid dehalogenase family
FT                   (C-terminal fragment), authentic frameshift"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54626"
FT                   /db_xref="GOA:Q38YV1"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV1"
FT                   /protein_id="CAI54626.1"
FT                   /translation="MARDAGNLTSMGAEIAYDSVNDLDTLLAMSNQIINGIIVAKGEPA
FT                   LLASVKQYLAEQDVMNLSSSGPDNIELIPKGIDKATAIRQIQTLHGIDADHTFVFGDGQ
FT                   NDLGMLQAAKYSVAMGNALPEVKAVANYVTESNVNDGVAKFLQKHFELSLSDSEVGL"
FT   tRNA            328601..328673
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:328634..328636,aa:Thr)"
FT   regulatory      328694..328717
FT                   /locus_tag="LCA_0325"
FT                   /old_locus_tag="LSA0325"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(328736..328759)
FT                   /locus_tag="LCA_0326"
FT                   /old_locus_tag="LSA0326"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(328744..331041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0326"
FT                   /old_locus_tag="LSA0326"
FT                   /product="Putative DNA helicase"
FT                   /function="3 Information pathways"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54627"
FT                   /db_xref="GOA:Q38YV0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YV0"
FT                   /protein_id="CAI54627.1"
FT                   /translation="MLQEDTQQQEQARVDLTVDQVNQRLTVINQQLDNAYNETKDIEQR
FT                   YGDTTKVNITEVDDRMETNAAVQQQKQLVAAAVENEKLLTSQQKRLTDLVDSPYFGRID
FT                   INEDGEEESLYIGTATFINEQDQFLVYDWRAPIASIYYNGTLGTVSYDTPNGPVKVDLT
FT                   LKRQFKIKNGQIEHLFDTNETVGDELLQAILGQQSDEYMQNIVATIQKEQNDIIRDTTA
FT                   DLLIVQGVAGSGKTSAVLQRIAFLLYHSRSHLEADQMVLFSPNRLFSHYISEVLPSLGE
FT                   KNMRQVTMAEFLSHRFSGLQVETLFDRFEKDQASFPEMTQAIRRFKESAPFMQQITDYV
FT                   KQVSTQPLAFNDLYFEDRPFFTKAQINKIYLDLPHNMRPGDKFIATKNTLIKRLKRQIN
FT                   LEVHLDWVAEKIDTLSDDDYRAIVGDREFDSGDLEQAFIAREIVQNYFADLYDAIYNDY
FT                   FLDVYTEYQNFLRTACPATIPVAVWEAMIETVAQNNERHLVGLSDAAPILYLRDLLTDS
FT                   GQNHSIQYLFVDEMQDYSIAQFVYLQHAFPNAKFTVLGDYAQDVFTATYQAGNFIERLC
FT                   AAFPKLKTNQISLTKSYRATAPITNFAKALLPKETALQAFSRDGRLPRVITATKEASLN
FT                   ALTQEIFHLQKRHATIAILTKDQQTARQLFASLTPDDQVTLISETTRSLPKGVLVLPLY
FT                   LAKGLEFDAVIGYDISATTFGQSSDVDLLYTLMTRAMHDLTLLGIGTLSPLITSLDPQY
FT                   YQNVTTTKETIA"
FT   regulatory      complement(331045..331058)
FT                   /locus_tag="LCA_0326"
FT                   /old_locus_tag="LSA0326"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      331380..331393
FT                   /gene="trpS"
FT                   /locus_tag="LCA_0327"
FT                   /old_locus_tag="LSA0327"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        331397..332413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="LCA_0327"
FT                   /old_locus_tag="LSA0327"
FT                   /product="Tryptophanyl--tRNA synthetase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54628"
FT                   /db_xref="GOA:Q38YU9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU9"
FT                   /protein_id="CAI54628.1"
FT                   /translation="MAKKIILTGDRPTGKLHIGHYIGSLRNRVAMQDSGEYETFIMIAD
FT                   QQALTDNARDPEKIRNSLFQVALDYLSVGIDPAKTTVFVQSQIPALSELTMHYLNLVTV
FT                   SRLQRNPTVKAEIQQKNFEQSIPAGFLIYPVSQAADITAFKATTVPVGDDQEPMLEQTR
FT                   EIVRTFNNVYGQEILVEPEGVFPPKGEGRLPGLDGNAKMSKSLGNAIYLSDDAETLEKK
FT                   VMSMYTDPLHIKVTDPGHIEGNTVFTYLDAFDDDHEKVAELKAQYQAGGLGDVKIKRYL
FT                   NEVLQAKFAPIRERRAEFEKNPAAVYKMLEEGSKKANAVAEQTLKEVRDAMGINYFN"
FT   regulatory      332606..332619
FT                   /locus_tag="LCA_0328"
FT                   /old_locus_tag="LSA0328"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        332622..333989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0328"
FT                   /old_locus_tag="LSA0328"
FT                   /product="Putative drug:Na(+) antiporter (drug efflux
FT                   pump)"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54629"
FT                   /db_xref="GOA:Q38YU8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU8"
FT                   /protein_id="CAI54629.1"
FT                   /translation="MHDFTKGNPLKVIILFTGPLLIGNIFQQLYSVIDTLIVGRTIGVN
FT                   ALAAVGSTGGLNMLIIGFCTGTTAGLSILTAQRYGAQDYRGVKRSFATSILISLVITVI
FT                   LTILSMVFSRQILVLMKTPTAIIADAQQFIMIIFAGIFASMAFNLLSNIIRALGDSRTP
FT                   LFFLIVGVVVNIVLDFIFILGFKMGVEGAGFATVSAQVVSAVLCLIYIYRRIPALVLRR
FT                   KDFRITPKEVREHLKVGLPMGFQSSIIAIGAIVIQIMLNTLGASAVAAYTAAGKIDQLA
FT                   NQVGNSFGVALATYAAQNYGARQYDRIRVGVRQTLLVSITFSIIMGALIITFGRPLVNI
FT                   FIGTQQPHVTALAQIYFRYNSSCYFILAILFAIRYTLQGLGQSVMPTLAGLAELLMRIF
FT                   AGIILVRMLGFTGASMANPLAWIGSCLVLLGSYFKTMRQLKRRAAKQTKKKESPNV"
FT   CDS_pept        333982..334518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0329"
FT                   /old_locus_tag="LSA0329"
FT                   /product="Putative DNA-entry nuclease precursor (N-terminal
FT                   fragment), authentic frameshift"
FT                   /function="3.2 DNA restriction and modification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54630"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU7"
FT                   /protein_id="CAI54630.1"
FT                   /translation="MFKKRFIGVVALLALMLAGCQVQPATPHKPAQTTTTHKQAKTTTA
FT                   LAAKTFKSGDEPYLVVNHNKSTLDVRQWQTERIKYGALDDLNRTTTNTAYLSNETLGHS
FT                   HTRARQNWRPTGWHNQPVMIDGHRVIPQNRGHLIAYAISFNFDEDGVFKKGQPGSNDNP
FT                   KNLATQTEFSNQRTM"
FT   CDS_pept        334564..334779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0330"
FT                   /old_locus_tag="LSA0330"
FT                   /product="Putative DNA-entry nuclease precursor (C-terminal
FT                   fragment), authentic framesshift"
FT                   /function="3.2 DNA restriction and modification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54631"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU6"
FT                   /protein_id="CAI54631.1"
FT                   /translation="MIYQVTTVFRGSELMPRGYWVQAISTDKTLNFNAYVWNVEPKMQF
FT                   DYATGRGRVDSAMKVSDRYQGNRYTR"
FT   regulatory      334791..334818
FT                   /locus_tag="LCA_0330"
FT                   /old_locus_tag="LSA0330"
FT                   /regulatory_class="terminator"
FT   regulatory      334860..334873
FT                   /locus_tag="LCA_0331"
FT                   /old_locus_tag="LSA0331"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        334876..335478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0331"
FT                   /old_locus_tag="LSA0331"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54632"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU5"
FT                   /protein_id="CAI54632.1"
FT                   /translation="MAALEPYQENYFETDEAYENQLVTEMPLKEVTINMAYFKGSHFKD
FT                   IQFEQMTFDNCDFQDVLFEHCALLNCSFIGNTFQRVAFDGCQLIGADFAEAGLRDVRFV
FT                   ACKLDYAGFNQTRMRHVDFEECSLQEVAFEYVDWQWLMMSGNDLNGIDLTGTNLKAFDL
FT                   SRNTFEKAVFSLDLLRGATVSSAQTLVIMSALRINVR"
FT   regulatory      335548..335561
FT                   /locus_tag="LCA_0332"
FT                   /old_locus_tag="LSA0332"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        335565..338186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0332"
FT                   /old_locus_tag="LSA0332"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54633"
FT                   /db_xref="GOA:Q38YU4"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU4"
FT                   /protein_id="CAI54633.1"
FT                   /translation="MKNLGRRIYQGIQRHLTLLKGLFILSVLVFVIFEVGRIFRDLNGE
FT                   QLRASLTTQSPVTLLAMLVIGFLAILPMLNYDFVIAELLPEEYSFWYKVKSGWIVNTFT
FT                   NIAGFGGFLGASLRANFYGKKASQKEILIAISKIALFLLAGLSIWCLISIVLIFGFGIG
FT                   QIYANYWLWLVGGACYFPVLLGSTRLKNAAFFSDLSVKRILRLTAGSFFEWGFAGGFFL
FT                   LIGYFLEIKGDLLQVLPLFMIANIIGVISMVPGGLGTFDLFMIFGLSAIGVGNADAVVW
FT                   LSFYRVFYYIMPFLVGVGLFTHDAGSRLNHYLQGLPRQIMQKIAHHFIVFFLYISGIIL
FT                   LLVATVPNFAITNTVIGQLYPYTFFFLDRVTNIIVAFVMLGLARGVANRVKRVYWPLMI
FT                   LLVIAIANTLWRDFSIKLAVFLILVLLASLLLKRELYREKIEFSWNDRIVDGAIFVGVF
FT                   LLYSFVGIANSPHLHHRKPVPTALLFPSERIWLVGFVGLLVAAATLFIVFRYLSRGGHK
FT                   IATPFDETRISKVIAEYGGNEVSHLAYLKDKSVYFYQEDGEDQVFLLFRKKADRLIVMG
FT                   EPVGNPDKFIDAIEALMREADLIDCHLAFYEISAELTMQLHEIGFDFIKFGEEGYVKLA
FT                   DFTLVGKKRRAERALMNKFEREGYQFELLTPPFSDDLMAELKAVSDDWLDGRVEKGFSL
FT                   GFFDPNYLQQAAIAVIYDPEHRIVAFANDMPTGTKEVSSIDLMRHRKDAPSGIMDEVFI
FT                   SLFEHNKAEGYEYFNLGMAPLANVGTSEFSFIEEKIAHLIYEYGYHFYGFQGLRTYKKK
FT                   YTTKWIPKYIAYQKRTSIIFTMLQILLVVNQKVTETPQRKGLAGHFMRFVQIGNLTNNQ
FT                   DK"
FT   CDS_pept        338196..338801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0333"
FT                   /old_locus_tag="LSA0333"
FT                   /product="Putative nucleotide methyltransferase"
FT                   /function="3 Information pathways"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54634"
FT                   /db_xref="GOA:Q38YU3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU3"
FT                   /protein_id="CAI54634.1"
FT                   /translation="MTDYYYSKNPEVEHAEKNWTFELRGFNFKFTTDNGVFSKNTVDYG
FT                   SRALLDAVDLSETPAGPILDMGCGYGPIGMTLAKLAPERQIDMVDVNERALGLAQKNCD
FT                   LNQIQNVAIFESAEYQNVTAQYAAILTNPPIRAGKTVVQNILKGAYDHLLPDGELDVVI
FT                   QKKQGAPSAKQLMADTFGNVQIIHKDKGYYILQSIKLK"
FT   regulatory      338857..338870
FT                   /locus_tag="LCA_0334"
FT                   /old_locus_tag="LSA0334"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        338874..339218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0334"
FT                   /old_locus_tag="LSA0334"
FT                   /product="Hypothetical extracellular protein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54635"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU2"
FT                   /protein_id="CAI54635.1"
FT                   /translation="MKMRYKILIGVGVTAGVGATAAFVGSKAIIEKVERYRKRLAVKNF
FT                   VKDKLHGNQKALELVDQLSDADVNNLLGAADKLNQLKDKLGEQTDNIPEMMEDLRQTLT
FT                   AYATKVKERL"
FT   regulatory      339283..339296
FT                   /locus_tag="LCA_0335"
FT                   /old_locus_tag="LSA0335"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        339299..339817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0335"
FT                   /old_locus_tag="LSA0335"
FT                   /product="Putative cytidine deaminase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54636"
FT                   /db_xref="GOA:Q38YU1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU1"
FT                   /protein_id="CAI54636.1"
FT                   /translation="MGYTQTEIDQWMQVAIDEANQARIIGEVPIGAVIVKDGQIIGRGH
FT                   NIREHAQDATLHAEIIAIQEACMVEKSWRLEDTAIFVTLEPCPMCAGAIINSRIPNVYF
FT                   GASDPKAGVTGTLMNLLTDKRFNHQATVVAGVREAECAALLQTFFKKIRENRRKKKKKT
FT                   GNFKPNRVE"
FT   regulatory      339931..339955
FT                   /locus_tag="LCA_0335"
FT                   /old_locus_tag="LSA0335"
FT                   /regulatory_class="terminator"
FT   regulatory      340226..340239
FT                   /gene="dnaX"
FT                   /locus_tag="LCA_0336"
FT                   /old_locus_tag="LSA0336"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        340242..341957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="LCA_0336"
FT                   /old_locus_tag="LSA0336"
FT                   /product="DNA-directed DNA polymerase III, gamma/tau
FT                   subunit"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54637"
FT                   /db_xref="GOA:Q38YU0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YU0"
FT                   /protein_id="CAI54637.1"
FT                   /translation="MSYQALYRVWRPQRFDDVVGQETMTQTLKNAIITKQTSHAYLFTG
FT                   PRGTGKTSAAKIFAKAINCHYQKDGEPCNECETCRAITAGALNDVIEIDAASNNGVEEI
FT                   RDIRDKAKYAPTQADYKIYIIDEVHMLSTGAFNALLKTLEEPPANVVFILATTEVHKVP
FT                   ATIISRTQRFNFKRITAADLFKRMAYILEQKEMTYDPAALKVIAKAAEGGMRDALSILD
FT                   QVLSFSDNHVTLENALDVTGSLTEALLADYVQTIHDHAPKAALQLLQQILAEGKDAQRF
FT                   VEDLIEYVRDLLMYQQAPELVMANEMDLLDEHFKQLSDALSAEQLYTVIDILNETQQQL
FT                   RFTNHPEIYLEVATVRLTQQPVAPAAVSANVSAPADNEQVTQLSRQVAQLQAALQKLET
FT                   AGPSAPVQQAKPKPAKKISKKVNRKLIYPVLADATRTNLENLKEVWPDLLNMLDVTKRA
FT                   IMRVSEPVAASQSGVVVAFNYEILFERANNDQDLLTVLENGLNRLTGNPFKVVLVPQDN
FT                   WPEIRKEYLQNHAVSGHNNEDQPTTTEKAPAPEVNEVVQQAQALFGDAVVVQKD"
FT   regulatory      341968..341981
FT                   /locus_tag="LCA_0337"
FT                   /old_locus_tag="LSA0337"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        341984..342292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0337"
FT                   /old_locus_tag="LSA0337"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54638"
FT                   /db_xref="GOA:Q38YT9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YT9"
FT                   /protein_id="CAI54638.1"
FT                   /translation="MRGMGNMQGMMKQMQKMQKEMGQTQDELNSTEFVGKVANDAVVVT
FT                   MTGDKKMKDIAIKPEAVDPDDIDMLQDLIIMAVNEAMVDIDKQTQAKMGKFTKGLPF"
FT   regulatory      342302..342315
FT                   /gene="recR"
FT                   /locus_tag="LCA_0338"
FT                   /old_locus_tag="LSA0338"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        342318..342914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="LCA_0338"
FT                   /old_locus_tag="LSA0338"
FT                   /product="Recombination DNA repair protein RecR"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54639"
FT                   /db_xref="GOA:Q38YT8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YT8"
FT                   /protein_id="CAI54639.1"
FT                   /translation="MQYPEPIAKLIESYMKLPGIGNKTATRLAFYTIDMNEDDVTNFAK
FT                   NLISARRDLHYCSVCGNITDEDPCEICRDTARSQEMILVVEQPKDVMSMERMNDYHGLY
FT                   HVLHGVLSPIEGKGPDDINIANLIKRLQKTPAKEVIIATNATPEGEATAMYISRLIKPA
FT                   GIKVTRLAHGLAVGSDIEYADEMTLLKAVEGRQEI"
FT   regulatory      342916..342929
FT                   /locus_tag="LCA_0339"
FT                   /old_locus_tag="LSA0339"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        342931..343185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0339"
FT                   /old_locus_tag="LSA0339"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54640"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YT7"
FT                   /protein_id="CAI54640.1"
FT                   /translation="MFGRRKPTLREAGDEALLDLIYQVKDKWRSAQKTQANVRGLDQTL
FT                   EMESKIQQAKFEFLYRQARQRKVASDAVSREVASRNALR"
FT   regulatory      343195..343236
FT                   /locus_tag="LCA_0339"
FT                   /old_locus_tag="LSA0339"
FT                   /regulatory_class="terminator"
FT   regulatory      343313..343326
FT                   /gene="tmk"
FT                   /locus_tag="LCA_0340"
FT                   /old_locus_tag="LSA0340"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        343329..343973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="LCA_0340"
FT                   /old_locus_tag="LSA0340"
FT                   /product="Thymidylate kinase (dTMP kinase)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54641"
FT                   /db_xref="GOA:Q38YT6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YT6"
FT                   /protein_id="CAI54641.1"
FT                   /translation="MVGKLITFEGPDGAGKTSALEAVVARLQKEVSQEIVVTREPGGNP
FT                   ISEQIRQIILDVKNTAMDDRTEALLYAAARRQHIVEKIQPALAADKLVICDRFVDSSIA
FT                   YQGAGRGIGEEAVAQMNLFATDGLTPDLTLYLDVPSEVGLARIKQHRQNQYDRLDQEKL
FT                   AFHQKVRQSYLKLAQAHPDRIKTIDASQPLEAVVTQCLQVIAQANLHLFEV"
FT   CDS_pept        343988..344317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0341"
FT                   /old_locus_tag="LSA0341"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54642"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YT5"
FT                   /protein_id="CAI54642.1"
FT                   /translation="MKLLLAIVQDKDSNLLSSELIDANIRATKLSTTGGFLKSGNTTFI
FT                   VGIEDERVPEALKIIEETCQAREQFMTPPINMDATMDSSMSYPIEVQVGGATVFVMPIE
FT                   QFHRF"
FT   CDS_pept        344321..345313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="LCA_0342"
FT                   /old_locus_tag="LSA0342"
FT                   /product="DNA-directed DNA polymerase III, delta prime
FT                   subunit"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54643"
FT                   /db_xref="GOA:Q38YT4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YT4"
FT                   /protein_id="CAI54643.1"
FT                   /translation="MATLTIEQMQPKLVQQFAQIIARGQLAHGYLLAGAQGVGKMQLAQ
FT                   WLALRLFCQQVNEDSQPCYQCPECQRILTGNHPDVVEIKPDGKSIKIADIRYLKQEVAK
FT                   SGMESSQRLFIIEAAETLTASAANSLLKFLEEPAPNVYAILCTSNKNLMLPTILSRLQV
FT                   IDLANLPKEMVRQQFEEAQILPAQAQLLSHLTSDLTQAQQLLAEDWLMQVVAKITSWAQ
FT                   KVAQKDLESFVTIQTQLLPLLTDRSQQKIALNLIGLWYQDLLNCRCDLAGDLCFSEYRT
FT                   QLNTISQQMTAAEIVAQTEFVLTAQRTFEQNVSCQNVLESLTLNLIAVA"
FT   regulatory      345347..345360
FT                   /locus_tag="LCA_0343"
FT                   /old_locus_tag="LSA0343"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        345365..345718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0343"
FT                   /old_locus_tag="LSA0343"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54644"
FT                   /db_xref="GOA:Q38YT3"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YT3"
FT                   /protein_id="CAI54644.1"
FT                   /translation="MSKTDLYEQLLTIEQQAKLTFDGITEMKAVLSKVLEENAELEIEN
FT                   KHLREHLQELQQTTEETDTKDLSQGLSKSKQNLQNLYEEGFHICPYFYGSRRENDEPCA
FT                   FCNDVIYGERTAD"
FT   regulatory      345738..345771
FT                   /locus_tag="LCA_0343"
FT                   /old_locus_tag="LSA0343"
FT                   /regulatory_class="terminator"
FT   regulatory      345800..345813
FT                   /locus_tag="LCA_0344"
FT                   /old_locus_tag="LSA0344"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        345817..346695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0344"
FT                   /old_locus_tag="LSA0344"
FT                   /product="Putative methyltransferase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54645"
FT                   /db_xref="GOA:Q38YT2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YT2"
FT                   /protein_id="CAI54645.1"
FT                   /translation="MQTQSSFKTTTQGTLYLVPTPIGNLGDMTYRAIETLKDVQLIAAE
FT                   DTRNTQKLLNHFEIETKQISFHEHNTQQRIETLIEKLEAGDDIAQVSDAGMPSISDPGH
FT                   ELVKACIEANIAVVPLPGANAGITALIASGITPQPFTFFGFLPRKGKELTETVAQLALK
FT                   PETTIFYEAPHRLKKTLQALINGFGGERQVTLGRELTKKFEEFIRGDLQEALTWATDNE
FT                   MRGEFVIIVAGNPTPQNLSVVATDPTLSLSEQVEAQIQQGASPNVAIKTVAKANDLKKQ
FT                   VVYNAYHDLTE"
FT   CDS_pept        346706..347452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0345"
FT                   /old_locus_tag="LSA0345"
FT                   /product="Putative Acyl-ACP thioesterase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="3.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54646"
FT                   /db_xref="GOA:Q38YT1"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YT1"
FT                   /protein_id="CAI54646.1"
FT                   /translation="MAGKQYTEEYRIPYFETDIKGELTLASLVNVLILASEHQLNDLNV
FT                   GEETMHSLNLGWVVTQYQMTINRMPKVDEKARIVTEAESYNRYFCYRNFWLYDEAGNEC
FT                   VFVQSIFVMMSYETRSMVPVVPEIMAPFESMAIKGSKRFPRIKKIDSEKASQKEYRVRY
FT                   FDIDGNQHVNNVHYFEWMLDALDYDFLMDHRVTSVNIRYGHEIQYGQMTQSQVEQVMVD
FT                   DIMTTRHKVAVGDLSAAEAEIAWTKR"
FT   regulatory      347504..347517
FT                   /locus_tag="LCA_0346"
FT                   /old_locus_tag="LSA0346"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        347520..347717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0346"
FT                   /old_locus_tag="LSA0346"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54647"
FT                   /db_xref="GOA:Q38YT0"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YT0"
FT                   /protein_id="CAI54647.1"
FT                   /translation="MVKIIKLFANQHPYLAYIALIVTASLIGITVEWLINRDFVNNIWG
FT                   ALMMIIIGIIGIYYKQKKKS"
FT   regulatory      347762..347787
FT                   /locus_tag="LCA_0346"
FT                   /old_locus_tag="LSA0346"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(347762..347787)
FT                   /gene="asnA1"
FT                   /locus_tag="LCA_0347"
FT                   /old_locus_tag="LSA0347"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(347803..348777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA1"
FT                   /locus_tag="LCA_0347"
FT                   /old_locus_tag="LSA0347"
FT                   /product="L-asparaginase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54648"
FT                   /db_xref="GOA:Q38YS9"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS9"
FT                   /protein_id="CAI54648.1"
FT                   /translation="MKKILVLHTGGTIAMSADQDGAVAPTGQNPMAGFEKLFDNQLTII
FT                   SEEFANLPSPHITPTVMLALKNRIQEAEATGIDGVVITHGTDTLEETAYFLDLTLPNNV
FT                   PIVITGAMRSSNEIGSDGLHNLISAVWTAASDDAHDKGVLVVMNDEIHTARYVTKTHTT
FT                   NVATFRTPTFGPIGLVSKHDANFFQELIRSEICDIQELVEPVFLLKAYAGMDGTLFEAI
FT                   NQPTTKGLVIEALGAGNLPPATLPAIQALLDRNIPVVLVSRCFNGIAEDVYDYDGGGVK
FT                   LKKMGITFCQGLNGPKARLKLQVGLSAGKTGADLVNFVSNAVS"
FT   regulatory      complement(348781..348794)
FT                   /gene="asnA1"
FT                   /locus_tag="LCA_0347"
FT                   /old_locus_tag="LSA0347"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      349043..349056
FT                   /locus_tag="LCA_0348"
FT                   /old_locus_tag="LSA0348"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        349062..349598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0348"
FT                   /old_locus_tag="LSA0348"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54649"
FT                   /db_xref="GOA:Q38YS8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR030949"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS8"
FT                   /protein_id="CAI54649.1"
FT                   /translation="MVNQDRLFGVKLDTRRVVLLAVLIALQLVIARFAISLTIYRISFG
FT                   FIVTALMGWWFGPVWAGLAAVLGDLINSLMIGVPGGYFPGFTLSAFLGAFIYGCFFYRQ
FT                   KITWLRVILAVLTVVVVVNLGLNSWWVSILSQTPISVHFATRAVGEAATMVIHPIVIYL
FT                   VMHFEPIVRLKDRIQ"
FT   regulatory      349614..349646
FT                   /locus_tag="LCA_0348"
FT                   /old_locus_tag="LSA0348"
FT                   /regulatory_class="terminator"
FT   regulatory      349721..349734
FT                   /locus_tag="LCA_0349"
FT                   /old_locus_tag="LSA0349"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        349739..350464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0349"
FT                   /old_locus_tag="LSA0349"
FT                   /product="Putative O-sialoglycoprotein
FT                   metallo-endopeptidase (M22 family)"
FT                   /function="2.9 Protein fate"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54650"
FT                   /db_xref="GOA:Q38YS7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS7"
FT                   /protein_id="CAI54650.1"
FT                   /translation="MKLLAMDTSNQAVSVALLEDQQILGEMTVNIRQTHSQTLLPMIDQ
FT                   LLKQTKTPIEAIDRFVVAQGPGSYTGLRIAVTTAKSFAWTMGKELVGISSLALLAGNVQ
FT                   ETTALIVPLFDARRDNVFAGVYQWQDQHLQNVVADQHLALTDLLAQLALLNEPVYFVGG
FT                   DVQQFNAQIKATLGSQAHFVDANHNLPHAAVLGQLGANAEPVVDIHGFGPHYLRKTEAE
FT                   VNWGKTHDDQGSAAYVEQV"
FT   regulatory      350511..350524
FT                   /locus_tag="LCA_0350"
FT                   /old_locus_tag="LSA0350"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        350526..350993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0350"
FT                   /old_locus_tag="LSA0350"
FT                   /product="Putative N-acetyltransferase, GNAT family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54651"
FT                   /db_xref="GOA:Q38YS6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS6"
FT                   /protein_id="CAI54651.1"
FT                   /translation="MIDDQPFYLARASQSDIPALIDIERSVYGGKTPWDRWAFASELSK
FT                   RRTSIYLVLCQGSEVVAFVGAWFSTNEAHIANIAVRPSFQKRGIGHFLVHEVVALARDY
FT                   PSQKITLEVRTGNTGAQSVYRRMGFKVVKTRRNYYVQEKEDAFSMCRILSQ"
FT   CDS_pept        351004..352038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0351"
FT                   /old_locus_tag="LSA0351"
FT                   /product="Putative O-sialoglycoprotein
FT                   metallo-endopeptidase (M22 family)"
FT                   /function="2.9 Protein fate"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54652"
FT                   /db_xref="GOA:Q38YS5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YS5"
FT                   /protein_id="CAI54652.1"
FT                   /translation="MTEKKELILAFESSCDETSVAVIENGQRILSNVIATQIKSHQRFG
FT                   GVVPEVASRHHVEQITLCTQEALEQAGVTYDDLTAVAVTYGPGLVGALLIGVTAAKAIA
FT                   YAHHLPLVPVNHMAGHIYAARFVKPLEYPLLALLVSGGHTELVYMPAAGQFEIIGDTRD
FT                   DAAGEAYDKIGRVLGVPYPAGKEIDRLAHLGQDTFNFPRAMLKEDNLDFSFSGLKSAFI
FT                   NTVHHADQIGETLDQADLAASFQASVVEVLVTKTLRAAQSLKVKQLVVAGGVAANQGLR
FT                   EGLAAGIESAGLDLDLIMPPLRLCGDNGAMIGAAAHIALAQNTLADLDLNAIPSLDFPY
FT                   QNEL"
FT   regulatory      352321..352357
FT                   /locus_tag="LCA_0351"
FT                   /old_locus_tag="LSA0351"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(352321..352357)
FT                   /locus_tag="LCA_0352"
FT                   /old_locus_tag="LSA0352"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(352363..353622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0352"
FT                   /old_locus_tag="LSA0352"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54653"
FT                   /db_xref="GOA:Q38YS4"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS4"
FT                   /protein_id="CAI54653.1"
FT                   /translation="MFKFKSLYLFGYGLILSAIVGILLGLFYSLQSTLISLFWQKATFG
FT                   SLLDAIMLMMVGLVIIISRHYFGPLPQNLGVIKADLKQTGTANYRYVLLQMLIPAVILV
FT                   SGTSLGPEATLVSSTFLYSIWLADKQRYVAAHFDDLRAQSIGMRLKVLATPHRYLLHYQ
FT                   QPTAPLTKVATCQKKALSTTYFLNGTAWFSGVFILTGEPSLIIRLGQSHWQGRDLYWFL
FT                   PLVLGGYLLGKLWLAGMVGLRKIMQARLTNDQVRVLIGGLAIFLASLFFPHILFSGQHN
FT                   FHLFTTIWQDQSMLFLMSRSLLKLILLTICLNTGWLGGDIFPVLFASTAQGMAISQLFP
FT                   QVDSLFVIGLIAISMGSAILEAPLVAGLIMVILFLPPNLFWVGIIATGIVLGLEKYRQH
FT                   HQARHEQHQSQGARLHQSEA"
FT   regulatory      complement(353625..353638)
FT                   /locus_tag="LCA_0352"
FT                   /old_locus_tag="LSA0352"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      353884..353897
FT                   /locus_tag="LCA_0353"
FT                   /old_locus_tag="LSA0353"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        353900..354217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0353"
FT                   /old_locus_tag="LSA0353"
FT                   /product="Putative cellobiose-specific phosphotransferase
FT                   system, enzyme IIB"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54654"
FT                   /db_xref="GOA:Q38YS3"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS3"
FT                   /protein_id="CAI54654.1"
FT                   /translation="MAEKTIMLCCAAGMSTSLLVSKMQKSVEAQGVDAEIFATGASDAD
FT                   NQLENKKIDCVLLGPQVRFMEGQFKEKLAPKGIGVEVIDMKAYGMMDGETVLKQALALI
FT                   G"
FT   regulatory      354232..354255
FT                   /locus_tag="LCA_0353"
FT                   /old_locus_tag="LSA0353"
FT                   /regulatory_class="terminator"
FT   regulatory      354300..354313
FT                   /locus_tag="LCA_0354"
FT                   /old_locus_tag="LSA0354"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        354317..354679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0354"
FT                   /old_locus_tag="LSA0354"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54655"
FT                   /db_xref="GOA:Q38YS2"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS2"
FT                   /protein_id="CAI54655.1"
FT                   /translation="MSLLGTIIWWIFGGLVSAVGWFLAGLVWCVTIVGIPVGLQCFKIG
FT                   GLTLMPFNARVVSSGGAGSFLLNIVWFIFGGFILWANHIFWGLLLTITIVGIPFAHQHF
FT                   KLASLSLSPFGKQIVG"
FT   regulatory      354685..354706
FT                   /locus_tag="LCA_0354"
FT                   /old_locus_tag="LSA0354"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(354685..354706)
FT                   /locus_tag="LCA_0355"
FT                   /old_locus_tag="LSA0355"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(354719..356665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0355"
FT                   /old_locus_tag="LSA0355"
FT                   /product="Putative drug resistance ABC transporter, two
FT                   ATP-binding subunits"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54656"
FT                   /db_xref="GOA:Q38YS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS1"
FT                   /protein_id="CAI54656.1"
FT                   /translation="MILLQVQQVARHFGGDYLFKNAQLEVQDHARVALVGPNGAGKSTL
FT                   LKMIAGITTPDDGQIILGKNVQVGYLAQDSGLSSERNIYDEMLTIFEGLRQMEAQMHTL
FT                   EQAIADPDANRSDEDYQALLKQYDQIQHDFSEANGYGYEAEIRGVLHGFQFPEETFTKP
FT                   ISTLSGGERSRLALAKLLLEKKDVLILDEPTNHLDIQTLTWLENYLQTYPGALLTVSHD
FT                   RYFLDKITKEVYDMSRHTLTHYTGNYSHFLTQKSANLSLEWKAYEKQQAEIEKLQTFVD
FT                   KNLVRASTTKQAQSRRRQLEKMDKLERPTNDASKIHFHFDIDQPSGNEVLQVVDAAVGY
FT                   SADKVMVEPINFEVNKQERLAIIGPNGIGKSTLLKSILHQIPFLKGHERVGSNVSIGYY
FT                   DQEQRNLHANKTVLNELWDEHRTTPEKEIRTLLGSFLFTGDDVLKVVSQLSGGEKARLL
FT                   LTKLAMNHDNFLIMDEPTNHLDIDSKEVLEQALREFDGTVLFISHDRYFINQVATGIIE
FT                   LSTTTGSKRYLGDYDYYLAKKAEEEAFAQAAEVPVEVSDQPVTAQDNYKASKETQRAQR
FT                   KLEREVTALEEQMATLEEQATAIQEKMTQADIITKPLVLQELQQDLEKVQADLAQTEAD
FT                   WEEQAMALEEFTN"
FT   regulatory      complement(356668..356681)
FT                   /locus_tag="LCA_0355"
FT                   /old_locus_tag="LSA0355"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      356848..356861
FT                   /locus_tag="LCA_0356"
FT                   /old_locus_tag="LSA0356"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        356863..357510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0356"
FT                   /old_locus_tag="LSA0356"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54657"
FT                   /db_xref="GOA:Q38YS0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YS0"
FT                   /protein_id="CAI54657.1"
FT                   /translation="MAENKIPRATAKRLPLYYRYLNFLNNSGKTKISSTELSEAVKVDS
FT                   ATIRRDFSYFGALGKRGYGYDVESLLSFFKKTLNQDRLTNVALIGIGNLGHALLNYNFR
FT                   QTNNIRISAAFDVKPELIGTIQTGVPVYSMDEMVEQLKLQQIEIVILTVPIEVAQKVTD
FT                   QLVDAGIKGIMNFTPIRISVPNTIRIQNVDLAKELQTLIYFLDNYNTEEASK"
FT   regulatory      357512..357554
FT                   /locus_tag="LCA_0356"
FT                   /old_locus_tag="LSA0356"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(357512..357554)
FT                   /locus_tag="LCA_0357"
FT                   /old_locus_tag="LSA0357"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(357560..358192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0357"
FT                   /old_locus_tag="LSA0357"
FT                   /product="Hypothetical protein, CAAX protease family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54658"
FT                   /db_xref="GOA:Q38YR9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YR9"
FT                   /protein_id="CAI54658.1"
FT                   /translation="MTQSQQNFRLIISYLIILLIPSALVRFFGLSDQFYLFTTITDSLG
FT                   ALLLLYFNYRGPKNSLEKHPLPLKKAIIWGISGILLALIVQIIAGSIDHLLFKNSTQSL
FT                   NTLTLMTALKAQPWLIIILTIAAPTMEELVFRKAIFGGLSARLNPLLAALISSLLFAVI
FT                   HQDSHLIIYAAIGLFLCWLYRKTGSIYTTIISHAGMNLVVTLFYLSH"
FT   regulatory      complement(358194..358207)
FT                   /locus_tag="LCA_0357"
FT                   /old_locus_tag="LSA0357"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      358347..358360
FT                   /gene="groS"
FT                   /locus_tag="LCA_0358"
FT                   /old_locus_tag="LSA0358"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        358364..358648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="LCA_0358"
FT                   /old_locus_tag="LSA0358"
FT                   /product="Co-chaperonin GroES (10 kD chaperonin) (Protein
FT                   Cpn10)"
FT                   /function="3.9 Protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54659"
FT                   /db_xref="GOA:Q38YR8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YR8"
FT                   /protein_id="CAI54659.1"
FT                   /translation="MLKPLEDRVVIAVKDEAEQTVGGIVIASNAKQKPQTGKVVAVGAG
FT                   AMTSDGQRIPLDVKENDEVIYDKYAGSEVEYEGQQYLVLHAKDIIAIIE"
FT   regulatory      358686..358699
FT                   /gene="groL"
FT                   /locus_tag="LCA_0359"
FT                   /old_locus_tag="LSA0359"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        358702..360327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="LCA_0359"
FT                   /old_locus_tag="LSA0359"
FT                   /product="Chaperonin GroEL (60 kDa chaperonin) (Protein
FT                   Cpn60)"
FT                   /function="3.9 Protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54660"
FT                   /db_xref="GOA:Q38YR7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YR7"
FT                   /protein_id="CAI54660.1"
FT                   /translation="MAKELKFSEDARSKMLAGVDQLANTVKTTLGPKGRNVVLEKAYGS
FT                   PEITNDGVTIAKAIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLAQAIIREGMK
FT                   NVTAGANPVGIRRGIELATREAVKKLHEISHKVESKDAIAQVAAVSSANEETGRLIADA
FT                   MEKVGNDGVITVEESKGIDTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITD
FT                   KKISNIQDVLPLLQSIVQEGKALLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGD
FT                   RRKEQLEDIATLTGATVITSDLGLELKETTIDQLGTAGKVTVTKDDTTIVEGAGSKSAI
FT                   AERVENIKKQIAETTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEQKYRIEDALN
FT                   ATRAAVEEGYVAGGGTALIDVIESVAALEEEGDVQTGINIVLRALEEPVRQIATNAGLE
FT                   GSVIVEKVKSQPVEVGYNAANGNWENMIEAGILDPTKVTRSALQNAASVAALMLTTEAV
FT                   VADKPEDNPAPAAGMDPSAMGGMM"
FT   regulatory      360595..360625
FT                   /gene="groL"
FT                   /locus_tag="LCA_0359"
FT                   /old_locus_tag="LSA0359"
FT                   /regulatory_class="terminator"
FT   regulatory      360936..360949
FT                   /locus_tag="LCA_0360"
FT                   /old_locus_tag="LSA0360"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        360954..362705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0360"
FT                   /old_locus_tag="LSA0360"
FT                   /product="Putative amino acid/polyamine transport protein"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54661"
FT                   /db_xref="GOA:Q38YR6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YR6"
FT                   /protein_id="CAI54661.1"
FT                   /translation="MQQLKRIFIGKPLKSSDEGNQKLGRFKALAMLSSDALSSVAYGTE
FT                   EIVVVLTTLSAAAIWYSIPIAAFVLVLLISLTLSYRQVIHAYPGGGGAYVVSSENLGKN
FT                   AGLVAGGSLLVDYMLTVAVSISAGAEAITSAIPAMYGHQVGISFVIVIILMAMNLRGMR
FT                   ESASFLMVPVYLFVLMMTLMIIVGCYKIFTGAIPFHATATVGAVVPGISMALIFRAFSS
FT                   GSSSLTGVEAISNAVPFFKKPRATNAAETLAIMAAILGFFFAGITFLNYWYGIVPMEKV
FT                   TVLSQVAQHTFGKGFFFYIVQFATAFILAVAANTGFSAFPVLAYNLAKDKYMPHMYMDR
FT                   GDRLGYSNGIITLAIGSMALIFIFNGDTSRLIPLYAVGVFIPFTLSQSGMLRKWWVERP
FT                   KNWFGKSIANFVGALISFAILIILFVYRLPDIWPFFIIMPIMIWIFYKIHDHYKKVARQ
FT                   LRVSANEAVLHDYDGSTVIVLVSNVTQVTRGALDYAQSIGDYVIAMHVSTDENPEKERE
FT                   IQAEFKADFPNVRFVDVHSSYRSIQKPIVRFVDIVSKNAQKRNFTTTVLVPQFVPRKPW
FT                   QNILHNQ"
FT   regulatory      362828..362858
FT                   /locus_tag="LCA_0360"
FT                   /old_locus_tag="LSA0360"
FT                   /regulatory_class="terminator"
FT   regulatory      362945..362958
FT                   /locus_tag="LCA_0361"
FT                   /old_locus_tag="LSA0361"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        362960..363766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0361"
FT                   /old_locus_tag="LSA0361"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54662"
FT                   /db_xref="GOA:Q38YR5"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YR5"
FT                   /protein_id="CAI54662.1"
FT                   /translation="MRILFIGDTVGTMGQKMVNEYLPLLKQQYKPQVTIINGENIADGK
FT                   GMTQKDYKNLLQAGADAITMGNHTWNKRDILDFIDDAKKLVRPANFPKGTPGQGMTMIN
FT                   VNQAKLAVINLQGRALMGELLEDPFAMLDDMVAQVSKETNCIFVDFHAETTSEKLALAW
FT                   YLDGRISALVGTHTHVQTNDARVLPDGTAVLTDAGMTGPYNGILGVKREKIISRFMTQR
FT                   PERFELVTEGPGQLNGCLIEIGDQTGHAKSIKPIHISPDHPFGSRF"
FT   regulatory      363772..363785
FT                   /gene="mutS"
FT                   /locus_tag="LCA_0362"
FT                   /old_locus_tag="LSA0362"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        363788..366391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="LCA_0362"
FT                   /old_locus_tag="LSA0362"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54663"
FT                   /db_xref="GOA:Q38YR4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YR4"
FT                   /protein_id="CAI54663.1"
FT                   /translation="MPQKTKETPMMAQYQKVKDQYPDAFLFYRLGDFYELFNDDAVKAS
FT                   QLLELTLTARNKNAADPIPMCGVPHHAAQNYIDILVDQGYKVAICEQMEDPKTAKGMVK
FT                   REVVQLVTPGTVMDEKAGHAKQNNYLTAVVAQGDQFGFAYTDLSTGEMKVSQISSLDVL
FT                   LNEMLSLQTKEVVVNHDVPSEVVQAFVQQQILVSYQDEGADTAEVSFVSQNISQPLALA
FT                   VIKQLVVYLATTQKRHLGHLQRAQAYEPSQYLKLDHSAKMNLELTASLRTGHKSGTLLW
FT                   LLDETKTAMGGRLLKQWLERPLLDLNQIKNRQNQVASFLQHYFERTNLQEALTKVYDLE
FT                   RLAGRVAFGSVNGRDLIQLKTSLEQIPKIKDVLTGINETQAFDQALTRLDPVDDVRTLI
FT                   ETAINPDSPISVTDGGIIQDGYDEQLDQYRNAMSNGKQWLAQLEAQEREATGIHNLKIG
FT                   FNRVFGYYIEVTRANLSSLPEGRYERKQTLTNAERFITPELKEKEQLILEAEERSTALE
FT                   YELFTQVREQVKLQIERLQTLAKGVAALDVLQSFAVVSESYHYVQPTLRTDSREIDLVD
FT                   GRHPVVEKVLGRQKYIPNAVQMGKETDMLLITGPNMSGKSTYMRQLALTVIMAQMGCFV
FT                   PAKSANLPVFDQIFTRIGAADDLISGQSTFMVEMMEANRAIMSATANSLILFDEIGRGT
FT                   ATYDGMALAQAIIEYIHDHVHAKTLFSTHYHELTALADTLTALRNVHVGAVEENGELVF
FT                   LHKMLAGPADKSYGIHVAKLAGMPETLLQRADVILGQLEDKPKAPVQPATVAPAQPAAA
FT                   AVEEQMALFEPEVAAPVDKKTDKVVAAIKNFDLMSATPLEALNQLYEWQKQLNKH"
FT   regulatory      366396..366409
FT                   /gene="mutL"
FT                   /locus_tag="LCA_0363"
FT                   /old_locus_tag="LSA0363"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        366412..368373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="LCA_0363"
FT                   /old_locus_tag="LSA0363"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54664"
FT                   /db_xref="GOA:Q38YR3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YR3"
FT                   /protein_id="CAI54664.1"
FT                   /translation="MMGKIHELSEILSNQIAAGEVIERPASVVKELVENAIDANSTQVD
FT                   IVVEQAGLQMIQVIDNGDGIEPEDVPVAFKRHATSKIATRQDLFKIQSLGFRGEALASI
FT                   ASVSDLTIETATADSLGTFAHFKGGLLEEQKTNPIRPGTAITVRDLFFNTPARLKYVKT
FT                   FQTELANIVDIVNRLAMSHPQIAFTLTNDGHLLLKTAGNNDLKQTIAGIYGVTMAKKLL
FT                   AVSASDLDFKLTGYVSLPELTRATRNYLSILINGRFIKNYQLNKAIIKGYGSKLMVGRY
FT                   PIAVLAIEMDPLLIDVNVHPTKQEVRLSKETALMTLIEGAIKERLATENLIPDAMQNLK
FT                   RTKTVDVDQLQMNLNQITQERRHPSGTVRPVSPMPIPVKTVTPEIAETETPLAAPTAKA
FT                   PAITPERPLFEQPQALAEWDQKYATEAVGKPFGDQVVDETDESEENVVEPTVRFPELRY
FT                   IGQLHSTFLLAEGEDGFYILDQHAAQERIKYEYYREKIGEVSTSVQNLLVPLVLEYPNS
FT                   DALKIQEKTELLASVGIQLENFGQNSFVVHSHPTWIGQGQEEMTIRGMIDDVLKDGRIS
FT                   IAQFREKTAIMMSCKQSIKAHHHLDDAQAKALLADLAKTENPFNCPHGRPVLIHYTQKD
FT                   LEKMFKRIQEPHHSWEGE"
FT   CDS_pept        368373..368918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="LCA_0364"
FT                   /old_locus_tag="LSA0364"
FT                   /product="Inhibitor of septum formation (Maf protein)"
FT                   /function="1.7 Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54665"
FT                   /db_xref="GOA:Q38YR2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YR2"
FT                   /protein_id="CAI54665.1"
FT                   /translation="MFILASQSPRRQALLKRVVNDFEVQPAQIDEHETPLTAPGDYVQT
FT                   LAQRKGEAVAVQYPTATILAADTAISFQGTLYGKPKDRQDAYEMLRQLSGQTHQVYTGL
FT                   WLMKDGLVQQKVVQTDVTFWHLSTAEIEQYLDQNEYADKAGAYGIQGAGALLINKVNGD
FT                   FYNVVGLPVSTVARMLQN"
FT   CDS_pept        368931..369494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0365"
FT                   /old_locus_tag="LSA0365"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54666"
FT                   /db_xref="GOA:Q38YR1"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YR1"
FT                   /protein_id="CAI54666.1"
FT                   /translation="MVNVAVFCGASSGRRPVYTQAASDLGHWLVKRQDQLIYGGSRVGL
FT                   MGTIADTVLENGGRVVGVMPEFLNQREPAHAGLSDLVMVDSMAERKSKMIELADVFIAL
FT                   PGGPGTLEEMSEVISWARIGQQDSPCIFYNVAGYYDLLQQFLAHMVEEGFLTQGDFEKY
FT                   LFTDSLTEIATFIATYQPPKIREY"
FT   regulatory      369889..369902
FT                   /gene="ruvA"
FT                   /locus_tag="LCA_0366"
FT                   /old_locus_tag="LSA0366"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        369905..370516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="LCA_0366"
FT                   /old_locus_tag="LSA0366"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54667"
FT                   /db_xref="GOA:Q38YR0"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YR0"
FT                   /protein_id="CAI54667.1"
FT                   /translation="MYEYLKGLVTAVNPYYVVLEVQGIGYQLQVANPYRYTESMSEVVQ
FT                   IFVHQAVRDTDITLFGFYDLDEKQLFQKLISVSGIGPKSALAILANSDHSGLIQAIMND
FT                   DIGYLTKFPGVGKKTAQQIALDLKGKLGDLEQSATLVGQTAIDLGSQGDSPELSDALAA
FT                   LSALGYSAREVKAITPKLTDFAAQTTDQYLREGLRLLMKK"
FT   CDS_pept        370529..371536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="LCA_0367"
FT                   /old_locus_tag="LSA0367"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54668"
FT                   /db_xref="GOA:Q38YQ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YQ9"
FT                   /protein_id="CAI54668.1"
FT                   /translation="MADERIVSAENDDFAEASIEKTLRPQVLAQYIGQDRVKNELAVYI
FT                   EAAKKREESLDHVLLYGPPGLGKTTLAMVIANELQVQIRTTSGPAIERPGDLVALLNEL
FT                   QPGDVLFIDEIHRLPKMVEELLYSAMEDFYIDIVVGQGPTAHPVHFPLPPFTLIGATTR
FT                   AGLLSAPLRDRFGIVEHMAYYTEADLMDIVQRSAGVFNMSIVPDGALEIARRSRGTPRI
FT                   ANRLLKRTRDYAQVADQNTIDQAIADHALSQLQVDIRGLDGVDRKILQMMIDYYQGGPV
FT                   GLKTIAANIGEENETIEEVYEPYLLQIGFLKRTQRGRMVTPAGYAHLGMPYPEK"
FT   CDS_pept        371551..372582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="LCA_0368"
FT                   /old_locus_tag="LSA0368"
FT                   /product="S-adenosylmethionine:tRNAribosyltransferase-isome
FT                   rase"
FT                   /function="3.7 Protein synthesis"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54669"
FT                   /db_xref="GOA:Q38YQ8"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YQ8"
FT                   /protein_id="CAI54669.1"
FT                   /translation="MVSTEDFDYNLPEELIAQTPMIERAASRLLVMDHETGALEDKVFY
FT                   DIIDELNPGDAVVMNNTRVLPARLYGVKPDTGGHEEVLLLNNTHDDEWEVLMKPAKRAK
FT                   VGTEVVFGDGQLRAIVTKELEHGGRMIEFKYDGIFMQILEALGEMPLPPYIKEKLDDPE
FT                   MYQTVYAKEPGSAAAPTAGFHWTEELLQKVQDKGIKLVYLTLHVGLGTFRPVSEDNVED
FT                   HKMHSEFYRLTEEAAATLNEVKQNGGRIVATGTTSIRTLETIATKFDGEIKADSGWTEI
FT                   FIKPGYQWKAVDAFITNFHLPKSTLVMLVASFTGRENILNAYQHAVDERYRFFSFGDAM
FT                   FVK"
FT   regulatory      372589..372602
FT                   /locus_tag="LCA_0369"
FT                   /old_locus_tag="LSA0369"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        372606..373130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0369"
FT                   /old_locus_tag="LSA0369"
FT                   /product="Putative N-acetyltransferase, GNAT family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54670"
FT                   /db_xref="GOA:Q38YQ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YQ7"
FT                   /protein_id="CAI54670.1"
FT                   /translation="MMYLRKAVFSDLPRISAIIDGAKAALKERGVNQWQAGDPSESQFE
FT                   NDIRQEYCYILIKDDTIVGVASIVDTVDDGYSAITNGDWQSVASSHPYYSIHRMALDGS
FT                   VRGQHLAHQFMTLLITAASIDGAHDVRIDTHPDNLAMQHVIQKAGFTYCGDILIADDPS
FT                   PKRFAYQLVLK"
FT   regulatory      373159..373180
FT                   /locus_tag="LCA_0369"
FT                   /old_locus_tag="LSA0369"
FT                   /regulatory_class="terminator"
FT   regulatory      373319..373332
FT                   /gene="arcA"
FT                   /locus_tag="LCA_0370"
FT                   /old_locus_tag="LSA0370"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        373337..374572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="LCA_0370"
FT                   /old_locus_tag="LSA0370"
FT                   /product="Arginine deiminase (Arginine dihydrolase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54671"
FT                   /db_xref="GOA:Q38YQ6"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YQ6"
FT                   /protein_id="CAI54671.1"
FT                   /translation="MTSPIHVNSEIGKLKTVLLKRPGKEVENITPDIMYRLLFDDIPYL
FT                   PTIQKEHDQFAQTLRDNGVEVLYLENLAAEAIDAGDVKEAFLDKMLNESHIKSPQVQAA
FT                   LKDYLISMATLDMVEKIMAGVRTNEIDIKSKALIDVSADGDYPFYMDPMPNLYFTRDPA
FT                   ASMGDGLTINKMTFEARQRESMFMEVIMQHHPRFANQGAQVWRDRDHIDRMEGGDELIL
FT                   SDKVLAIGISQRTSAQSIEELAKVLFANHSGFEKILAIKIPHNHAMMHLDTVFTMIDYD
FT                   KFTIHPGIQGAGGMVDTYILEPGNNDEIKITHQTDLEKVLRDALEVPELTLIPCGGGDA
FT                   VVAPREQWNDGSNTLAIAPGVVVTYDRNYVSNENLRQYGIKVIEVPSSELSRGRGGPRC
FT                   MSMPLVREDLKK"
FT   regulatory      374580..374593
FT                   /gene="arcB"
FT                   /locus_tag="LCA_0371"
FT                   /old_locus_tag="LSA0371"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        374598..375614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="LCA_0371"
FT                   /old_locus_tag="LSA0371"
FT                   /product="Ornithine transcarbamoylase (Catabolic OTCase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54672"
FT                   /db_xref="GOA:Q38YQ5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YQ5"
FT                   /protein_id="CAI54672.1"
FT                   /translation="MTNSVFQGRSLLAEKDFTKSELEYLIDFSLHLKDLKKKGIPHHYL
FT                   EGKNIALLFEKNSTRTRAAFTTAAIDLGAHPEFLGKNDIQLGKKESVEDTAKVLGSMFD
FT                   GIEFRGFSQKVVEDLAKYSGVPVWNGLTDEWHPTQMIADFMTVKENFGKLKGVTLTYVG
FT                   DGRNNMANSLLVTGSMLGVNIHIVAPDSLQPTQEVRDLAEGYAKETGSKNMITSDVDAG
FT                   VKGSDVLYTDVWVSMGEEDKFEERVNLLKPYQINMDMVKKTGNENMIIMHCLPAFHDIE
FT                   TEYGKKIDEQFGIQEMEITDEAFRSKYARQFEEAENRMHSIKAIMAATLGNLFIPQA"
FT   regulatory      375629..375665
FT                   /gene="arcB"
FT                   /locus_tag="LCA_0371"
FT                   /old_locus_tag="LSA0371"
FT                   /regulatory_class="terminator"
FT   regulatory      375696..375709
FT                   /gene="arcC"
FT                   /locus_tag="LCA_0372"
FT                   /old_locus_tag="LSA0372"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        375713..376657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="LCA_0372"
FT                   /old_locus_tag="LSA0372"
FT                   /product="Carbamate kinase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54673"
FT                   /db_xref="GOA:Q38YQ4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YQ4"
FT                   /protein_id="CAI54673.1"
FT                   /translation="MTKRKIVVALGGNAILSTDASASAQIKAVKETVKQLVAFVKQGDQ
FT                   LIISHGNGPQVGNLLIQQAASDSEKTPAMPLDTVGAMSQGEIGYWMQNAFNEVLAEEGL
FT                   ALDVATIVTQTIVDAKDEAFQNPTKPIGPFYSEAEAKKQQSINPEAHFVEDAGRGWRRV
FT                   VPSPRPIGIQEAPVIQKLVEGNVITISAGGGGVPVAKEGNKLRGVEAVIDKDFASEKLA
FT                   ELVGADMLIILTAVDNVYVNFNKPDQKKLTNVSVAELEDYIKDDQFAKGSMLPKIQAAI
FT                   EYVNNRPDSKAIITSLDNVKNLLAHDAGTIITK"
FT   CDS_pept        376669..377784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcT"
FT                   /locus_tag="LCA_0373"
FT                   /old_locus_tag="LSA0373"
FT                   /product="putative aminotransferase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54674"
FT                   /db_xref="GOA:Q38YQ3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YQ3"
FT                   /protein_id="CAI54674.1"
FT                   /translation="MEIANFGVEEWLNVYETQATLDIAQSTIASMTMSELMALSPDNGT
FT                   QFYQDLAQQKMNYGAIEGSEAFKQAVSELYQTVNSNQVLQTNGATGANLLALYALVKPG
FT                   DHVISMFPTYQQLYEIPISIGATVSYWQLDEANNWVPDIAELKKLIRPETKLICLNNAN
FT                   NPTGTVISTELMQAIVEVARTVGAYVLVDEVYLPLGEGQQTTSIADLYELGIATNSLSK
FT                   TYSVPGIRVGWLVANETLTDLFRKYRDYTMICAGVFSDQLAVYVLQHRKQVLARNRALV
FT                   QRNLKIFKAWVAQEPLVDVVYPESVSTSFIHFKEIEDDEAFCKYLLKEYGVLLVPGKRF
FT                   EIPGHARLGYCAPEATLKKGLAELSKALRTY"
FT   regulatory      377801..377814
FT                   /gene="arcD"
FT                   /locus_tag="LCA_0374"
FT                   /old_locus_tag="LSA0374"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        377818..379245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD"
FT                   /locus_tag="LCA_0374"
FT                   /old_locus_tag="LSA0374"
FT                   /product="Arginine/ornithine antiporter"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54675"
FT                   /db_xref="GOA:Q38YQ2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR022461"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YQ2"
FT                   /protein_id="CAI54675.1"
FT                   /translation="MTEEKPAKKIGLLALIALVISSSIGSGVFGLTSDLASASAPGPVL
FT                   IAWVIVGFGILMLALSLNNLLMKEPELEGIFSYAEKGFGPFAGFISGWGYWLSAWLGNV
FT                   AFATILMSALGYFFPIFKSGQNLPSILVASVLSWSLTYFVNRGVEGAAAINTLVTICKL
FT                   IPLFVFIIFGIVLFKGHLFTQAFWNNMSSSFVAGDVMSQIKNCMMVMMWVFVGIEGASM
FT                   LSARAEKKSDAGKATILGLVSLLAIYILASVLPYGYLTQDQLASIKQPAMLYIFEQMVG
FT                   TWGGYFIGVGLIISILGAWLSWTMLPAETMLLMAKQNLLPAYFGRVNKKKAPTFALVVT
FT                   AGLIQVFLFTLLFTTKAYNFAYSLCTASIIVCYMLVAAYQIKYSWAHLQEKGNRQQLLI
FT                   GVLALLFEIAGILMAGVSYLLLCFIAYIPGIYFYGRARKNNGHQHFLSKGEWLITTIIV
FT                   IGAIIGIWLVVSGKIVI"
FT   regulatory      379301..379314
FT                   /gene="arcR"
FT                   /locus_tag="LCA_0375"
FT                   /old_locus_tag="LSA0375"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        379317..380018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcR"
FT                   /locus_tag="LCA_0375"
FT                   /old_locus_tag="LSA0375"
FT                   /product="Arginine deiminase pathway transcriptional
FT                   regulator, Crp family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54676"
FT                   /db_xref="GOA:Q38YQ1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YQ1"
FT                   /protein_id="CAI54676.1"
FT                   /translation="MIAADEYPRYIQYLRTRPEFIDFSDEEMNILMNNMKVKDFHKGQE
FT                   LFDQTDERSRFYFVVSGLVRAERTDESDEFTFYTYIKQNLAFPYRGMFTDQYYPYTARA
FT                   MTDIEIIYFPMATFEHLLQKNTDSIVKVVQEMGSIISESEDQIQRMVTSSAKQRVIQAL
FT                   KIFEINLGEPLRCGRSYIPYPITVKELATMSGTTRETAGQIVKQLVAQKLLSYEHKEFR
FT                   FEKAFFKDDLA"
FT   regulatory      380058..380094
FT                   /gene="arcR"
FT                   /locus_tag="LCA_0375"
FT                   /old_locus_tag="LSA0375"
FT                   /regulatory_class="terminator"
FT   regulatory      380140..380153
FT                   /locus_tag="LCA_0376"
FT                   /old_locus_tag="LSA0376"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        380156..381715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0376"
FT                   /old_locus_tag="LSA0376"
FT                   /product="Putative transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54677"
FT                   /db_xref="GOA:Q38YQ0"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YQ0"
FT                   /protein_id="CAI54677.1"
FT                   /translation="MDDAEIIKTKKRFKLKMPGAFVILFILTVVAVMATWVVPSGSYAK
FT                   LSYDQKSTQLVVTKPSGQVEKVPATQASLDRLGVKIKISQFTSGSINAAVSIPNTYQRL
FT                   KQRPASLAAVPNSMVRGTVEAVDIMVFILVLGGLIGTVKASGAFESGLLALTKKTKGHE
FT                   FLLIFFVAILMVLGGTLCGIEEEAVAFYPILVPVFIAMGYDSIVCVGAIFLASSIGTTF
FT                   STINPFSVVIASNAAGISFTEGLLWRVGGCIVGAIFVIYYLYRYSKKVKADPTQSYSYE
FT                   DHDAFDKMWAITSEGAQSKAVFTWRKKLILVLFVVTFPIMVWGVMSQGWWFPTMAASFL
FT                   TFAIIIMFLTATGPEGIGEKGVIDAFVNGASSLVGVSLIIGLARGINLIMNEGMISDTL
FT                   LQYSSSLVAHVSGPIFILIMLVIFFVLGFIVPSSSGLAVLSMPILAPLADTVNIPRFVV
FT                   VTAYQFGQYAMLFLAPTGLVMATLQMLDVKYAHWLRFVWPVVAFVLTFGGAMLVLQVLI
FT                   YS"
FT   regulatory      381791..381804
FT                   /gene="tgt"
FT                   /locus_tag="LCA_0377"
FT                   /old_locus_tag="LSA0377"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        381807..382949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="LCA_0377"
FT                   /old_locus_tag="LSA0377"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /function="3.7 Protein synthesis"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54678"
FT                   /db_xref="GOA:Q38YP9"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YP9"
FT                   /protein_id="CAI54678.1"
FT                   /translation="MEPAIKYRLIKKEKHTGARLGEIVTPHGTFKTPMFMPVGTQASVK
FT                   TMAPEDLKEMGAGIILSNTYHLWLRPGEDIVEKAGGLHKFMNWDRGVLTDSGGFQVFSL
FT                   AKLRDISEEGVAFKSHLNGEKLFLSPEKAIHVENALGADIMMSFDECPPFFESYDYVKK
FT                   SVERTSRWAERGLIAHQNPATQGLFGIVQGAGFEDLRRQSARDLVGMDFPGYSIGGLSV
FT                   GESKGEMNRVLDFTTPMLPEDKPRYLMGVGSPDALIDGVIRGVDMFDCVLPTRIARNGT
FT                   TMTSQGRLVVKNAKYSEDFRPLDPKCDCYVCKNYTRAYIRHLIKADETFGIHLTSYHNL
FT                   YFLINLMHQVQDAIEQDNLLEFREAFFEEYGYNENNGRNF"
FT   regulatory      383006..383019
FT                   /locus_tag="LCA_0378"
FT                   /old_locus_tag="LSA0378"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        383023..383379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0378"
FT                   /old_locus_tag="LSA0378"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54679"
FT                   /db_xref="GOA:Q38YP8"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP8"
FT                   /protein_id="CAI54679.1"
FT                   /translation="MLNLVLGANPFGGNSSFLIILVLMMVMMYFMVMRPQKKQQQKHQE
FT                   MVNQMKKGDQVVTIGGLHGVIDSVNNDTKIVVLDCDGVYLKFNLSAIRTVEPTAKATET
FT                   VVEETVDETKEETK"
FT   regulatory      383391..383429
FT                   /locus_tag="LCA_0378"
FT                   /old_locus_tag="LSA0378"
FT                   /regulatory_class="terminator"
FT   regulatory      383605..383618
FT                   /gene="adhE"
FT                   /locus_tag="LCA_0379"
FT                   /old_locus_tag="LSA0379"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        383622..386216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="LCA_0379"
FT                   /old_locus_tag="LSA0379"
FT                   /product="Bifunctional enzyme: alcohol dehydrogenase,
FT                   acetaldehyde dehydrogenase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54680"
FT                   /db_xref="GOA:Q38YP7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP7"
FT                   /protein_id="CAI54680.1"
FT                   /translation="MVKKEGVKAVVDAVSEVDKMVTDLVTRAHEALKIMETFDQAKVDH
FT                   IVHQMAIAGLDHHMELAKMAVEETGRGIYEDKAIKNIFATEEIWHAIKDNKTVGVIEED
FT                   PEHGITKIAEPVGVIAGVTPVTNPTSTTIFKAEIAIKTRNPIIFAFHPNAQKCSARALE
FT                   VIKEEAVKAGLPADALLFIEEPSLAATQALMNHTGIATVLATGGPGMVKAAYSTGKPAL
FT                   GVGAGNAPAYIEESANIKQAVNDLILSKSFDNGMICASEQAVIVDAKIYNEVKKEFQAQ
FT                   GVYFAKASELPALNEAIIDPAKNAVRPAIPGQSAANIAKLAGIDIPEDTPVLIAEIKGV
FT                   GHQYPLSHEKLSPVLAMIKAKDREDGLALCEAMLDLGGLGHTASLHTTDDALPLEFARR
FT                   MKACRVLVNTPSAQGGIGDLYNEMIPSLTLGCGSYGHNSISHNVSTIDLLNIKTLAKRR
FT                   NNMQWVKLPSKIYFEKNSVNYLEKMADLNKVFIVADQGMVNLGYVRIVEEVLAKRANDV
FT                   QMQIFSDVEPDPSTNTIYKGAAAMRSFEPDAIVAIGGGSVMDAAKGMWLFYDSEEADFF
FT                   GAKQKFLDIRKRTYKFPKLNKTKLICIPTTSGTGSEVTPFAVITDSETHIKYPLADYAL
FT                   TPDVAIVDSQFVESVPPRVVAHTGLDVLCHATESYVSTMASNYTKGLSLQAIKLVFDNL
FT                   KASYDGDITAKGNMHDASTMAGMAFANALLGINHSLAHKLGGAFNLPHGLMIAITMPHV
FT                   IRYNATTPTKRALWAKYSYFRADEDYAEIARYIGLKGNTTAELVEAYANAVTELAESVG
FT                   IQMSLKANGVTKADFKQHVDELAELAYEDNCTVTNPKEPLIKELKGILEAEF"
FT   regulatory      386233..386262
FT                   /gene="adhE"
FT                   /locus_tag="LCA_0379"
FT                   /old_locus_tag="LSA0379"
FT                   /regulatory_class="terminator"
FT   regulatory      386382..386395
FT                   /locus_tag="LCA_0380"
FT                   /old_locus_tag="LSA0380"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        386400..387062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0380"
FT                   /old_locus_tag="LSA0380"
FT                   /product="Putative metal(Iron)-dependent transcriptional
FT                   regulator, DtxR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54681"
FT                   /db_xref="GOA:Q38YP6"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP6"
FT                   /protein_id="CAI54681.1"
FT                   /translation="MTPNKEDYLKIIFELGGDAKKVTNKEILAGLNVSAASVTEMVNKL
FT                   VKENYVNHTPYQGIQLTSEGAREAALLVRNHRLWEVFLVDKLHYQFNTVHPEAEQLEHV
FT                   TNHDLAERLADFLGHPKRCPHGGIIPNAKGEFEQQSHHALVDLEVGEKAVIERVLDDND
FT                   LLKYTLEIGLTVGDTVTLTKVGLFESPITVMDETQQTEIQVGIKAAQHIFVTPIAAD"
FT   regulatory      387066..387079
FT                   /gene="zwf"
FT                   /locus_tag="LCA_0381"
FT                   /old_locus_tag="LSA0381"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        387082..388578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="LCA_0381"
FT                   /old_locus_tag="LSA0381"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54682"
FT                   /db_xref="GOA:Q38YP5"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP5"
FT                   /protein_id="CAI54682.1"
FT                   /translation="MRSDLAALFIIFGGSGDLAQRKLYPALFNLYRKGYLKESFAVIGT
FT                   ARRPWTDEHYHEIVMASLEGFEEDDETKQTFTSHLYYQSHDVTDAEHYETLKALAAKLD
FT                   DKYQLNQNRIYYMAMSPRYFGTIASHLGSEALLTADGFNRLIIEKPFGRDYESAKALNQ
FT                   ELTQTFDENQIYRIDHYLGKEMIQNIVALRFGNGLLSGVWNNQFIDNVQITLAESVGVE
FT                   ERAGYYETSGALRDMLQNHIMQVIGMLAMEVPVNFSAEDVQREKTRLFRSIQPYSPAEI
FT                   KQNFVRAQYAETTVDGENKPGYRQETNVAPDSQTETFVAGKVMIDNERWCGVPFYVRTG
FT                   KRLARKETQINIVFKKTGVNIFADDKSDRSAMAPDVLTIYVEPEQGFSLTINGKEVGQG
FT                   FSLKPDQLNYQYDKQMLADSPEAYERLILEALNGDGTNFTHWHELAASWQFVDAIRQVW
FT                   DADQTPLPTYSIGSMGPKEATDLLASTDAKWIFDPTQTKK"
FT   regulatory      388637..388650
FT                   /gene="dinP"
FT                   /locus_tag="LCA_0382"
FT                   /old_locus_tag="LSA0382"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        388652..389782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="LCA_0382"
FT                   /old_locus_tag="LSA0382"
FT                   /product="DNA-damage-inducible protein P"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54683"
FT                   /db_xref="GOA:Q38YP4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP4"
FT                   /protein_id="CAI54683.1"
FT                   /translation="MAELFKIPLENDTSRKIIHIDMDAFYASIEEREQPDLRQKPLIIA
FT                   RDPSDTGGKGVVTTANYVARQYGVHSAMSAQKAAELIPKHQAVFKTPNFPLYQSVSAQI
FT                   HDIFHTVTDKIEPIAFDEAYLDVTENKLGLTHTIEVVAYLQKAILEETQLVSSAGISYN
FT                   KFLAKMASDYRKPAGRTLVLPEQAIAFLSRLPIEKFRGVGQKTVPKMQDLGIMTGADLL
FT                   AQSEMFLMQHFGKLGYGLYRHVRGIDNRPVEYQRERKSIGNEHTYGQPLISEEQVQVQL
FT                   KSLAVELAQRLRKNQKHGLTVVLKVRNRQYETITKRKTLGEYVGNAAELEAIANQIWQS
FT                   IGQAEVGIRLLGITVTNLAPQTFENITLPLYDWEND"
FT   regulatory      389886..389899
FT                   /locus_tag="LCA_0383"
FT                   /old_locus_tag="LSA0383"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        389902..391224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0383"
FT                   /old_locus_tag="LSA0383"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54684"
FT                   /db_xref="GOA:Q38YP3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP3"
FT                   /protein_id="CAI54684.1"
FT                   /translation="MATKHDQILMYIENLPIGDKISVRSIAKTLAVSEGTAYRAIKAAE
FT                   NNGLVSTIERVGTIRIEQKLKGKIENLTFAEIVQVIDGEVLGGKDGLNKLLDKFVIGAM
FT                   QLAAITRYITPKSLLIVGDRIDVQRLALENGAAVLITGGFHTSDEVIALANELALPILQ
FT                   TTYDTYTVATLINRALTDQLIKKEITTVASIYRPFSETYSLLATDTVGDYKKLSAAVKH
FT                   SRFPVINEHRRLVGIVTVKDILDKPASMTLDKVMTKEPASVKKYMSIASVGHAMTWNSL
FT                   EIMPVVADNLELEGIITRQDVMSNMQTAQRQPQVAETFYDQIIELLHPSESFPEFYSAA
FT                   YQFEVSPQMTNNLGTISFGVLSEAVSAACQRMLQATHQRHSMIEQINLHYLRLIQIESQ
FT                   IQILPRILEIGRRSAKIDVDVYANHVIVAKAIVTCQILERG"
FT   CDS_pept        391228..392181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0384"
FT                   /old_locus_tag="LSA0384"
FT                   /product="Putative phosphoesterase, DHH family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54685"
FT                   /db_xref="GOA:Q38YP2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP2"
FT                   /protein_id="CAI54685.1"
FT                   /translation="MTIPEQIIAKIKAYQTIIIHRHVNPDPDAIGSQVGLAEVIRNSYP
FT                   DKKVYQVGSDTGNLAWLANAQPIDPALYQGALVITTDAANTPRISGEDYNQGAYLIKID
FT                   HHPNDEPYGDLNWVLPDASSTSEIIVDMINDSQGQLQLNQAAARVLYAGIVGDTGRFMF
FT                   NSTTPHTMTCAAQLMTFDIQHDKINQRMNEITLEQAKLQGYLFDQLQVNDDQVAYLVVD
FT                   QETQKRLNVSAQQVHSIVGTPGRLKGVLTWVIFVQQDDGTYRVHFRSKGPIINELAKQH
FT                   DGGGHPLASGAKAADQAEIDTIITALSALAADYTAQ"
FT   regulatory      392208..392221
FT                   /locus_tag="LCA_0385"
FT                   /old_locus_tag="LSA0385"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        392226..393581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0385"
FT                   /old_locus_tag="LSA0385"
FT                   /product="Putative ATP-dependent DNA/RNA helicase"
FT                   /function="3 Information pathways"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54686"
FT                   /db_xref="GOA:Q38YP1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030881"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP1"
FT                   /protein_id="CAI54686.1"
FT                   /translation="MDNQFTQFNLKPEIITALDEMHFTKPTAVQRRVIPAINAGKSVIG
FT                   QSQTGSGKTHAFLLPLLNKLVPEKDEVQIVITAPSRELAYQIYTAAELITKHMNGDIRI
FT                   GRYVGGTDKQRQIEKLQQHQPQIVIGTPGRILDLITSKALKIYTAKTLVIDEADMTLDM
FT                   GFLKPVDNIASRLPEDLQMMVFSATIPDKLQPFLQKYMHNPVIEEVKNETIISPTIENW
FT                   LVPTKGKALNQTIYSLITMGHPFMVLIFANTKSKVDDIHHYLQSQGLKVAKIHGDIPPR
FT                   QRKRIMKEVHNLDYQYVVATDLAARGIDIEGISMVINAEVPREDLEFFVHRVGRTGRNG
FT                   LKGTAITLYGPDDEQAVAQIEAMGIKFTPKAFKDGELVTSYDRNRRKKRVATTHELDVN
FT                   LKGFVKKAKIKRKPGYKKKIKEAIQKDARQKRRIEQRVEMRERKRNNKKQNQ"
FT   regulatory      393603..393616
FT                   /locus_tag="LCA_0386"
FT                   /old_locus_tag="LSA0386"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        393619..394605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0386"
FT                   /old_locus_tag="LSA0386"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54687"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YP0"
FT                   /protein_id="CAI54687.1"
FT                   /translation="MVHENDLQLPNWLQLSEQARRANFGQVLRYFVSPLVAIEGIQPEV
FT                   VQAGRLTFKTYSAWFSGEQFVFIPAQSAVSLGWSLGADKLAPSEWFAQTNRQLAANEGQ
FT                   LWADKADVDAYVEQLTTPSRIVNMPALLVARESVPRDWLAQGRYSPITRHFTGNQLFFS
FT                   RFQAEIQNGLYRTQPETPLLETAHLVLRLLADQQVYQVFEKMTFTDQQLRQTLRQQGYD
FT                   FVSVDQYEWLRGAGAPTLWPSGNHLPQPMAESAASFGLDFTADQQAYEITTDPLVYKGG
FT                   PCVTGGRYQLERQLPSSPFYESGVSTALMGNTDLATRYRRTITVALE"
FT   regulatory      394834..394847
FT                   /gene="alaS"
FT                   /locus_tag="LCA_0387"
FT                   /old_locus_tag="LSA0387"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        394850..397486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="LCA_0387"
FT                   /old_locus_tag="LSA0387"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54688"
FT                   /db_xref="GOA:Q38YN9"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YN9"
FT                   /protein_id="CAI54688.1"
FT                   /translation="MKQLTSAQVRQMFLDFFKEKGHDVEPSASLIPDEDPTLLWINSGV
FT                   ATLKKYFDGRVVPNNPRITNAQKSIRTNDIENVGKTARHHTFFEMLGNFSVGDYFKEDA
FT                   IPWAWEFLTSDKWIGLDPEKLYVTVYPKDKDAHRIWHEKVGLAEDRIIEVEDNFWDIGE
FT                   GPCGPDSEIFYDRGQSFNNVSEDDPENYPGGENERYLEVWNIVFSEFNHLPNGEYVEQP
FT                   HKNIDTGMGLERLVSVIQEAPTNFETDLFMPLIEATAAMSDHKQYGQNAADDISFKIIA
FT                   DHARAVTFAIGDGAMPANEGRGYVLRRLIRRAILNGKKLGINDAFMYKLVPIVGEIMHS
FT                   YYPDVLEQKDFIEKVIRSEEDRFRETLNDGLRLLNQTIEAVKAENETEINGADAFKLFD
FT                   TFGFPIELTTEYAEDEGLTVDQAGFEKEMAAQKARARNARSDEQSMGSQNEVLLNIKTK
FT                   SEFTGYSELETESRLADIIQDNAEQESVTTGVAQLVFEATPFYAEMGGQVADQGIIKNL
FT                   AGQVVAEVTDVQYAPNGQPLHTVKVLKEMISGVHYTLSVDPTFRGGVVKNHTATHLLDQ
FT                   ALRDVLGEHTHQAGSLVEPDYLRFDFTNLGQVTPDQLAEVEQIVNDKIWAALPVNTVET
FT                   DIETAKQMGAIALFTEKYGKTVRVVQIGDYSMELCGGTHANNTSDLGLFKITSESGIGA
FT                   GTRRIEAVTSKAAFKYLNDKQVLLNELASELKVAQTKDLPKKIQQLQADLKAEQKENEQ
FT                   LKAKFAQEQAGNVFENVVEAGQWRLVAADAKVAGMNELRQLADQWQQKQISDVLVLATV
FT                   AGDKVSLIVAVAPDAIKAGIKAGDLIKQIAPLVGGGGGGRPDMAQAGGKNPAGIPDALA
FT                   AAKEFLA"
FT   regulatory      397502..397521
FT                   /gene="alaS"
FT                   /locus_tag="LCA_0387"
FT                   /old_locus_tag="LSA0387"
FT                   /regulatory_class="terminator"
FT   regulatory      397654..397667
FT                   /locus_tag="LCA_0388"
FT                   /old_locus_tag="LSA0388"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        397672..397932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0388"
FT                   /old_locus_tag="LSA0388"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54689"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YN8"
FT                   /protein_id="CAI54689.1"
FT                   /translation="MNLDKTVHFDFGKNSPKNVHETLVTVYQTLEDKGYNPINQIVGYL
FT                   LSGDPAYIPRYNDARNLIRKHERDEIIEELVKNYLDKGNTK"
FT   CDS_pept        397932..398375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0389"
FT                   /old_locus_tag="LSA0389"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54690"
FT                   /db_xref="GOA:Q38YN7"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YN7"
FT                   /protein_id="CAI54690.1"
FT                   /translation="MRLMGFDVGSRTVGIAVSDLFGWTAQGVEIIRINEDESEFGLDRV
FT                   KELVAQHQVTGFVLGLPKNMNNSIGPRAVKAQEYGAMLTELFPEIPVDYIDERLTTVQA
FT                   ERMLVEQADTSRKKRKQVIDKLAAVMILQNYLDAKGPLTKQGY"
FT   regulatory      398408..398421
FT                   /locus_tag="LCA_0390"
FT                   /old_locus_tag="LSA0390"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        398425..398736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0390"
FT                   /old_locus_tag="LSA0390"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54691"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YN6"
FT                   /protein_id="CAI54691.1"
FT                   /translation="MTETNKNIHQEAEQEITLIDDQGNEELYQVLFTFDSEDYGKSYVL
FT                   LYPASSAEDEEVDIQAFAFTSDVAGDASQGDLFPIEDDEEWEMVEEVLNTFLADDNMQ"
FT   regulatory      complement(398984..399017)
FT                   /gene="rnhC"
FT                   /locus_tag="LCA_0391"
FT                   /old_locus_tag="LSA0391"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(399024..399941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="LCA_0391"
FT                   /old_locus_tag="LSA0391"
FT                   /product="Ribonuclease HIII (RNase HIII)"
FT                   /function="3.6 RNA restriction and modification"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54692"
FT                   /db_xref="GOA:Q38YN5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YN5"
FT                   /protein_id="CAI54692.1"
FT                   /translation="MQAVIKMTPAQLKTIQQTYPSNRPLPPGAVFAHRGNGLNVTGYRS
FT                   GKVLFQGATAEAAAAKWGPLAPAKKSKATKGSAKGDTLPPDFANWSVIGSDEVGNGSYF
FT                   GPLTIAAVYVSQENLSFVRNLGVADSKTLTDAQIDQMAIKMMTKLPYHIVNIMPQKYNQ
FT                   VHEQMNIEKMKAVSHNFALLKVLKKIQPDQPQGILIDQFEPRATYYRYLKDEPVVLRDN
FT                   VYFTTKAEQFHLAVAAASIIARHQANLSMIELSKLAGRDIPVGAHKSIDKIAADLLDQG
FT                   GLEYLGQFAKLHFINTKKAQALRS"
FT   regulatory      complement(399944..399957)
FT                   /gene="rnhC"
FT                   /locus_tag="LCA_0391"
FT                   /old_locus_tag="LSA0391"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      400119..400132
FT                   /locus_tag="LCA_0392"
FT                   /old_locus_tag="LSA0392"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        400135..400674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0392"
FT                   /old_locus_tag="LSA0392"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54693"
FT                   /db_xref="GOA:Q38YN4"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YN4"
FT                   /protein_id="CAI54693.1"
FT                   /translation="MLSLIIILMLLHAVYTGMRRGIVLQVVYAIGYFIAFWIAVPLSQT
FT                   LGPKLNLLVPYPSATEESYFAFFQQKVGLSLDKAFYIGVAFVLVMFISGLIIRFIGLLL
FT                   NSLTFIYVFSRFNKVLGGVLNFIVVYIGIFLVLYVLALVPVDGLQNMLAHSWLAKMMVL
FT                   KTPLLTSLVTQWWIVG"
FT   regulatory      400686..400706
FT                   /locus_tag="LCA_0392"
FT                   /old_locus_tag="LSA0392"
FT                   /regulatory_class="terminator"
FT   regulatory      400713..400726
FT                   /locus_tag="LCA_0393"
FT                   /old_locus_tag="LSA0393"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        400730..403093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0393"
FT                   /old_locus_tag="LSA0393"
FT                   /product="DNA mismatch repair protein, MutS family"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54694"
FT                   /db_xref="GOA:Q38YN3"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YN3"
FT                   /protein_id="CAI54694.1"
FT                   /translation="MNHKILKTLEYDKIKQMLQGYAITAFGQEQIATLEPINEADLIQI
FT                   RLNQTKDGVDIERLKGGIPLPQLENIRPHLKRIEIGAMLNGSELAQIGRVLRATSAVVR
FT                   FFDDLEKDELELKALPELVAQFVTLPQLTERIRSSVADDGAILDTASTKLRGLRTGLKQ
FT                   LEGQIRSRMASYTHGAKAKYLSDPIVTIRNDRYVIPVKQEYRGQFGGVVHDQSASGQTL
FT                   FMEPQAIMELNNRLRQLQIEEQQEIERILAELSEAIMPERHNILANAELLGQLDFVNAK
FT                   AQLAKALKATEPLINAENHVDLKQARHPLIDATKVVANDIAIGADYQAIVVTGPNTGGK
FT                   TITLKTLGLVQVMAQSGLFITAREESQVGVFSDIFADIGDEQSIEQNLSTFSAHMENII
FT                   QILKQIDDRSLVLLDELGAGTDPQEGAALAIAILDQIGIVGANVVASTHYPELKIYGYN
FT                   RPQTINASMEFDVATLQPTYRLLIGVPGRSNAFDISTRLGLPNSIVDQAKQLMNDESQD
FT                   LNNMITDLENQRKAAETEYQALRHELTEATDLHQQLSTAYQQFFEDRETEMTKAKEKAN
FT                   AIVEKAEVKADKVITKLRDMQMNQGAQIKENQLIDAKAELGQLHQETTLKKNKVLQRAK
FT                   RRQTLKVGDDVLVTSYGQRGTLIRQVDSKNWEVQMGIIKMKIANDDLEKQKVVEDNRPQ
FT                   RHVTTVNSGGARHVKAQLDLRGKRYEEAMAEVDQYIDAALLANYQQVTIVHGKGTGAIR
FT                   QGVQEYLQANRQVKKYEYAPANAGGNGATIVTFK"
FT   regulatory      403111..403147
FT                   /locus_tag="LCA_0393"
FT                   /old_locus_tag="LSA0393"
FT                   /regulatory_class="terminator"
FT   regulatory      403217..403230
FT                   /gene="trxA3"
FT                   /locus_tag="LCA_0394"
FT                   /old_locus_tag="LSA0394"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        403233..403544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA3"
FT                   /locus_tag="LCA_0394"
FT                   /old_locus_tag="LSA0394"
FT                   /product="Thioredoxin"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54695"
FT                   /db_xref="GOA:Q38YN2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YN2"
FT                   /protein_id="CAI54695.1"
FT                   /translation="MVDVLTDKDFEAETSQGVVLTDFWATWCGPCRMQSPVIEELAQTN
FT                   DKVKFTKMDVDANPDTPAKFGIMAIPTLLVKKDGQVVETITGFHNKEQLTETLAKYTD"
FT   regulatory      403596..403626
FT                   /gene="trxA3"
FT                   /locus_tag="LCA_0394"
FT                   /old_locus_tag="LSA0394"
FT                   /regulatory_class="terminator"
FT   regulatory      403900..403913
FT                   /gene="dltA"
FT                   /locus_tag="LCA_0395"
FT                   /old_locus_tag="LSA0395"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        403912..405444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="LCA_0395"
FT                   /old_locus_tag="LSA0395"
FT                   /product="D-alanine-poly(phosphoribitol) ligase, subunit
FT                   1(D-alanine-D-alanyl carrier protein)"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54696"
FT                   /db_xref="GOA:Q38YN1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YN1"
FT                   /protein_id="CAI54696.1"
FT                   /translation="MVMTNSIIQKIDTIAIEQPQTVAYQYGQTQYSYADLKVASDRIAA
FT                   FIQDQALPKGAPVIVFGGQQFEMVATFLGAVKAGHAYIPVEQHSDAERIQQIESVAKPA
FT                   AVLSWASASQIEVDMPVFQADILADVVASGATDYDAQQSVQGDDNFYIIFTSGTTGLPK
FT                   GVQISENNLLSFVDWANPAFGVADNSRVLIQAPYSFDLSVMNLYPGLCSGATLVILEKE
FT                   ITDNFKTLFEVLPTLKVNEWVSTPSFVEICLLAPTFDSEHYPELREFVFCGEELTHQTA
FT                   EKLLERFPSAKVFNTYGPTEATVAMTSIEITADILAQYDRLPIGYTKADTKTVVVDEQN
FT                   NEVAPGQPGELLISGPSVSKGYLNNPEKTNAAFFEKDGQRFYHSGDLVVADDNQLIFYK
FT                   GRTDFQVKMHGYRIELEEIDHHLGQLAQVKQACTVPRYNKAHQVTQLIAYVVPAEGQVG
FT                   DATLTKTLKAALAENTMAYMIPQRFVYPESLPLSVNGKVDRKALIKEVNGNA"
FT   CDS_pept        405437..406645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="LCA_0396"
FT                   /old_locus_tag="LSA0396"
FT                   /product="D-alanyl transfer protein (membrane protein)"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54697"
FT                   /db_xref="GOA:Q38YN0"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YN0"
FT                   /protein_id="CAI54697.1"
FT                   /translation="MPNLQPYANPNYFIILGIALVPLIIGFLNGKRWHIYETLVSLLFL
FT                   VLIFDGDKINQGLALIGYVIFEGALIWGYTVYRQKRNNTALFDLAVVLAIMPLVIVKFV
FT                   PFLNPGRNSIIGFLGISYLTFKAVGMIMETRDGSIKKFEPWLFLQFMLFFPTISSGPID
FT                   RYRRFKKDYLKVPERDHYIDMLGKAMHNFMLGFVYKFILGYAFGTLLLPRMAHLAMASR
FT                   GGFLDISWGLVGYMYVYSMYLFFDFAGYSLFAVGTSYVMGIETPINFNKPFSSPNIKEF
FT                   WNRWHMTLSFWFRDYIYMRLMFFLMKHKITKSKVLIANLGYLTLFLLMGFWHGLTWYYI
FT                   AYGLFHAIWIILTDVWLRFKKKHKDHIISNRWTNYLAIFATFNTVCLSFLIFSGFLDRL
FT                   WFH"
FT   regulatory      406657..406670
FT                   /gene="dltC"
FT                   /locus_tag="LCA_0397"
FT                   /old_locus_tag="LSA0397"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        406675..406911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="LCA_0397"
FT                   /old_locus_tag="LSA0397"
FT                   /product="D-alanine-poly(phosphoribitol) ligase, subunit 2
FT                   (D-alanine-D-alanyl carrier protein)"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54698"
FT                   /db_xref="GOA:Q38YM9"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YM9"
FT                   /protein_id="CAI54698.1"
FT                   /translation="MDVENTVVEILADLTGNDDIKDDMDMDLFETGTLDSMATVQLLLE
FT                   LQGQLDIDVPVSEFDRNEWATPNKIIAKAKELQ"
FT   CDS_pept        406913..408184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /locus_tag="LCA_0398"
FT                   /old_locus_tag="LSA0398"
FT                   /product="Lipoteichoic acid D-alanyl esterase precursor"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54699"
FT                   /db_xref="GOA:Q38YM8"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YM8"
FT                   /protein_id="CAI54699.1"
FT                   /translation="MFKKLWLIFGPVLIAGACLGALLLSPFRFSHPSAKTLSTAATSMS
FT                   SNVIKGEAIKDAAFNADYIPVIGSSELSRMDPLHPSVMAEKYDWKNKPFLIGAPGTQSL
FT                   THFLSLQATGQHLTGKKAVVIISPQWFVPRGVKSEMFDFFYSPLQTSYFLVHAKDSAAT
FT                   RYAAKRILDLTSDTTSGVMRDALKNKALGLPLTTVQKVYINNIKRPGLQHQDQLFSQLF
FT                   IHGREKELAKGLKVLPDEQDLQTLDQVATTLGRKATAGNPFGIQKKFYEQRILPNQAKL
FT                   KGEQSNFNYESSPEFSDFQLMLDFFAQHKMAVQFIIPPVNARWASYTGLSQDMLNNFST
FT                   KISYQLKSQGFNNIVDMTKDGNEDYFMQDTIHLGWRGWLKVDQHVQPFMATKKAGKVSY
FT                   KISDDYLDRSWQDVAGNQVQDFEE"
FT   regulatory      408194..408217
FT                   /gene="dltD"
FT                   /locus_tag="LCA_0398"
FT                   /old_locus_tag="LSA0398"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(408194..408217)
FT                   /locus_tag="LCA_0399"
FT                   /old_locus_tag="LSA0399"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(408363..409286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0399"
FT                   /old_locus_tag="LSA0399"
FT                   /product="Iron(III)-compound ABC transporter,
FT                   substrate-binding lipoprotein precursor"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54700"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YM7"
FT                   /protein_id="CAI54700.1"
FT                   /translation="MKKSSRFIAILGLTSLIILAGCQAKTATKKQTRTIADSMDHKVSV
FT                   PTHPKRVIGSYLEDYLISLDIKPVVQWSVKNGTSRQDYLAKYLKNVPTINYDLPFEAVA
FT                   KAKPDLILVGDNSAVQGGKYAQYNKLAPTYVVKNGAKVKWRTQLKDVAKAVNKEDKGQA
FT                   VLKDYDQKLASAKKTIQTKAPNKSAAVLWVTNNSAFMVNDHAASGALLYQDLGLKEPEL
FT                   VKTISKNATADWMPVSLEKLTELDADYIFLVNSDRGAAMFKEPIWQNVKAVKNKQLYSY
FT                   DKSSSWMYKGPIAYEEMIQSVLKVVK"
FT   regulatory      complement(409288..409301)
FT                   /locus_tag="LCA_0399"
FT                   /old_locus_tag="LSA0399"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      409442..409455
FT                   /locus_tag="LCA_0400"
FT                   /old_locus_tag="LSA0400"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        409459..410262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0400"
FT                   /old_locus_tag="LSA0400"
FT                   /product="Iron(III)-compound ABC transporter, ATP-binding
FT                   subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54701"
FT                   /db_xref="GOA:Q38YM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YM6"
FT                   /protein_id="CAI54701.1"
FT                   /translation="MAILETQQVSVGYNRRLIIQDLSIQIPQGQITTLIGPNGSGKSTL
FT                   IRTLAHLLKPSSGTVLLADQALATKTPKEMAQEMALLPQVGELTTDLSVFDLVSFGRLP
FT                   YRQQFRPLSAVDKEKIEWAIERTGLNQFRDRFLSTLSGGQRQRAWIAMALAQDTDILIL
FT                   DEPTTYLDLTHQLEIMLLIQELNQIEDRTIIMALHDLNHAARFSDQLIALKNGQLQASG
FT                   TVNEVMTRDNLRHIFNIDATLIEHDQRPLILTYDRWSEGEQDHDE"
FT   CDS_pept        410252..411244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0401"
FT                   /old_locus_tag="LSA0401"
FT                   /product="Iron(III)-compound ABC transporter,
FT                   membrane-spanning subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54702"
FT                   /db_xref="GOA:Q38YM5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YM5"
FT                   /protein_id="CAI54702.1"
FT                   /translation="MMNKKFGFSLVISLILLAILMVVSIRYGAAQTTMKTVYHAVFDYH
FT                   ASQLQQAVIHEIRLPRVLGAALIGASLAGSGLIMQELTQNPLADSGLLGINAGAGFMLT
FT                   ISFIVLPKATPQQTAIFALIGAALSACLILAISMAKKTQKTTTVVLAGMAISSCLVALS
FT                   EGLSLMTQLKRDLAFWHFGGVAAITWTQLTQLGPWLIAGLIASLCLAPQLRLLQLGDEL
FT                   VLSLGRKTSVVRLLGFICVIILAGISVALVGSVAFVGLMVPHITRYLVGYDVRKVMPVT
FT                   LLLGASLVVAADLISRTINPPQEIPFGIMIALIGVPFFIYLARKGASQA"
FT   CDS_pept        411241..412242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0402"
FT                   /old_locus_tag="LSA0402"
FT                   /product="Iron(III)-compound ABC transporter,
FT                   membrane-spanning subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54703"
FT                   /db_xref="GOA:Q38YM4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YM4"
FT                   /protein_id="CAI54703.1"
FT                   /translation="MNMMTKRYRRWLVGLSALLIATTLVSLQTGQLAIGPQAIGQLLIG
FT                   QGQAQDALILVDFRMPRIIIAILVGFALAIAGEVLQSTTQNPLVDTGFLGINSGAGIAV
FT                   LLFITFAADQGSQIFILPVLALIGALVSAVVIVIGAYQKSVGITANRLLLTGVAVSTCF
FT                   SALMVLLTLKLSPDNYQFVMTWLAGSIWGSSWPFIWALLPWLLLTLPYIFSKSQTLDAF
FT                   VLKPDNMRSLGVDFQKQRLYLIGAAVILAGASVSISGGIGFIGLITPHIARRIIGYQHR
FT                   YQLLLTGLLGSCFLLVADTCGKLLSPTAEIPAGIIVALIGAPYFIYLLIKTK"
FT   CDS_pept        412250..413236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0403"
FT                   /old_locus_tag="LSA0403"
FT                   /product="Putative thioredoxin reductase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54704"
FT                   /db_xref="GOA:Q38YM3"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YM3"
FT                   /protein_id="CAI54704.1"
FT                   /translation="MTAMTNIYETTIIGGGPAGLYAAFQAGLYGLNGQLLEGDQQFGGK
FT                   VATYAERVIHDIGGMPNITGQDLIQNLTAQAAFYDTPLRTQTLVTDVKYLADQDYYQID
FT                   TPDDRYYSQTLILAMGGGVVRPKQLRLFEEQTFENVHYAPANPEDYRDQRVVLIGPGYN
FT                   LMELAPHLLATAKSVVWLTTKRPFVDEAAEKAFLTAYPQIDYYCQPLASYQQVDQQVTS
FT                   ITLADQTQITFDQAVVSLGYRRSLQTLDQWQLSAEQIEERPDIWVIGNQIPDRAGISLL
FT                   TSAFQDGITAVTEIVAQLKPTAKTPMVTTHNPVFQADTKAYWQERLR"
FT   regulatory      complement(413254..413282)
FT                   /locus_tag="LCA_0404"
FT                   /old_locus_tag="LSA0404"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(413295..413939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0404"
FT                   /old_locus_tag="LSA0404"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54705"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YM2"
FT                   /protein_id="CAI54705.1"
FT                   /translation="MTQSLYTQLTDTPQTATYLAQATLRDILLPLILGDETEGISYWAG
FT                   KQLATKFPLESIADLSQFFEQINFGQLSLKKQKKNQYFFELTGPIITKRLADFKTPDFQ
FT                   LEAGFIAQTLEQQLQVTAEAKATVENKKRVTIFVQTDTNDPIEIPLETEAMVTMQSPEV
FT                   TPISPTEPAEPVTPVTTEPTPEPEHEPVAKASFSSVANLPSRQELHRRKKH"
FT   regulatory      complement(413941..413954)
FT                   /locus_tag="LCA_0404"
FT                   /old_locus_tag="LSA0404"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      414086..414099
FT                   /gene="murI"
FT                   /locus_tag="LCA_0405"
FT                   /old_locus_tag="LSA0405"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        414104..414928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="LCA_0405"
FT                   /old_locus_tag="LSA0405"
FT                   /product="Glutamate racemase"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54706"
FT                   /db_xref="GOA:Q38YM1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YM1"
FT                   /protein_id="CAI54706.1"
FT                   /translation="MKKQPIGFMDSGVGGLTLVKEARKRLPNEDMVFIGDQARLPYGEK
FT                   PAATVREFAWQMANFLRHQEIKALVIACNTATAAALPDLQAQLAIPVIGVIKPGSIAAL
FT                   QTTHNRRVGVIATTGTIQSAAYSQQMAALNPDVQVTGLAAPQFVTMIEANQRHGQAVQT
FT                   IVNQILQPLQKSEIDTLVLGCTHFPLLTTAIQTAVGPDVTLVNPAVQAITMLEEVLTQQ
FT                   QQLATTTPGTLRMYTTGSVAAFEEIAQQWLAQPDLTAQQVDIQKEKNDGPDR"
FT   CDS_pept        414909..416141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0406"
FT                   /old_locus_tag="LSA0406"
FT                   /product="Putative nucleoside triphosphatase, Ham1 family"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.6.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54707"
FT                   /db_xref="GOA:Q38YM0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YM0"
FT                   /protein_id="CAI54707.1"
FT                   /translation="MMVRTDNRAANDVRPVKVQWHYLTKQPASVLWQRGTTKVLAAVTE
FT                   QATKKVTLIGSGLTQVQSDWLQQTLTTLLAPALEKTGLLVSVTVLEDGGSLLAEASNAV
FT                   FGALQLLPEQFLPNRAAAVTAILTGNETLVDASDTEEAVADSTLLVVTDNQEQILAMTL
FT                   QGATAVNSSQLNELLLVASQGGTRTAEQIQASYQQAVHPIIQKEHSEMPTIVIATKNPG
FT                   KAQEFHAMFEKEGIQIKTLLDYPELPEINETGQTFEENARLKADQIAAILQLPVLADDS
FT                   GLMVDALDGRPGIYSARFAGDHNDAGNNAKLLYELTGVPAEKRTAHFHTTLVFAKPDRP
FT                   NDDLVVEGSVNGRILGIPRGDNGFGYDPLFYVPELDKSMAELSMAEKNAISHRAKAIEN
FT                   LEPLWRDWLAK"
FT   CDS_pept        416153..416674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0407"
FT                   /old_locus_tag="LSA0407"
FT                   /product="Putative phosphoesterase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54708"
FT                   /db_xref="GOA:Q38YL9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL9"
FT                   /protein_id="CAI54708.1"
FT                   /translation="MRLVVVSDSHGDRDILVQLVAHYKDEVVTFLHCGDSELTTTDSLF
FT                   QQMTVVQGNMDFNGHFPEQVVVPVGAQKAFLTHGHLYGVNFDLTRLMLAAQAEGAQLAF
FT                   YGHTHQLACEMHQGLLVLNPGSISQPRGQFQPLGGTYAVVDITATDYQVQYYDRHFEKV
FT                   PQLQFKFKRA"
FT   regulatory      416682..416713
FT                   /locus_tag="LCA_0407"
FT                   /old_locus_tag="LSA0407"
FT                   /regulatory_class="terminator"
FT   regulatory      416756..416769
FT                   /locus_tag="LCA_0408"
FT                   /old_locus_tag="LSA0408"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        416772..417257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0408"
FT                   /old_locus_tag="LSA0408"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54709"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL8"
FT                   /protein_id="CAI54709.1"
FT                   /translation="MISDAFQNLLLENKEHFLIPGEMVASVQENNSLEHAFILLTTVKY
FT                   SSIPVLDNHSKFKGMLTMPLITETMLGLDHLSFDNLRKMTVQDVMQKDVVTIKDPYDIE
FT                   ETLHLLVDHPYLPVLSDDGEFTGIVTRREMMKSFNRVAHNIEKEYKIEALPIEKQQN"
FT   regulatory      417280..417311
FT                   /locus_tag="LCA_0408"
FT                   /old_locus_tag="LSA0408"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(417280..417311)
FT                   /locus_tag="LCA_0409"
FT                   /old_locus_tag="LSA0409"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(417565..418461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0409"
FT                   /old_locus_tag="LSA0409"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54710"
FT                   /db_xref="GOA:Q38YL7"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL7"
FT                   /protein_id="CAI54710.1"
FT                   /translation="MPLINALKGALIGVALVIPGLSGSIFAVIVGLYEPLLKAIAQFKQ
FT                   DWRQAIGFLWPIGIGAGIGVLLSTKIILWLCTAYPLAAYSFFIGLVLGSLPFIWRKLKK
FT                   LNWQQVLIAIACGGLMLLITKIGGHQNESDIAIKQLTSLQDFGMLTFTGFFSVSLMVIP
FT                   GVSGSIMLMIIKQYGTVYHAVSQLLDLLVYLVTGRFEQAGEAFKSVALLLPFMLGAVIG
FT                   TVIVAKIMHYLLAHYAQYVYAGVLGVILAAIWILAETGVVPAWPAVGGLTTLLGPIALI
FT                   AVMLVLGAIATIYFDRA"
FT   regulatory      complement(418463..418476)
FT                   /locus_tag="LCA_0409"
FT                   /old_locus_tag="LSA0409"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(418486..419373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0410"
FT                   /old_locus_tag="LSA0410"
FT                   /product="Putative mechanosensitive ion chanel"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54711"
FT                   /db_xref="GOA:Q38YL6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL6"
FT                   /protein_id="CAI54711.1"
FT                   /translation="MFFQSLTTTPVESVQKQTNIFMRYITSIDWDHLLGLFITGFFQII
FT                   LISLLFYLLSRIGRFIIKRAFRKYREADGFSNNRMNTIYTLMTNALAYLLIFFYLYALL
FT                   SIIGVPVGTLIAGAGIFSLAVGLGAQGFVNDIVTGFFILAEQQFDVGNTVRIGTIEGTV
FT                   TAIGLRTTQVQSYDGTLNFIPNRNISIVSNLSRNNMRVLINIRINPDTDIEQLATIVKQ
FT                   VNTELVPRHPEIKDGPTLLGVSTLTDGTLAYQVVMHTLNGEQATTQRLFLQGYLQAINA
FT                   AGITLPTSSLTLTN"
FT   regulatory      complement(419377..419390)
FT                   /locus_tag="LCA_0410"
FT                   /old_locus_tag="LSA0410"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      419513..419526
FT                   /locus_tag="LCA_0411"
FT                   /old_locus_tag="LSA0411"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        419531..419965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0411"
FT                   /old_locus_tag="LSA0411"
FT                   /product="Hypothetical extracellular protein precursor"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54712"
FT                   /db_xref="GOA:Q38YL5"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL5"
FT                   /protein_id="CAI54712.1"
FT                   /translation="MTGGQIAALIAAGAFAVLVVFLIVMLLKVTKVLTRVSETVTEANK
FT                   SVTTITNDVDVLSRQVEGLLNKTNVLLDDVNGKVADLDPVFRAAGELGESVSSLNAASR
FT                   GLTEKVTSVGRTTAKATVASKMGASALRFYQNRRQIKDKE"
FT   CDS_pept        419971..420408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0412"
FT                   /old_locus_tag="LSA0412"
FT                   /product="Hypotehtical extracellular protein precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54713"
FT                   /db_xref="GOA:Q38YL4"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL4"
FT                   /protein_id="CAI54713.1"
FT                   /translation="MAKKGFLFGVLVGGAAAIGATLLLTPKTGKELQNKLVDLGEDAID
FT                   RAQDYYYLMNETAADLKGEAKFHMNRVHDYASDWQENALDIKEQAKAQFDEKTADLKSQ
FT                   FGSSLEPAAEDFDDIVIEGKSAFGQAKDEAEEKMTPDSLGE"
FT   regulatory      420423..420443
FT                   /locus_tag="LCA_0412"
FT                   /old_locus_tag="LSA0412"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(420620..420652)
FT                   /locus_tag="LCA_0413"
FT                   /old_locus_tag="LSA0413"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(420697..420774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0413"
FT                   /old_locus_tag="LSA0413"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54714"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL3"
FT                   /protein_id="CAI54714.1"
FT                   /translation="MNDQLVGRLTDVASRRNMPAEARFK"
FT   CDS_pept        complement(420820..421917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="LCA_0414"
FT                   /old_locus_tag="LSA0414"
FT                   /product="Xaa-Pro dipeptidase (Proline dipeptidase)"
FT                   /function="2.9 Protein fate"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54715"
FT                   /db_xref="GOA:Q38YL2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL2"
FT                   /protein_id="CAI54715.1"
FT                   /translation="MNNQLAQLQNWLVENNMDVAYISNPTNILYFTGFESDPAERVLAL
FT                   FVFADQDPFLFTPQLEVGSAKKAGWKLDVYGYLDHEDPYAIIADQIKKRMANPTRWALE
FT                   KDDLPVQRYEAILKQFPNATFPGDASRFMENLKLIKTPEEIALMEAAGREADYAFEVGF
FT                   NALKAGKTEQDIVAEIEYALMRKGVMHMSFDTIVQSGINAANPHGGPEANILTPDALVL
FT                   FDLGTLHKGYMSDATRTVAFGKPDAKSLEIHKVCLEANLAAQDAVKPGITAAELDKIAR
FT                   DVITKAGYGEYFIHRLGHGIGTSEHEFPSIMEGNDMIIKPGMCFSIEPGIYIPDVAGVR
FT                   IEDCVHVTETGAESFTHMTKELQTF"
FT   regulatory      complement(421921..421934)
FT                   /gene="pepQ"
FT                   /locus_tag="LCA_0414"
FT                   /old_locus_tag="LSA0414"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      422116..422129
FT                   /gene="CcpA"
FT                   /locus_tag="LCA_0415"
FT                   /old_locus_tag="LSA0415"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        422134..423135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CcpA"
FT                   /locus_tag="LCA_0415"
FT                   /old_locus_tag="LSA0415"
FT                   /product="CcpA transcriptional regulator (Catabolic control
FT                   protein A)"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54716"
FT                   /db_xref="GOA:Q38YL1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL1"
FT                   /protein_id="CAI54716.1"
FT                   /translation="MEKQTITIYDVAREADVSMATVSRVVNGNPNVKPATRKKVLEVID
FT                   RLDYRPNAVARGLASKKTTTVGVIIPDVSDIYFASLARGIDDVATMYKYNIILANSDEN
FT                   NQKEVQVLNTLLAKQVDGLIYMGHSISDAIRAEFARSKTPIVLAGSIDPDEQVGSVNID
FT                   YVAAVKDATLKLIKNGNEKVAFICGNLEFPINSKYRLRGYKDALNEAGIPYDESLIFET
FT                   EYSYSAGEALFGKVQAIGATAAVVSDDELAVGVLNAAVDAGVNIPTDFEIVTSNNTKLT
FT                   EMVRPKMTSISQPLYDMGAVGMRLLTKMMNKEEIDDKTILLPYSIVDRQSTK"
FT   regulatory      423147..423175
FT                   /gene="CcpA"
FT                   /locus_tag="LCA_0415"
FT                   /old_locus_tag="LSA0415"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(423147..423175)
FT                   /gene="pbp1B"
FT                   /locus_tag="LCA_0416"
FT                   /old_locus_tag="LSA0416"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(423183..425738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="LCA_0416"
FT                   /old_locus_tag="LSA0416"
FT                   /product="Bifunctional glycosyltransferase/transpeptidase
FT                   penicillin-binding protein 1B"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54717"
FT                   /db_xref="GOA:Q38YL0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YL0"
FT                   /protein_id="CAI54717.1"
FT                   /translation="MKDSKQRSSQRQKHASALISKGRRKVNTLFSKIKTKLSHSMPWLN
FT                   NWFNHQDKDQNRIFVDQFSAKPLTFKLNAFLEALKSLVLYGISIGLIMFALGLGIGAGY
FT                   FAALMKEEPVPSYQVLKQQLDNTDQAAGLYFAKNTKFGAIKTDLSRTPVSINEMSPYLT
FT                   DAIVATEDEDFYKHQGVVPKALLRAVISDLTGFGSQTGGSTLTQQLIKMQVLTSQVTFK
FT                   RKATEVLLALRVDKYFTKKEILQDYLNIATLGRNNKGQNVAGVQEAAQGLFGKDAKNLT
FT                   LAEAAYIAGLPQSPSVYTPYDQDGTLKDPEYLKYGLNRKNTVLFRMYRDHRITKAEYQA
FT                   AKKVDLTSEFQAKAEPESTSKRYGYVYNLLESQATDIMTKQLANEANVSTQKLNSSPTL
FT                   YKQYETKATELLSTKGYQIHSTIDKDIYDSMQEIVKQEGSSFGPTYQDTTTDPITGLQS
FT                   VGDTPVQNGSVLLDNRTGKVISFVGGRDFSLKQTNYMLTKRSPGSTIKPLLVYGPAIDQ
FT                   KLIGSKTMLADFKTNFKTYAPTDYGNTIQNKFIPADKALAQSLNIPTVNLYNKLRKTTN
FT                   PATYMDKMGIHLSDDEYSQLGLALGGTKDGISVLAQASAFTTFADEGQHVDAYVIDKIT
FT                   DPAGNIIYKHHTKKTRVFSKATSYIMNQILSGVLTDTDGTATQLSDQLYFNTNNLVGKT
FT                   GTNNDNRDVWFIGSTPGITLASWMGYDSTGRNLTDSSSTINQNYWAKLANSVYQNDSSI
FT                   MKLEEDHEKPSTVTSSKVVKATGQLPGIVSINGNTRTVDSGKVTSLYNNWTPEATQYEF
FT                   GIGGTSSNYETFWNHYMGYNNGYGTIMYGETKASQSESE"
FT   regulatory      complement(425743..425756)
FT                   /gene="pbp1B"
FT                   /locus_tag="LCA_0416"
FT                   /old_locus_tag="LSA0416"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      426005..426018
FT                   /gene="nagB"
FT                   /locus_tag="LCA_0417"
FT                   /old_locus_tag="LSA0417"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        426022..426729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="LCA_0417"
FT                   /old_locus_tag="LSA0417"
FT                   /product="Glucosamine-6-phosphate deaminase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54718"
FT                   /db_xref="GOA:Q38YK9"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YK9"
FT                   /protein_id="CAI54718.1"
FT                   /translation="MKIIKVKDQVEGGQKGFEIFKEGLANDAKVFGLATGSSPIKFYET
FT                   VVASDLDFTNCTSVNLDEYVGLSADNSQSYHYFMKENLFNKKPFAKSYLPNGLASDIPA
FT                   ELKRYDQVIADNPVDIQILGIGQNGHIGFNEPGAAFDSNTQEVQLTESTIKANARFFEN
FT                   EADVPTKAISMGIGSILKAKKIVLFAYGESKAEAIKGTVEGPQTTDVPASALQLHDDVT
FT                   IIVDEAAASLLSK"
FT   regulatory      427017..427042
FT                   /gene="nagB"
FT                   /locus_tag="LCA_0417"
FT                   /old_locus_tag="LSA0417"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(427017..427042)
FT                   /locus_tag="LCA_0418"
FT                   /old_locus_tag="LSA0418"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(427058..427762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0418"
FT                   /old_locus_tag="LSA0418"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54719"
FT                   /db_xref="GOA:Q38YK8"
FT                   /db_xref="InterPro:IPR032083"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK8"
FT                   /protein_id="CAI54719.1"
FT                   /translation="MIVITLIISTLALFFASIFGQKMWRPILMTIFGLTFIASLFFIVQ
FT                   NDHNHYGMKTVTETKTQTLVSSADAKGMSMLLYHPLGNGTEKVYLYRTDSHQSKPKATQ
FT                   TEKTTNSVQKNADKAALVTTTKYRVYKNDAAKFWFGISGNDHEFVSRHNTFKVAKGWLV
FT                   LSDTQAKQLTKTLKRQQAQIKAGATNAGKQAVMAAMQANPAMTATQQQAVAKKAAMAYQ
FT                   QAAMAKVMVTLK"
FT   CDS_pept        complement(427759..428652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0419"
FT                   /old_locus_tag="LSA0419"
FT                   /product="Putative drug:H(+) antiporter (C-terminal
FT                   fragment), authentic frameshift"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54720"
FT                   /db_xref="GOA:Q38YK7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK7"
FT                   /protein_id="CAI54720.1"
FT                   /translation="MKSVIQLSKPKIDIPSIILSTVGFGSLLYGFSEVGDKGWGDTLVL
FT                   ATLAVGVIVIALFVWRQLTMENPFLELRVFKSPVFTIAAILSGVTNMAMVGAEMVLPLY
FT                   IQNIRGESAFHSGLTLLAGSLMMGIMMPITGRIFDKYGAKRLAMTGMFLLMAATAPFIF
FT                   LTAKTPIIYIVVLYAVRMFGISMVMMPVTTSGMNALPMNLISHGTAVNNTFRQVASSIG
FT                   TAILISVLSSVTKNNMPSTHMVKTLPLAFRDKMINATLSGYHAAFIVAVIFCVIGFIIT
FT                   FFLSSKKSTTNGGAKA"
FT   CDS_pept        complement(428621..429235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0420"
FT                   /old_locus_tag="LSA0420"
FT                   /product="Putative drug:H(+) antiporter (N-terminal
FT                   fragment), authentic frameshift"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54721"
FT                   /db_xref="GOA:Q38YK6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK6"
FT                   /protein_id="CAI54721.1"
FT                   /translation="MSDSRPLDIHGKPYNRTALVLVLLIGTFCTVLNQTILSTAFPTLM
FT                   KAFDVSTSAVQWLTTGFLLVNGIMIPISAWLINRFNSKVLYMSAMTVFLLGTIICYIAP
FT                   TSSFATLLIGRLIQAAGVGISMPILQTIMLTIFPPEKRGTAMGMAGIVIGLAPALGPTL
FT                   SGWIIDSYNWRVLFGMIIPIVLLVLVLASFQYEERYPTFET"
FT   regulatory      complement(429239..429252)
FT                   /locus_tag="LCA_0420"
FT                   /old_locus_tag="LSA0420"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      429373..429386
FT                   /locus_tag="LCA_0421"
FT                   /old_locus_tag="LSA0421"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        429388..429828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0421"
FT                   /old_locus_tag="LSA0421"
FT                   /product="Putative transcriptional regulator, MerR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54722"
FT                   /db_xref="GOA:Q38YK5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK5"
FT                   /protein_id="CAI54722.1"
FT                   /translation="MQKDLFLKLIDTDRLIFGISEVCKMAGVTPRQLRYWEQKGYIKAR
FT                   EVDGNKAREYDAQMMIKAIFIKHFLDEGYTLSVAVQKIQKHMANMKIVRSIIREHFEGI
FT                   EELDGEMAVNLGYFDDTKQQILYAIVKEGHSTFKLVDAPTKE"
FT   regulatory      429838..429877
FT                   /locus_tag="LCA_0421"
FT                   /old_locus_tag="LSA0421"
FT                   /regulatory_class="terminator"
FT   regulatory      429966..429979
FT                   /locus_tag="LCA_0422"
FT                   /old_locus_tag="LSA0422"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        429984..431216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0422"
FT                   /old_locus_tag="LSA0422"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54723"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK4"
FT                   /protein_id="CAI54723.1"
FT                   /translation="MEKRQYLQFINEGYGFEFYLNLVGFVADFNGSYPTEREFKTILEE
FT                   NGVAYTAIRRHKLKQMYPEMFAKQHQGHEDAKQYQFDLDHQELGVQRVYYAYSQPELVD
FT                   EQGATCLTTTTPTFVTRQPRYRLFDNSGQYYLFDVPQDQFEQQLNALPTEVLDFEQPHV
FT                   AGILMLIEQVKQLGYTVVGYHLSHIESYPVVEPALLTALINHQQETHQPTFEPINDLLN
FT                   IKTDYRSLLCYDDQLKIPVFNKESSQQFGRDDNLYFKIRDAAGQVVFDRLTLDILGTIL
FT                   FCVGQQLPLEQIQAAFLTDPKASFKAGEDYFMYDRLACSAEVPIETLTDIKKVALCSVD
FT                   TTQTISEYWRWSPRDLMRYGKAIAPADFGQPAPAAALMLAFNQQLTSALRRILKQSALQ
FT                   VRKVTRQFLVL"
FT   regulatory      431252..431265
FT                   /locus_tag="LCA_0423"
FT                   /old_locus_tag="LSA0423"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        431268..431414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0423"
FT                   /old_locus_tag="LSA0423"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54724"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK3"
FT                   /protein_id="CAI54724.1"
FT                   /translation="MSAAQQIYASQMKTAAETRYDLLVDGQCVLQEVPLDELLPAIMEF
FT                   ANE"
FT   regulatory      431427..431450
FT                   /locus_tag="LCA_0423"
FT                   /old_locus_tag="LSA0423"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(431427..431450)
FT                   /gene="pepV"
FT                   /locus_tag="LCA_0424"
FT                   /old_locus_tag="LSA0424"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(431474..432877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="LCA_0424"
FT                   /old_locus_tag="LSA0424"
FT                   /product="Xaa-His dipeptidase V (Carnosinase)"
FT                   /function="2.9 Protein fate"
FT                   /EC_number="3.4.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54725"
FT                   /db_xref="GOA:Q38YK2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK2"
FT                   /protein_id="CAI54725.1"
FT                   /translation="MTLNWQQEAAKYKDQMLTDLTSLLKINSARDVEHKEDDAPLGPGP
FT                   RDALLQMLAIADRDGFTTKNIENVAGRIEFGSGDEIFGILGHVDVVPAGDGWETNPFEP
FT                   VIKDGKIYARGSSDDKGPSIAAYYALKLLKDNDIKLNKKVHFIFGTDEESEWVGINRYL
FT                   EVEPKPDFAISPDANFPIINGEKGIVSYMITFKPVDGADGEMTLVSFKSGLRANMVPQT
FT                   AKAILTGAMPADFQAKFDAYVAEHKLQGTITTDGDQTVIDLIGKGSHAQEPKAGVNAAT
FT                   HLATFLADFALDAKGGNYIGTIARLMHEDSRGHLLNINHTDDVMGDLTACPAVFNYTQD
FT                   GVASVLLNVRYPKGVTDESTREGLAKTLSDVADVTIEGHAQAPHYVPGDDELVATLLQV
FT                   FEDQTGLKGHEQVIGGGTYGRILERGVAFGALPEERENVMHQANEYMHIEDIMNAIAIY
FT                   ADAIYRLTR"
FT   regulatory      complement(432880..432893)
FT                   /gene="pepV"
FT                   /locus_tag="LCA_0424"
FT                   /old_locus_tag="LSA0424"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(432991..433025)
FT                   /locus_tag="LCA_0425"
FT                   /old_locus_tag="LSA0425"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(433070..435160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0425"
FT                   /old_locus_tag="LSA0425"
FT                   /product="Putative heavy metal-transporting P-type ATPase"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54726"
FT                   /db_xref="GOA:Q38YK1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK1"
FT                   /protein_id="CAI54726.1"
FT                   /translation="MTQIQLAGIDCAACATKIETNVKKLPQVQDCAVNFATQKLSYELT
FT                   GDQAATAFELALQQLLTTIEPDVTIQKSLPAAGQTPPKKFKFNLDLIRIIISGLLLLGS
FT                   YVLPLSQPLLISLLLVAFVLIGYDIIWTAIRNILHGQWFDENFLMTVATIGAFGIGEYA
FT                   EAVGVMLFYQVGEYFQSLAINRSRDSIASLVAIKPTFANLQTSQGLQQVAPEAVPVGAT
FT                   ILIKPGEKVPLDGTVIAGSSFVDTAAVTGESVPRSFNVGDTLLSGSINQSGLLTLQVTK
FT                   PYANSTVAKILDLVENASSQKAPTENFITRFAKIYTPIVVGFAVLLAVVPPLFLGQPFS
FT                   DWLYRALIFLVISCPCALVISIPLGFFAGIGTASKNGILVKGSNYLEALNDVRTVVFDK
FT                   TGTLTQGSFTVTAIHAVDHQPEHLLALAALAEQHSTHPIAQSIIAANQAPLNQTLSAVT
FT                   EVAGHGVSATLDGQSLKVGKASWLKEQGLTPLTPTEVGTAVHIAYGTDYLGYLVISDQL
FT                   KKDAATAIAQLKKVGIRQTMMLTGDNDAIAKQVSQSLGIDHYQSELLPQDKVATLASLT
FT                   DNRAQNGKVAFVGDGINDTPVLARADVGVAMGGLGSDAAIEAADIVLMSDEPTKLATAI
FT                   DIARFTRKIVWQNIAFALIVKAIFLLLGAFGIATMWEAVFADVGVTLIAILNALRIMRK
FT                   SN"
FT   regulatory      complement(435164..435177)
FT                   /locus_tag="LCA_0425"
FT                   /old_locus_tag="LSA0425"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(435323..435356)
FT                   /locus_tag="LCA_0426"
FT                   /old_locus_tag="LSA0426"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(435366..435698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0426"
FT                   /old_locus_tag="LSA0426"
FT                   /product="Putative transcriptional regulator, ArsR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54727"
FT                   /db_xref="GOA:Q38YK0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YK0"
FT                   /protein_id="CAI54727.1"
FT                   /translation="MTIDHDQLIRSVQKTLPKEDTLDHISTLFKILGDKTRAKILYALF
FT                   QSELRVYDIVSVLEMSQSSISHQLRVLKQAKLVKSRKEGKEVYYSLADNHVINIFSQVI
FT                   AHVNEH"
FT   CDS_pept        complement(435713..437041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0427"
FT                   /old_locus_tag="LSA0427"
FT                   /product="Putative cell surface Glycerophosphoryl diester
FT                   phosphodiesterase precursor"
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54728"
FT                   /db_xref="GOA:Q38YJ9"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ9"
FT                   /protein_id="CAI54728.1"
FT                   /translation="MLKSKSQLGIVLFCCFYFLLLSGFTVVGHRGDPINAPEETFQSID
FT                   MAFSQGANYVELDLHESQDGVLVISHDRNLKRVTGVDTIVSQNTFAKLSTLKMSNGEPV
FT                   HSVEQLFQHYQNNPNAKFLIETKKTKKGNPQDMEAKLVALIQKYHLQKRIMVHSFSLPS
FT                   LINMQKLMPEIPRIFIVGSLKRISFESFKYADGINISSELVTPTIIKQLHYLHQKVYVW
FT                   NEMAENQATWNWLVNLDVDGVVTNYPALGRHYQAAQDQSQIESLETTGQVNSVHDLTTV
FT                   ENPYEQVPTKAPAKAGHSYDVTQTVTVADQTYYRIGTNRFVLSDAINVGQTAQAASLLV
FT                   GKTAQIKPNPMTVATWNSPLHPTQTTGQLLANSRHKILAVRYVGNQVWLQTATGWFKSR
FT                   QALIQLDPNTDLPTIALAYYRQLPKQLRPTNLLLKHSFFNTKF"
FT   regulatory      complement(437046..437059)
FT                   /locus_tag="LCA_0427"
FT                   /old_locus_tag="LSA0427"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      437320..437333
FT                   /locus_tag="LCA_0428"
FT                   /old_locus_tag="LSA0428"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        437335..437649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0428"
FT                   /old_locus_tag="LSA0428"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54729"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ8"
FT                   /protein_id="CAI54729.1"
FT                   /translation="MAEKQQVFDIIEEITRLDGSTYYELGNIFMNGRAELAANRGLIKG
FT                   VRILQLNIPHSNAVQTYEDYINNTYTMPAVDFTEWEEWEKTPGPVEEAFKEVLKANHIG
FT                   "
FT   CDS_pept        437662..438264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0429"
FT                   /old_locus_tag="LSA0429"
FT                   /product="Putative phosphoesterase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54730"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ7"
FT                   /protein_id="CAI54730.1"
FT                   /translation="MIYFTADTHFYHEELLGMNDFAPRPFADVATMNETIVTNWNQRVQ
FT                   SEDQVYLLGDVALVPNKPTAFAQVNALLGALNGQIILVKGNHDNRAFFKYLKKHDPGTE
FT                   AHPHYQFVDVGALIKINHRQYFLTHYPLLLGKVSQTVNLHGHIHHNMLPIAENINVGID
FT                   APERELLKTPLPFGTPLSVADIEAILTAKQKALTQLK"
FT   CDS_pept        438277..439656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0430"
FT                   /old_locus_tag="LSA0430"
FT                   /product="Putative nucleotide phosphoesterase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54731"
FT                   /db_xref="GOA:Q38YJ6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ6"
FT                   /protein_id="CAI54731.1"
FT                   /translation="METIHILHTNDLHSHFENWPRMRRFLLAHQAAYRQKGETVLTFDI
FT                   GDAMDRSHPLTEATDGQINTTLLNQIGYDGVTIGNNEGIGNSHAQLEHLYDHANFPVLL
FT                   ANLYEQSTNTLAKFAQPYRIITTDQGTRIAVVGLTAPFFLTYRPNGWDPVTISEEMPQL
FT                   LAQIEGQYDVLVLLSHLGLTTDQWLAEHYPEIDVMCGAHTHHLLKDGLMVNQTLLTAAE
FT                   KYGHYIGDITLTLDANHRPVDRKARTVLTADLPEEAADEAEIAGYLAQGHAQLAAQVVA
FT                   DLPEALPIATIGESPMMTAGLKAIEAATQTEAAVLNTGLFLGGLEPGLVTKDDLQSQLP
FT                   HPMHLIKVTLKGYDLWRLVLEMEKNRLFLRKFPIKGMSFRGKIFGDIVYDGITVDMTLR
FT                   RVFWHGQEIAPEASYTLTTVDHYLFIPFFPTIEIVGETEIMFPDFLRNAVATYLTQKYP
FT                   V"
FT   regulatory      439660..439673
FT                   /locus_tag="LCA_0431"
FT                   /old_locus_tag="LSA0431"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        439675..440292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0431"
FT                   /old_locus_tag="LSA0431"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54732"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ5"
FT                   /protein_id="CAI54732.1"
FT                   /translation="MADTKTKPKIAKKVTRALEKEMIAAAKQPEVPQHVVVKSETMIDI
FT                   DKCAYEVVANYRDGFDAEKLNERYNEVLAKYDYIVADWGFEQLRLKGFYKSTNRRANKD
FT                   QLIDTLQDYLYEYCNFGCAYFVLERQGKPQIRNENRRSNRRRGPQKQRRQKQGFTERKV
FT                   TPNQKVTKEQPQKAVTENKKSVNKRHFKIRPLESNSPKETGK"
FT   CDS_pept        440301..441086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0432"
FT                   /old_locus_tag="LSA0432"
FT                   /product="Putative sugar phosphatase, HAD superfamily"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54733"
FT                   /db_xref="GOA:Q38YJ4"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ4"
FT                   /protein_id="CAI54733.1"
FT                   /translation="MTKTNYAGYLIDLDGTVYRGSEQMPEARDFIERLQAKNIPFMFLT
FT                   NNTTKSPAAVIKNLADNHDIHATEDQVYTPSLATARYLLNLNGGQANGKTVYVIGEIGL
FT                   KQALLDAGFRTNEYDPDYVVVGLDYDVTYHKFELATLAIKRGALFIGTNADTNLPNERG
FT                   LVPGAGSVIALVERATQQSALYIGKPEKIIMEMALEQFGLTKDQVVMVGDNYNTDIKAG
FT                   LNAEMATLLVYTGVSTPADLAKVTAQPTHIINSLAEWEV"
FT   CDS_pept        441074..441715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0433"
FT                   /old_locus_tag="LSA0433"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54734"
FT                   /db_xref="GOA:Q38YJ3"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ3"
FT                   /protein_id="CAI54734.1"
FT                   /translation="MGSLNGVKKTGNWLVFYLSIVSGSILAAIAIGWLSYDLVSRQLHL
FT                   AAQMQMSQATLMHEFNRLMRYLVLPGGQSLVLPHFKMSANGLAHFKEVKHLFLLTAVIF
FT                   LVTIVPALRSWRRDFKSGRQWRYIRPMQVALVMPIVIGLIASVSFDRFFVLFHELLFRN
FT                   LDWQFDPLLDPIILVLPEQYFMLCFICFFVILEGLFLIILWRAKKSLKIY"
FT   regulatory      441787..441800
FT                   /locus_tag="LCA_0434"
FT                   /old_locus_tag="LSA0434"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        441802..442455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0434"
FT                   /old_locus_tag="LSA0434"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54735"
FT                   /db_xref="GOA:Q38YJ2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ2"
FT                   /protein_id="CAI54735.1"
FT                   /translation="MTQLIDFVLHIDAHLVNIVNQFGNWTYVILFAIIFVETGAVILPF
FT                   LPGDSLLFAAAALAARTDNDLNIWVFAALFLVAAIAGDSLNEQIGKRVGMAATKSRFFG
FT                   KFINTEKIEEAQVFFNKYGGKTITIGRFMPIIRTFVPFVAGGSQMSFGKFFRYDVIGSV
FT                   LWVVLCCGAGYFFGNIAVVKEHFSLVVLGIIAVSLIPMVITAVKSQLKSRKAKS"
FT   regulatory      442464..442502
FT                   /locus_tag="LCA_0434"
FT                   /old_locus_tag="LSA0434"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(442464..442502)
FT                   /gene="trxB1"
FT                   /locus_tag="LCA_0435"
FT                   /old_locus_tag="LSA0435"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(442510..443496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="LCA_0435"
FT                   /old_locus_tag="LSA0435"
FT                   /product="Thioredoxin reductase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54736"
FT                   /db_xref="GOA:Q38YJ1"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YJ1"
FT                   /protein_id="CAI54736.1"
FT                   /translation="MLDPNHLFDITVIGGGPVGMFAAYYAGMRKADVQIIESLPELGGQ
FT                   VATLYPEKEIFDVAGFKGITGAQLTANLAEQLAVFEPTTQLETSVKAILPQEDGTYILE
FT                   TSKGTTHTRGVIVAVGNGAFTPRKLAVDYQPEWENNYIHYFAKEMAQFKDQTVAVAGGG
FT                   DSAIDWALMLEKVAKQVYIIHRRDQFRGLESSVDALMNSSIQIKTPFLIDGLTEVDHQL
FT                   ALSLNKMKSTDQEQLVVDKLLVNYGFISDTRILRDWGLTLDHHQVSVNQQMATNLPNVY
FT                   AIGDIATYPGKVKLIASGFGEAPVAVTELLTKLYPEKRQPLHSTSIM"
FT   regulatory      complement(443499..443512)
FT                   /gene="trxB1"
FT                   /locus_tag="LCA_0435"
FT                   /old_locus_tag="LSA0435"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      443626..443639
FT                   /locus_tag="LCA_0436"
FT                   /old_locus_tag="LSA0436"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        443641..444225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0436"
FT                   /old_locus_tag="LSA0436"
FT                   /product="Putative peptidylprolyl isomerase (Peptidylprolyl
FT                   cis-trans isomerase) (PPIase)"
FT                   /function="3.9 Protein folding"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54737"
FT                   /db_xref="GOA:Q38YJ0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YJ0"
FT                   /protein_id="CAI54737.1"
FT                   /translation="MTFPQLDLENFAGPTATFDTNHGEFTVALFPEQAPKTVENFIGLA
FT                   EKDYYDGIVFHRVINDFMIQGGDPTGTGMGGESLWGQAFGDEFSQELFNLNGALSMANA
FT                   GPNTNGSQFFIVTNEHINPSMMSQMPGAGYPEEVIAAYEKGGTPWLDHKHTVFGQVLSG
FT                   MDVVNEINAVETGMQDKPVDPVVINHISIKH"
FT   regulatory      444241..444266
FT                   /locus_tag="LCA_0436"
FT                   /old_locus_tag="LSA0436"
FT                   /regulatory_class="terminator"
FT   regulatory      444356..444369
FT                   /locus_tag="LCA_0437"
FT                   /old_locus_tag="LSA0437"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        444373..444750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0437"
FT                   /old_locus_tag="LSA0437"
FT                   /product="Hypothetical protein with an RNA-binding domain"
FT                   /function="3.6 RNA restriction and modification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54738"
FT                   /db_xref="GOA:Q38YI9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI9"
FT                   /protein_id="CAI54738.1"
FT                   /translation="MVYRIGQKVTGTVTGIQPYGVFVALDESVQGLIHISECGHGFVKA
FT                   LDEQFTVGQQLDVLVLDVDEYTHKISLSLRALHKAQDLLPQRAKKHYWTNRRIQTGFAP
FT                   IAERLPGWTKAAIEELNQRGK"
FT   CDS_pept        444751..445137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0438"
FT                   /old_locus_tag="LSA0438"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54739"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI8"
FT                   /protein_id="CAI54739.1"
FT                   /translation="MSAKVAGTIMYKTKQGQYDFLVQKQADTDYKMLSTHKNSDQTPLA
FT                   AVLNAIKATIKIDVNELRLINLANINLEGENVSFFVFQWSEHPAEFYDEQLQIIAESGY
FT                   RFANPSEITELLDKLEVTGVPHLN"
FT   rRNA            445757..447106
FT                   /gene="rrsF"
FT                   /gene_synonym="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            447330..450248
FT                   /gene="rrlF"
FT                   /gene_synonym="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            450340..450456
FT                   /gene="rrfF"
FT                   /gene_synonym="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            450467..450539
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:450500..450502,aa:Val)"
FT   tRNA            450542..450614
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:450575..450577,aa:Lys)"
FT   tRNA            450637..450720
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:450671..450673,aa:Leu)"
FT   tRNA            450756..450828
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:450789..450791,aa:Thr)"
FT   tRNA            450836..450907
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:450868..450870,aa:Gly)"
FT   tRNA            450922..451010
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:450956..450958,aa:Leu)"
FT   tRNA            451022..451095
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:451056..451058,aa:Arg)"
FT   tRNA            451101..451174
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:451135..451137,aa:Pro)"
FT   tRNA            451212..451285
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:451246..451248,aa:Met)"
FT   tRNA            451302..451375
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:451336..451338,aa:Met)"
FT   tRNA            451421..451494
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:451455..451457,aa:Met)"
FT   tRNA            451497..451570
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:451531..451533,aa:Asp)"
FT   tRNA            451580..451652
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:451613..451615,aa:Phe)"
FT   tRNA            451665..451735
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:451697..451699,aa:Gly)"
FT   tRNA            451742..451815
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:451776..451778,aa:Ile)"
FT   tRNA            451830..451917
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:451864..451866,aa:Ser)"
FT   tRNA            451926..451997
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:451959..451961,aa:Glu)"
FT   tRNA            452031..452114
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:452064..452066,aa:Ser)"
FT   tRNA            452128..452201
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:452162..452164,aa:Met)"
FT   tRNA            452204..452277
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:452238..452240,aa:Asp)"
FT   tRNA            452287..452359
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:452320..452322,aa:Phe)"
FT   tRNA            452365..452445
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:452399..452401,aa:Tyr)"
FT   tRNA            452453..452523
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:452485..452487,aa:Trp)"
FT   tRNA            452583..452655
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT                   /anticodon="(pos:452616..452618,aa:His)"
FT   tRNA            452665..452736
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:452697..452699,aa:Gln)"
FT   tRNA            452764..452834
FT                   /gene="tRNA-Cys"
FT                   /product="transfer RNA-Cys"
FT                   /anticodon="(pos:452796..452798,aa:Cys)"
FT   tRNA            452872..452955
FT                   /product="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:452906..452908,aa:Leu)"
FT   regulatory      452983..452998
FT                   /gene="tRNA-Leu"
FT                   /regulatory_class="terminator"
FT   regulatory      453074..453087
FT                   /locus_tag="LCA_0439"
FT                   /old_locus_tag="LSA0439"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        453089..453937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0439"
FT                   /old_locus_tag="LSA0439"
FT                   /product="Hypothetical extracellular lipase/esterase
FT                   precursor"
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54740"
FT                   /db_xref="GOA:Q38YI7"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI7"
FT                   /protein_id="CAI54740.1"
FT                   /translation="MKKWGFLLSGGFLVAIIVGILLINQRPNQARQQANRVHDSAPTFY
FT                   LHGYGGSGRSSDSMIAAAEERGRATKVLTAIVSRTGQVELEGHWTGNTTRPIIQVIYKN
FT                   NRNANYRQNGEWFKRVLIAVNRQHHFKQFNVVAHSMGNLTLAFYLANNAQNKKMPQLTK
FT                   FVSIAGHYAGIIGMDDRANQNHLAKNGRPQQINATYRQLMGLRHRLPKNQIQYLNIYGD
FT                   LSDGSDSDGRVSNVSSQSLRYLVAPRAKSYQEVQFKGSNAQHSKLYENEAVNKAVIDFL
FT                   W"
FT   regulatory      453947..453981
FT                   /locus_tag="LCA_0439"
FT                   /old_locus_tag="LSA0439"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(453947..453981)
FT                   /gene="mleR"
FT                   /locus_tag="LCA_0440"
FT                   /old_locus_tag="LSA0440"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(453963..454883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleR"
FT                   /locus_tag="LCA_0440"
FT                   /old_locus_tag="LSA0440"
FT                   /product="Transcriptional regulator of the malolactic
FT                   fermentation, LysR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54741"
FT                   /db_xref="GOA:Q38YI6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI6"
FT                   /protein_id="CAI54741.1"
FT                   /translation="MKIKDLEYFVALIKLKNFTAVADQFGVSQPTITYAVKRLETEFET
FT                   KLIRRDQSHQSIIITDSGEQLNRHAVKILNEIQLTTTDMQNLSATELRFGLPPIIGTYY
FT                   FSKLAQKLVKAGSIQHFATVDGGSTELLASLEAGRLDAALLGSATPLENDALTAEIIEQ
FT                   HHFKIVVSPKSSLANAKQVAFRDLANENFIMLAEGFVHPVIFDTLSTMNQMNPDIIYRT
FT                   NDVSILKSMVHENVGIGFLTETAITPADDLITLDLLDQPQPTFYISLASRKTQLFSATQ
FT                   QALLGTLITAAKEYRLEQKNSNTDS"
FT   regulatory      complement(454886..454899)
FT                   /gene="mleR"
FT                   /locus_tag="LCA_0440"
FT                   /old_locus_tag="LSA0440"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      454998..455011
FT                   /gene="mleS"
FT                   /locus_tag="LCA_0441"
FT                   /old_locus_tag="LSA0441"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        455015..456646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleS"
FT                   /locus_tag="LCA_0441"
FT                   /old_locus_tag="LSA0441"
FT                   /product="Malolactic enzyme"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54742"
FT                   /db_xref="GOA:Q38YI5"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI5"
FT                   /protein_id="CAI54742.1"
FT                   /translation="MKAQQILNDPFLNKGTAFTAEERAQFGLTGMLPPHVQTIDEQVKQ
FT                   AYAQYQSKANMLEQRIFLMSIFNENRVLFFKLFSQHVAEFMPVVYDPTIADTIENYSAL
FT                   YVNPQHAAFLSIDDPDSMKTTLANAADGREIKLIVVTDGEGILGIGDWGTQGVDISVGK
FT                   LMVYTAAAGIDPSQVLPVVLDAGTNRESLLNDELYLGNWHERVRGDRYYDFVDQFVQTA
FT                   EELFPNMYLHFEDFGRSNAANILNKYKDQIVTFNDDIQGTGIITLAGIMGALNISGGKM
FT                   TDQVYMSFGAGTAGAGITHRIFEEMLQEGLTEEQARSRFYMVDKQGLLFDDDPELTPEQ
FT                   KPFARKRSEFANADELTTLEAAMKAIHPTILVGTSTQPGTFTESIVKEMAAHTERPIIF
FT                   PLSNPTKLAEATAEDLIKWTDGKALVATGIPAAPVEYNGVTYEIGQANNALVYPGLGLG
FT                   TIASTAKVLNDEMISKAAHSLGGIVDPTEPGAAVLPPVTKLDVFSQTVANAVAQSAVDQ
FT                   GLNKEEIADVQKAVADMKWEPEYKAL"
FT   regulatory      456663..456676
FT                   /gene="mleP1"
FT                   /locus_tag="LCA_0442"
FT                   /old_locus_tag="LSA0442"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        456681..457643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleP1"
FT                   /locus_tag="LCA_0442"
FT                   /old_locus_tag="LSA0442"
FT                   /product="L-Malate uniport protein"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54743"
FT                   /db_xref="GOA:Q38YI4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI4"
FT                   /protein_id="CAI54743.1"
FT                   /translation="MAAFLTSLSSVIEIVLVIALGFWLRSSKKFDDNFKGTISFLIMNV
FT                   ALPLSIFVSVLDNLTREKLVGLSGGLIYVLISFALGYLVAWLLTKAFRIRPGRRGTFIN
FT                   MFVNANTIFIGLPLNLALFGDKSLPYFLIYYVANTVSTWAIGVFFISNDDPTKEKGAAK
FT                   GKFNWRKLLPSPLIGFLAALIYLLTGLPLPELVDKTFSMVGGIVTPMSLIYIGIILADA
FT                   GLKSIHFDRDTILALLGRFVVAPAIMIAIMMFFKNTTSIPTIEQSTLIIQAATPGLAVL
FT                   PILVGQSHGDVEYATNVVTTSTVLFVVVVPILMQIVQFI"
FT   regulatory      457658..457682
FT                   /gene="mleP1"
FT                   /locus_tag="LCA_0442"
FT                   /old_locus_tag="LSA0442"
FT                   /regulatory_class="terminator"
FT   regulatory      457772..457785
FT                   /locus_tag="LCA_0443"
FT                   /old_locus_tag="LSA0443"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        457790..458158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0443"
FT                   /old_locus_tag="LSA0443"
FT                   /product="Putative single-stranded mRNA endoribonuclease"
FT                   /function="3.6 RNA restriction and modification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54744"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI3"
FT                   /protein_id="CAI54744.1"
FT                   /translation="MSEKIYTKQAPEPLGPYSQAIATNKIVFMSGQLGLKDGKLAPDLA
FT                   GQTKQAIMNLQSVLKEAGLSLENIVKTNCFLTNLDDFNEFNQVYAEFFGDIAPARSAVQ
FT                   VGKLPAGGIVEIEAIAVR"
FT   regulatory      458165..458178
FT                   /locus_tag="LCA_0444"
FT                   /old_locus_tag="LSA0444"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        458181..459086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0444"
FT                   /old_locus_tag="LSA0444"
FT                   /product="Putative malate dehydrogenase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54745"
FT                   /db_xref="GOA:Q38YI2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI2"
FT                   /protein_id="CAI54745.1"
FT                   /translation="MNKVAIIGIGHVGSTVAYTLVSRRICSELVLFDQKPKLAEAERND
FT                   LEAGQVDHTGFVKITANDESQLATCDLVIFSAGDISILEHSDDRFDELTYTKTAVAQWA
FT                   PKLKAANFKGILLNITNPCDVITQYLQALTGFPKERVLGTGTTLDTARMQVAVGHYLNV
FT                   APNSVQGYVLGEHGNSQFVAWSGVHVGGQPLATQLSPEQLAQFEVDARQGAWEILSGKG
FT                   YTSYGIANQAAHCAAAILQNTRQVLPVSNFDETVQCYVGHPAMVGAAGVLQDYPSQLTT
FT                   AEQQKWQTSIDTIKHMYAAI"
FT   regulatory      459094..459121
FT                   /locus_tag="LCA_0444"
FT                   /old_locus_tag="LSA0444"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(459094..459121)
FT                   /gene="mleP2"
FT                   /locus_tag="LCA_0445"
FT                   /old_locus_tag="LSA0445"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(459132..460079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleP2"
FT                   /locus_tag="LCA_0445"
FT                   /old_locus_tag="LSA0445"
FT                   /product="L-Malate uniport protein"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54746"
FT                   /db_xref="GOA:Q38YI1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI1"
FT                   /protein_id="CAI54746.1"
FT                   /translation="MQTLVNSSAGVFIIIIMIAVGYALAARHWFNDDSTALIAKLVTQV
FT                   ALPPYMIISITKDFSHDQLATLLPNLRFPVISMLLLFELSIIVARFIKVDASRRGLFES
FT                   MFFNSNTVFVGLPINLALFGQRSLPFVLVYYMANTTIFWTLGVYLIQRDGAVQDGLSLK
FT                   TVLQKVFSAPLIGFIIGVILVLLDWHLPSFLTQSFTYLGNLTIPLSMLFIGISIYNAGL
FT                   KNIRFGKDQLGVLAGRFIFAPLLMTALVYPSHMPTLMKQVFILQSCMPVMTNAPVVARL
FT                   YNTDADFAAVMVTETTLGALLMVPIMMFLLGQLF"
FT   regulatory      complement(460081..460094)
FT                   /gene="mleP2"
FT                   /locus_tag="LCA_0445"
FT                   /old_locus_tag="LSA0445"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      460265..460278
FT                   /locus_tag="LCA_0446"
FT                   /old_locus_tag="LSA0446"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        460281..461222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0446"
FT                   /old_locus_tag="LSA0446"
FT                   /product="Putative dihydroorotate oxidase, catalytic
FT                   subunit"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54747"
FT                   /db_xref="GOA:Q38YI0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033886"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YI0"
FT                   /protein_id="CAI54747.1"
FT                   /translation="MISTETTLAGIHFDNCLMNAAGVYCYDADELNQIQKSAAGTFVTK
FT                   SATVVPRAGNPEPRYLSTPWGSINSMGLPNKGLPYYLDYVSQQQTLFPEKRYFQSITGF
FT                   NIDEDEALLKQITDSDFNGLVELNLSCPNVPGKPQTGYDFETVEQILTRVFEVYEGPLG
FT                   VKLPPYFDIVHFDQMAAILNQFPLAFINSVNSIGNGLTIDAATERVSIKPKHGFGGIGG
FT                   DYIKPTALANVHTFYQRLKPEIQIIGTGGVKSGQDVFEHLLCGASMVQVGTALHKEGPQ
FT                   IFDRLTAELQTIMQQKGYNKIADFKGKLKYLD"
FT   CDS_pept        461228..461926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0447"
FT                   /old_locus_tag="LSA0447"
FT                   /product="Putative hydrolase, haloacid dehalogenase family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54748"
FT                   /db_xref="GOA:Q38YH9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH9"
FT                   /protein_id="CAI54748.1"
FT                   /translation="MISKMQYKHLFFDMDNTLFDFDADEDQALERLFNAQDIDLTSDIK
FT                   TTYQTFNQGLWRQYEQGELTREILLNTRFATFFKKQFNKVVDGQQLSSQYLDNLALGHD
FT                   LMPQSEELLAGLQAQHAKLYITTNGVARTQYQRLQDSGLAHYFDAIFVSEELGYQKPDP
FT                   AYFQTVFQKLETVPMTQSLIVGDSLTSDVQGGQNVGVATAWYNPTGQINHDQALQPTHE
FT                   IKQLTELLTL"
FT   regulatory      461966..461979
FT                   /gene="gltP"
FT                   /locus_tag="LCA_0448"
FT                   /old_locus_tag="LSA0448"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        461983..463263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="LCA_0448"
FT                   /old_locus_tag="LSA0448"
FT                   /product="Putative glutamate/aspartate:cation symporter"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54749"
FT                   /db_xref="GOA:Q38YH8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH8"
FT                   /protein_id="CAI54749.1"
FT                   /translation="MKKQRYFRISLGWRILIGIALGLVAGGIFYQNKAAIAVMQAMGTL
FT                   FINLIKMIVLPIVVSCLVVGIAKMGDIKKLGRIGGKTLLYFEMMTTIAIALGLTVGNLT
FT                   KPGALINIHSLSQGSIGQYTAAAKSASNHGLGDIIMNIVPTNIFKALSEGDMIPIIFFT
FT                   VLFGLGLATFGKRSEPLINAFEMISEVMFKLTNWIMQLAPIGVFALIGVTIAQFGFDAL
FT                   KPLVYFLVICYLTMIFFVVVVAGLVARIWHINILELLKVFKEELVLSFSTASSEAALPK
FT                   VMEKIQDYGVSQGIASFVIPTGYTFNLDGSAIYQSLAALFLAQAYHIHLSLMQQLTLLV
FT                   VLMITSKGMAGVPGASFVVLLATITTIGVPAAGVAFIAGIDRLVDMGRTAVNVMGNSLA
FT                   AVIIAKSENEFDETKRTKYLAQLSAKK"
FT   regulatory      463650..463663
FT                   /gene="manL"
FT                   /locus_tag="LCA_0449"
FT                   /old_locus_tag="LSA0449"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        463668..464645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="LCA_0449"
FT                   /old_locus_tag="LSA0449"
FT                   /product="Mannose-specific phosphotransferase system,
FT                   enzyme IIAB"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54750"
FT                   /db_xref="GOA:Q38YH7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH7"
FT                   /protein_id="CAI54750.1"
FT                   /translation="MVGIVIASHGEFAKGIMQSGSMIFGEQEKVQAVTFMPNEGPDDLK
FT                   AHLEAAVATFDADDDVLFLVDLWGGSPFNQANGLFEAHKDKWAIVTGLNLPMLIEAYAS
FT                   RLSMTSAHEIAAHIIDEAKAGVRVKPEDLEPKEAPKAEAKQAANTGTPGKFKYVLARID
FT                   SRLLHGQVATTWSKTTNPTRIIVISDNVAKDELRTNLIKQAAPGGIKAHVVPIDQMIKL
FT                   AKDDQHFGKERALLLFESPQDALRAVEGGVPLETINVGSMAHSTGKVQPNTVLAFDQDD
FT                   IDTFEKLKEKGIKFDVRKVPSDSNGNMDSILKKAQSELDKQNNK"
FT   regulatory      464661..464674
FT                   /gene="manM"
FT                   /locus_tag="LCA_0450"
FT                   /old_locus_tag="LSA0450"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        464680..465486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="LCA_0450"
FT                   /old_locus_tag="LSA0450"
FT                   /product="Mannose-specific phosphotransferase system,
FT                   enzyme IIC"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54751"
FT                   /db_xref="GOA:Q38YH6"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH6"
FT                   /protein_id="CAI54751.1"
FT                   /translation="MDLNFIQVILVIFVAFLAGVEGILDQFHFHQPVIACTLIGLVTGN
FT                   LLPCLILGGTLQMIALGWANVGAAVAPDAALASIASAIILVLGGQGKAGVTSAIAIAVP
FT                   LAVAGLLLTIIVRTLATGIVHIMDAAAKEGNFRKIEMWQYIAIIMQGVRIAIPAGLILA
FT                   IGAGPVKEMLTAMPVWLTDGLAIGGGMVVAVGYAMVINMMATKEVWPFFAIGFVLATIS
FT                   QLTLIGLGAIGISLALIYLALSKQGSGNNGGGSNTGDPLGDIIDNY"
FT   CDS_pept        465505..466416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manN"
FT                   /locus_tag="LCA_0451"
FT                   /old_locus_tag="LSA0451"
FT                   /product="Mannose-specific phosphotransferase system,
FT                   enzyme IID"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54752"
FT                   /db_xref="GOA:Q38YH5"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH5"
FT                   /protein_id="CAI54752.1"
FT                   /translation="MAEQLKLTKKDRISVWLRSTFLQGSWNYERMQNGGWAYTLIPALK
FT                   KLYKTKEDRSAALVRHMEFFNTHPYVAAPILGVTLALEEERANGAPIDDVTIQGVKVGM
FT                   MGPLAGIGDPVFWFTVKPIIGALAASLAMSGNILGPIIYFVAWNAIRMAFTWYTQEFGY
FT                   RAGSKITEDLSGGILQDITKGASILGMFILGSLVNRWVSVKFTPTVSSVKLDKGAFIDW
FT                   DKLPSGAKGIQSALQQQAQGLSLTDHKITTLQDNLDSLIPGLAALGLTLFCMWLLKKKV
FT                   SPIVIILGLFVVGIVFHLLHLM"
FT   regulatory      466671..466701
FT                   /gene="manN"
FT                   /locus_tag="LCA_0451"
FT                   /old_locus_tag="LSA0451"
FT                   /regulatory_class="terminator"
FT   regulatory      466743..466756
FT                   /locus_tag="LCA_0452"
FT                   /old_locus_tag="LSA0452"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        466759..467127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0452"
FT                   /old_locus_tag="LSA0452"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54753"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH4"
FT                   /protein_id="CAI54753.1"
FT                   /translation="MVQSINTKVELVINATSFTALTDYGRIMIGDKGFEFFNDRDARQF
FT                   IQIPWEEVDYVIASVMFKGKWIPRYAIQTKKNGTYTFASKEPKKVLRAIREHVPAERLV
FT                   QSLGVWDVIKRVFTRRAK"
FT   regulatory      467142..467173
FT                   /locus_tag="LCA_0452"
FT                   /old_locus_tag="LSA0452"
FT                   /regulatory_class="terminator"
FT   regulatory      467262..467275
FT                   /locus_tag="LCA_0453"
FT                   /old_locus_tag="LSA0453"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        467279..467503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0453"
FT                   /old_locus_tag="LSA0453"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54754"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH3"
FT                   /protein_id="CAI54754.1"
FT                   /translation="MGFDKAIIALKAGKKVVRTGWGGPELFIVQVSGDTYQGETISPYL
FT                   LIKTTEEPAYSMFQPTSCDVLAEDWQLVD"
FT   CDS_pept        467503..468243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0454"
FT                   /old_locus_tag="LSA0454"
FT                   /product="Putative oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="2 Intermediary metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54755"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH2"
FT                   /protein_id="CAI54755.1"
FT                   /translation="MGHFADLKQKTVLVTGAASGIGQAQMLAFLAEGATVIALDKAPIT
FT                   QTADGLKTVQVDVRDAPQLTATLKSLLATVSSFDIVCNTAGILDQYTPTLETSEADWDN
FT                   LMAVNLKSQFLVTNAVLPSMLARHEGIFVNMASIAGLVAGGGGAAYTASKHAIIGYTKQ
FT                   LDYDYASQGIRANCIAPGAIETPMNAADFAGAGEMAKEVARQTPAGRWAQPAEVAQLSL
FT                   YLASQASDYIHGTVVPIDGGWLEK"
FT   CDS_pept        468264..468497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0455"
FT                   /old_locus_tag="LSA0455"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54756"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH1"
FT                   /protein_id="CAI54756.1"
FT                   /translation="MAKQIKLSQTVYELVTAYPEIVPILVSIGLDGVTNPALLNTAGRF
FT                   MTLPKGAQMKQIPLSQIVATLTENDFEVIADD"
FT   CDS_pept        468490..470013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0456"
FT                   /old_locus_tag="LSA0456"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54757"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YH0"
FT                   /protein_id="CAI54757.1"
FT                   /translation="MTDQHSSAYRQKRIVEILKMLHNGGSFEEAKRIFDESFSGVDVSE
FT                   ITSVERELIASGLNPMEIQHLCNVHAAVFKGAINPNGAETPAQEQPGHPVAVLKLENLV
FT                   INSLLVDELLPCLKKWQQSGSDQAYLNRMQQALKDLLTIDRHYSRKENLLFPLMDKYGI
FT                   TAPPKVMWGVDDQIRGLVKTAYQMVISEPVPDKYEVEAAIEKMTKEIQEMIFKEEEIMV
FT                   PMVNEVFTPADWGLMAAESQPIGYTLIPEPLPWQPSQADLEASEQRAVPAIAKELNAMA
FT                   QSLADKQTPVSRVQPEVKTTPTKSEAASQIPFAIQGTPVETPVIQASVAEPKSAEMPDF
FT                   VKAMLADKAPAEKRPAKVSRNREAPQPHIEIGTDNQATIVLPSGTMNLSELTAILQVLP
FT                   LDLTFVDQDDIVRWFSDNNHRIFPRTRAVLGRAVVNCHPPKSVDKVEKILADFHAGTED
FT                   HADFWINFRGKLVYIRYFAVRDPQQRYLGCLEVSQDITEIQALTGEKRL"
FT   regulatory      470031..470044
FT                   /locus_tag="LCA_0457"
FT                   /old_locus_tag="LSA0457"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        470050..470895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0457"
FT                   /old_locus_tag="LSA0457"
FT                   /product="Putative transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54758"
FT                   /db_xref="GOA:Q38YG9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG9"
FT                   /protein_id="CAI54758.1"
FT                   /translation="MQQIILLLAVGILAGILGAILGIGGGIILTPVLTLAIGLDIKYAI
FT                   GASIVAVIATSSGATIAYLKDDMLNLRVAMFLEIATTVGAIIGALLTGVVPTGFLFILF
FT                   GSFLLFSTYNMIQKLRGKKAEEHVGAANDQWAEKLNLNGTYYDKANQKQVDYQVEKVPG
FT                   GFAMMFGAGIASGLLGIGSGVFKVTAMDTIMKMPLKPSSATSNLMMGVTAAASATVYFF
FT                   SGAILPEIAAPLALGILAGATVGSRIMQHLQPKFIRMIFIPILLYMGLQMVLKGFGVHI
FT                   "
FT   CDS_pept        470895..471260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0458"
FT                   /old_locus_tag="LSA0458"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54759"
FT                   /db_xref="GOA:Q38YG8"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG8"
FT                   /protein_id="CAI54759.1"
FT                   /translation="MTDRKKEMAQIELVIGKILRVGVLVSATVLIIGMLLFLMHGGTGY
FT                   GEHQFPTTFAMIFQGMAELKAGAVIMFGLFCLILTPVLRVVVSIYAFAKEEDYLYVWIT
FT                   VIVLVILIIGMTIGFIK"
FT   regulatory      471282..471314
FT                   /locus_tag="LCA_0458"
FT                   /old_locus_tag="LSA0458"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(471282..471314)
FT                   /locus_tag="LCA_0459"
FT                   /old_locus_tag="LSA0459"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(471324..471755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0459"
FT                   /old_locus_tag="LSA0459"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54760"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG7"
FT                   /protein_id="CAI54760.1"
FT                   /translation="MQTYRIKKPRKLEITYDDQILTLHYPGLLKKNDKDDREIAFKKLK
FT                   SVRFFEATYRQGHLQILYQKPNHALEKIIISFEAADNDDLQKLYQLMNDYIEKPAEEDL
FT                   SFVKKGELIMAYLKMKEGGLMTDDEFEEKKKRILGLEDQ"
FT   regulatory      complement(471757..471770)
FT                   /locus_tag="LCA_0459"
FT                   /old_locus_tag="LSA0459"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      471876..471889
FT                   /locus_tag="LCA_0460"
FT                   /old_locus_tag="LSA0460"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        471893..471985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0460"
FT                   /old_locus_tag="LSA0460"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54761"
FT                   /db_xref="GOA:Q38YG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG6"
FT                   /protein_id="CAI54761.1"
FT                   /translation="MQFFTGIRNGLLLALPIWGVLILVMSSWLY"
FT   regulatory      471988..472022
FT                   /locus_tag="LCA_0460"
FT                   /old_locus_tag="LSA0460"
FT                   /regulatory_class="terminator"
FT   regulatory      472153..472166
FT                   /locus_tag="LCA_0461"
FT                   /old_locus_tag="LSA0461"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        472169..473371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0461"
FT                   /old_locus_tag="LSA0461"
FT                   /product="Putative glycosyl transferase, group 1"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54762"
FT                   /db_xref="GOA:Q38YG5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG5"
FT                   /protein_id="CAI54762.1"
FT                   /translation="MNIGIFTDTYFPQVSGVATSIKTLKEGLEKKGHSVYIFTTTDPHV
FT                   DKETIEPNIFRFASVPFVSFTDRRIAVRGLFHAYQVAKELDLDIVHTQTEFSMGYIGKF
FT                   VAKNLKIPCLHTYHTMYEDYLHYVLNGKLLRPYHVKQMSKAFLYHMSGIVAPSERVSQT
FT                   LNRYQVKAPIRIIPTGVDISRYEKQVTLDVRESLGLTKEQPVLLSLSRVAYEKRIDVII
FT                   DALPRLVAQKPDLMLVIAGEGPAREDLEAQVARLGMSEHVIFTGMIDNDDVSNYYHMAD
FT                   LFVSASDSESQGLTYIEAMAAEVKIVVMASPYASELLTDPSIGTTFTTEDEMLHQILNY
FT                   LNHPGAFDDPAPRQNKLHAISADYFAEQMVQFYKQSQVLYDELKLDQDELLELEDMDTK
FT                   K"
FT   regulatory      473390..473409
FT                   /locus_tag="LCA_0461"
FT                   /old_locus_tag="LSA0461"
FT                   /regulatory_class="terminator"
FT   regulatory      473433..473446
FT                   /locus_tag="LCA_0462"
FT                   /old_locus_tag="LSA0462"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        473449..474465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0462"
FT                   /old_locus_tag="LSA0462"
FT                   /product="hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54763"
FT                   /db_xref="GOA:Q38YG4"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG4"
FT                   /protein_id="CAI54763.1"
FT                   /translation="MSRTNKIVFAVMLAIGCGIFAYESRTLQLNQLVADISRLKVGWLL
FT                   VALLCMLVSWFFEALVLCVFLKGRTTDFSLFNALRIPLIAQLFNAITPFSSGGQPAQLV
FT                   ALMQSRVEAGQASSVLLMKFIVYQFMVLVNFLLSMVIGFSQVSKHFGTLAILINFGLIV
FT                   HVVVLAVLLLVMYYNKFTKQLVHWLLIPVSWFVSKKRMAEWRGTLLTKIDTFYAESLHL
FT                   KKEKKKLIKGCLLTLCQLFFYYSVPYFVLLALGSPNVNYLEVMVLHVMIVMIVSLFPVP
FT                   GGSGGAEYSFKTLFATFTLSSSKLVLAMLLWRLFTYYLGMFMGIGALAVKPKLSAKK"
FT   CDS_pept        474478..475356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0463"
FT                   /old_locus_tag="LSA0463"
FT                   /product="Putative 2-hydroxyacid dehydrogenase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54764"
FT                   /db_xref="GOA:Q38YG3"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG3"
FT                   /protein_id="CAI54764.1"
FT                   /translation="MQPTIGFIGIGVMGSSMVKNLLKANYSVVVYNRTKQKADEVVSLG
FT                   AKWADTPAAVTAQSDVVLSMVGYPQDVEAIYYGDDGIFSAVTPDKIVVDMTTSTPTLAQ
FT                   KIAATASELGLQALDAPVSGGDIGAQNGTLTVMVGGNQAAYEQVKPVFEAVGQTVQRFG
FT                   EAGKGQHTKMANQIMIAGTMTGMTEMLVYAQAAGLDLPAVLKTVNGGSAQNWSLANYGP
FT                   RILAGDYTPGFFAKHFLKDLKIALEESEKMGLNLPATHQAKKLYARLVNEAGLGDDGTQ
FT                   ALIKLWTDSIK"
FT   regulatory      475412..475425
FT                   /locus_tag="LCA_0464"
FT                   /old_locus_tag="LSA0464"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        475428..475661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0464"
FT                   /old_locus_tag="LSA0464"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54765"
FT                   /db_xref="InterPro:IPR014904"
FT                   /db_xref="InterPro:IPR038073"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG2"
FT                   /protein_id="CAI54765.1"
FT                   /translation="MQSSQLVAIIKRLVAMQEDQSAEVQERRFEKEGDLKATVSYDPQA
FT                   QAFELEDSSTHQQFQFDNIDLVAMELYDLLAD"
FT   regulatory      475670..475695
FT                   /locus_tag="LCA_0464"
FT                   /old_locus_tag="LSA0464"
FT                   /regulatory_class="terminator"
FT   regulatory      475862..475875
FT                   /locus_tag="LCA_0465"
FT                   /old_locus_tag="LSA0465"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        475882..477939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0465"
FT                   /old_locus_tag="LSA0465"
FT                   /product="Putative phosphoglycerol transferase"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54766"
FT                   /db_xref="GOA:Q38YG1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG1"
FT                   /protein_id="CAI54766.1"
FT                   /translation="MKQIGHKIQAGLSTRWGFFLFAVALFWLKTIYAYQTKFNLGVKGG
FT                   MQAFLMTINPIPTTLLLFGIALFMNGRKSYITLMIIDLLTSVWLFSNILYYREFSDFLT
FT                   FNLMKGSGAVSNNLGKSIAGIIEYSDFLVFADVLLLLILLATKLIKIDRRVFMKRNAFA
FT                   ITGLSVVLFGANLGMAEADRSGLLTRTFDNNYIVKYLGMNAYTVYDGVKTTKNNAIKAN
FT                   ADSSSMSSVLKYMKDNRVAPNVEYTGVAKGKNVFVIHLESFQQFLIDYKWDNQEVTPNI
FT                   NKLYHDQNTLSFDNFFNQVGQGKTADAELMLENSLFGLPEGAAMVTQGTTNTFQAAPAI
FT                   LNQQGYTTASFHGDVPSFWNRDNTYKSWGYDYFFSSQYFKEGKDYNVGYGLKDKIFMQD
FT                   SARYIEQLPQPFYAKLITVTNHYPYLLDKKNQSIAKTDTGDDTVDGYVQTAKYLDQALG
FT                   EFMTWLQKTGLDKNSMLVLYGDHYGVSGNHKKAVAKLLKKDEFNDFDNAQFQRVPFMVH
FT                   MPGLKGGVNHTYGGEIDVLPTLLNLLGVKNNDTIQFGSDLLAANRNQTVVFRNGDYVAP
FT                   DYTKVGSTYYDTKTGKELTKMTKAQKLRVLALSEHVTKELSLSDKVITGDLLRFYTPTG
FT                   FEATDKTKLSYKVSDAKAQLKADKTKTSVIQKNNGKSTMNLYQTDAPELK"
FT   regulatory      477950..477973
FT                   /locus_tag="LCA_0465"
FT                   /old_locus_tag="LSA0465"
FT                   /regulatory_class="terminator"
FT   regulatory      478071..478084
FT                   /locus_tag="LCA_0466"
FT                   /old_locus_tag="LSA0466"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        478089..478523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0466"
FT                   /old_locus_tag="LSA0466"
FT                   /product="Putative transcriptional regulator, Fur family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54767"
FT                   /db_xref="GOA:Q38YG0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YG0"
FT                   /protein_id="CAI54767.1"
FT                   /translation="MSQTIVEQTLRKLKVNNVRITPQRQAVLEFMIGTHMHPTADDVYQ
FT                   ALAGRFPNMSVATIYNNLRLFTELGVIEEMTYGDASSHFDFAQTKHYHAICDRCGKVVD
FT                   IFYPGLEDVEIVAQNLTGFMVTGHRMEVHGICPECQLVNR"
FT   rRNA            478891..480461
FT                   /gene="rrsG"
FT                   /gene_synonym="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            480685..483603
FT                   /gene="rrlG"
FT                   /gene_synonym="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            483696..483774
FT                   /gene="rrfG"
FT                   /gene_synonym="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            483816..483888
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:483849..483851,aa:Asn)"
FT   tRNA            483900..483989
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:483934..483936,aa:Ser)"
FT   tRNA            484007..484078
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:484040..484042,aa:Glu)"
FT   tRNA            484084..484156
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:484117..484119,aa:Val)"
FT   tRNA            484169..484242
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:484203..484205,aa:Asp)"
FT   regulatory      484261..484287
FT                   /gene="tRNA-Asp"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(484330..484345)
FT                   /locus_tag="LCA_0467"
FT                   /old_locus_tag="LSA0467"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(484357..484980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0467"
FT                   /old_locus_tag="LSA0467"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54768"
FT                   /db_xref="GOA:Q38YF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YF9"
FT                   /protein_id="CAI54768.1"
FT                   /translation="MGLAIHPFPKHLDLYFMLTALLGALLTIPLVLSTTSKLKRSLAAI
FT                   GLLIALVISLIIGRHSLVWAGTLLAITSLLVLVPFIFPKQFNNHWLRLVCQFLLAPYFF
FT                   LATLIFNGLHFLPEALLVKIGLFLGLIFLFELIPTNKMLTVVGDCLWLITVLLIIATKI
FT                   IVGWQLLPFMIAQLLLLATQLGFIKNNTYLHELYYLIFITGLFL"
FT   regulatory      complement(484983..484996)
FT                   /locus_tag="LCA_0467"
FT                   /old_locus_tag="LSA0467"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      485228..485241
FT                   /gene="metK"
FT                   /locus_tag="LCA_0468"
FT                   /old_locus_tag="LSA0468"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        485247..486446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="LCA_0468"
FT                   /old_locus_tag="LSA0468"
FT                   /product="Methionine adenosyltransferase
FT                   (S-adenosylmethionine synthetase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54769"
FT                   /db_xref="GOA:Q38YF8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YF8"
FT                   /protein_id="CAI54769.1"
FT                   /translation="MQERHLFTSESVSEGHPDKIADQISDAILDAMLEQDPQARVACET
FT                   TVTTGLVLVVGEISTTAYVDIQKVVRETIKKIGYRDGQYGFDGDNCAVIVALDEQSPDI
FT                   AQGVDDSLESREKDEDPLDKIGAGDQGLMFGFAVDQTPELMPLPIALSHRLMRKVAELR
FT                   KSGQLAYLRPDAKAQVTVEYDENEQPKRVDTVVISTQHDEDVTLETIQKDMLEQVIKTV
FT                   IPAEYLDDKTKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATK
FT                   VDRSASYAARYIAKNIVAAGLARKCEVQLAYAIGVAQPVSVSVNTFETGTVSEEAIQTA
FT                   IRENFDLRPAGIIKMLDLQRPIYKQTAAYGHFGRTDVDLSWERLDKVDALKASIAKLNH
FT                   "
FT   regulatory      486524..486537
FT                   /locus_tag="LCA_0469"
FT                   /old_locus_tag="LSA0469"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        486541..488001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0469"
FT                   /old_locus_tag="LSA0469"
FT                   /product="Putative drug:H(+) antiporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54770"
FT                   /db_xref="GOA:Q38YF7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YF7"
FT                   /protein_id="CAI54770.1"
FT                   /translation="MEKRKTNVLLVTIALFVATFMTAIEGTIVSTAMPTIISNLHGMRL
FT                   MNWVFSIYLLTNAMMTPIYGKMADRIGRKPIFIFGLVLFVIGSSLCGLSNHMETLIISR
FT                   AIQGLGAGAIMPVSFTIIADIYPIEKRAKVLGFNGSAWGIASIIAPLLGGFIVDKLTWH
FT                   WIFFINVPIGLITIGLIWYFLQEEKRTSDQPIDYWGSFWLMMALLGLLYGFQLMGETHL
FT                   SGGLLVPALVIAVVAFILFVRVEKKAQDPIISLSLFKNRTFVVQNAVAALVSGFLIGFE
FT                   VYMPMWMQGILGLKASMGGFVVTPSSIMWIFASLWAGQLLVKHAPQRILMGSLAILLGG
FT                   SIVLALVPQTTPFWFFLMVAACLGIGFGMIITTTTVTSQSVAGSDKVGVATSFNTLSRT
FT                   LGQTLMVSVYGIILNRQLAKGISGDSRLNQNMLNELINPETAAKLPQNLLPDLRHILYN
FT                   GLHYIYFASIVLILVAMWINLSDRRQKQ"
FT   regulatory      488007..488026
FT                   /locus_tag="LCA_0469"
FT                   /old_locus_tag="LSA0469"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(488007..488026)
FT                   /locus_tag="LCA_0470"
FT                   /old_locus_tag="LSA0470"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(488035..489060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0470"
FT                   /old_locus_tag="LSA0470"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54771"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YF6"
FT                   /protein_id="CAI54771.1"
FT                   /translation="MTEEVLIGGYTRRIGKGIYRGTLSPETATITDIKPYITLDNASYL
FT                   AISKQQILYTVVKEGEQGGIAAYDISGTTPVYLNAILAAGAPPAYVAVDETRQLIYAAN
FT                   YHKGEILVYAIQNDGHLVLANTVQHTGHGPRPEQASAHVHYTDLTPDNRLAVCDLGTDE
FT                   LTTYTIADNGDLTKTATYHSEPGFGARHLVFHPNHQVAYLLGELSSEVTVLNYDANTGE
FT                   FTAVETYSMLPDDWHEANGGAAIRISQDGQFLYASNRGYNSIVVYRISADGQQLTTIQQ
FT                   MSTDGEFPRDFNLSANDQFLFAVNQNSDNGTLYHRDAQTGLLTPCQKGLETPEGVCVLF
FT                   R"
FT   regulatory      complement(489063..489076)
FT                   /locus_tag="LCA_0470"
FT                   /old_locus_tag="LSA0470"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      489190..489203
FT                   /locus_tag="LCA_0471"
FT                   /old_locus_tag="LSA0471"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        489206..489598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0471"
FT                   /old_locus_tag="LSA0471"
FT                   /product="Putative glucitol/sorbitol phosphotransferase
FT                   system, enzyme IIA"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54772"
FT                   /db_xref="GOA:Q38YF5"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YF5"
FT                   /protein_id="CAI54772.1"
FT                   /translation="MMIMQAEIVAIGAQAIDAAEPLVILFNEQATPAIKAVALIQRFTT
FT                   ANQSERLTMTTQSIVVIDGQHYQVTYVGALVNENLNNIGHVALIFDSAPEEDQLQSGLY
FT                   LTPKDASLQGKPDFKVGTLIQYQETM"
FT   CDS_pept        489614..490753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0472"
FT                   /old_locus_tag="LSA0472"
FT                   /product="Putative transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54773"
FT                   /db_xref="GOA:Q38YF4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YF4"
FT                   /protein_id="CAI54773.1"
FT                   /translation="MADRKQTKEQSWFFKWFLNQKLPVILLNVFLILLIILLATKLAWL
FT                   LEPIQQLMLIVGLPIIIAAVLYYLINPLIDWLEHRWHLNRVLSITLIFIVIVALLAWGV
FT                   ATIIPIIQSQTTSLIKQWPSYWANIQKQTMSWFNDPSFKSLQKQLDDINTDMLSNLSGK
FT                   VNKMLTSTVTHIGTAVGVVTNIVIAIVTMPFILFFMLKDGHRLKGYLVKFFPVRIRETT
FT                   SQVLEEINGQVSQYIRGQLTVAFWVAVMFTIGYWIVGMKYGLTLGILAGLLNLIPYLGS
FT                   FLALVPSVVIAAFISPILLIKVLLVFAVEQTLEGRVVSPLVLGSKMSMYPVTTIIVLLA
FT                   SGKLFGLVGVIVGIPVYAIIKILVTHLFEWFKKVSGLYE"
FT   regulatory      490814..490847
FT                   /locus_tag="LCA_0472"
FT                   /old_locus_tag="LSA0472"
FT                   /regulatory_class="terminator"
FT   regulatory      491038..491051
FT                   /gene="tnpA2-ISLsa2"
FT                   /locus_tag="LCA_0473"
FT                   /old_locus_tag="LSA0473"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        491057..491374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA2-ISLsa2"
FT                   /locus_tag="LCA_0473"
FT                   /old_locus_tag="LSA0473"
FT                   /product="Transposase (orfA) of ISLsa2 (IS150 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54774"
FT                   /db_xref="GOA:Q38YF3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YF3"
FT                   /protein_id="CAI54774.1"
FT                   /translation="MNVLKWMKTNKASYPKTALHFNISNVGTIWQWQHIWETEGADALY
FT                   RSKGRQTIMTADKQSKKRQQTELERLREENELLQIENEYLKKLRALVQEEEDNKRKSSK
FT                   S"
FT   regulatory      491400..491413
FT                   /gene="tnpB2-ISLsa2"
FT                   /locus_tag="LCA_0474"
FT                   /old_locus_tag="LSA0474"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        491416..492228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB2-ISLsa2"
FT                   /locus_tag="LCA_0474"
FT                   /old_locus_tag="LSA0474"
FT                   /product="Transposase (orfB) of ISLsa2 (IS150 family)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54775"
FT                   /db_xref="GOA:Q38X77"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q38X77"
FT                   /protein_id="CAI54775.1"
FT                   /translation="MAKSTYEYIISHEPNGSSDQSVKQAIQTIKKNHPAYGYRRVTGEL
FT                   HRMNILVNHKKVLVLMRELQLLSTAFNKRTRKYNSYRGNVGTVAKNLIHRRFFTDRPYQ
FT                   KLVTDVTEVRWGTKTIDERAYFTCIYDLFSGEILSHQVSRHPTVEFTTTVLNRAVKKIP
FT                   KNLKYRTTVHSDQGFQYQHQDWTNILKEHRIFQSMSRKATCLDNASMESFFHIMKAEAF
FT                   YQKETDTYETLVSQISVWIDDYNFSRIKTKLGCKSPVEYRIFTTQKAA"
FT   regulatory      complement(492172..492216)
FT                   /locus_tag="LCA_0475"
FT                   /old_locus_tag="LSA0475"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(492343..492780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0475"
FT                   /old_locus_tag="LSA0475"
FT                   /product="Putative N-acetyltransferase, GNAT family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54776"
FT                   /db_xref="GOA:Q38YF1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YF1"
FT                   /protein_id="CAI54776.1"
FT                   /translation="MDIKHTLGDNSVIFRDATYIRRTVFVREQNMPETQEIDAHEDHTV
FT                   HYVGYIEQDPAVTARVHVLKDGGFRIQRVATIKSFRGQGLGFKLIEAIIEDAKRTKTPY
FT                   IILFAQDHAIGFYEKLGFEVISEGEMEANIPHHYMKLTINH"
FT   regulatory      complement(492784..492797)
FT                   /locus_tag="LCA_0475"
FT                   /old_locus_tag="LSA0475"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(492904..492922)
FT                   /gene="guaC"
FT                   /locus_tag="LCA_0476"
FT                   /old_locus_tag="LSA0476"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(492944..493921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="LCA_0476"
FT                   /old_locus_tag="LSA0476"
FT                   /product="Guanosine 5'-monophosphate reductase (GMP
FT                   reductase)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="1.7.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54777"
FT                   /db_xref="GOA:Q38YF0"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YF0"
FT                   /protein_id="CAI54777.1"
FT                   /translation="MDVFDYEDVQLIPNKCIVKSRSEIDTTVRFGSETFKIPVVPANMQ
FT                   TIIDEPLAIWLAENHYFYVMHRFQPEKRPAFIKMMHERNLFASISVGVKDDEFDFINQL
FT                   AQDNLIPEYITIDIAHGHSQVVIDMIQHIKKVLPKSFVIAGNVGTPEAVRDLERAGADA
FT                   TKVGIGPGKVCITKIKTGFGTGGWQLGALRWCAKAATKPIIADGGIRTNGDIAKSIRFG
FT                   ANMVMIGSLFAGHTESPGELVEEDGQQFKEYFGSASEFQKGTHQNVEGKRILVPYKGSI
FT                   SDTLTEMRQDLQSSISYAGGKRLSALRKVDYVLVRHSIFNGDML"
FT   regulatory      complement(493924..493937)
FT                   /gene="guaC"
FT                   /locus_tag="LCA_0476"
FT                   /old_locus_tag="LSA0476"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(494022..494054)
FT                   /locus_tag="LCA_0477"
FT                   /old_locus_tag="LSA0477"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(494068..495021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0477"
FT                   /old_locus_tag="LSA0477"
FT                   /product="Putative ion Mg(2+)/Co(2+) transport protein"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54778"
FT                   /db_xref="GOA:Q38YE9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE9"
FT                   /protein_id="CAI54778.1"
FT                   /translation="MLDTYRFDEAKKKLTKHAKIQPNSWINITDPTQEEIDLLTKKLHV
FT                   PSDFIYYSLDADESARAEHDPDYNATLIIFNMPILEKDDQQADKFRYKTSPLGIIVTDS
FT                   VILTINKTPVDFLQSFIDNQIKNFNPQEQRRSVLQILYRISTIYLQYLRDINRSRERIE
FT                   NRLQKSLRNEELYDLMGIQRGLVYFMMSLKTDKMVLASLMRSNMLMLNESEIDLLDDIQ
FT                   IENQQAIEMAEISNSIINETADTYSSIINNNMNNVMKFLASYSIMLTIPGLVFSFYGMN
FT                   VALPLANFKISWIVTIAISLTIAGLLGFRFWRKRYF"
FT   regulatory      complement(495024..495037)
FT                   /locus_tag="LCA_0477"
FT                   /old_locus_tag="LSA0477"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      495094..495107
FT                   /locus_tag="LCA_0478"
FT                   /old_locus_tag="LSA0478"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        495110..495946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0478"
FT                   /old_locus_tag="LSA0478"
FT                   /product="Putative rRNA large subunit methyltransferase A"
FT                   /function="3.6 RNA restriction and modification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54779"
FT                   /db_xref="GOA:Q38YE8"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE8"
FT                   /protein_id="CAI54779.1"
FT                   /translation="MKKIDLAQQFLQANLSALQCPICQGAFATISDHQLVCEVGHSFDL
FT                   AKNGTLYFLPKQMKSEYTKEMLSHRRAFLQAGFFKPFLDEIAKQLTANSRILDVGCGEG
FT                   TPVYQLAQQVPAQYIGFDISKPAIQLASDYNQEGWFCVADLARMPFADQSLDTVLNIFS
FT                   PSQYQEFKRVLKPDGQLIKVIPNAGYLHELRELLYQGQEKESYDHGPVLDLFEQHFPGY
FT                   QEIQVQQKMTLTPETLADLVEMTPLTWTATEAQLQAITLAALPEISLDVTVLVGKQ"
FT   regulatory      496077..496111
FT                   /locus_tag="LCA_0478"
FT                   /old_locus_tag="LSA0478"
FT                   /regulatory_class="terminator"
FT   regulatory      496183..496196
FT                   /locus_tag="LCA_0479"
FT                   /old_locus_tag="LSA0479"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        496199..496708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0479"
FT                   /old_locus_tag="LSA0479"
FT                   /product="Putative rRNA methyltransferase"
FT                   /function="3.6 RNA restriction and modification"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54780"
FT                   /db_xref="GOA:Q38YE7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE7"
FT                   /protein_id="CAI54780.1"
FT                   /translation="MTNHIVLYEPLIPANTGNIARTCAGTDTVLDLIEPLGFETDDKHL
FT                   KRAGLDYWDQVKINYHKNLDAFLETVPDRKHLYLITKFAKQAYSDQDVTDTSVDHYFMF
FT                   GKETTGLPETFMRENEDQCLRIPMSDHIRALNLSNCAALVIFEALRQQDFPGLEKSHLY
FT                   DHDKLK"
FT   CDS_pept        496720..497127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0480"
FT                   /old_locus_tag="LSA0480"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54781"
FT                   /db_xref="InterPro:IPR009530"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE6"
FT                   /protein_id="CAI54781.1"
FT                   /translation="MQTKKDPISVDAFHFDRVSPDAEPQQNIQVSLVKIDADDEYLQEA
FT                   DLKAGNIYQIVTPFQVMPQGSGFAVSGQISRVVQLLDFFGTPDEIEQKEMMKLSRPLIE
FT                   YIETLTYQVTAVALNEGIQLQFTAHETPEEA"
FT   regulatory      497141..497175
FT                   /locus_tag="LCA_0480"
FT                   /old_locus_tag="LSA0480"
FT                   /regulatory_class="terminator"
FT   regulatory      497251..497264
FT                   /gene="ftsK"
FT                   /locus_tag="LCA_0481"
FT                   /old_locus_tag="LSA0481"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        497267..499636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="LCA_0481"
FT                   /old_locus_tag="LSA0481"
FT                   /product="Cell division DNA translocase FtsK"
FT                   /function="1.7 Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54782"
FT                   /db_xref="GOA:Q38YE5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE5"
FT                   /protein_id="CAI54782.1"
FT                   /translation="MATQTKKRKKKTTTKKKKTQQPDYTINFVGFLFILISLFSGLKLG
FT                   FIGALFANVFRLFVGDTFVLGAILFAMLGIYLLIYGKQPPLWQQKTAGFSLAYIGILIW
FT                   LSAFILHQQAINNHFVAATWRLLFEDFQKMAVTTEVGGGLVGAVIYSGSHFLFAQMGTY
FT                   IIAVLVTVMGLFIFMDIPFSVVVKSSQRFVHGLFQVGRYTKSGLVKATEKGRDQVSALK
FT                   EQTQNALSAVDEKTAPTKTAKKPTSEPTGEPEKTGVVVNEPATFKINGPKDLPKPIATH
FT                   QATNEAEATAETPTEQVPDVAELTHAVEIDADYEMPTPELLTQIPPSDQSAEYEAIEKN
FT                   QQVLKQTFDSFGVDVTVKSASLGPAVTKYEIQPAVGVKVSKIVNLADDLALALAAKDIR
FT                   IEAPIPGKPYVGIEVPNTTVSTVSFREMIEQEPPHPGKPLAVPLGKDISGKVIMSDLAK
FT                   MPHLLIAGSTGSGKSVAINGIITSILMSAQPHEVKLMLIDPKMVELNVYNGIPHLLIPV
FT                   VTNAKKAANALNKVVKEMERRYQLFADTGQRNMTEYNQYIQGHNEDGEIKGAALPYIVV
FT                   IVDELSDLMMVASNEVESAIIRLAQMARAAGIHMIVATQRPSVDVITGLIKANIPSRIA
FT                   FAVSSGIDSRTILDGSGAEKLLGRGDMLYLPIGMSKPLRVQGAFISSQDVESIVSFIKA
FT                   QKTAEYDEEMIPTAADEHQETADPEDEYYQEAVELVVKQQTASVSMVQRRFRVGYNRAA
FT                   RLIDEMESRGIIGPSEGSKPRKVLLQEVPSEQPPTE"
FT   regulatory      499648..499681
FT                   /gene="ftsK"
FT                   /locus_tag="LCA_0481"
FT                   /old_locus_tag="LSA0481"
FT                   /regulatory_class="terminator"
FT   regulatory      499818..499831
FT                   /locus_tag="LCA_0482"
FT                   /old_locus_tag="LSA0482"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        499834..501105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0482"
FT                   /old_locus_tag="LSA0482"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54783"
FT                   /db_xref="GOA:Q38YE4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE4"
FT                   /protein_id="CAI54783.1"
FT                   /translation="MNQKVMDGVYLNILQTQQFKTIRFSVQLVAPATKETLTKRSLLAS
FT                   VLSASSQAYRDQVAIANQLQAMYGAGFNMNAYRQGQLAIFSISMRIVSPQYLRDTIDLQ
FT                   QQAIAFIGELLLKPDVIDQAFNAVTFDREKENLQRYIDSVADDKQTYAALKLRELYFTD
FT                   QTQQTPNYGDADVLKTITATDLYTYYQQMIANDRIQMTVVGNVDEEKLALDLAQLSLAP
FT                   RGEMLPGIFYQQAASNAVRELTEEQAVQQGKLNMAYQLPAYFYQKDYYAALVMNALFGG
FT                   TPLSLLFTNVREKASLAYYASSNIDAFRGAVMVQTGIESHQKERVLAIIEAQRQSIIAG
FT                   DFTQAMFEQTKLALINQFKSSLDSPGYLGQQQFNQIFVPETELDAGRFTTAILAVSKQA
FT                   VQEQAAKMQLQAIYFLKGVDTNEA"
FT   CDS_pept        501095..502399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0483"
FT                   /old_locus_tag="LSA0483"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54784"
FT                   /db_xref="GOA:Q38YE3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE3"
FT                   /protein_id="CAI54784.1"
FT                   /translation="MKLRQNPRLGETLYEETLENGLTVKLYPKSGYHKTYAILTTDYGA
FT                   IDTTFVPAGQTDYVTVPDGIAHFLEHKLFEKADYDAFEKFGQFGASSNAFTSFTRTSYL
FT                   FSTTSHLKENLDILLDFVQEPYFTTATVDKEKGIIGQEIQMYNDEPDWRLFYTVIGNLY
FT                   PQHPVRTDIAGTIESIAQITPEELYQAHQTFYQPSNMNLFIVGQIDDPEEVLSWVSANQ
FT                   DAKDFVAPSDINRSLPEEEADGSDIIPYRSLEMPVTRSKSMVGIKGLTDFGTGQEALEM
FT                   KIKMNLLLELLFGDSSTQVQKLYEQGILDDSFGYEYAIQRSFNFITLGGDTDDAQGLSD
FT                   ALINILEHYQESPDFSEANLALVKRAAIGEYLQAFNSLEAIANQYSDAFFDEVSPFDVL
FT                   GLIEQVTLADLAQVAAEFFKIEIMTVCHILSEVAQ"
FT   CDS_pept        502399..503130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0484"
FT                   /old_locus_tag="LSA0484"
FT                   /product="Putative oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54785"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE2"
FT                   /protein_id="CAI54785.1"
FT                   /translation="MSRSALIIGASGDIGTTIAERLAADGWSLYLHYNQNQERIYKLQQ
FT                   QLSQQYARQDFFALQLDLTTGTTAVDQLKKQLFQVDAVIFAAGMTTYGLLPEVSAEQID
FT                   ALWQVHVKTPMLILQALQPKLAQSDLGRIVFIGSIYGGRGSAMEVPYSTVKGAQSAFAN
FT                   AYAQEVGSLGITVNVIAPGAVATKMNQQFTADEQAAIAAEIPTGRFATPTQIAYWVQTL
FT                   LAPEANYLTGQTIYVDGGWLK"
FT   regulatory      503196..503209
FT                   /locus_tag="LCA_0485"
FT                   /old_locus_tag="LSA0485"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        503212..504135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0485"
FT                   /old_locus_tag="LSA0485"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54786"
FT                   /db_xref="GOA:Q38YE1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE1"
FT                   /protein_id="CAI54786.1"
FT                   /translation="MNEIGQKLREARIEKGYTLDDLQQITKIQKRYLSSIEEGDFDALP
FT                   GTFYVRAFIKQYAQTVGVDSEALLAEYQDKLPNAKPEEYVEKSVENQTRLTRETTDSKW
FT                   SKWRGLAPQIAVVAVVIVIVGIVYGITLSNRGKNRETLTETSSSVTVSGDQSTTKKASS
FT                   DDNQQKAQESKAKEASKASEQSKKEADKKAKETKLSASMTSMSGSQQAFTIKNLPNKAN
FT                   TLTFSAENTTAWVGLIVNGSTIWQGSVTPGTDQTTQLPAGVTQFSVKTGNGPATKMKIN
FT                   DTAVNLNPNNETVQVRTVNFTATLAK"
FT   regulatory      504144..504157
FT                   /gene="pgsA"
FT                   /locus_tag="LCA_0486"
FT                   /old_locus_tag="LSA0486"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        504161..504745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="LCA_0486"
FT                   /old_locus_tag="LSA0486"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate3-phospha
FT                   tidyltransferase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54787"
FT                   /db_xref="GOA:Q38YE0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YE0"
FT                   /protein_id="CAI54787.1"
FT                   /translation="MNLPNKLTMFRIILIPIFTILLAFNVPAGEVLVAGTAIPVSELIA
FT                   TVIFIVASLTDLLDGKIARSQHLVTNFGKFADPLADKLLVMTAFIFLVELGAAPAWVVA
FT                   IIIWRELAVTGLRLLLSQGGEVMAAAMPGKIKTTTQMLAIILLFLHNVFFANIGLPMAD
FT                   IMLYVCLFFTIYSGTEYFIKNRGIFKDSFSK"
FT   regulatory      504755..504775
FT                   /gene="pgsA"
FT                   /locus_tag="LCA_0486"
FT                   /old_locus_tag="LSA0486"
FT                   /regulatory_class="terminator"
FT   regulatory      504910..504923
FT                   /gene="recA"
FT                   /locus_tag="LCA_0487"
FT                   /old_locus_tag="LSA0487"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        504928..505995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="LCA_0487"
FT                   /old_locus_tag="LSA0487"
FT                   /product="DNA recombinase A"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54788"
FT                   /db_xref="GOA:Q38YD9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YD9"
FT                   /protein_id="CAI54788.1"
FT                   /translation="MAKDERQAALDAALKKIEKNFGKGSIMRMGEKVDTQVSTVSSGSL
FT                   ALDEALGVGGYPRGRIVEIYGPESSGKTTVALHAVAEVQKQGGTAAYIDAENAMDPKYA
FT                   TALGVNIDDLLLSQPDTGEQGLEIADALVSSGAVDILVVDSVAALVPRAEIEGEMGDAH
FT                   VGLQARLMSQALRKLSGTINKTKTIALFINQIREKVGVMFGNPEVTPGGRALKFYSTVR
FT                   LEVRRAETIKNGTDMIGNRARIKVVKNKVAPPFKVAEVDIMYGQGISRTGELVDMAVEK
FT                   DIINKSGSWYSYGSERIGQGRENAKNYLADHEDVEDEVRLKVRAAYGISDVPEEDLPTT
FT                   EDEQINILPDDSTEE"
FT   regulatory      506007..506045
FT                   /gene="recA"
FT                   /locus_tag="LCA_0487"
FT                   /old_locus_tag="LSA0487"
FT                   /regulatory_class="terminator"
FT   regulatory      506366..506379
FT                   /locus_tag="LCA_0489"
FT                   /old_locus_tag="LSA0489"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        506382..507947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0489"
FT                   /old_locus_tag="LSA0489"
FT                   /product="Putative metal-dependent phosphohydrolase
FT                   precursor"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54789"
FT                   /db_xref="GOA:Q38YD8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YD8"
FT                   /protein_id="CAI54789.1"
FT                   /translation="MNLDLLLILTAVIMLIVGFAVGAILQKKAHEREIDGANKTAKGII
FT                   ELAEKEAATRKKEILLEAKDENHQYRSEIENELKDRRGEVQKQENRLIQREETMDRKDA
FT                   TLDKKERTLEEHESRLAEQAQQLKEKQAEVETLVEQQRTKLQEIAELSHDDAQKIILDE
FT                   TKRNLDHERAVLIKESEESAKEHADRTAKTLVAEAIQRSAADMVAETTVTVVTLPNDDM
FT                   KGRIIGREGRNIRTLETLTGIDLIIDDTPEAVVLSGFDPIRREIARMTLEKLIQDGRIH
FT                   PARIEEMVDKSRKEMDEQIRQIGEQAIFDVGIHTMHPDLIKILGRLHFRTSYGQNVLNH
FT                   SIEVAKLTGILAAELGEDVTLAKRAGLLHDIGKALDHEVDGSHVEIGVELATRYKEPAT
FT                   VINAIGSHHGDIEATSIISVLVAASDAISAARPGARSESLENYIHRLEKLESITNSFKG
FT                   VDHSFAIQAGREVRVIVKPEQVTDDQATVLARDVKNQIEDQLEYPGHIKVTVIRETRTV
FT                   EYAK"
FT   regulatory      507968..507998
FT                   /locus_tag="LCA_0489"
FT                   /old_locus_tag="LSA0489"
FT                   /regulatory_class="terminator"
FT   regulatory      508077..508090
FT                   /gene="tagO"
FT                   /locus_tag="LCA_0490"
FT                   /old_locus_tag="LSA0490"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        508094..509191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagO"
FT                   /locus_tag="LCA_0490"
FT                   /old_locus_tag="LSA0490"
FT                   /product="Undecaprenyl-phosphate N-acetyl-glucosaminyl
FT                   transferase"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54790"
FT                   /db_xref="GOA:Q38YD7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YD7"
FT                   /protein_id="CAI54790.1"
FT                   /translation="MMPMFRIIVGLFATMLVSAAITPLVRRLAFVLGAVDKPNARRVNK
FT                   KAMPSMGGLAIFIAFNVGTFILLRGQFPTHELFSIFLAECIIIITGMIDDIKELSPKEK
FT                   MLGILIAALVIYFLAGVRMNILTIPLVGTFKLGWLSFPITIFWILAITNAVNLIDGLDG
FT                   LATGVSIIALFTMGVIAYFFLSITNVSVSIMIFCLGAALIGFLPHNFHPAKIFLGDTGA
FT                   LFIGFMIAVLSLKGLKNVTFITLLIPVIILGVPITDTVYAMLRRILNRKPISQADKHHL
FT                   HHRLMQLGLSHRQTVLVIYGLALVFSLISLLYPLSTLWGSLVLTIAVLIGLELFVESIG
FT                   LVGENRQPLLHLLKRLLKPKDEEKD"
FT   regulatory      509185..509205
FT                   /gene="tagO"
FT                   /locus_tag="LCA_0490"
FT                   /old_locus_tag="LSA0490"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(509185..509205)
FT                   /locus_tag="LCA_0491"
FT                   /old_locus_tag="LSA0491"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(509218..509883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0491"
FT                   /old_locus_tag="LSA0491"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54791"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YD6"
FT                   /protein_id="CAI54791.1"
FT                   /translation="MESYLTVQADGQFELEIKKSRFICQIARVSDEAAAQDFIDQVRKT
FT                   HTKANHNCFAYQLGQPANIQKQSDDGEPSGTAGVPILEVLRQMQLTNLCVVVTRYFGGT
FT                   KLGTGGLIRAYSHATSAALEHLGIVQGIEQTACQLTIDYAQFDSLQNRLAQLALTAQDI
FT                   QYTTNIQLTVWLPTEEVPAFEAQMTELLNGQLTLGLGQQQFNEVPISAQAIHDLRYQK"
FT   regulatory      complement(509887..509900)
FT                   /locus_tag="LCA_0491"
FT                   /old_locus_tag="LSA0491"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      509929..509942
FT                   /locus_tag="LCA_0492"
FT                   /old_locus_tag="LSA0492"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        509945..511282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0492"
FT                   /old_locus_tag="LSA0492"
FT                   /product="Putative bacterial type II secretion/competence
FT                   system, ATP-dependent DNA helicase ComFA-like"
FT                   /function="1.10 Transformation/competence"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54792"
FT                   /db_xref="GOA:Q38YD5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YD5"
FT                   /protein_id="CAI54792.1"
FT                   /translation="MGQQVIACGRQFTAAQLADTQNNNYSLPQIKRRPAFLRVKHRLVC
FT                   QRCQQVVPPQTCLPDGRHYCAQCLLFGRLVEGDWLYTVPECHLFENNIPKLTWEGQLTP
FT                   HQEKAAQAVVEVVQTQKRHVLTAVTGAGKTEMLFQGILVALQKGQRVCLAAPRVAVCLE
FT                   LYPRLQAAFATTSIMLMHGEQTEPYRYTQLVICTTHQLLKFYHAFDTVIVDEVDAFPFV
FT                   DNPVLATAVEQACKPQCALLYLTATPTPAIKRAIAAKQMTVSELPLRFHGHLLPEPQRH
FT                   VAFNWRAQLKKGRLPKRLERDCQTYLKTQQILLFVPQVRLLQPVANRLSTLLPAVRIET
FT                   LHANDPDQIKKITAFRAQQIQLMVTTTILERGVTFKNVAVLVLGAEHMVFNEAVLVQIA
FT                   GRAGRHKDYAQNPVHFYYQDYTRAIKGACRQIKTQNQRGRRLQSTV"
FT   CDS_pept        511282..511953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0493"
FT                   /old_locus_tag="LSA0493"
FT                   /product="Putative bacterial type II secretion/competence
FT                   system, protein ComFC-like"
FT                   /function="1.10 Transformation/competence"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54793"
FT                   /db_xref="GOA:Q38YD4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YD4"
FT                   /protein_id="CAI54793.1"
FT                   /translation="MCHNLIIEKPSIKQLLQLKPLLNPHICQVCLQQFERISGHRCSDC
FT                   SRSLLTGILCPDCQQWRQRYPQQHLKTQALFTYNRAMQLYFQRYKGQGDYQLRLLFERD
FT                   IRTRFPVKPNVTYVPIPSDEQHQQERGFNPVQGLFETCFPLTSLLKKRPTEKGQAQKNR
FT                   AERLASPQFFELIPQELPYKPQSIIILDDIYTTGRTVWHAQQCLRANYPQATINAITLA
FT                   R"
FT   regulatory      512063..512076
FT                   /locus_tag="LCA_0494"
FT                   /old_locus_tag="LSA0494"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        512080..512625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0494"
FT                   /old_locus_tag="LSA0494"
FT                   /product="30S ribosomal interface protein S30EA"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54794"
FT                   /db_xref="GOA:Q38YD3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YD3"
FT                   /protein_id="CAI54794.1"
FT                   /translation="MLSFNVRGENIEVTEAIRSYVEKKISKLEKYFDESATATAHVNLK
FT                   VYPDKTAKVEVTIPLPYLVLRAEETSPDMYGSVDLVTDKLERQIRKYKTKINRKSRERG
FT                   IKGVELVVSSEETLPEEPMQVVRTKRVSLKPMDSEEAILQMNMLGHEFFIFEDSETNGT
FT                   SIVYKRQDGRYGLIETDE"
FT   regulatory      512650..512687
FT                   /locus_tag="LCA_0494"
FT                   /old_locus_tag="LSA0494"
FT                   /regulatory_class="terminator"
FT   regulatory      512855..512868
FT                   /gene="secA"
FT                   /locus_tag="LCA_0495"
FT                   /old_locus_tag="LSA0495"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        512874..515237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="LCA_0495"
FT                   /old_locus_tag="LSA0495"
FT                   /product="Preprotein translocase SecA subunit"
FT                   /function="1.6 Protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54795"
FT                   /db_xref="GOA:Q38YD2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YD2"
FT                   /protein_id="CAI54795.1"
FT                   /translation="MANFLKSWVESDKREVGRMGKIADKVQSYEDEYSNLSDEALQAKT
FT                   PEFKTRLANGETLDDILPEAFAVAREGAKRVLGLFPFRVQIIGGITLHEGNIAEMKTGE
FT                   GKTLTATMPVYLNALAGQGVHVVTVNEYLSSRDATEMGELYNWLGLSVGLNLNAKTPEE
FT                   KRDAYNSDITYSTNSELGFDYLRDNMVVYKEEMVQRPLNFAIVDEVDSILIDEARTPLI
FT                   ISGQAEKSTALYIRADRFVKTLKEDADYKIDWPTKTISLTEAGIGKAEANFGLDNLYDI
FT                   ENTALTHHLDESLRANFIMLKDIDYVVQDGEVLIVDQFTGRVMDGRRYSDGLHQAIEAK
FT                   EGVEIQDETKTMANITYQNYFRMYNKLSGMTGTAKTEEEEFREIYNMEVISIPTNRPIA
FT                   RNDKSDVLYPTLESKFHAVVKDIKSRYEKGQPTLVGTVAVESSELLSRLLDENNVPHAV
FT                   LNAKNHFKEAEIIMNAGQRGAVTIATNMAGRGTDIKLGPGVTDLGGLAVIGTERHESRR
FT                   IDNQLRGRAGRQGDPGETQFYMSLEDDLMKRFGSERIKAFLDRMKISDDDAVIQSKMIT
FT                   RQVEAAQKRVEGNNYDTRKQTLQYDDVMREQREVIYKQRMQVIMAEDNLKEVIMPMISR
FT                   TVKRIVQLHTQGDTADWNLEAIHDFATTSMVSEEQLTLEKLQGKSAEEIEALLMTFAEK
FT                   NYATKQKQLSDENQMLEFEKVVILRVVDERWTDHIDAMDQLRNSIGLRGYGQMNPLVEY
FT                   QEEGYRMFEEMISDIDYDTTRLFMKAEIRQNIRR"
FT   regulatory      515246..515269
FT                   /gene="secA"
FT                   /locus_tag="LCA_0495"
FT                   /old_locus_tag="LSA0495"
FT                   /regulatory_class="terminator"
FT   regulatory      515409..515422
FT                   /gene="prfB"
FT                   /locus_tag="LCA_0496"
FT                   /old_locus_tag="LSA0496"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        515425..516423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="LCA_0496"
FT                   /old_locus_tag="LSA0496"
FT                   /product="Peptide chain release factor 2"
FT                   /function="3.7.5 Translation termination"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54796"
FT                   /db_xref="GOA:Q38YD1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YD1"
FT                   /protein_id="CAI54796.1"
FT                   /translation="MGDPDFWNDQQSAQQLIDQNNVLKEKYDSFNQLQAQFEELSVTLE
FT                   LLQEEPDDELQASFEADLEQIQSQMRQYELGQLLSGEYDSNNAIVELHPGAGGTESQDW
FT                   GAMLLRMYLRWADAHGFTVETEDYQAGEEAGIKSVTLMIKGHNAYGLLRSEKGVHRLVR
FT                   ISPFDSAGRRHTSFCSVDVMPELDGSIDIEVRTEDLRVDVFRSSGAGGQHINKTSSAVR
FT                   LTHLPTGIVVSSQAQRSQLQNRETAMNMLKAKLYQKEQEEQAKKAAAIKGEQLEIGWGS
FT                   QIRSYVFHPYTMVKDHRTNYETGNGQAVMDGDLDPFMYAYLQWQLSQKNPN"
FT   regulatory      516536..516549
FT                   /gene="ftsE"
FT                   /locus_tag="LCA_0497"
FT                   /old_locus_tag="LSA0497"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        516554..517240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="LCA_0497"
FT                   /old_locus_tag="LSA0497"
FT                   /product="Cell-division associated ABC transporter, ATP
FT                   binding FtsE subunit"
FT                   /function="1.7 Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54797"
FT                   /db_xref="GOA:Q38YD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YD0"
FT                   /protein_id="CAI54797.1"
FT                   /translation="MIRMTNVSKEYPNGVTAIKDLSVTIDAGEFAYIVGPSGAGKSTFI
FT                   KMLYHQLKATSGEIEVAGFDLVNMKDREVPYLRRKVGVVFQDFKLLPRLTVFENVAYAM
FT                   EVIEAEPEVIQKRVLEVLELVGLKAKNDRFPNELSGGEQQRVAVARAIVNYPEVLIADE
FT                   PTGNLDPETSEGIMDILEAINNKETIVLMATHNRQMVNERTHRVLAIEDGRLVRDEKEG
FT                   EYGYED"
FT   CDS_pept        517206..518117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="LCA_0498"
FT                   /old_locus_tag="LSA0498"
FT                   /product="Cell-division associated ABC transporter,
FT                   membrane FtsX subunit"
FT                   /function="1.7 Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54798"
FT                   /db_xref="GOA:Q38YC9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC9"
FT                   /protein_id="CAI54798.1"
FT                   /translation="MKKKVSMAMKIRTLKRHLNDSFKSLKRNGWMSVAAVSAVTVTLLL
FT                   VGVVFAMIFNFNKISNDIENDVHVRVMVERGTANDQKNQLEKKLKKMASVKKVTYSSRK
FT                   KELNKVVGSYGQSFKMFTGDDNPLYDVYMVSTTNPNKTIGVAKKAKKLAHVYDATYGGN
FT                   NAKKLFSVMKNIRKWGLGFAALLLFVAVFLISNTIRITILSRRDEIGIMRLVGATNAYI
FT                   RWPFLFEGAWTGLLGVIVPVIVIDFGYVWVYNHMALSMASAGYSLLRPGMFLFQLDLTM
FT                   AILGIVIGALGSVVSMRRFLKI"
FT   regulatory      518144..518171
FT                   /gene="ftsX"
FT                   /locus_tag="LCA_0498"
FT                   /old_locus_tag="LSA0498"
FT                   /regulatory_class="terminator"
FT   regulatory      518293..518306
FT                   /locus_tag="LCA_0499"
FT                   /old_locus_tag="LSA0499"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        518311..519444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0499"
FT                   /old_locus_tag="LSA0499"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54799"
FT                   /db_xref="GOA:Q38YC8"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC8"
FT                   /protein_id="CAI54799.1"
FT                   /translation="MEMFVNMLLTFFTTPLLWVAIVFAFWLALHRIKHERQTFRIAVNP
FT                   KWPELKLFWWHGLLAGLALSCCTLLLGVTINLNWWLVYQIVAVVALFLMPIGFAGNVLI
FT                   LLSALLYLISAMIWPQYQILAGNSLLAELLIVAGLITILTGFLQKWDATKVVTPHVITS
FT                   SRGRMTAMFTSRQIYLAPVFFLVPGTNQLPDWGFWPVLHIGQQSFNIVILPLILGFSVK
FT                   AIKELMSALVTRDLRTQITFGGVIVVAGIVSFIFPRIILSTLSVALIICFILQWRLRRQ
FT                   SRANKQHFTKPYAGIRILGVLEQTPAAKMGLEAGDVIVECNGQAISNNENFYQAIQSHS
FT                   TYCHLKVQDLQGEYRITESAVFADAPHELGVILFPEN"
FT   regulatory      519446..519459
FT                   /locus_tag="LCA_0500"
FT                   /old_locus_tag="LSA0500"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        519464..520177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0500"
FT                   /old_locus_tag="LSA0500"
FT                   /product="Two-component system, response regulator
FT                   (possibly involved in phosphate regulation)"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54800"
FT                   /db_xref="GOA:Q38YC7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC7"
FT                   /protein_id="CAI54800.1"
FT                   /translation="MKTILVVDDEPAILTLLRYNLEQEHFKVMTATDGAQALTMALQQK
FT                   FDFIILDLMLPKLDGIAVTKKIREAKLKTPIMILTAKDNETDKIVGLEVGADDYVTKPF
FT                   SPREIIARIRAIERRTTQPIEQPVEQASETIVVGDLSVDETEVIAKKGDHKLHLTPKEF
FT                   ELLVYFMHRLNKVQSREKLLNAVWGFDYPAETRMVDIQVSHLREKIEDNPRHPVYLKTV
FT                   RGFGYQLEDPAHDQA"
FT   CDS_pept        520164..521825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0501"
FT                   /old_locus_tag="LSA0501"
FT                   /product="Two-component system, sensor histidine kinase
FT                   (possibly involved in phosphate regulation)"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54801"
FT                   /db_xref="GOA:Q38YC6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC6"
FT                   /protein_id="CAI54801.1"
FT                   /translation="MTKHDQVRFYKLATILVAIYIAFILLINLVIYRQQSATLKERRAD
FT                   YALIVKDADFKRQKWLQQNKLQVVTSQSPQHTKLERSVADVLNRDHTTRNFSVRQKIDG
FT                   RWYLVAVHQSSQPTFVLLMPQQRFWHTWPEIALTVTVLYLLFSLIVLWQFKRQRSHFYE
FT                   HLKILVANIHHIRYEETPEPIIFQKDASLYVLAHEVNQLNKDMRHMRQKIAIQQGSFDR
FT                   LIDHLPVGVMVINENRQVVLHNEAMGQLLETAIEPQKHPYIDDIKTYELTRMIEHTFRY
FT                   RRSHHQEIQLIQNRERFVDANVVQLNTVKSKFQALVILYDLTDIRRVEQMQLDFVSNVS
FT                   HELKTPVTAITGFAETLLAGAKDDPETLQQFLKIIYEESTRLTALIQDILALSHLDRQD
FT                   QTQAQDIGLKAIVEANLELMQQKIQQKEIHVSVNIPETLTFKTQKMKLNQVLKNLIANG
FT                   ITYNKQAGSLVIAAQVDHQQLIIRVVDSGLGIPSDLQERIFERFYRVDQARATHKSGTG
FT                   LGLAIAKEITESIGGQLTVESQLGVGSQFILTFPLT"
FT   regulatory      521903..521916
FT                   /gene="pstS"
FT                   /locus_tag="LCA_0502"
FT                   /old_locus_tag="LSA0502"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        521918..522778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="LCA_0502"
FT                   /old_locus_tag="LSA0502"
FT                   /product="Phosphate ABC transporter, substrate-binding
FT                   lipoprotein precursor"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54802"
FT                   /db_xref="GOA:Q38YC5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC5"
FT                   /protein_id="CAI54802.1"
FT                   /translation="MRKRSVIGLLVTFVVLLLTGCQSKQNGQSVTAVGSSALQPLIEAL
FT                   AEQYSAQHSGQFINVQGGGSGTGLSQIQEGAVQMGNSDLFAEEKAGIKAGKLVDHKVAV
FT                   VGITPVINKKIGVKNLSLTQLAKIFSGEITNWQQVGGPDQEVVLVNRAQGSGTRSTFEQ
FT                   WVMGNRKTKPAQEQDSTGMVRSIVANTPGAISYLAFSYVDNTVATLKLDGVAPDDQNVM
FT                   NNTWPIWSYEHVYTKGQPTGLTKEFLAYVLSDKIQNKQVSKMGYIPVAQMQVERSLDGT
FT                   ITKVK"
FT   CDS_pept        522788..523711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="LCA_0503"
FT                   /old_locus_tag="LSA0503"
FT                   /product="Phosphate ABC transporter, membrane-spanning
FT                   subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54803"
FT                   /db_xref="GOA:Q38YC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC4"
FT                   /protein_id="CAI54803.1"
FT                   /translation="MDPIKASLLKKSRAAKTESRGKLISLLCISLIVFIVLAIFYFVAS
FT                   KGLATFFKDKVSLWRFLTQSDWNPSLKDSHGRPEVGALPMIMGSFGVTFLAALLATPFA
FT                   IGAGIFMTEISPKRGEKILQPVMELLVGIPSVVYGFIGLSVVVPTMRHIFGGSGFGILA
FT                   GTCVLFIMILPTVTSMTVDALKSVPRHYREASLALGATRWQTTWKVVLKAATPGILTGV
FT                   VFGMARAFGEALAVQMVIGNAALMPHNLISPASTLTSVLTMGIGNTVMGSLANNALWSL
FT                   ALLLLLMSLLFNLLVRLIGRKGAMGR"
FT   CDS_pept        523711..524595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsA"
FT                   /locus_tag="LCA_0504"
FT                   /old_locus_tag="LSA0504"
FT                   /product="Phosphate ABC transporter, membrane-spanning
FT                   subunit"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54804"
FT                   /db_xref="GOA:Q38YC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC3"
FT                   /protein_id="CAI54804.1"
FT                   /translation="MDAKKWDKVATCVLTLIAGLIVLLLASLLGYILIRGLPHVTWQFL
FT                   TNPASTFTKGGGIGVQLFNSFYLLVIAMVISVPLSIGAGIYLAEYAPKNWVTNVVRTAI
FT                   EVLSSLPSVVVGLFGFLVFVIQFKLGFSILAGALALTVFNLPLLTRNVEDALKSIHFTQ
FT                   REAGLALGLSRYETVKHVIIPEALPNIITGMILGAGRIFGEAAALIYTAGQSAPSLDFT
FT                   NWNPTYIASPLNPMRPAETLAVHIWKINSEGIMPDATAVSAGASAVLIIAVLLFNWLAR
FT                   VIGKRVYRKMTAA"
FT   CDS_pept        524605..525414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB1"
FT                   /locus_tag="LCA_0505"
FT                   /old_locus_tag="LSA0505"
FT                   /product="Phosphate ABC transporter, ATP-binding subunit 1"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54805"
FT                   /db_xref="GOA:Q38YC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YC2"
FT                   /protein_id="CAI54805.1"
FT                   /translation="MADYDLTKTHIKKLAEPKHEIALSTEDLNVYYGDKRAMHDASLQF
FT                   ERYRITALIGASGSGKSTYLRSLNRMNDNIANTRVTGKIMYRDVDINSDEVDVYKMREH
FT                   IGMVFQRPNPFAKSIYDNITFALKQHGQKDKKYLDEIVETTLKQAALWDQVKDSLNKSA
FT                   LALSGGQQQRLCIARAIAMKPDILLMDEPASALDPISTNTVEETLIRLKEQYTIVIVTH
FT                   NMQQAARISDYTAFFHSGHALEFDETRKMFTRPKIKAAEDYVSGHFG"
FT   regulatory      525418..525431
FT                   /gene="pstB2"
FT                   /locus_tag="LCA_0506"
FT                   /old_locus_tag="LSA0506"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        525435..526193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB2"
FT                   /locus_tag="LCA_0506"
FT                   /old_locus_tag="LSA0506"
FT                   /product="Phosphate ABC transporter, ATP-binding subunit 2"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54806"
FT                   /db_xref="GOA:Q38YC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YC1"
FT                   /protein_id="CAI54806.1"
FT                   /translation="MANKIIESSDVHLFYGKNEALKGINMDFAENEITALIGPSGCGKS
FT                   TYLRCLNRMNDLIDSATVTGKFLLNGQDIYAPEMDTVKLRKEVGMVFQQPNPFPFSIYD
FT                   NVVYGLRLSGVKDHRVLDEAVETSLKQAAVWDDVKDKLHESALSLSGGQQQRVCIARVL
FT                   AVKPKVILMDEPTSALDPISSTKIENMLLELRQQYTIIMVTHNMHQASRISDKTAFFLQ
FT                   GELIEYAPTKKIFLNPTEKETEDYISGRFG"
FT   regulatory      526195..526208
FT                   /locus_tag="LCA_0507"
FT                   /old_locus_tag="LSA0507"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        526210..526887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0507"
FT                   /old_locus_tag="LSA0507"
FT                   /product="Putative phosphate transport system regulatory
FT                   protein"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54807"
FT                   /db_xref="GOA:Q38YC0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YC0"
FT                   /protein_id="CAI54807.1"
FT                   /translation="MRRLFEDELNELHVRFSEMGMMVNEAIYKSVKAFINHDKQLAREV
FT                   IADDHKINERETDLERKSFELIALQQPVSTDLRIIVTIMKASSDLERMGDHAVSIAKST
FT                   IRVKGNTRVPDIEKDIADMADKVKQMVEEVLDAYVKEDRRRAIAIAEEDTAINAYSENI
FT                   YDDCVKEMQRDSETVVGSMDYMLVASYLERIGDYVTNICEWIVYLRTGKVVELNSNDKE
FT                   DEF"
FT   regulatory      527085..527098
FT                   /locus_tag="LCA_0508"
FT                   /old_locus_tag="LSA0508"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        527101..527571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0508"
FT                   /old_locus_tag="LSA0508"
FT                   /product="Putative nucleoside deoxyribosyltransferase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="2.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54808"
FT                   /db_xref="GOA:Q38YB9"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB9"
FT                   /protein_id="CAI54808.1"
FT                   /translation="MQKQIYLAGGWFTPKQADMVARAHKALAANPTVGYIHSPQEHQYK
FT                   DVTEDNDPNGLFGGYEWANQTYQNDITAMDLADMAVVLWDMADEDTGTAFEVGYLNASH
FT                   TPIVFVCEDDLQENPINLMLAKGISKCVTDINELETLDFQFVAGEPYPGKII"
FT   regulatory      527596..527624
FT                   /locus_tag="LCA_0508"
FT                   /old_locus_tag="LSA0508"
FT                   /regulatory_class="terminator"
FT   regulatory      527746..527759
FT                   /gene="kbl"
FT                   /locus_tag="LCA_0509"
FT                   /old_locus_tag="LSA0509"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        527761..528948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="LCA_0509"
FT                   /old_locus_tag="LSA0509"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase (Glycine
FT                   acetyltransferase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54809"
FT                   /db_xref="GOA:Q38YB8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB8"
FT                   /protein_id="CAI54809.1"
FT                   /translation="MTKTLEAFLHEGLASLKEQGLYNTIDVLEAHNGPIIKINGRELIN
FT                   LASNNYLGFANRDELKAADQAATQKWGVGAGAVRPINGTLQIHQDLEAKIAEFKGTEAA
FT                   IAFQSGFNCNMGAISAVMTKNDAILSDELNHASIIDGCRLSGAKIIRIKHQDMADLEEK
FT                   AKAATESGLYEKVMYITDGVFSMDGDVANLPEAVKIAEKYQLITYVDDAHGSGVMGHGK
FT                   GTVKHFGLQDKIDFQMGTLSKAIGVVGGYVAGTQELIDWLKVRGRPFLFSTSLTPGSVA
FT                   ACITALDLIMAHPEYVDQLWENADYFKAKLKAVGFKVAKSETPITPVILGDEQLTQKFS
FT                   QALVANGVYAKPIVFPTVPLGTGRIRNMPSATHTKAMLDEAVTVYEKVGRELGII"
FT   regulatory      528952..528965
FT                   /locus_tag="LCA_0510"
FT                   /old_locus_tag="LSA0510"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        528968..529231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0510"
FT                   /old_locus_tag="LSA0510"
FT                   /product="L-threonine dehydrogenase (N-terminal fragment),
FT                   authentic frameshift"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54810"
FT                   /db_xref="GOA:Q38YB7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB7"
FT                   /protein_id="CAI54810.1"
FT                   /translation="MHKVMVTGCLGQIGSELVTQLRAQNGVDSVIATDIRRPDHNETVE
FT                   SGPFEVLDVTDYDRMLKIATDYQVDTLIHLAALLSAVAEERP"
FT   CDS_pept        529250..529915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0511"
FT                   /old_locus_tag="LSA0511"
FT                   /product="L-threonine dehydrogenase (C-terminal fragment),
FT                   authentic frameshift"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54811"
FT                   /db_xref="GOA:Q38YB6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB6"
FT                   /protein_id="CAI54811.1"
FT                   /translation="MTGLVNALEVARELDLKFFTPSSIGAFGPSTPKDNTPQDTIQRPT
FT                   TMYGVTKVSGELLCDYYHTKYGVDTRGVRFPGLISYKTLPGGGTTDYAVDIYYEALRKG
FT                   YYESFIKEGTYMDMMYMPDAIGAIIKLINADPERLIHRNAFNITAMSFEPEQIKAAIQK
FT                   ELPDFEMTYAVDSARQAIADSWPNQIDASCAKAEWDFEPQYDLEAMTKDMLAQLKTRI"
FT   regulatory      529927..529949
FT                   /locus_tag="LCA_0511"
FT                   /old_locus_tag="LSA0511"
FT                   /regulatory_class="terminator"
FT   regulatory      530085..530098
FT                   /locus_tag="LCA_0512"
FT                   /old_locus_tag="LSA0512"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        530102..531577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0512"
FT                   /old_locus_tag="LSA0512"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54812"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB5"
FT                   /protein_id="CAI54812.1"
FT                   /translation="MNERQRILDLVNQGVLTSSEALILLENLAKNDQNTTKMSAEPEVP
FT                   DVDDNEQESAPETDQRAIVEERARELTIALSGVNRQLQDLKQKIQADQEQVTVLDTMED
FT                   LDSLTSEKAAERQALKTAVLQNQAQIDDLEEQRQTLTEELNQIEKQRRQMAKNQWSEKL
FT                   GLSDDWKENASETFDEISGRLGEASLHLGKLMKETAKNVMDNIDWKEVNFKVPGLATEK
FT                   FTHEFIYSDVTPEMINVKVANGNVDFKIWDQPEIKVVAQVKLYGKMGEPTAREAFEARS
FT                   NINVTDADLVFQVPNKRIQADLTFYLPANNYLQTNVKLLNGDIALDGFTGRDLYLKTSN
FT                   GQLTLNSTDVAMLEAENVNGGITVTDGHYEDILGTTVNGNIVMKAQVLNSSVSTVNGDI
FT                   KASFNDNQLQHLKAKSVNGTVKLALPQTIGFTLEARTRFGMIKNRLANAQTVDQHQSTG
FT                   SQMLQLARNEDMQAAQLTLGTTTGNILLKDNEN"
FT   regulatory      531586..531599
FT                   /locus_tag="LCA_0513"
FT                   /old_locus_tag="LSA0513"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        531605..531841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0513"
FT                   /old_locus_tag="LSA0513"
FT                   /product="Putative stress-responsive transcriptional
FT                   regulator"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54813"
FT                   /db_xref="GOA:Q38YB4"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB4"
FT                   /protein_id="CAI54813.1"
FT                   /translation="MAQKRLYKSRDNRMISGVMGGIAEYFNVDATLVRVLYCLFSFFSA
FT                   AFPGIVVYIILALVIPERPSQTRRDSHDEWSEY"
FT   CDS_pept        531841..532113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0514"
FT                   /old_locus_tag="LSA0514"
FT                   /product="Hypothetical small extracellular protein
FT                   precursor"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54814"
FT                   /db_xref="GOA:Q38YB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB3"
FT                   /protein_id="CAI54814.1"
FT                   /translation="MPFLLILVPILAIILAITVMGVLIGSVMILFKFAIPLLVIWLIYR
FT                   LIVGHNKPRHHYHEQHQAYYSQPSDSRGRKEARDVKVDDDNWSDF"
FT   CDS_pept        532113..532487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0515"
FT                   /old_locus_tag="LSA0515"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54815"
FT                   /db_xref="GOA:Q38YB2"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YB2"
FT                   /protein_id="CAI54815.1"
FT                   /translation="MRYWTRVLVNTILFIAISGLLPGLFHVDGILVALVASIVLSILNV
FT                   LVKPILHILSFPITFLTLGLFSLVINGIMLELTSIFVSSGSTFPNVTFGFSGLGAAIVV
FT                   AFILSIANTIIGNQFSRECY"
FT   regulatory      532495..532521
FT                   /locus_tag="LCA_0515"
FT                   /old_locus_tag="LSA0515"
FT                   /regulatory_class="terminator"
FT   regulatory      532609..532622
FT                   /gene="hprK"
FT                   /locus_tag="LCA_0516"
FT                   /old_locus_tag="LSA0516"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        532625..533566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="LCA_0516"
FT                   /old_locus_tag="LSA0516"
FT                   /product="Hpr kinase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54816"
FT                   /db_xref="GOA:Q38YB1"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YB1"
FT                   /protein_id="CAI54816.1"
FT                   /translation="MADSVSMERLVTDLKLQVYSGEAHLKEKIVTLSDISRPGLELTGY
FT                   FNYYPYERIQLFGMTEVSFTQNMTAEERLMIMRRMASENTPCFLISRSLEPPKEMLQAA
FT                   EESGIPVLGSNLSTTRLSSLVTDYLDGQLAERRSMHGVLVDIYGLGVLITGDSGVGKSE
FT                   TALELVKRGHRLIADDRVDVYQQDERTVVGEAPMILRHLLEIRGIGIIDVMNLFGAGAV
FT                   RADTSISLIVHLQNWSQDKKYDRLGSDTEEQMIFDVPVPKITVPVKVGRNLAIIIEVAA
FT                   MNFRAKSMGYDATKTFEANLGKLIESNSDDEN"
FT   regulatory      533607..533653
FT                   /gene="hprK"
FT                   /locus_tag="LCA_0516"
FT                   /old_locus_tag="LSA0516"
FT                   /regulatory_class="terminator"
FT   regulatory      533669..533682
FT                   /gene="lgt"
FT                   /locus_tag="LCA_0517"
FT                   /old_locus_tag="LSA0517"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        533685..534521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="LCA_0517"
FT                   /old_locus_tag="LSA0517"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /function="1.6 Protein secretion"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54817"
FT                   /db_xref="GOA:Q38YB0"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YB0"
FT                   /protein_id="CAI54817.1"
FT                   /translation="MNLILGVLNPIALQLGPLAIHWYGVIIASGVVLAVVLALREAKRR
FT                   NVGEDDILNLILWALPFALIGARLYYVIFEWSYYQANPSEIIKIWHGGIAIYGGLIAAT
FT                   IVFIIYCRKHFLSPWLVLDIAAPTVMIAQAIGRWGNFMNQEAFGAKTTLHFLQTLHLPN
FT                   WVTDQMLIDGAYRQPTFLYESTWNVLGFIIIMSVRHRQGWFKQGEILLSYIAWYAFGRF
FT                   FVEGMRTDSLFIGPLRVSQILSLVLFFGAMGLWIWRRKQQTLPDYLEGNTLRSAVK"
FT   CDS_pept        534539..535561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gps"
FT                   /locus_tag="LCA_0518"
FT                   /old_locus_tag="LSA0518"
FT                   /product="[NAD(P)+]-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54818"
FT                   /db_xref="GOA:Q38YA9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YA9"
FT                   /protein_id="CAI54818.1"
FT                   /translation="MTVNVAVLGAGSWGTILANLLVENGHHVELWGNDPEKVAEINEQH
FT                   TNKHYLPEFKIDSRLHATLDLNEAFEAVDVVLFVIPTQVIRLVAEQIAPVLEAKGVKPV
FT                   IVTASKGLEQGSHKRISEVLTETIPADIRNGIVVLSGPSHAEDVAMKDITTLTAASTDL
FT                   VQAQWIQEIFMNDYFRLYTNTDVIGVEMGAALKNVIALGAGALHGLGYGDNTKAALMTR
FT                   GLAEISRLGVAMGANPLTFIGLSGVGDLIVTGTSVHSRNWRTGNALGEGQKLDDVLENM
FT                   GMVVEGVATCKAAYELAQQRSVDMPITNAIYNVLYRGCDIRTEIGNLMQRSGKPEIDFK
FT                   "
FT   regulatory      535659..535672
FT                   /locus_tag="LCA_0519"
FT                   /old_locus_tag="LSA0519"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        535680..536081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0519"
FT                   /old_locus_tag="LSA0519"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54819"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YA8"
FT                   /protein_id="CAI54819.1"
FT                   /translation="MGDLVSVRPTCEFYFDRGMQAFERFHYEKALTCLQRSKSLAKTKD
FT                   DYIFVVCQLAICLESVGNYRGAVIALEEIPSVNYQTHPELQYFLATAYAFLGQMQESYQ
FT                   LAKAYLQSDDADFEAEATELLQELKQIKG"
FT   regulatory      536097..536127
FT                   /locus_tag="LCA_0519"
FT                   /old_locus_tag="LSA0519"
FT                   /regulatory_class="terminator"
FT   regulatory      536180..536193
FT                   /gene="trxB2"
FT                   /locus_tag="LCA_0520"
FT                   /old_locus_tag="LSA0520"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        536198..537118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB2"
FT                   /locus_tag="LCA_0520"
FT                   /old_locus_tag="LSA0520"
FT                   /product="Thioredoxin reductase"
FT                   /function="4.6 Miscellaneous"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54820"
FT                   /db_xref="GOA:Q38YA7"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YA7"
FT                   /protein_id="CAI54820.1"
FT                   /translation="MAKSYDVIVIGAGPGGMTAALYASRSNLSVLMLDRGIYGGQMNNT
FT                   AEVENYPGFKSILGPELGEKMYASATQFGAEYGYGTVNSIEDKGEFKLVHTDEGDFQAR
FT                   AVIIATGSEHKKVGIPGEDEYGGRGVSYCAVCDGAFFKNKEVVVIGGGDSAIEEGLYLT
FT                   QLASKVTVIHRRDQLRAQKILQDRAFVNDKMAFVWNAQVKTIEGDDKKVAAVTYVDKES
FT                   GETKGVPASGVFIYVGIDPMTSAFKDLGILTEAGWVKTDDHMATSVPGIFAIGDVREKD
FT                   LRQITTAVGDGGIAGQEVFKYIQSI"
FT   regulatory      537149..537177
FT                   /gene="trxB2"
FT                   /locus_tag="LCA_0520"
FT                   /old_locus_tag="LSA0520"
FT                   /regulatory_class="terminator"
FT   regulatory      537258..537271
FT                   /gene="pgm"
FT                   /locus_tag="LCA_0521"
FT                   /old_locus_tag="LSA0521"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        537274..538998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="LCA_0521"
FT                   /old_locus_tag="LSA0521"
FT                   /product="Phosphoglucomutase"
FT                   /function="2.1.2 glycolytic pathway"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54821"
FT                   /db_xref="GOA:Q38YA6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YA6"
FT                   /protein_id="CAI54821.1"
FT                   /translation="MSWQDNYAIWNNQTKMDLPLREALDNMANDEEALEKAFSVPMEFG
FT                   TAGMRGLLGPGINCMNIYTVRQATEGLAQFMETLPEATKKRGVAISFDSRYQSETFAHE
FT                   AARVLGQHQIPTFVFDALRPTPELSFTVRHLHTYAGIMITASHNPKQYNGYKIYGEDGA
FT                   QMPPKESDMITSYIRQVSDLFAIEVADEMALREAGIMALIGENVDQAYLAEVKKVTINQ
FT                   ELVDTVGKTMSLIYTPLHGTGKVLGERALRQAGFEQFTMVAEQAVADPEFATTPFPNPE
FT                   FPQTFDMAIELGKSQKADLLIATDPDADRLGAAVRQPDGSYQLMTGNQIASVLLRYILQ
FT                   ASKDAGTLPANAAAVKSIVSTELATKIAASYNVKMIDVLTGFKFIAEQIQHFEDTNENT
FT                   FMFGFEESYGYLVKPFVRDKDAIQTLVLLAEVAAYYKSNGKTLYDGIQELYAEYGYYAE
FT                   QTTAIDFEGVNGPQQMADLMVKCREESPVDFAGIKVASAEDFQTQTQTFADGHTEPINL
FT                   PTSNVLKYHLEDGTWIAIRPSGTEPKVKFYVGTCADDEATADLKLANFEKAIQALVK"
FT   regulatory      539104..539117
FT                   /locus_tag="LCA_0522"
FT                   /old_locus_tag="LSA0522"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        539123..539755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0522"
FT                   /old_locus_tag="LSA0522"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54822"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YA5"
FT                   /protein_id="CAI54822.1"
FT                   /translation="MGMHQYLQGLNNLETLNRAPGLFKYQEHSVAAHSFKVCEIAQLLG
FT                   DIEEENGQPINWQVLYERALNHDYTERFIGDIKTPVKYATHELRAMLANVESSLTDNFI
FT                   NNEIPGFLQERYKRRLSEGKDETLEGQLLAVADKIDLLYESFGEIEKGNPENAFLEIFA
FT                   ESLKTIMQYQNLASAQYFIRKMLPDLLSEDFADRGKLTQLVRQTLSN"
FT   regulatory      539948..539961
FT                   /gene="uvrB"
FT                   /locus_tag="LCA_0523"
FT                   /old_locus_tag="LSA0523"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        539963..541966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="LCA_0523"
FT                   /old_locus_tag="LSA0523"
FT                   /product="Excinuclease ABC, subunit B"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54823"
FT                   /db_xref="GOA:Q38YA4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YA4"
FT                   /protein_id="CAI54823.1"
FT                   /translation="MIDRQNDNLFDLVAPYEPAGDQPAAIETLTKNFEAGAKAQVLMGA
FT                   TGTGKTFTMSNVIKNLNKPTLIISHNKTLAGQLYAEFKQFFPNNAVEYFVSYYDYYQPE
FT                   AYVPSSDTYIEKDSSINDEIDKLRHSATSSLLERNDVIVVASVSCIFGLGDPREYQNHV
FT                   LSLRPGMEVERNDLLRQLVDIQFERNDIDFQRGRFRVRGDVVEIFPASRDDHALRVEFF
FT                   GDEIDRIVEVDALTGEVIGERSHVAIFPATHFMTNDEKMEKAIESIKAELAERLAVLKG
FT                   EGKLLEAQRLEQRTNYDLEMMQEMGYCSGIENYSRHMEDRQAGEPPYTLLDFFPKDSIM
FT                   MIDESHVTMPQIRGMYNGDRARKQMLIDYGFRLPSALDNRPLTLPEFEEHVNEIMYVSA
FT                   TPGPYEAEQTDIQVDQIIRPTGLLDPNIEVRPIMGQIDDLVGEINDRIEKNERVFITTL
FT                   TKKMSEDLTDYLKELGIKVRYLHSDIKTLERTEIIRDLRLGKFDVLIGINLLREGIDVP
FT                   EVSLVAILDADKEGFLRSERSLIQTIGRASRNEHGQVLLYADKITDSMRHAIDETKRRR
FT                   TIQEDYNTAHNITPKTIIKPIRDAISMVQSVEHPEEIKMTNEIDLENMSKAEKLEMVER
FT                   LSEQMRLAAKKLDFEQAATLRDTILELKSEID"
FT   CDS_pept        541976..544828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="LCA_0524"
FT                   /old_locus_tag="LSA0524"
FT                   /product="Excinuclease ABC, subunit A"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54824"
FT                   /db_xref="GOA:Q38YA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YA3"
FT                   /protein_id="CAI54824.1"
FT                   /translation="MANDKIVIHGARAHNLKDIDVTIPRDKLVVITGLSGSGKSSLAFD
FT                   TLYAEGQRRYVESLSAYARQFLGQMDKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVT
FT                   EINDYLRLLWARVGQPICPNDGTEISSQSVEQMVDRVLALPERTKLQIMSPIVRGKKGQ
FT                   HKKIFEKIQREGYVRVQVDGEVMDVSTDLELDKNKKHDINIVVDRIVVKDGVRSRLFDS
FT                   FEAALRLSDGYATADVIDGEQLLFSEHYACPICGFTVGALEPRLFSFNAPFGACPECDG
FT                   LGLKLEVDTDLVVPDTSKTLREGAIAPWNPISSQYYPQMLEQACTAFKIDMDRPFSKLT
FT                   PRQKDIILNGSQGKEFHFHYENDFGGVRDVEVPFEGVLSNIDRRYRETNSDFTRTQMRT
FT                   YMTELTCQTCHGKRLNRQALAVKVGGQDIAEVSDNAIKDGLPFFDNLELSEKDQVIAKP
FT                   ILKEVHDRLTFLINVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSNLSGVLYILDEPSI
FT                   GLHQRDNDRLIGSLKKMRDLGNTLIVVEHDEDTMRAADYLIDIGPGAGDLGGEVMAAGT
FT                   PTEVEQNPNSLTGRYLAGQDYIPVPLKRRQGNGKKVRVTGAAENNLKDLTVDFPLGEFV
FT                   AVTGVSGSGKSTLVNTILKKALAQKINRNSAKPGQYKTITGYQNLEKLINIDQSPIGRT
FT                   PRSNPATYTGVFDNVRDLFAQTNEAKLRGYKKGRFSFNVKGGRCEACKGDGIIKIEMNF
FT                   LPDVYVPCEICHGSRYNSETLEVVYKGKNIAEILDMTVSEATEFFENIPKIARKLQTIV
FT                   DVGLGYVTLGQSATTLSGGEAQRMKLASELQKQSTGKNLYILDEPTTGLHTDDIKRLLG
FT                   VLERLVDEGNTVLVIEHNLDMIKTADHIIDLGPEGGDKGGTIVATGTPETLVNVAESYT
FT                   GRYLKPILERDTARTLAAQE"
FT   regulatory      544836..544859
FT                   /gene="uvrA1"
FT                   /locus_tag="LCA_0524"
FT                   /old_locus_tag="LSA0524"
FT                   /regulatory_class="terminator"
FT   regulatory      544934..544947
FT                   /locus_tag="LCA_0525"
FT                   /old_locus_tag="LSA0525"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        544950..545486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0525"
FT                   /old_locus_tag="LSA0525"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54825"
FT                   /db_xref="GOA:Q38YA2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YA2"
FT                   /protein_id="CAI54825.1"
FT                   /translation="MFRRNDWRFDWSELMTGIIFLIGAYFLLNKPKATLSGLVIIVAVA
FT                   AIIRGIAKISVYGQLIQDTGIRATVMLVNAILDIVIGLLFIFNIPAGIFTMSYMFAIWF
FT                   LLDAIVGLLNVSHLKQFNMGLYILSIILNVLGLIVGLLLLMNPVVAAVTMTTLLGFYFV
FT                   IVGINAIVIAIARRL"
FT   regulatory      545495..545523
FT                   /locus_tag="LCA_0525"
FT                   /old_locus_tag="LSA0525"
FT                   /regulatory_class="terminator"
FT   regulatory      545595..545608
FT                   /locus_tag="LCA_0526"
FT                   /old_locus_tag="LSA0526"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        545612..546496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0526"
FT                   /old_locus_tag="LSA0526"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54826"
FT                   /db_xref="GOA:Q38YA1"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38YA1"
FT                   /protein_id="CAI54826.1"
FT                   /translation="MTDTLNLVVITGMSGAGKTVAMQSFEDLGYFCVDNMPPSLLPKFW
FT                   ELVKESGKVTKIALVIDLRSRAFYDGIIEMLSGLDNTQFVTTKILFLDASDEELVSRYK
FT                   ETRRSHPLARNGRLMDGIHKERELLTEIRNQSQMVVNTSMLSPRELREQIFRVFKTSDN
FT                   PSFHIEVMSFGFKYGLPIDADIVMDVRFLPNPYYVAEFKALNGLDKPVRDYVMEQPATE
FT                   KFYQQLTALLKSIMPGYLKEGKTSVTIAIGCTGGQHRSVALAQRLADDLAVDYPVDVTH
FT                   RDMKKRKESVNRS"
FT   CDS_pept        546493..547527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0527"
FT                   /old_locus_tag="LSA0527"
FT                   /product="Putative extracellular lipase/esterase precursor"
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54827"
FT                   /db_xref="GOA:Q38YA0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q38YA0"
FT                   /protein_id="CAI54827.1"
FT                   /translation="MTATNRIIRVIKGRRPKVVVIGGGTGLPVILKSLREQNADATAIV
FT                   TVADDGGSSGVIRDYINVVPPGDIRNVLVALSDLPQLTLDIFQYRFKSHDAFFSGHAIG
FT                   NLIIAALSEMESGIFDAVQRLSEMMAVDGHVYPAANVALTLNAAFQDGTQLAGESEITA
FT                   ARKQIKRVWVTKTDPDDQEEPTAVQEVVEAIMAADVVVLGPGSLFTSILPNLMIKNLGE
FT                   AVKQTKAEIIYICNIMTQKGETERFTDANHVRVLNEHLGQHVVDTVLVNTGQVPANYLD
FT                   HQKYDEILWPVEHDFDGLRQLGCRVISDNFLKLDNHGVFHNGQKVASEIMNLAFQVNTT
FT                   KRGE"
FT   CDS_pept        547530..548474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0528"
FT                   /old_locus_tag="LSA0528"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54828"
FT                   /db_xref="GOA:Q38Y99"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38Y99"
FT                   /protein_id="CAI54828.1"
FT                   /translation="MASYASEVKKELTQLEVHPEHARAELAALIRMNGSLSLMNHQFVL
FT                   NVQTENPAIARRIYSLLKQNYQVESELLVRRKMKLKKNNQYIVRLKYDTNTVLNDLNIV
FT                   AEDGFTIHTRVSEDIIDEDQRVRSYLRGAFLAGGSVNNPETSRYHLEIYSLYEEHNQDI
FT                   VRMMNRFGLNAKTTVRRSGYITYLKEAEKIADFLQVIGATNAMLKFEDIRIVRDMRNSV
FT                   NRLVNCETANLNKTIDAAAKQIENIEYLRDSVGLDNLPAKLREIALLRLEFPDITLKEL
FT                   GEKMPSGAISKSGINHRLRKLNQLAEGYQQKVI"
FT   regulatory      548551..548564
FT                   /locus_tag="LCA_0529"
FT                   /old_locus_tag="LSA0529"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        548567..549022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0529"
FT                   /old_locus_tag="LSA0529"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54829"
FT                   /db_xref="GOA:Q38Y98"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y98"
FT                   /protein_id="CAI54829.1"
FT                   /translation="MIKPVLLDEQLCFSIYRAQKAYNHFYGKVLKPYGLTYPQFIAMLA
FT                   LWEHGTMSVKELGHHLELDSGTLTPLLKRLEADGWVDRKRASDDERRVDVSLTEQAESQ
FT                   KLEIYERVGNCTNYLAFTSDKYHDLRQSMNEVEKHLNAIQADTDRFA"
FT   regulatory      549051..549086
FT                   /locus_tag="LCA_0529"
FT                   /old_locus_tag="LSA0529"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(549051..549086)
FT                   /locus_tag="LCA_0530"
FT                   /old_locus_tag="LSA0530"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(549136..549660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0530"
FT                   /old_locus_tag="LSA0530"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54830"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y97"
FT                   /protein_id="CAI54830.1"
FT                   /translation="MDISIIKSDQVTTEGGIVIGHPEAPVTFVEFLNLACPYCRKWFLK
FT                   SEEQLTKAVEAGQVRRIIKPYNKDKDDLLIGNLAHTYLPFDQPAIALNAIHFLYTHQKT
FT                   WRPDLSDSEFDKYMQANLKLSPLDNTVQLAAIVDEAQAANIKFVPTIIAGEHIFDESIT
FT                   PEELDMILQAQ"
FT   regulatory      complement(549663..549676)
FT                   /locus_tag="LCA_0530"
FT                   /old_locus_tag="LSA0530"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(549712..549742)
FT                   /gene="clpP"
FT                   /locus_tag="LCA_0531"
FT                   /old_locus_tag="LSA0531"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(549809..549842)
FT                   /gene="clpP"
FT                   /locus_tag="LCA_0531"
FT                   /old_locus_tag="LSA0531"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(549884..550468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="LCA_0531"
FT                   /old_locus_tag="LSA0531"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /function="3.9 Protein folding"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54831"
FT                   /db_xref="GOA:Q38Y96"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38Y96"
FT                   /protein_id="CAI54831.1"
FT                   /translation="MLVPTVIEQTSRGERAYDIYSRLLKDRIIMLSGEVNDQMANTIIA
FT                   QLLFLDAQDSDKDISIYINSPGGSVTAGLAIMDTMNFIKSDVQTIAMGMAASMASVLLS
FT                   AGTKGKRFALPNSTVLIHQPLGGAQGQQTEIEIAAREILKTRKRLNQILADNSGQTFEK
FT                   LQADTDRDNYMTAQEAKDYGLIDDIMVNQPK"
FT   regulatory      complement(550471..550484)
FT                   /gene="clpP"
FT                   /locus_tag="LCA_0531"
FT                   /old_locus_tag="LSA0531"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(550820..550835)
FT                   /locus_tag="LCA_0532"
FT                   /old_locus_tag="LSA0532"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(551011..551592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0532"
FT                   /old_locus_tag="LSA0532"
FT                   /product="Putative N-acetylmuramoyl-L-alanine amidase
FT                   precursor (cell wall hydrolase)"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54832"
FT                   /db_xref="GOA:Q38Y95"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y95"
FT                   /protein_id="CAI54832.1"
FT                   /translation="MATITSKIRIGLIFSSLLVLLTGCDLHQSSQTPARTWETNQEEQQ
FT                   RQSRFIKKIGQNAKLVYQKKHQVLPSIIIAQAIIESDWGRSDLATKANNLFGVKGQYQG
FT                   QQILMTTDEYENNQRTTIKDYFKVYPSLEIAIQDHSDFLSVGTYTTLANLTNYAEQADL
FT                   LQKTGYATDPNYATKIKKAIQDYDLAEYDA"
FT   regulatory      complement(551595..551608)
FT                   /locus_tag="LCA_0532"
FT                   /old_locus_tag="LSA0532"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      551790..551803
FT                   /gene="iunH2"
FT                   /locus_tag="LCA_0533"
FT                   /old_locus_tag="LSA0533"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        551808..552767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH2"
FT                   /locus_tag="LCA_0533"
FT                   /old_locus_tag="LSA0533"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54833"
FT                   /db_xref="GOA:Q38Y94"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y94"
FT                   /protein_id="CAI54833.1"
FT                   /translation="MTHKMILDLDTGIDDALAIAYALGSPEVELIGITSEYGNVLTERS
FT                   VVNSQQILHLLGHPEIPVYLGAGHSTMTNDFSVLPISAEIHGQDGVGEIHLTQPHPDAA
FT                   SESAVDFILAACQQYGADLSIVATGPMTNLALAIQKDLPTLQKVGQIVIMGGALTVCGN
FT                   VSPYAEANISQDPEAADLLFKSGLPVTMVGLDVTLRTLFTKKDTQEWRALATDAAKAYA
FT                   DMVDYYIKAYEVTSPHLHGCALHDPLAVAVAINPSLVTTFPLNLKTEVEGPSRGRTIGD
FT                   NARLDDPKTRTAVCVQVDTPRFLNAFKTRIGQLLKAVK"
FT   regulatory      552826..552854
FT                   /gene="iunH2"
FT                   /locus_tag="LCA_0533"
FT                   /old_locus_tag="LSA0533"
FT                   /regulatory_class="terminator"
FT   regulatory      552942..552955
FT                   /locus_tag="LCA_0534"
FT                   /old_locus_tag="LSA0534"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        552959..558922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0534"
FT                   /old_locus_tag="LSA0534"
FT                   /product="Hypothetical cell surface protein precursor (with
FT                   LPQTG sorting signal)"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54834"
FT                   /db_xref="GOA:Q38Y93"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y93"
FT                   /protein_id="CAI54834.1"
FT                   /translation="MKKVSRKKMLRRTLYVCSGTLLLLNSGVGVASVFVINQNRAQASQ
FT                   VNPRAGLADVSILQNASLTSTTGTQMTPNAEGNFDLSLNYTGQGVATVGVADKKVLVYA
FT                   LPASLQGKVVGGSTVDIQADLLPITPGDIPGVKPLFDALGLAITALDKALKIPAVVAAF
FT                   DDLKQVQSLGSYQETVTANVSPDGKTISVDFTQGFGRYVHQAYAALFHSLRDAIAAVHS
FT                   DNILIETLVKALQKASAELFEVIDAIAGGTSTILDSALSGNLLGSASGTLHTTVSDPGV
FT                   PTATVKAAAINNALISADILTAIEQEGEAVTLNFPTTATNPIENYDVATPTVTRPVAGQ
FT                   TTVAGNVILKEPIPAGTTFEAVVTLDDGTTKTAAVQADGTFVVDTGALTAGQILSTKVV
FT                   ATNGQYTKESTAVESTVSDVSTENPIENYDVATPTVDPATAGDTKLDGQGTLKQPIPAG
FT                   TTFKAVAILADGTEVSGDVDTTTGKFSIGTDPLIVGDVTVKVVATNGQFTKPSANVTVT
FT                   VADSSTENPIENYDMATPTVDPATAGDTSLDGQVTLAQPIPAGTTFKAVATLANGTEVS
FT                   ADVDTTTGKFSIGTDPLIVGDVTVKVVATNGQFTKPSANVTVTVADSSTENPIENYDVA
FT                   TPTVDPATAGDTKLDGQVTLNQPIPAGTTFKAVATLANGTEVSADVDTTTGKFSIDTDP
FT                   LVAGDVAVKVVATNGQFTKPSANVTVTVADAPIEDPIANYDVATPTVEKSFAGDTNVKG
FT                   HVDLKTPIPDNTTFEATVTLPGGRQVKADVQANGDFTVNTEELLVAGSQLAIHITAING
FT                   QFTKEGAAVNSTVADALPTDPLVNYQVTTPTLDSATAGQTKVSGHVNLQVPIPEGTTFK
FT                   AEVQLPDGGTVAADVQANGDFEVPTRALVAGENLSVKVIAQNGIYQKESTPASLLVSEV
FT                   VPTDPLENYTVATLDVNPMTTDDTQLTGKVTLTDIPAGTTFEAVVTMADGSTKRANVSP
FT                   DGQFIIETGQLAADDVLSVKITAKNSGYTKDSASVDVTVTQAPDTNPLANYTVAQPVVD
FT                   AASAGDTTVTGKVDLTTNPAPAGTTFEATVMLPDGTLKTAEVADDGTFTVTTGELKADD
FT                   ILEIHVTAHNSGYQKESNPVQLTVDAAVETNPLENYTVNAPVVAPLTEGDTAVKGQVNL
FT                   EIPIPNGTTFEAIVTLADGTTKAVAIGADGQFTVPTAALVADETVAVKVVATNGTFTKD
FT                   SSVVYQKVSQKLPTDPIADYEVGTPTVDSVTADQTRVTSQVVLAEPIPEGTSFEATVTL
FT                   ADGTQKTAAVDENGHFTIVTGNLTEGDQLTVKVTAKNSIYTKDSALVTVNVGPAVEQNP
FT                   LADYDVNMPVLNPAKVGDTHVSGSVTLKQPVPAGTTFEASVTLQDDTTTTATILPSGEF
FT                   TVGTKPLTAGEILSAKVTAINGNFKKDSQTVSLTVDAGLPTNPIENYDVATPMMQPAVE
FT                   GDKSIKGQVTLVQPIPNGTSFKAVITLPDGTTKATTINSSGQFELPTDALVAGQTYTAK
FT                   VVATNGANMKESQSASVTVSEKEETDPLVDYNVATPTINQGIAGETQVSGQVQLDPDWP
FT                   AGTTFEAVIVLPNGRTRAVRLDSGAVAPDGKFTINTTALTADQKVLVKIVAKNGTFTKN
FT                   SANAEMIVKAAPITDPLETYDVATPSVDPVKAGDTKVTGKVELVTPIPDGTTFEAVVTL
FT                   PSGKQVKVTVDSNSNFTLPIDAVKAGDKLTVEIIAHNGDHEKGSDKVNVTVETGNPGET
FT                   NPLENYVVAKPSVDPVKAGDTQVTGKVTINKPFPKGTTFEASVTMPDGSVKYGMVDING
FT                   NFIVKTGQLKAGQRLIVTIIAHNDGFEKDSQPVRIRVAANDQDGSGTGNGNGGTGNNTG
FT                   NGGNTNGNSNGSHNPGNNNAGNGGQTNNGGSGQLGNSNNVNNLTNNGSNSSQNSHHMLN
FT                   GGVSDTTGSPNANSKTGDLPQTDANKTGVWAAFGTFLIAMVALFKSLLPIKRDK"
FT   regulatory      558952..558970
FT                   /locus_tag="LCA_0534"
FT                   /old_locus_tag="LSA0534"
FT                   /regulatory_class="terminator"
FT   regulatory      559057..559070
FT                   /locus_tag="LCA_0535"
FT                   /old_locus_tag="LSA0535"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        559074..559097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0535"
FT                   /old_locus_tag="LSA0535"
FT                   /product="Hypothetical small peptide"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54835"
FT                   /protein_id="CAI54835.1"
FT                   /translation="MMISSTD"
FT   regulatory      559631..559644
FT                   /locus_tag="LCA_0536"
FT                   /old_locus_tag="LSA0536"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        559648..560292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0536"
FT                   /old_locus_tag="LSA0536"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54836"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y92"
FT                   /protein_id="CAI54836.1"
FT                   /translation="MEKVLILGAHGKIVQLTRAQLLAKTDAQLVLFLRKANRLTIQDQQ
FT                   REQLVEGDASQQVDLVQAMKGVTVVYANLAGANIETQAKAVVSAMKTAGVKRLIWISTL
FT                   GIYDEVPGAYGQWNHQMLDDGYLPTYAAAAKVIETSGLAFTIIRPAWLSDKDEIDYEIT
FT                   HRADAFKGTEVSRKSVAAEVVRLIQNPTEAVGDSLGLNKPNTEGDKPEWYR"
FT   regulatory      560298..560316
FT                   /locus_tag="LCA_0536"
FT                   /old_locus_tag="LSA0536"
FT                   /regulatory_class="terminator"
FT   regulatory      560375..560388
FT                   /locus_tag="LCA_0537"
FT                   /old_locus_tag="LSA0537"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        560392..560772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0537"
FT                   /old_locus_tag="LSA0537"
FT                   /product="Putative transcriptional regulator, DUF24 family
FT                   (MarR related)"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54837"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y91"
FT                   /protein_id="CAI54837.1"
FT                   /translation="MNEPQNHYTNGVLMTLAVMGTKWKPLILCHLVDGPQRPADLKRAV
FT                   QGISSKVLTDQLRELERDGIITRTIFNEVPPHVEYAISEYRQSLVPVLGVMANWGEARI
FT                   DFLKQSGVAVDLTYTDHEKYEL"
FT   regulatory      560920..560933
FT                   /locus_tag="LCA_0538"
FT                   /old_locus_tag="LSA0538"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        560936..561682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0538"
FT                   /old_locus_tag="LSA0538"
FT                   /product="Putative oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54838"
FT                   /db_xref="GOA:Q38Y90"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y90"
FT                   /protein_id="CAI54838.1"
FT                   /translation="MTIQNKVVVITGASSGIGKETATLLAAKGAKLVLAARRESMLAPL
FT                   AAALTAKYNTEIIYQKTDVTQLAEVKALIDSAITKFGRIDVLFNNAGLMPVSMLRDGKV
FT                   DEWEAMIDINLKGALYGIKYALPIMEQQKSGHIITTDSVAGHFTGEGSSVYSATKYAMR
FT                   AVMEGLRVEEVGKGIKSTLISPGHAQTELAAKISDPKLREAVLKSEAETGLSANDVANA
FT                   VVYAIETPANVGINEVILRSIDQRDY"
FT   regulatory      561709..561726
FT                   /locus_tag="LCA_0538"
FT                   /old_locus_tag="LSA0538"
FT                   /regulatory_class="terminator"
FT   regulatory      561794..561807
FT                   /locus_tag="LCA_0539"
FT                   /old_locus_tag="LSA0539"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        561810..562055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0539"
FT                   /old_locus_tag="LSA0539"
FT                   /product="Putative NADPH-quinone oxidoreductase (N-terminal
FT                   fragment), authentic frameshift"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54839"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y89"
FT                   /protein_id="CAI54839.1"
FT                   /translation="MKVIMQNDFSGIAGLAVTTMADPKASVLSVIVRNQFIPVLPYDWL
FT                   TGEGALKAIRPVKLPMVIGYGFGGIVEQVGRLRDAQ"
FT   CDS_pept        562052..562711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0540"
FT                   /old_locus_tag="LSA0540"
FT                   /product="Putative NADPH-quinone oxidoreductase (C-terminal
FT                   fragment), authentic frameshift"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54840"
FT                   /db_xref="GOA:Q38Y88"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y88"
FT                   /protein_id="CAI54840.1"
FT                   /translation="MIGIQPNGAAKTIINSQVPPLLFEVPQNVTLQAATTLIGGGDAAL
FT                   HAVQKSRINKNDIVLVTGASGGVGTYLVQLLKLAGATVIALASSNNLAFVRMLGADYVL
FT                   NYQTDLRQQLGNVPQPNKVIDMVGQQDLLTVISQQYETLAILSLSTQAFRPMKINQHFE
FT                   FSNGSVGINGYQQLLAMLANHQLCAHIQAEYNFADIKKAHFDSKNGHSQGRILLKF"
FT   regulatory      complement(562655..562679)
FT                   /locus_tag="LCA_0541"
FT                   /old_locus_tag="LSA0541"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(562708..563562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0541"
FT                   /old_locus_tag="LSA0541"
FT                   /product="Putative DNA-binding protein, XRE family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54841"
FT                   /db_xref="GOA:Q38Y87"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y87"
FT                   /protein_id="CAI54841.1"
FT                   /translation="MISDTTIVTALGQRIALERRAQHLSQKQLAADICSQPMISQIEKG
FT                   TYIPNAILLAKICQRLHLSITNDLLHDYLVIDSLPEFAPTIQALCNQHQYAKMLTYLDD
FT                   DSLVQQLHRQIDLQTYYYYYGVALFQTQQPVINSLRYLKLALAETSHSEASLWTSTEGL
FT                   ILAAIAYIEQHETQIIDTTKFEQLRTALKTNRLLSFDENINSFYYLYSLSLFEHAEYSF
FT                   ALLIANEGIDWTTTHQSHYMLADLFLVCAKAAEQLSQPSTAEVAYQKSETLATIFDITT
FT                   HSF"
FT   regulatory      complement(563564..563577)
FT                   /locus_tag="LCA_0541"
FT                   /old_locus_tag="LSA0541"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(563644..563665)
FT                   /locus_tag="LCA_0542"
FT                   /old_locus_tag="LSA0542"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(563678..564796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0542"
FT                   /old_locus_tag="LSA0542"
FT                   /product="Aryl-alcohol dehydrogenase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="1.1.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54842"
FT                   /db_xref="GOA:Q38Y86"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y86"
FT                   /protein_id="CAI54842.1"
FT                   /translation="MKIKAAVVEQQGAPFVIKDNIELAPLHPDDVQVHMVASGICHSDE
FT                   ALRKGDAIIGYPIILGHEGSGIVEKVGSNVQSLKVGDHVVLSFYACGICENCLKGMPTQ
FT                   CLNYAENNLSGVRPDGSSHFTENEHHVADMFDQSSFTTTTVVRERNAVKVPDDLDLREL
FT                   GPLGCGYVTGSGTVLNTLKPKLGDTIAVFGTGAVGLAAMMAGKISGCTKVIAVDIIDER
FT                   LALAKELGATDTINSRQTDDVVAAIQALTNGRGVNFCVDTTGITPVMEDSIKALCQGGV
FT                   SATIAVTPNHIDLDTWNDLCVNDKSVVGVNMGDSIPQIDIPRLIEFYRQGMFPFDKTEK
FT                   FYDFEDINLANEASIKGETIKPVLIIDPDYQI"
FT   regulatory      complement(564800..564813)
FT                   /locus_tag="LCA_0542"
FT                   /old_locus_tag="LSA0542"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(564907..565548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0543"
FT                   /old_locus_tag="LSA0543"
FT                   /product="Putative 3-methy-adenine DNA glycosylase I"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54843"
FT                   /db_xref="GOA:Q38Y85"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38Y85"
FT                   /protein_id="CAI54843.1"
FT                   /translation="MTTIQPAPMAFFTNRPTTEIARDLLGTHLLYTSHQGTLGGLIVET
FT                   EAYMGAQDTAAHAYNGRRTPFSEPLYHEPGTIYIYQLRSFFLFDIVTQAVDQPQGVLIR
FT                   AIEPTHGLAQMQRNRPNKPSVNLTNGPGKLMGALGIHDKQLTFKNVATAPLTIDLANRR
FT                   QPRHITTAPRIGVNAKAASGQLPYRYFITGNPYVSGTLKKDWDREQHGWL"
FT   regulatory      complement(565551..565564)
FT                   /locus_tag="LCA_0543"
FT                   /old_locus_tag="LSA0543"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      565670..565683
FT                   /locus_tag="LCA_0544"
FT                   /old_locus_tag="LSA0544"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        565687..566559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0544"
FT                   /old_locus_tag="LSA0544"
FT                   /product="Putative drug ABC exporter, ATP-binding subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54844"
FT                   /db_xref="GOA:Q38Y84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y84"
FT                   /protein_id="CAI54844.1"
FT                   /translation="MIDIQQLKMQFDSQVVLAGLDLTVQPGEIIGLVGANGAGKSTLIN
FT                   LMLGRLTPTQGQIRILGEQPNEKRHLNQVGAMTQGDVPLARLKVIEELALVRSYYQTPL
FT                   ATEMLLTLANLMEHAQKLVSQLSGGQLRRLSFALAMAGNPQLLFLDEPTVGMDVGSRQQ
FT                   FWQQIDDLKQQGKTIILTSHYLEEIEQIATRILILKAGQFQYDGDFATLQRQFKDAQVS
FT                   FTTTEPLDSFTQWSAVTSASQDGAKVILQVSDSDQVLAQLVPLLLTKVHDIRIQASSLA
FT                   DIYRDIMGE"
FT   CDS_pept        566563..567306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0545"
FT                   /old_locus_tag="LSA0545"
FT                   /product="Putative drug ABC exporter, membrane-spanning
FT                   subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54845"
FT                   /db_xref="GOA:Q38Y83"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y83"
FT                   /protein_id="CAI54845.1"
FT                   /translation="MKTVMTQIKMDFKRAYLRNSRFAFFSLLMPIGFYLLFTKVMNQGL
FT                   VSASFNLQYMVSMTTYSLILSNVFTLSTLLYNDMREGLLALIDLSPTSKATYYTAKLLN
FT                   LGVINGLTIIVIFVVAALSNQLQLAWTTWLLTAGWLWLASLPLCLLGISISFLNDDNQI
FT                   QLASNLLAFPLAILSGLWWPLAMMPKQVQVIGRHLPVYPINQIAQSIVLKKTVHFADYG
FT                   VTLGWAVILVGLVVYLNHYQKGARH"
FT   CDS_pept        567306..567506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0546"
FT                   /old_locus_tag="LSA0546"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54846"
FT                   /db_xref="GOA:Q38Y82"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y82"
FT                   /protein_id="CAI54846.1"
FT                   /translation="MSFFKRYIAMPQQYGLFPYVWLLFLLFPIAYAFPFKTLRQQVIIG
FT                   LVLIFVIAYRNSYVATTYRPF"
FT   CDS_pept        567519..567800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0547"
FT                   /old_locus_tag="LSA0547"
FT                   /product="Two-component system, sensor histidine kinase
FT                   (N-terminal fragment), authentic frameshift"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54847"
FT                   /db_xref="GOA:Q38Y81"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y81"
FT                   /protein_id="CAI54847.1"
FT                   /translation="MVVSAILAVIVQALYLSIYTAWVFGSIPMRRRSFWGYYGAYMLSI
FT                   LVPTLFLYYYYGGQMGRDDWVGSSMAYSVSYPHLRQVRFNVIIEKIGS"
FT   CDS_pept        567710..568429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0548"
FT                   /old_locus_tag="LSA0548"
FT                   /product="Two-component system, sensor histidine kinase
FT                   (C-terminal fragment), authentic frameshift"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54848"
FT                   /db_xref="GOA:Q38Y80"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y80"
FT                   /protein_id="CAI54848.1"
FT                   /translation="MGWLVYGLFCVLSPFAAGSIQRYNRKNRQLMQTNQRLTEIIKQNE
FT                   RQRIARDLHDNLGQSFSMITLKAEYARKLLAKKSDAVPEQLLAIEQASRQNLKMVRDIV
FT                   AGLRQTTIAEELINQERNLSVAGIILLTKDENQIEGLPQSNQQVLAQCLHEAVTNIIRY
FT                   SHATECYVTFAQSATTFQMTIQDNGRGLKKADQFKSHGMAGMRERLEVIQGELTVDGRH
FT                   GTTLTLTMPIVTETKND"
FT   CDS_pept        568422..569027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0549"
FT                   /old_locus_tag="LSA0549"
FT                   /product="Two-component system, response regulator"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54849"
FT                   /db_xref="GOA:Q38Y79"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y79"
FT                   /protein_id="CAI54849.1"
FT                   /translation="MIKLYLAEDQQLLNTALAGILELEDDLTMIGTATNGQIALEQIAT
FT                   LQPDVALLDIEMPGLTGLEIARRLHEQQPQVKVIILTTFAQTSYFKQAISAEVAGYLLK
FT                   DGPSDDLIVAIHSVMAGKTVYAPELVVGLTNQPQNPLSQRETDVLQAVANGLSNKEVAS
FT                   QLFLSDGTVRNYMSTILSKLAASNRIEAIQIARHNGWL"
FT   regulatory      569081..569094
FT                   /locus_tag="LCA_0550"
FT                   /old_locus_tag="LSA0550"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        569097..569423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0550"
FT                   /old_locus_tag="LSA0550"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54850"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y78"
FT                   /protein_id="CAI54850.1"
FT                   /translation="MSLENLHKWAFFYFSPAFSPEQNTVINRNQAGTCEMITVGFDPSA
FT                   KTDGSVIGLALQLKAEGVQFIELCGGFGPTWTTKINEALNYEIPVGAVMYGPEFRQPLF
FT                   EIMQ"
FT   regulatory      569438..569468
FT                   /locus_tag="LCA_0550"
FT                   /old_locus_tag="LSA0550"
FT                   /regulatory_class="terminator"
FT   regulatory      569532..569545
FT                   /locus_tag="LCA_0551"
FT                   /old_locus_tag="LSA0551"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        569547..571187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0551"
FT                   /old_locus_tag="LSA0551"
FT                   /product="Putative oligopeptide ABC transporter,
FT                   substrate-binding lipoprotein precursor"
FT                   /function="1.2.1 Transport/binding of proteins/peptides"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54851"
FT                   /db_xref="GOA:Q38Y77"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y77"
FT                   /protein_id="CAI54851.1"
FT                   /translation="MLKKRRTFIIGLGAALLCSLFLILNVANVQAKQVLQLGAQAPLDT
FT                   IDISTSTGYGQTGNIFESLYRLGQKGKIEAGLAKSSQVSDDGLTWTFKIRKAQFSNGDP
FT                   IRAQDFVYSWQRTIKPTTKSPYTNLLSNIKNAPAIADGKLDPKQLGVKALDKHTLQVTL
FT                   TKPVAYMKTLMAYPLFAPQDQKVIEKYGKKYATKSKYMVYSGPFKLKGWSGTSEEWQFK
FT                   KNPRYWDYKKVKLSAVKFTVLENTSTALYLYQDGRLDLTQLDNQQVENYSSNRDFKRYP
FT                   YAQTYFLKYNFNSDNQQVKHILNNQDARLALSLAINRKTMNNRLYGFKTNPVTGFVASG
FT                   LANSPVKKVDFAKSQAVPHTVDYEPKLAKEYWQKALKATGMKKVTLSLTVDSDDPNTSY
FT                   VSQYLKGQLEEILPGFQLNLRTVPSQVAGSRDHEGDYDILLSAWGADFKDPISFLEIML
FT                   PGAANNTGGFKNADYQKNVDLATNQDANDPSQRWADMVEAAQVLNRTQSLTPLYQNETG
FT                   YLQNPKVKGIIHNTAGTQWSYKTAYIKGQ"
FT   regulatory      571249..571262
FT                   /locus_tag="LCA_0552"
FT                   /old_locus_tag="LSA0552"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        571267..571674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0552"
FT                   /old_locus_tag="LSA0552"
FT                   /product="Organic hydroperoxide resistance protein"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54852"
FT                   /db_xref="GOA:Q38Y76"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y76"
FT                   /protein_id="CAI54852.1"
FT                   /translation="MAKQYETTMINEGGRNGFVYDPEKSTKYVIKAPGTDKTGKSTNPE
FT                   QLFAAGYSSCFNSALELVLSQDQIKAETTVKATVSLYNDGPADFYIGVELVGHIEGLSP
FT                   EDTKRYLEKAHEVCPYSKATRGNIDVKIDVM"
FT   regulatory      571688..571723
FT                   /locus_tag="LCA_0552"
FT                   /old_locus_tag="LSA0552"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(571688..571723)
FT                   /locus_tag="LCA_0553"
FT                   /old_locus_tag="LSA0553"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(571740..572036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0553"
FT                   /old_locus_tag="LSA0553"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54853"
FT                   /db_xref="GOA:Q38Y75"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y75"
FT                   /protein_id="CAI54853.1"
FT                   /translation="MGTYSLLGALLSLWEPHWQAILLIAALTIGIAALCSVAYHKATTS
FT                   IGQNALLLAGLIMLILTIIASQQIGYSAIIIGLVLCIVGVNLKSWLQMNTRAH"
FT   CDS_pept        572242..572604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0555"
FT                   /old_locus_tag="LSA0555"
FT                   /product="Hypothetical small protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54855"
FT                   /db_xref="GOA:Q38Y74"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y74"
FT                   /protein_id="CAI54855.1"
FT                   /translation="MTQKRKWPVWLKVVMWIGIIGGGFAVMIMLNLAYSKGLTAIAQRL
FT                   GVPYSYYHHMHHERHHYEEQYMANDFDEVGLILAILTVLGGVYLCFSLLENQEKKYKKR
FT                   ATKQHNKRLNKVKKRH"
FT   regulatory      572716..572729
FT                   /locus_tag="LCA_0556"
FT                   /old_locus_tag="LSA0556"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        572733..573623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0556"
FT                   /old_locus_tag="LSA0556"
FT                   /product="Putative drug ABC exporter, ATP-binding subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54856"
FT                   /db_xref="GOA:Q38Y73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y73"
FT                   /protein_id="CAI54856.1"
FT                   /translation="MTLLTATGITKKFGTKTAVKQIDLTVQTGQLVAFLGPNGAGKSTT
FT                   INLLTGTIAPTAGTIEMAGLRPDSRQYQKQIGVVFQKSVLDNQLTVWQNLKSRADMYQG
FT                   VTLTPESELITAFGLTSILKQAYGTLSGGQRRRVDIARALIHQPKLLFLDEPSTGLDIQ
FT                   TRTVIWQTLNQLRQQQGLTIILTTHYLEEAAEADFVYVIDHGQIIAADTVEQLQATYAQ
FT                   SQLMIETDYPEVVLAQLTPEWRVLQTNHQLQIALPDDQQAIIILTKVQSVVTHFEFRQG
FT                   NMDDIFMALTGKEIR"
FT   CDS_pept        573623..574489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0557"
FT                   /old_locus_tag="LSA0557"
FT                   /product="Putative drug ABC exporter, membrane-spanning
FT                   subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54857"
FT                   /db_xref="GOA:Q38Y72"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y72"
FT                   /protein_id="CAI54857.1"
FT                   /translation="MMALVKRHLALYFGNKSGVFFSLLGALIAFVLYLVFLKHNMLASW
FT                   SQLAAPQKLLDPWLIGGTLAVTAVTTTANGLNQMIVDRESGTLADLALTDMSFIGIQFS
FT                   YLVSAVIIGILMQLVMFAAMVGYFSLTDQFVLSLAAIGPVMGIMLLSSIVWTTFNVLIL
FT                   SFVTNLDSLGKIGTILGTSAGFFAGVYLPIGAVPVAAQNLMKITPFPYNAAIYRQVLMA
FT                   DQLKITFKQVPQLRHQFEQTLGIGIQLQHLTSWQANALILAGFSVVFGALTLVFAKSSR
FT                   RKAINKV"
FT   regulatory      574499..574512
FT                   /locus_tag="LCA_0558"
FT                   /old_locus_tag="LSA0558"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        574516..574968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0558"
FT                   /old_locus_tag="LSA0558"
FT                   /product="Putative transcriptional regulator,LytR/AlgR
FT                   family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54858"
FT                   /db_xref="GOA:Q38Y71"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y71"
FT                   /protein_id="CAI54858.1"
FT                   /translation="MKVNFEQNKDLADDDIQVTVQAAHLSPTVIELIQALEARQQSVDV
FT                   YPITVDERVVLVPTAEIIALEVYGNDVTLYTVKATYQIRGVLKKILSKLNQQDFIQVAK
FT                   GAAINLNHLQSLEAAFSGSMTAFLTNQLKMSVSRKYLPELRQQLGM"
FT   CDS_pept        574974..575381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0559"
FT                   /old_locus_tag="LSA0559"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54859"
FT                   /db_xref="GOA:Q38Y70"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y70"
FT                   /protein_id="CAI54859.1"
FT                   /translation="MLKESLKSAGIGLLIGSFTFLVVIMSLNSTVTITRANILSNWVMS
FT                   ALIGIISMIFDSEKIPFAWALFSHYCGVLLLVGLTGIYNGLWPIFIAHPVRHVLFVTLI
FT                   YALVWLGLQISNWIDVRRMNEKLAKRRQMKK"
FT   regulatory      575390..575432
FT                   /locus_tag="LCA_0559"
FT                   /old_locus_tag="LSA0559"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(575390..575432)
FT                   /locus_tag="LCA_0560_a"
FT                   /old_locus_tag="LSA0560_a"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(575441..575788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0560_a"
FT                   /old_locus_tag="LSA0560_a"
FT                   /product="Putative bacteriocin immunity protein"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0560_a"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54860"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y69"
FT                   /protein_id="CAI54860.1"
FT                   /translation="MTNQEIAKENIHTLYNSLMAHPDKSNALLDITDVLSQVYLTLETA
FT                   KNPEVLVNRLANYIYSVGFGKIHLNKSEEQLLIDLGAYGQRAGWNSVYRGDYTAKAEFF
FT                   NYSDARKYARV"
FT   regulatory      complement(575793..575806)
FT                   /locus_tag="LCA_0560_a"
FT                   /old_locus_tag="LSA0560_a"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        575965..576099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0560_b"
FT                   /old_locus_tag="LSA0560_b"
FT                   /product="Putative bacteriocin inducing peptide"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0560_b"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54861"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y68"
FT                   /protein_id="CAI54861.1"
FT                   /translation="MMIFKKLSEKELQKISGGVGIQKCSLGFSSREYLNKITKWIKHH"
FT   regulatory      576730..576743
FT                   /gene="sppKN"
FT                   /locus_tag="LCA_0561"
FT                   /old_locus_tag="LSA0561"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        576747..576956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppKN"
FT                   /locus_tag="LCA_0561"
FT                   /old_locus_tag="LSA0561"
FT                   /product="Two-component system, sensor histidine kinase,
FT                   (SppK fragment) (sakacine P production) , degenerate"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54862"
FT                   /db_xref="GOA:Q38Y67"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y67"
FT                   /protein_id="CAI54862.1"
FT                   /translation="MLSIKTYAIRQETEDKIARNQQLQDYLVNIEQQYTELRRFKHDYQ
FT                   NTCRWRVLPKRAISNSLRRIIRSY"
FT   CDS_pept        576893..577444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppKC"
FT                   /locus_tag="LCA_0562"
FT                   /old_locus_tag="LSA0562"
FT                   /product="Two-component system, sensor histidine kinase
FT                   (SppK fragment) (sakacine Pproduction ), degenerate"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54863"
FT                   /db_xref="GOA:Q38Y66"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y66"
FT                   /protein_id="CAI54863.1"
FT                   /translation="MESFAEKGDQQQFKAYYQELLAQRPIQSEIQGAVIAQLDYLKNDP
FT                   IRGLVIQKFLAAKQAGVTLKFEMTEPIELQTANLLTVIRIIGILLDNAIEQAVQETDKL
FT                   VSCAFLQSEGLIEITIENTASQVKDIQAFSALGYSTKGAGRGTGLANVQDLIAKQTNLF
FT                   LETQIENRKLRQTLMITEET"
FT   CDS_pept        577446..578192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppR"
FT                   /locus_tag="LCA_0563"
FT                   /old_locus_tag="LSA0563"
FT                   /product="Two-component system, response regulator SppR
FT                   (sakacin P production)"
FT                   /function="1.3 Signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54864"
FT                   /db_xref="GOA:Q38Y65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y65"
FT                   /protein_id="CAI54864.1"
FT                   /translation="MYPVYLLEDDLQQQAIYQQIIANTIMINEFAMTLTCAASDTETLL
FT                   AAIKDQQRGLFFLDMEIEDNRQAGLEVATKIRQMMPFAQIVFITTHEELTLLTLERKIA
FT                   PLDYILKDQSMAEIKRQLIDDLLLAEKQNEAAAYHRENLFSYKIGPRFFSLPLKEVVYL
FT                   YTEKENPGHINLLAVTRKVTFPGNLNALEAQYPMLFRCDKSYLVNLSNIANYDSKTRSL
FT                   SFIDGSEAKVSFRKSRELVAKLKQMM"
FT   regulatory      578197..578231
FT                   /gene="sppR"
FT                   /locus_tag="LCA_0563"
FT                   /old_locus_tag="LSA0563"
FT                   /regulatory_class="terminator"
FT   CDS_pept        578358..578501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0564_a"
FT                   /old_locus_tag="LSA0564_a"
FT                   /product="Hypothetical small peptide"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0564_a"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54865"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y64"
FT                   /protein_id="CAI54865.1"
FT                   /translation="MERISEYKVLNNNVLAGVQGGKKKKGGFFWHYFGDPIVSFGKGFI
FT                   GY"
FT   regulatory      578508..578521
FT                   /locus_tag="LCA_0564_b"
FT                   /old_locus_tag="LSA0564_b"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        578523..578687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0564_b"
FT                   /old_locus_tag="LSA0564_b"
FT                   /product="Hypothetical small peptide"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0564_b"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54866"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y63"
FT                   /protein_id="CAI54866.1"
FT                   /translation="MNKKLDSFSSIEDDKLGLVIGGRNNLAYGLGKLVRAGVDIGIAIG
FT                   SKGRYKPRH"
FT   CDS_pept        578713..579381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0564_c"
FT                   /old_locus_tag="LSA0564_c"
FT                   /product="Putative bacteriocin Immunity protein"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0564_c"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54867"
FT                   /db_xref="GOA:Q38Y62"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y62"
FT                   /protein_id="CAI54867.1"
FT                   /translation="MNTLEVISQRRAVGGFVLLIIGYLLSSRISLEISFFNISCLFLIL
FT                   FSYSALIVLFGYQSTKDLLKPLKRPFVRKILSAVGLSFLIVFGISIVLMMFFGEVAVTQ
FT                   NGNIPFLKSITVKWQLVSLLIIFLNIIGEELWVAGIVLPIATWLTEYKFNWLLANLIGC
FT                   LIFALIHLEIYKFNIAICLIVGFSRYGFSMAWKSNDTLRGGIYAHLLYDSLLLAVNILL
FT                   "
FT   regulatory      580208..580221
FT                   /locus_tag="LCA_0565"
FT                   /old_locus_tag="LSA0565"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        580228..580398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0565"
FT                   /old_locus_tag="LSA0565"
FT                   /product="Hypothetical small peptide"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54868"
FT                   /db_xref="GOA:Q38Y61"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y61"
FT                   /protein_id="CAI54868.1"
FT                   /translation="MFLKKSNVLIIISILLIIGGIGLLIIFGNEDRFRLADIMLIIGMT
FT                   LFIDIKFKDRH"
FT   regulatory      580413..580426
FT                   /locus_tag="LCA_0566"
FT                   /old_locus_tag="LSA0566"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        580431..580613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0566"
FT                   /old_locus_tag="LSA0566"
FT                   /product="Hypothetical small peptide"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54869"
FT                   /db_xref="GOA:Q38Y60"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y60"
FT                   /protein_id="CAI54869.1"
FT                   /translation="MRLKKNFYKSLDLYIGIWALIASFAVFNETMFSVSWWLDIVGVII
FT                   GISLIVSGLFLGDKA"
FT   regulatory      580660..580694
FT                   /locus_tag="LCA_0566"
FT                   /old_locus_tag="LSA0566"
FT                   /regulatory_class="terminator"
FT   regulatory      580738..580751
FT                   /locus_tag="LCA_0567"
FT                   /old_locus_tag="LSA0567"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        580755..581087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0567"
FT                   /old_locus_tag="LSA0567"
FT                   /product="Hypothetical protein"
FT                   /function="5 Proteins of unknown function that are similar
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54870"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y59"
FT                   /protein_id="CAI54870.1"
FT                   /translation="MAINDQELFDLIDAAYNEDLSNQPQKYEYKAALLAGAKQLIEGAD
FT                   SLSVCVDIYNAYHENYIVSISLPRANRNLYGYIHHKLEKLDQKRLRDLNLGYGLIASSM
FT                   MFGGMH"
FT   regulatory      581089..581102
FT                   /locus_tag="LCA_0568"
FT                   /old_locus_tag="LSA0568"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        581106..581393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0568"
FT                   /old_locus_tag="LSA0568"
FT                   /product="Putative SakacinP immunity protein, SpiA"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54871"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y58"
FT                   /protein_id="CAI54871.1"
FT                   /translation="MKWYSGGSERSEQAIITIKALLTDLQDASKGPALQTVLTTYQAEL
FT                   ESKKASVPLILSRLNLAIANALQEDGLTLSAAQSEQVKAITALSNIRYGY"
FT   CDS_pept        581417..581596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0569_a"
FT                   /old_locus_tag="LSA0569_a"
FT                   /product="Hypothetical small protein"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0569_a"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54872"
FT                   /db_xref="GOA:Q38Y57"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y57"
FT                   /protein_id="CAI54872.1"
FT                   /translation="MTFNHFFYKAIDFYCGLYLLFSSWSIINESISTISWWFDCFCIVL
FT                   GLWLMIENLLTKKD"
FT   regulatory      581609..581622
FT                   /locus_tag="LCA_0569_b"
FT                   /old_locus_tag="LSA0569_b"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        581625..581861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0569_b"
FT                   /old_locus_tag="LSA0569_b"
FT                   /product="Hypothetical small protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0569_b"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54873"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y56"
FT                   /protein_id="CAI54873.1"
FT                   /translation="MASDQGLLNILRLIEVALSDPQVAADYQLATHLNKGAAAVKNGYL
FT                   DSQCRNDYQQAINYFLMVNGFKVSPALIQLMSL"
FT   regulatory      581898..581932
FT                   /locus_tag="LCA_0569_b"
FT                   /old_locus_tag="LSA0569_b"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(581934..582257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0570"
FT                   /old_locus_tag="LSA0570"
FT                   /product="Hypothetical small protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54874"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y55"
FT                   /protein_id="CAI54874.1"
FT                   /translation="MKEAILVYTTLPLIIGSNFSSHHEQEFVMHLNTALAAKQLDWHVS
FT                   LDESFGDSQAIKAKKPDALILKNGLQHQFERHDFDQNQIYQLGALELSTLSTRSVVAFL
FT                   ANH"
FT   regulatory      complement(582260..582273)
FT                   /locus_tag="LCA_0570"
FT                   /old_locus_tag="LSA0570"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      582324..582337
FT                   /locus_tag="LCA_0571"
FT                   /old_locus_tag="LSA0571"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        582341..582625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0571"
FT                   /old_locus_tag="LSA0571"
FT                   /product="Hypothetical small protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54875"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y54"
FT                   /protein_id="CAI54875.1"
FT                   /translation="MFDKTYFDFFKHMSLTGDGTSWYLLALKTPLEAASVIERLQGQFD
FT                   QIRLYGEGYSIRSSLGQAKVIELIEQSLNLKVEQDFQLVSLSQFNAIGR"
FT   regulatory      582778..582791
FT                   /gene="tdcB"
FT                   /locus_tag="LCA_0572"
FT                   /old_locus_tag="LSA0572"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        582795..583835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="LCA_0572"
FT                   /old_locus_tag="LSA0572"
FT                   /product="Threonine deaminase ( Threonine
FT                   ammonia-lyase,Threonine dehydratase, IlvA homolog)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54876"
FT                   /db_xref="GOA:Q38Y53"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y53"
FT                   /protein_id="CAI54876.1"
FT                   /translation="MATNNLVLKTADICDIRDIEEARATIKPYIRETPLIQSMFLSRNV
FT                   AKGNVYLKLENMQLTGSFKFRGANNKINHLTEEQRQRGIVTASAGNHAQGVALTAKLLG
FT                   IDATVVMPEEAPIAKQEATAGYGANVVLHGATFNDARLYMEQLAEEKGMTIVHPYDDRE
FT                   VMAGQGTIGLEILDEIWNVDTVIIPVGGGGLISGVATALKSFNPSIHIIGVQSENVHGM
FT                   AASIDAGKITSHHDDFTLADGTDVAIPGDLTYPVVQNLVDEFILVTEDEIAMAMTDLMQ
FT                   RTKIVTEGAGALPTAALLSGKIDPKWLEDKNIVAMVSGGNVDLTRVSGIIEHLFKPADT
FT                   SKGVVG"
FT   regulatory      583850..583873
FT                   /gene="tdcB"
FT                   /locus_tag="LCA_0572"
FT                   /old_locus_tag="LSA0572"
FT                   /regulatory_class="terminator"
FT   regulatory      583964..583977
FT                   /locus_tag="LCA_0573"
FT                   /old_locus_tag="LSA0573"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        583979..584611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0573"
FT                   /old_locus_tag="LSA0573"
FT                   /product="Hypothetical protein, CAAX protease family"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54877"
FT                   /db_xref="GOA:Q38Y52"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y52"
FT                   /protein_id="CAI54877.1"
FT                   /translation="MVTMNRVCYFIFLVLLTSVIYVEELLGVSNHYLAQHEIRFIVFDL
FT                   IMWGLLLTLLLVIYRRLSKANGPEVTVPVIKKIGIILLMLAASYLLNWFDQQWNPLALP
FT                   QNQVVIDQRMQAAPYLTTIGNGLIAPTIEELLFRGLFFNFFFLKKTRFNGFLKIIVSGL
FT                   IFGSMHELAINYNWLIYCAMGWILGATYYWTKDLKCSMILHALINLL"
FT   CDS_pept        complement(584598..585035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LCA_0574"
FT                   /old_locus_tag="LSA0574"
FT                   /product="Hypothetical integral membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54878"
FT                   /db_xref="GOA:Q38Y51"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y51"
FT                   /protein_id="CAI54878.1"
FT                   /translation="MLKQKLKRNIPTLIYLVTLYIAYQILTTIITVFTDQTILKMAKES
FT                   PSGFIVLFGGFYFLYIILAVGVLYSGHILSKQDGHYELSLLILNILSTFTTLTTIILKF
FT                   SGAQMPAPLLPITFFIILTTISLATTSKLLQMRANRLAKAN"
FT   regulatory      complement(585039..585052)
FT                   /locus_tag="LCA_0574"
FT                   /old_locus_tag="LSA0574"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      585176..585189
FT                   /gene="npr"
FT                   /locus_tag="LCA_0575"
FT                   /old_locus_tag="LSA0575"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        585192..586544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npr"
FT                   /locus_tag="LCA_0575"
FT                   /old_locus_tag="LSA0575"
FT                   /product="NADH peroxidase"
FT                   /function="4.6 Miscellaneous"
FT                   /EC_number="1.11.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LCA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI54879"
FT                   /db_xref="GOA:Q38Y50"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q38Y50"
FT                   /protein_id="CAI54879.1"
FT                   /translation="MKIIVVGSSHGGFETVQESLLDYPDATIQWYEQGDFLSFLSCGMQ
FT                   LYLEGTVKNVDDVSYATPEGMRAKGVDVRLQQAITAINADQHTVQVKDLKNNTTREESY
FT                   DKLVLSVGAVPFELPVAGRDLANVYAMRGRDWAIKLKAKTVDPTVKNVVVIGSGYIGIE
FT