(data stored in SCRATCH zone)

EMBL: CR940346

ID   CR940346; SV 1; linear; genomic DNA; HTG; INV; 5905 BP.
XX
AC   CR940346;
XX
PR   Project:PRJNA153;
XX
DT   15-MAY-2005 (Rel. 83, Created)
DT   26-JAN-2017 (Rel. 131, Last updated, Version 6)
XX
DE   Theileria annulata mitochondrial genome DNA
XX
KW   HTG; HTGS_PHASE2.
XX
OS   Theileria annulata
OC   Eukaryota; Sar; Alveolata; Apicomplexa; Aconoidasida; Piroplasmida;
OC   Theileriidae; Theileria.
OG   Mitochondrion
XX
RN   [1]
RP   1-5905
RX   DOI; 10.1126/science.1110418.
RX   PUBMED; 15994557.
RA   Pain A., Renauld H., Berriman M., Murphy L., Yeats C.A., Weir W.,
RA   Kerhornou A., Aslett M., Bishop R., Bouchier C., Cochet M., Coulson R.M.R.,
RA   Cronin A., de Villiers E.P., Fraser A., Fosker N., Gardner M., Goble A.,
RA   Griffiths-Jones S., Harris D.E., Katzer F., Larke N., Lord A., Maser P.,
RA   McKellar S., Mooney P., Morton F., Nene V., O'Neil S., Price C.,
RA   Quail M.A., Rabbinowitsch E., Rawlings N.D., Rutter S., Saunders D.,
RA   Seeger K., Shah T., Squares R., Squares S., Tivey A., Walker A.R.,
RA   Woodward J., Dobbelaere D.A.E., Langsley G., Rajandream M-A., McKeever D.,
RA   Shiels B., Tait A., Barrell B., Hall N.;
RT   "Genome of the host-cell transforming parasite Theileria annulata compared
RT   with T. parva";
RL   Science, e1252229 309(5731):131-133(2005).
XX
RN   [2]
RP   1-5905
RA   Pain A., Renauld H., Murphy L., O'Neil S., Harris D.A., Quail M.A.,
RA   Berriman M., Hall N., Barrell B.G.;
RT   ;
RL   Submitted (31-MAR-2005) to the INSDC.
RL   The Wellcome Trust Sanger Institute Genome Campus, Hinxton, Cambridge CB10
RL   1SA, UK
XX
DR   MD5; f403b64ba6fa57c48c27c129a61de943.
DR   BioSample; SAMEA3138180.
DR   EuropePMC; PMC1581436; 16963708.
DR   EuropePMC; PMC4717669; 26780836.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5905
FT                   /organism="Theileria annulata"
FT                   /organelle="mitochondrion"
FT                   /strain="Ankara isolate clone C9"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:5874"
FT   CDS_pept        <1..1519
FT                   /codon_start=2
FT                   /transl_table=4
FT                   /locus_tag="Tap370b08.q2ca38.01"
FT                   /product="cytochrome C oxidase subunit I (COX1 homologue),
FT                   putative"
FT                   /note="SMART pfam:COX1 (PF00115) at aa 38-497,
FT                   E()=5.90e-166"
FT                   /db_xref="EnsemblGenomes-Gn:Tap370b08.q2ca38.01"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72674"
FT                   /db_xref="GOA:Q4UJ69"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UJ69"
FT                   /protein_id="CAI72674.2"
FT                   /translation="HTQIYVEKFRHIFVLWFLKNFKFYLVFEFVLSLFNSVSGNHKIIG
FT                   ISYLWLAYWFGMIGFYMSVLIRTELGMSGLKIITMDTLEIYNLLFTLHGLIMVFFNIMT
FT                   GLFGGIGNYLYPVLLGSCDVVYPRVNLYSLLLQPIGFVLVVSSVYLEIGSGTGWTLYPP
FT                   LSTSLSNIGIDLIIFGLLAAGIASTLSSINFITTFASIKTIGFVIDRISPAAWSIVLTS
FT                   FLLLLSLPVVTAVFLMVFFDRNHSTMFFESSNSGDPILYQHLFWFFGHPEVYIMILPGF
FT                   GIISLLLSTYTTKEMFGNQTMILAMGSIALLGCLVWGHHMYTSGLEADTRGYFTTVTIL
FT                   IALPTGNKIFNWVTTLQCVESIKSLGLILFAVLFIVNFVIGGTTGVVLGNAGLDVVLHD
FT                   TVYVVGHFHFVLSIGAIISLICFIVYIQRMLFGIILSNRLLSLMAPIFMIAVLFTFLPM
FT                   HFTGFSPLPRRIPDYPDEMWGWNFICTLGATMMLVLKLTVLFIISLW"
FT   CDS_pept        complement(join(2326..3090,3122..3124))
FT                   /transl_table=4
FT                   /locus_tag="Tap370b08.q2ca38.02c"
FT                   /product="cytochrome C oxidase subunit III (COX3
FT                   homologue), putative"
FT                   /note="SMART pfam:COX3 (PF00520) at aa 56-264,
FT                   E()=6.00e-05"
FT                   /db_xref="EnsemblGenomes-Gn:Tap370b08.q2ca38.02c"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72675"
FT                   /db_xref="GOA:Q37679"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q37679"
FT                   /protein_id="CAI72675.1"
FT                   /translation="MRNSVQSDLKYINIINISETLYLFYSTGLDTLEYIDSTYKNFIIM
FT                   YVNQHLLYGTTLKYLSVGEFFINSLTIFINGIRETMTSSTVIMYAIFGMFIFSEIMVFS
FT                   TFIWGFFHFRLSNPVMIIEVNLEAFLQISDVLNAGSILISLILQRIEERGYFEVDYMLE
FT                   RLILIGFIFLSFQGDEYSLVKSYINNHWVTLYFNVLTGLHSLHVYVGGIFALMQAFASE
FT                   NCGCQKDEDFNAGMYWHFVEIIWIALTMLLFLL"
FT   CDS_pept        complement(4452..5543)
FT                   /transl_table=4
FT                   /locus_tag="Tap370b08.q2ca38.03c"
FT                   /product="cytochrome B, putative"
FT                   /note="SMART pfam:cytochrome_b_N (PF00033) at aa 1-190,
FT                   E()=3.00e-44; pfam:cytochrome_b_C (PF00032) at aa 246-351,
FT                   E()=5.50e-06; 1 transmembrane domain at aa 215-237"
FT                   /db_xref="EnsemblGenomes-Gn:Tap370b08.q2ca38.03c"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72676"
FT                   /db_xref="GOA:Q4UJ67"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UJ67"
FT                   /protein_id="CAI72676.1"
FT                   /translation="MNLFNSHLLSYMVPKNLNLNWNFGFILGILLVLQIISGLMLSFFY
FT                   VPAKGMAFESTLAVMLNICFGWFVRLYHSFGVSFYFFFMFLHIMKGMWYSSNHLPWSWY
FT                   SGVVIFVLSIATAFVGYVLPDGQMSFWGATVIGGLLKFFGKANVLIFGGQTVGPETLER
FT                   FFSIHVILPVIILLVVIFHLYVLHRDGSSNPLAVIDMLAIFRFHPVVLFSDIRFIVIVI
FT                   LLIGVQSGYGFISIFQADPDNSILSDPLNTPAHIIPEWYLLLFYATLKVFPTKVAGLLA
FT                   MAGMLELLVLLVESRYFKQTVSAMNYHRVWTTSSVPLVPVLFMLGSIGKMVVHVDLIAI
FT                   GTCVVLSVVLFIYKLLDSARVRA"
XX
SQ   Sequence 5905 BP; 2057 A; 883 C; 855 G; 2110 T; 0 other;
     gcatactcaa atatatgtcg aaaaattcag acatatattt gttttgtggt ttttaaaaaa        60
     ttttaagttt tatttagttt ttgagtttgt tttaagcttg tttaattctg tttcaggaaa       120
     tcataaaatc ataggaatat cttatttatg gttggcatat tggtttggta tgataggatt       180
     ttatatgagt gtgctgatta gaactgaatt aggtatgagc gggttaaaga taataactat       240
     ggatactttg gagatttata atttgttatt tacattacac ggtcttatta tggtgttttt       300
     taatattatg actggtcttt ttggaggaat tggaaattat ttgtatcctg ttcttttagg       360
     atcttgtgat gttgtatatc ctagagttaa tctctatagt ttgttacttc aaccaattgg       420
     ttttgtatta gtagtatctt cagtttattt agaaattgga agtggaacag gatggacatt       480
     gtatcctcct ctttcgactt ctctttctaa tattggaatt gatcttataa tatttggttt       540
     gttggcagct ggaattgcaa gtacattaag cagtattaat tttataacta cttttgcttc       600
     tataaaaaca ataggttttg ttattgacag aatttcgcca gcagcatggt cgattgtttt       660
     gacttcattt ttgttattgt tatcattgcc ggttgttacc gcagtttttc ttatggtatt       720
     ttttgataga aatcatagca caatgttttt tgaatcttca aattctggag atccaatctt       780
     atatcaacat ttgttctggt tttttggaca ccctgaggtt tatataatga tattacctgg       840
     atttggtatt attagcttat tattatctac atatactaca aaagaaatgt ttggtaatca       900
     gactatgata ttagctatgg gttctatagc tttgttaggt tgtttagttt ggggacatca       960
     tatgtataca tcaggtttgg aagcagatac tcgtgggtat tttacaacag ttacaatatt      1020
     gattgctctt ccaacaggta ataaaatatt taattgggtt acaacattgc aatgtgttga      1080
     gtcaataaaa tcattaggac ttatattatt tgctgtttta tttattgtaa attttgttat      1140
     aggaggtaca actggtgttg tgcttggaaa tgctggacta gacgtagtat tgcatgatac      1200
     tgtttatgta gttggacatt ttcactttgt cctttcgata ggtgctataa tttcattaat      1260
     atgttttata gtttatattc aaagaatgtt atttggaatt attctttcga acagattatt      1320
     gtcactaatg gctcctattt ttatgatagc agttttattt acattcttac caatgcattt      1380
     tactggattc tctcctcttc caagaagaat accagattat ccagatgaaa tgtggggatg      1440
     gaattttatt tgtacacttg gagcaacaat gatgttagta ttgaaattaa cagtattatt      1500
     tattatatca ttatgataag tacactaggc atgcaatacc gaacagggcc agttaaattt      1560
     catttcttgc atcactgcta ttttttagct aaacagaact tttttaaacc ataacttcaa      1620
     cttattaata tatttttctt gttaactatt tgtgcgataa ttacgtcaaa tacctaaaga      1680
     gtcatcaatg atttaatcct ttgtattttt aatgggacca tgaatagata tgtaccattt      1740
     tagtaattca aaagagaatt cataagtaac ctttgtgaaa gtgatagcga gatgggaatt      1800
     gtgcttctat agtttaatat aatttttgaa tctcgaaaaa cagaaaagag atagcgttat      1860
     agctcttgca gtcagtacga agtcgaaaca aggtagttga cagtgaactt gtagctgaac      1920
     aaagtaaaga aacagacgca tagtcaatag ctttgtatat aattatgtta taaaaaattc      1980
     gaatacaatt atatcgtcct ttgttttttt aacatagatg atattctttt atagaaatct      2040
     agattctatt agcatacgta tataacattg aaggttataa atacgtgtcg agcagtgtgt      2100
     tcaaagtagt tattacgcga aaaacattga atttctaaat ttcaagatga atccgatttg      2160
     atgatattat aaaaaatggc taatgatatt atttaatatc agcatgggat tataaaacag      2220
     tatattgtgt atctttattt actgtcagct aaaacgtatc aaattcccta ctctgttacc      2280
     tcgaaaaaat ttttatttat ttcaaatcta tatagtgtgt gtcttttaaa gtaaaaacaa      2340
     taacattgtt aaagctatcc aaataatttc tacaaaatgc caatacattc cagcattaaa      2400
     atcttcatct ttttgacatc cacaattttc agaagcaaag gcttgcatta aagcaaaaat      2460
     acctccgaca tatacatgta atgaatgaag tcctgttaaa acattaaaat atagtgttac      2520
     ccaatggtta ttaatataag atttaaccaa tgagtattca tcaccttgaa atgataagaa      2580
     tataaatcca attaatatta atctttcaag catatagtct acttcaaaat agccacgttc      2640
     ttctattctt tgtaaaatta atgatattaa aatacttcca gcatttaaaa catctgaaat      2700
     ttgcaaaaag gcttctaaat ttacttcaat aatcataact ggattagaaa gtctgaagtg      2760
     aaaaaacccc catataaaag tggaaaatac cattatttct gagaatatga acattccaaa      2820
     tattgcatac attataacag ttgaggaagt cattgtttct cttataccat ttataaatat      2880
     tgttaaacta tttataaaga attctccaac acttaaatat ttaagtgttg ttccatataa      2940
     taaatgttga tttacgtaca ttataataaa gttcttatat gtggaatcaa tatattccag      3000
     ggtatctaat cctgtactat aaaacagata tagagtttca gatatgttaa ttatattaat      3060
     gtactttaag tctgattgta cgctgtttcg tattagacta tataggttaa cttacatagt      3120
     ccattttatt taatattaaa tgaggagcgt ctgttgaata cctacacaag ataatgctaa      3180
     gatttatatc gatgtatatt atctgatacc tgttcagtgg ttaacaacca aacaacaagg      3240
     atctctttta aagtaagaat tgactatcta aataatagtc atgtgaatgg tataacgact      3300
     tctctattgt ctccactaat tgctctatga aatagaccta gctttgaata ggaagcttga      3360
     tatactatga cggtaagacc ctgtgcacct tcactctcct ctaaaataag ttttgcaaaa      3420
     caagaaggta tggtgagacg acatggaggt gtcaatagat taaatacata agtactatat      3480
     ttaatcttta acctgttatc cctggcgtac cttgttacca ataataatta ttagctctaa      3540
     gttctttttt atgtagaata tatattttat ataacctaat cttctcaaac atgaactcgt      3600
     ttttcgccta acatgaattt actatactcg gattatacag tgttgccgcg gctgctggca      3660
     ctgcatgatt ttacaatata atatccaatc cttatgtatg cttgaatgct gtaatcaact      3720
     ttttataaca agtttgaaat actttatgta gttatatata atactgctag tatatttaac      3780
     gtctagtact ttctgacgtt taatatcaat tcctacttcc atcatctttt cttactctta      3840
     aatattttaa taatataata accataattt accttctaga attatgttaa tttgagtaat      3900
     gaaaatatca gtatatacag taacttatta taggtcatta ctcttcataa aagatttcac      3960
     agagaacaat ctataattgt tcaattggaa tttatctgtt aactttattt tatccaacac      4020
     catttcaatg gtgtaaggtt cataccaatg tattaaataa agttagatta caatctttac      4080
     tgaaatattt aattacgtta agtatcagta agatatagtg tgtaaaatca aattaaacaa      4140
     catgttccac tgattttact acttataaca tttcaacatg tatgttatgt actaactgac      4200
     atccaaggca aagaattgta acacattaat gtactgataa atgggatgat tctgacttag      4260
     tgtaattata aaaaatatac aagttaatgt atttaaaaat tttctaacat ccaaatttta      4320
     aagcaatgat agcggttaat ctttcctatt ccttacgtac tctggctata acatttatac      4380
     acttgaaaca agactctttc tagacacaaa cttcccggct aaactcccct ccactaagcg      4440
     tctttcgaca cttatgcacg aactcttgca gagtccaata atttataaat aaatagaaca      4500
     actgacaaca caacacaagt tccaatagct atgagatcaa catgaacaac catctttcct      4560
     atagaaccta acataaataa aactggtact aatggtacac ttgatgtagt ccatactcta      4620
     tgataattca tagctgaaac agtctgttta aagtatctag attcaactaa taatactaac      4680
     aattctaaca ttcctgccat tgccaaaagt ccagctactt ttgttggaaa cacttttaat      4740
     gttgcataaa acaaaagtaa ataccattct ggaataatgt gtgcaggagt gtttaaagga      4800
     tcagataata tcgaattatc aggatctgct tgaaaaatag aaatgaatcc ataaccagat      4860
     tgcactccaa ttaataaaat tactataact ataaatctaa tatcactgaa aagtaccact      4920
     ggatgaaatc taaatatagc tagcatgtct ataactgcca atggatttga acttccatct      4980
     ctatgaagaa cataaagatg aaatataaca actaacaata taatcacagg caatataaca      5040
     tgtatagaaa agaatctctc taatgtctct ggaccaactg tttggcctcc aaaaattaga      5100
     acattagctt ttccgaaaaa tttcaataaa ccacctatga ctgtagctcc ccagaagctc      5160
     atttgaccat ctggtaatac ataaccaaca aaagcagttg ctatacttaa aacgaaaata      5220
     acaacaccag aataccaaga ccaaggtaaa tgattactag aataccacat acctttcatg      5280
     atatgtagaa acataaagaa gaaataaaac gaaactccaa acgagtgata aagacgaaca      5340
     aaccaaccga aacaaatgtt taacattacg gccaaagtac tttcaaaagc catacctttt      5400
     gctggcacat aaaagaaaga aagcatcaac ccggatataa tttggagtac taacaatatt      5460
     ccaagtataa acccaaaatt ccaattcaaa ttcaaatttt taggtaccat atacgaaagc      5520
     aaatgtgagt taaacaaatt cattgcaaat gttaatttgt aggttaaagc cctgtttcct      5580
     aatttttatt tttataactt ttttataaaa tatttgtacc tgtcaagttc cttcactaaa      5640
     tttaactcac agtatagaaa tatattttaa atgtgattgc aaaaatggtg ttaaaattta      5700
     atgcttgaat aaggtttagt aggtatgaga gttcatcata ttaatatggt acgtgagttg      5760
     ggttaagaac gccgcgaggc agttcgttcc ctatctagta tatttaaatc ctttataact      5820
     tacctagact aaataaaact taaaattttt taaaaaccac aaaacaaata tatgtctgaa      5880
     tttttcgaca tatatttgag tatgc                                            5905
//

If you have problems or comments...

PBIL Back to PBIL home page