(data stored in ACNUC9543 zone)

EMBL: CR940347

ID   CR940347; SV 1; linear; genomic DNA; HTG; INV; 2592520 BP.
XX
AC   CR940347;
XX
DT   15-MAY-2005 (Rel. 83, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Theileria annulata genomic DNA chromosome 1 part 1
XX
KW   HTG; HTGS_PHASE2.
XX
OS   Theileria annulata
OC   Eukaryota; Alveolata; Apicomplexa; Aconoidasida; Piroplasmida;
OC   Theileriidae; Theileria.
XX
RN   [1]
RP   1-2592520
RX   DOI; 10.1126/science.1110418.
RX   PUBMED; 15994557.
RA   Pain A., Renauld H., Berriman M., Murphy L., Yeats C.A., Weir W.,
RA   Kerhornou A., Aslett M., Bishop R., Bouchier C., Cochet M., Coulson R.M.R.,
RA   Cronin A., de Villiers E.P., Fraser A., Fosker N., Gardner M., Goble A.,
RA   Griffiths-Jones S., Harris D.E., Katzer F., Larke N., Lord A., Maser P.,
RA   McKellar S., Mooney P., Morton F., Nene V., O'Neil S., Price C.,
RA   Quail M.A., Rabbinowitsch E., Rawlings N.D., Rutter S., Saunders D.,
RA   Seeger K., Shah T., Squares R., Squares S., Tivey A., Walker A.R.,
RA   Woodward J., Dobbelaere D.A.E., Langsley G., Rajandream M-A., McKeever D.,
RA   Shiels B., Tait A., Barrell B., Hall N.;
RT   "Genome of the host-cell transforming parasite Theileria annulata compared
RT   with T. parva";
RL   Science, e1252229 309(5731):131-133(2005).
XX
RN   [2]
RP   1-2592520
RA   Pain A., Renauld H., Murphy L., O'Neil S., Harris D.A., Quail M.A.,
RA   Berriman M., Hall N., Barrell B.G.;
RT   ;
RL   Submitted (31-MAR-2005) to the INSDC.
RL   The Wellcome Trust Sanger Institute Genome Campus, Hinxton, Cambridge CB10
RL   1SA, UK
XX
DR   MD5; 474207dce744e8c64673dc2bb1e8a8cc.
DR   BioSample; SAMEA3138180.
DR   EnsemblGenomes-Gn; EPrG00000717687.
DR   EnsemblGenomes-Gn; EPrG00000717688.
DR   EnsemblGenomes-Gn; EPrG00000717689.
DR   EnsemblGenomes-Gn; EPrG00000717690.
DR   EnsemblGenomes-Gn; EPrG00000717691.
DR   EnsemblGenomes-Gn; EPrG00000717692.
DR   EnsemblGenomes-Gn; EPrG00000717693.
DR   EnsemblGenomes-Gn; EPrG00000717694.
DR   EnsemblGenomes-Gn; EPrG00000717695.
DR   EnsemblGenomes-Gn; EPrG00000717696.
DR   EnsemblGenomes-Gn; EPrG00000717697.
DR   EnsemblGenomes-Gn; EPrG00000717698.
DR   EnsemblGenomes-Gn; EPrG00000717699.
DR   EnsemblGenomes-Gn; EPrG00000717700.
DR   EnsemblGenomes-Gn; EPrG00000717701.
DR   EnsemblGenomes-Gn; EPrG00000717702.
DR   EnsemblGenomes-Gn; EPrG00000717703.
DR   EnsemblGenomes-Gn; EPrG00000717704.
DR   EnsemblGenomes-Tr; EBPr00000717687-1.
DR   EnsemblGenomes-Tr; EBPr00000717688-1.
DR   EnsemblGenomes-Tr; EBPr00000717689-1.
DR   EnsemblGenomes-Tr; EBPr00000717690-1.
DR   EnsemblGenomes-Tr; EBPr00000717691-1.
DR   EnsemblGenomes-Tr; EBPr00000717692-1.
DR   EnsemblGenomes-Tr; EBPr00000717693-1.
DR   EnsemblGenomes-Tr; EBPr00000717694-1.
DR   EnsemblGenomes-Tr; EBPr00000717695-1.
DR   EnsemblGenomes-Tr; EBPr00000717696-1.
DR   EnsemblGenomes-Tr; EBPr00000717697-1.
DR   EnsemblGenomes-Tr; EBPr00000717698-1.
DR   EnsemblGenomes-Tr; EBPr00000717699-1.
DR   EnsemblGenomes-Tr; EBPr00000717700-1.
DR   EnsemblGenomes-Tr; EBPr00000717701-1.
DR   EnsemblGenomes-Tr; EBPr00000717702-1.
DR   EnsemblGenomes-Tr; EBPr00000717703-1.
DR   EnsemblGenomes-Tr; EBPr00000717704-1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2592520
FT                   /organism="Theileria annulata"
FT                   /strain="Ankara isolate clone C9"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:5874"
FT   CDS_pept        complement(<1..704)
FT                   /codon_start=1
FT                   /locus_tag="TA17495"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA17495"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ66"
FT                   /protein_id="CAI72873.1"
FT                   /translation="MKKWTITVNLLFYITFLNQWKAVESQPTSSSRGSPYAGTSPAGGQ
FT                   TSTTKSQNQSASSSSQSRSSQSSSQPASSGSKSIQPTRSSGGTQPSGAGSTPTSQSQSR
FT                   SSQSSTQSARSGTQSQSVKTASQPTTPSSGAGTSASPSGSTQQPKASGTGSSTPPSSAS
FT                   QPPKAGGTSSPTTQTSSTPASQTPTSQSSSQSTGTGTSAGQVSQSPITESQPKSSSSAT
FT                   DQSSSGTSSDGTV"
FT   CDS_pept        complement(join(2448..2675,2687..2977,3054..4289))
FT                   /locus_tag="TA17500"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="TapBAC05a05.q1k.C.cand.2 - score = 17.54"
FT                   /db_xref="EnsemblGenomes-Gn:TA17500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72874"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ65"
FT                   /protein_id="CAI72874.1"
FT                   /translation="MILCIQIPIHCYIFLKILCVLLLYDNVVVWKQSFEPYPVSIYFKS
FT                   HTFHDSYDFNDSPNCYDSHDFNDSYNSYDSNDSYDYDSSTFIPRLYLNFDPYYYTYVYD
FT                   GNMWVLRKDLSHCYSFKLDPSMHPKDITIVTESGGSKESTTGSEESPSSSAGYTVYDHG
FT                   DGIYLYDFGNARCSEVMYCGQTVSKRQSGGPYPRRIVFDTETLTFEFDFKNKTAVYKLN
FT                   GGWYISEVYDNLEYFKYEFPDWICKQSYHRFGSKLSMKNLKILTSDESDGSGAKPINVH
FT                   SSMLLYEKWQFGYYYPVHTLYLELRYKNQVLFKSTEYPYRGRPRIVLFDENNNTIWVFF
FT                   SSGFSFSLNYIDHSDETVLKAEPSTHTEPVVESKTEPSNLVVEPIVIHSKTTSVTPPNI
FT                   LERRSLLISMLLKVSYPQSVIWESTNNVCITVVKIKTTKNVKYLALLLDNNMFLLLNQN
FT                   NDKWTNLSNTKRDIKKFKFLDDNDSELTMSEYIVSLVDFSFCYSLHNCVIFYNNCFSTL
FT                   HDDTEFGNISLFSFSLISNSFYALNADSQQKTIKPKSEIKTKEPKRNRNLLSHKVRVDH
FT                   DPQNPVST"
FT   CDS_pept        complement(4455..12653)
FT                   /locus_tag="TA17505"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="TapBAC05a05.q1k.C.cand.1 - score = 157.72"
FT                   /note="Signal peptide predicted for TA17505 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965, signal anchor
FT                   probability 0.000) with cleavage site probability 0.887
FT                   between residues 25 and 26"
FT                   /db_xref="EnsemblGenomes-Gn:TA17505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72875"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ64"
FT                   /protein_id="CAI72875.1"
FT                   /translation="MKKWTITVNLLFYITFLNQWKAVESQPTSSSRGSPYAGTSPAGGQ
FT                   TSTTKSQNQSASSSSQSRSSQSSSQPASSGSKSIQPTRSSGGTQPSGAGSTPTSQSQSR
FT                   SSQSSTQSARSGTQSQSVKTASQPTTPSSGAGTSASPSGSTQQPKASGTGSSTPPSSAS
FT                   QPPKAGGTSSPTTQTSSTPASQTPTSQSSSQSTGTGTSAGQVSKSPTPESQPESSSSET
FT                   DQSSSGSGSGTDGTVVTKSIEPTKVTLDIDSSQGTSQFGYSKSDKINTFTVKDEHVFSK
FT                   VNKGTDAVWDSKGGDCGTKVIFIDENKKYVSILLTNNMFLLFHLESGQWKDITSTRHDI
FT                   DRLKFFGDSDNPLTKNDFDVTIADYSYRFTFKGGVNCKKIKYADDDLWKDTDDSEFAEI
FT                   TAFDLGLISNNFFVKKGTKFKKLDFNPTQAKGGQSTTPVSEVVTATTVPQTSLTILTED
FT                   APEKAAVTVLSPTGRPRPAKTPEVATGHRTAITLNIAEKASNSAVDFKEDYLKNVMVFS
FT                   AMEKYVFNKIIKTGGSKCCGKTCCESEIVIWEAKDRTEHFHKVYVDGLGTFSKTKNLSL
FT                   HLCNGTFKHLNGSDSGPWSESPGVVDLDVRISNSNIQVDYFKKDNYRIYVAKPGYTIRK
FT                   VMKSKKCSSDCCCPPKVIWEAQNEHALKVVLMGSKKEPKHLGVLMMSGELNLLFKGGKD
FT                   EPWQNITSTKNKITDLKMYAMADDNTVELHKGHYSITLFNEFYGYLFYEGVGCVKVTHK
FT                   GKTIWDLREEGDFGCLKGVFLDLKSNKFNVMNDDDRCWLCEEVRKVNPVTLDVSSKAST
FT                   DDFDFTVDHNRNIKIYTSKGNAMFYQVVKKSSTNCCGSTCCDSEVVIWETKDPQNYATK
FT                   VFADGVGACSSTKNVSIYLLNGDILHFSEGDNVWKKSDSKIVLDVDKTSSTIGYDFVHH
FT                   GETRTFTVKPGYQFKTVMVSKTFSTDHTFWEAQTDEEWSTKVTVYGVQTNVRNINIFKN
FT                   DGSIKHFHKANRKWVSTTPFVLDIESNTDNDLFEYRSTRNFGHFNPKANLTIEKIIKTY
FT                   KSNCCVSTCFGSTCCGSTCCGSIDELVIWTATPEDHGLKAVLMGSGKDEKFMSILLQSG
FT                   NFVLLRKCGKGQCWEDITQDKSDFSNIKMYSLDEGTSNYHELTNNDYDPIIFESRYGYE
FT                   FKEGVKCVKITYNDKPMWSHTDDPEFGYLKGLYLDLPKDQFSVTNLKDQTKQLTRAKIA
FT                   KVTLDINKTESTNDFDHSKKRNFHKYTPKSFRLFSKVVQGTTDIWDSGDYVFGTSVGVR
FT                   TKDGHNYVAVLLDNGSFKLFQESGVNWTDITSSRFNVKMLQFYDKNDYELNSSNYTIEL
FT                   LGHHSCSTISYLFDRGPKCMTVMYGNDIIWDENSCCSYKTIERFDFDPISNIFYAIKNR
FT                   CESKKIEYKPAELAKVIADISKTKDTDQFYYSKDGDCQKYTPKPGNAFNKVVDGAIPIW
FT                   DSKDNIHSSLVRTKSKDDGKYLAILLTDNSFKLFKQEAGKNKPWVDITSQRHDISKLKF
FT                   LGVNDVEIKSSDYKVTIVDYAYEFKFNDSVNCKKIKFGEDVVWKHSDDPKFESITKFQL
FT                   GLISNSFFVVNNKSESKKIEQALATETKISQPKTAPVTLTVSTPVSGAKPKGTPVSVDI
FT                   EKTQSTNDFEYTDDNGVISYKPKSGHAFNKVVDGTKDVWASKDDVFGTLVRIKVTKNIK
FT                   YLAILLDNHMFSLFELVGSDWKDITSQRYDVSKLKFFGENDVEISKTHYTVAIVFLSYE
FT                   FTFNKGVKCKKIKLAHDDVWKDTDDAKYSDIKSFSLGLTSNTFFVKNQSDQSKKVEFKP
FT                   TEVTKVTVDINGTQSTDQFDYTDHNGVVTYKPKDNHVINKLVQGTTDIWESKNDVNGIL
FT                   VRTKVSKGVKFLVVLLDNNMFTVFQEEAGKWQDVTSKRHDVTKLRFIGDNDVELSKTDY
FT                   SVTIVDLSFSHIFNTGVNCKKIKLGDDELWKHSDDPKFESIKSFSLGLASNSFFAKNQS
FT                   DELKKIEKALEAEVPESESLVTATVISPVSAPVSVTKPAVTPVGVDISKTQTTNDFEYT
FT                   DDNGVISYKPKSGHAFNKVVDGTKDVWASKDDVFGTLVRIKVTKNIKYLAILLDNHMFS
FT                   LFELVGSDWKDITSQRYDVSKLKFFGENDVEISKTHYTVAIVFLSYEFTFNKGVKCKKI
FT                   KLAHDDVWKDTDDAKYSDIKSFSLGLTSNNFFVKNQSDQSKKVDFKPTQAKGTQVTKEQ
FT                   TKSEPQVEAKTAQQISSSSPPKGTPSTVTVTKGTPSVTTVTVDVSKTQSTDKLDYSKDG
FT                   DCHKYTPKDNHVFNKVVDGTTNIWESKDDIRCALVRSKFKDDGKYLAMLLTDNSFKLFQ
FT                   LDGNEWKEITSQRHDLSKLKFIGDNDTELKATDFTVTIVDYSYEFKFNAGIKCKKIKLG
FT                   VDDVWKHSDDTKFSEITKFQLGLISNSFFVVNNKSESKKLDFNQTDAKGAPVTTPSKVA
FT                   ADMDKTQSTSDFDYSKDASGFVTFTPKTGNVFNKVSKGNNVIWESKDNVCGTLVMTKTE
FT                   KKEVHLVILLDNYSFVLFHSSDKGKNWTNITSQRHDVKKLKFFGDNDAELSSSDYKVKL
FT                   VDLSYQYIFNSGVKCMKIKLGEEDLWKHTDDPKFTTITMFHLGLISNNFFVKNSSEFKK
FT                   LEFKPTQAKSTPAETKAQASPAAKPNEAKSAQAKPEAQTTQAKATPAATAAQTQAKPQA
FT                   QTTQPEPAKAAQTQAKATPPAKPAGQPKPSAK"
FT   misc_feature    complement(12579..12653)
FT                   /note="Signal peptide predicted for TA17505 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965, signal anchor
FT                   probability 0.000) with cleavage site probability 0.887
FT                   between residues 25 and 26"
FT   CDS_pept        complement(14409..15083)
FT                   /locus_tag="TA09760"
FT                   /product="phosphatidylserine decarboxylase, putative"
FT                   /note="Tap465h02.q1ca.cand.26 - score = 13.62"
FT                   /note="SMART pfam:PS_Dcarbxylase (PF02666) at aa 38-209,
FT                   E()=6.20e-28"
FT                   /note="1 probable transmembrane helix predicted for TA09760
FT                   by TMHMM2.0 at aa 23-45"
FT                   /note="Signal anchor predicted for TA09760 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 1.000) with cleavage site probability 0.000
FT                   between residues 28 and 29"
FT                   /db_xref="EnsemblGenomes-Gn:TA09760"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72876"
FT                   /db_xref="GOA:Q4UJ63"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ63"
FT                   /protein_id="CAI72876.1"
FT                   /translation="MVYSPVSTHGFIYLGLLSLSVSLSLLFSYYVAFFLFVVLVFVVYF
FT                   FRDPKRTVPCDDSLVLSPADGLVTSVELVKSPLGDGTTLTRVAVFLNVFNVHVNRSPVT
FT                   GVVKSVEYLKGKFLNTLDEDSVTKNEMIRTVFKSTHGNHTFIVEQLAGLIARRVVCDLN
FT                   PDNTVKLGSRMGIIKFGSRVNTFVPKEMKVLVSKGQKVKAGETIFAYMDPNTKEPLKYR
FT                   VC"
FT   misc_feature    complement(14949..15017)
FT                   /note="1 probable transmembrane helix predicted for TA09760
FT                   by TMHMM2.0 at aa 23-45"
FT   misc_feature    complement(15000..15083)
FT                   /note="Signal anchor predicted for TA09760 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 1.000) with cleavage site probability 0.000
FT                   between residues 28 and 29"
FT   CDS_pept        15519..16016
FT                   /locus_tag="TA09756"
FT                   /product="hypothetical protein"
FT                   /note="Signal peptide predicted for TA09756 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991, signal anchor
FT                   probability 0.000) with cleavage site probability 0.845
FT                   between residues 18 and 19"
FT                   /note="GPI-Anchor Signal predicted for TA09756 by DGPI
FT                   v2.04 with cleavage site probability 1.72 near 145"
FT                   /db_xref="EnsemblGenomes-Gn:TA09756"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72877"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ62"
FT                   /protein_id="CAI72877.1"
FT                   /translation="MQFVATLIIILLISNSNANKMAETLDISKVLDDEMFKSEDRKEDG
FT                   VSFMRIFPKEGYLISKIIQDYNFIWQRLSYKQECKYVDLYKRNDKPFLIAILVMKPNEE
FT                   TNLYFMNTISTWASISYKEFINSKSRDPNFSGSIPEEIKKSSFKTLGLNYTIIMIIFTL
FT                   SL"
FT   misc_feature    15519..15572
FT                   /note="Signal peptide predicted for TA09756 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991, signal anchor
FT                   probability 0.000) with cleavage site probability 0.845
FT                   between residues 18 and 19"
FT   misc_feature    15921..15926
FT                   /note="GPI-Anchor Signal predicted for TA09756 by DGPI
FT                   v2.04 with cleavage site probability 1.72 near 145"
FT   CDS_pept        16715..17212
FT                   /locus_tag="TA09755"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.C.cand.2 - score = 9.39"
FT                   /note="Signal peptide predicted for TA09755 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965, signal anchor
FT                   probability 0.000) with cleavage site probability 0.665
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA09755"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72878"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ61"
FT                   /protein_id="CAI72878.1"
FT                   /translation="MAKFIYFLVIIFVKLLICECENVVLNISAKPVELNTNKINSNTYF
FT                   VNGLPCKKFAPKPNNSVKKVMEGNIKVWEDSRSECTDAIVYPETDRPKLVHLFITTDAR
FT                   SSHEYYSREGDKWTKIDEAKYRTLLDEFLPQTSRPSMGKKKGSFQLPSLFIVFLQFFLY
FT                   SF"
FT   misc_feature    16715..16774
FT                   /note="Signal peptide predicted for TA09755 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965, signal anchor
FT                   probability 0.000) with cleavage site probability 0.665
FT                   between residues 20 and 21"
FT   CDS_pept        complement(join(17321..17431,17537..17633,17663..17856,
FT                   17887..18024,18055..18159,18191..18259))
FT                   /locus_tag="TA09750"
FT                   /product="cyclin, putative"
FT                   /note="Tap465h02.q1ca.cand.25 - score = 24.00"
FT                   /note="SMART CYCLIN (SM0385) at aa 20-112, E()=7.05e-06;
FT                   134-225, E()=6.36e-01"
FT                   /db_xref="EnsemblGenomes-Gn:TA09750"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72879"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ60"
FT                   /protein_id="CAI72879.1"
FT                   /translation="MIDEHVDKKTYEMLLAYGSEQIQKAGILLQLHAVTIATGQSILHK
FT                   FYLYHSLKEFDIRKTSASCCFIACKLEENHRKLEQIAKIFEFLKYYEDKYYKYSIENEN
FT                   KLKKEILEIEKQILIGFAFRLDKIIVSPHRYILQYTYTLFHNLDKYSSHTVDKLAQRAW
FT                   GYLNDSMRTSLCCMIKPAAISVGCIYLAATSLGIPLKKETMWFKVFETTWEEIVIVCKT
FT                   MYSLYSMGKPKYLII"
FT   tRNA            complement(18353..18424)
FT   tRNA            complement(18688..18759)
FT   tRNA            complement(19541..19612)
FT   CDS_pept        complement(join(19682..19947,19977..20469,20502..20645))
FT                   /locus_tag="TA09745"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.24 - score = 23.66"
FT                   /note="SMART RING (SM0184) at aa 218-263, E()=2.74e-02"
FT                   /db_xref="EnsemblGenomes-Gn:TA09745"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72880"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ59"
FT                   /protein_id="CAI72880.1"
FT                   /translation="MVEILMEDNSGIYYCHYCKSERTENQLDFLLSEEIKCLECQMTGF
FT                   VEKDYVIESDVNTGQNTIGQNTIGQNTIGQNTVYSLFPENQSNESIFSIFGMPLNTFIS
FT                   DLFQGSFCIPMRSVDRNVPMEVRFANDMASFVSSFPFQLTRVENTFEINPEDFSRVFST
FT                   FISDPFNNQSLNQVLQFIMQSDPNRYGSPPASREFINNLKVHTLNEELAKEYESCSICT
FT                   EEFQQGDQVHWLTDNKDLCKHVYHVNCIIPWLKRRNSCPVCRFEVPTDDENYNNQKELL
FT                   RNQITQEVQRNLNTNTTNN"
FT   CDS_pept        complement(join(20925..21193,21286..21386,21423..21517,
FT                   21837..22115,22219..22276,22334..22420,22453..22492,
FT                   22542..22677,22707..22949,23038..23097,23193..24083))
FT                   /locus_tag="TA09740"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 2 transmembrane domains at aa 431-453 and 461-
FT                   488"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09740 by TMHMM2.0 at aa 431-453 and 466-488"
FT                   /db_xref="EnsemblGenomes-Gn:TA09740"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72881"
FT                   /db_xref="GOA:Q4UJ58"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ58"
FT                   /protein_id="CAI72881.1"
FT                   /translation="MESNEYKITNKSNDSMDSNETIDHKDSSELIDHKESKETNLDLLI
FT                   KIIDRDKYYKRKREDTFEESNFTNILIDSDEEGEIELETKGSLLHKDIFNTFNEDYETY
FT                   LSSNSDLESEILFDHPLFSSYKLKNVTPLVKYLLSLREVPNPLTNHFEYHINTLISKRI
FT                   NTLLKSKKIDIPELSSSIKYFFTCLNTYVDVFYLNNRIGTLDSIRFIYSLHIANHITKS
FT                   STKSSSNKSSMNKSSLNKSSLNKCTMNKSSRNEESDVDERTEGFTRPKVLIICGLRCIA
FT                   KDIITNLLKIIPTSKSSKYSSQLESTVVKYSLHYPINKNLERFEMEFSLSDEDLKEQNE
FT                   SYLKTKKAKDYVMTFSGNQDDAFKIGIRYESGLLNLYTPFYSSDIIIASPLGLRPLINE
FT                   PDYDFLSSIEILLIDRIDIIKFQNWKLFLDLFNVIFSYGACSCSRVLLLLVVYSRVIDT
FT                   RYLKGIKVLKGYLGVLGILGIPVYSISRYLRATRYSTRVIYLFKGYLVINKPLLKWRDG
FT                   DINKIRMSIIDGQIEEYRQNIIISSSRSVIFNSFFKNLKNKRGSIRLFIPNNFNYIQLA
FT                   SKFNIQQLFIKVPSNNIKNSHTDTIKYFMENMLPNLEDINGILIILSDYTQYFSISKKL
FT                   KGTNVQYLTCLESNTPKQMKFARQQFQSKNIPILITTIRLLFFKRYLFKGTSKIFLLEP
FT                   PEYVQIYKDLIRMLDENRNNTIICYYTNYHAIVLEPIVGSNNISKLINAPNTKITQFN"
FT   misc_feature    complement(join(22270..22276,22334..22395,22464..22492,
FT                   22542..22581))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09740 by TMHMM2.0 at aa 431-453 and 466-488"
FT   CDS_pept        24180..25901
FT                   /locus_tag="TA09735"
FT                   /product="methionyl-tRNA synthetase, putative"
FT                   /note="Tap465h02.q1ca.C.cand.4 - score = 15.47"
FT                   /note="SMART pfam:tRNA-synt_1 (PF00133) at aa 57-468,
FT                   E()=2.10e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA09735"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72882"
FT                   /db_xref="GOA:Q4UJ57"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ57"
FT                   /protein_id="CAI72882.1"
FT                   /translation="MQILFYIVNVSLKFTKTLFFYLFILKNSISFRNPNSFERSFSYLT
FT                   QSPVHLNLNTKFSLNLFSKTDQRYLITSPLFYLNGPPHLGHAYTLVSSDVLKRFLILSG
FT                   YECKLLVGTDEHGSKIKLTSSNLGYSPKQYVNLMRNHYYELYKQYDISPDIVVHTSEND
FT                   HKSKVKDVFNSFVRSGFIYRGLHKGYFSPKEDLYYTESKLIDGKSPLGFEVSQVNEPAY
FT                   FFKLSSWREKLIDFFKESVIKPNHSLIEVRKSLESDLNDIAISRSNCDWGIPINIMNNG
FT                   ETDQNETVCNETVCNETVSNETVYVWFDALLGYLTHFNSFPQLQDQELKNLKLIHVIGK
FT                   DILTFHSLLWPSILMALDIQVPIKLLVHGWLLNKGEKISKSLGNVSNLEPQLSDVSRFA
FT                   LMSLGDFSSDFEFDSSIFDNSIKILRNKFANTFYRITSLLHNHKLDSVLPTNTDHELIN
FT                   KFHLYTVNITKYMESFRIDKYIQVLMEMSSEVNRFIELNQIWTMGTCELLQISWLLCTL
FT                   LFYISVYLSPITPKLSNDMISRLNPQLNQNTISPSFNIFNNIQHISYYPQHLNILI"
FT   CDS_pept        complement(join(26499..26729,26814..26911,26943..27030,
FT                   27118..27222,27257..27412))
FT                   /locus_tag="TA09730"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.22 - score = 16.94"
FT                   /db_xref="EnsemblGenomes-Gn:TA09730"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ56"
FT                   /protein_id="CAI72883.1"
FT                   /translation="MRNIQIRYITIWRINKPKDKYDRIINEKLYPRNENNITKLWNGIK
FT                   KNILIDSKNPDEETEKYFQFSVQKLMESPGRFTFRKFYNYLQELCMELKLIGKNTLPEE
FT                   QITGTFLQLKNQYNMMSYLTDEEFESDNHKIFTFETKKLISNSLNVDIKDVDDMLLHHE
FT                   TCKIDRTWYFRRLILGRKLPTNFKERDYISYQRPSSNNTTNNINNTTFVDKNFSEIIIS
FT                   SIS"
FT   CDS_pept        complement(join(27626..27764,27795..27891,27921..28118,
FT                   28535..28807,29216..29456))
FT                   /locus_tag="TA09725"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 2 transmembrane domains at aa 95-117 and 179-
FT                   201"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09725 by TMHMM2.0 at aa 95-117 and 179-201"
FT                   /db_xref="EnsemblGenomes-Gn:TA09725"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72884"
FT                   /db_xref="GOA:Q4UJ55"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ55"
FT                   /protein_id="CAI72884.1"
FT                   /translation="MLQYEKLKERLNSINIKRNKKRVTDTRLQLTQYISHIIPITTQRL
FT                   ILSPFIRSSLICQINSNKFKQLFNINNLTPINIFKGTYNRYGIYGLWKGTTLHILSGII
FT                   FPGIYIITNSITNKTKSDYFKKYLESLTICTFSHLFSYPFDTCFTRLSSNYNIHNFRNY
FT                   IKQTIQNQVIKSNMNIGIRNLYSGFLLCLISTSTHLMITLPLNEQIQYKIIENINEEIS
FT                   KNVILKSNIKSLNPIEMKPVELYPFNLIFATVTSFISKTITYPIDTLKVKYQYSSKNGY
FT                   KDFFTHIKVNFINLINFFREMVDLVYVNYIVDLV"
FT   misc_feature    complement(join(28030..28098,28698..28766))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09725 by TMHMM2.0 at aa 95-117 and 179-201"
FT   CDS_pept        join(29587..29668,29698..29943,30478..30581,30964..31299)
FT                   /locus_tag="TA09720"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.C.cand.5 - score = 9.33"
FT                   /note="1 probable transmembrane helix predicted for TA09720
FT                   by TMHMM2.0 at aa 13-35"
FT                   /note="Signal anchor predicted for TA09720 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.069, signal anchor
FT                   probability 0.925) with cleavage site probability 0.033
FT                   between residues 28 and 29"
FT                   /db_xref="EnsemblGenomes-Gn:TA09720"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72885"
FT                   /db_xref="GOA:Q4UJ54"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ54"
FT                   /protein_id="CAI72885.1"
FT                   /translation="MNNKNEFSYRILLIFIHIIFVLVILSSGSLTGLYYFKPFIHVGLK
FT                   YPQEQINIWNITLSDTNLILTGGNFKTNIAFYNTSIFPITYEPQQVDLFYYPIGEQPSC
FT                   MLLHSSDYHFDPMSDSCSISKIYNTINQNNDSFFKISDLKITMGSSGWDFSIPKYKELI
FT                   WNIGFEVPYEDLSSIKRIYMDCVKFNRVLFSILLKGNVLNYLFMRKEIDTTFELLIPME
FT                   CSIDPNIHNLFHSHNAPNHSIIFNNLKHTSFKF"
FT   misc_feature    29587..29670
FT                   /note="Signal anchor predicted for TA09720 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.069, signal anchor
FT                   probability 0.925) with cleavage site probability 0.033
FT                   between residues 28 and 29"
FT   misc_feature    join(29623..29668,29698..29720)
FT                   /note="1 probable transmembrane helix predicted for TA09720
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        join(31429..31722,31798..32064)
FT                   /locus_tag="TA09715"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.C.cand.6 - score = 7.21"
FT                   /db_xref="EnsemblGenomes-Gn:TA09715"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72886"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ53"
FT                   /protein_id="CAI72886.1"
FT                   /translation="MDELLCVWNSIFSESNEYTFGYNEKLYNLLITQEYTNYINSSKNI
FT                   NSSKNINPTKDINSFNDIKPYSFKQILQIILNNNDPEINIILNTFFNLREYLINSFNEI
FT                   MIENGFEELLKDSIKLIIVDAFNRKLKQMNIDFTPILIDVTGVKNIEQFLQIIKEIKLL
FT                   INQINNINNNINIKQNIINNVIL"
FT   CDS_pept        32569..34767
FT                   /locus_tag="TA09710"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 2 RRM (SM0360) at aa 536-601, E()=4.49e-17 and
FT                   620-689, E()=1.91e-11"
FT                   /db_xref="EnsemblGenomes-Gn:TA09710"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72887"
FT                   /db_xref="GOA:Q4UJ52"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ52"
FT                   /protein_id="CAI72887.1"
FT                   /translation="MNRNRNIRSSLDNSYTPRQNYLNDESNERNFKLNTRSRNNFNSFN
FT                   NRINNRDTRDTREVRDTRDTKEFTRDTKDYDNDNFRDSRDTLRDTREPTRDLRDPLRSR
FT                   DTMETRDRDIRNVKRDYDTITYQNSKDSTQFNYSNRINTPRDGRDSRDSKEFTRDRDTV
FT                   DTRDSKEYIRDTKEFTRDTPRDTLRETMDTRDNLDTRDREVRDSRDTRDTLRDTMDNRD
FT                   SRDYDDNFRDTPRDTLRDTRDTRDTMDTRYDRIGPYERRNQPYQSNNGNLRNSGPIRKS
FT                   NITYNRYQNNRYNPNFNPNNRYNPNNRYNPNYNPNYNPNNRYNPNYNPNNRFNPNYNPN
FT                   NRYNPNYQNNRYNPNYQNNRNDPNNRYDTRYDNRYTDSRNDTRYTDRNDRYDTRDMRDT
FT                   RDYTMDMRDNMDTRDDRRYTDNRYDNRYSNDNRYTDRNYPNDRYDTRYTDRSDPNNRYP
FT                   NDRYDNRYTNDTRYTDSRNDNRYTDRTDRTDRTDRTERYDRTERYDRNDTRYDRNDMEL
FT                   RNMEDINVIRNKERIHRTKIFIGNLSGDVTQEELTDKFSSFGPINRIDFRRKFAFIDYV
FT                   RSKDADAAIRDMHNKFIWGSYLKVQPHIDQNKRLSSRDPKPSFQITVSNLDQSVSWQDL
FT                   KDFGRQAGDVHYTSIIIKGDKRFGLIEYTNEQSVQKAMNELNGQKIVDNILELTHIPMS
FT                   EFFKKLGYNDSIESHIIDDDIQLYVTVTGPTPAPKGAS"
FT   CDS_pept        complement(join(35529..35636,35672..35804,36389..36902,
FT                   37140..37217,37364..37628))
FT                   /locus_tag="TA09705"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.20 - score = 9.08"
FT                   /db_xref="EnsemblGenomes-Gn:TA09705"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72888"
FT                   /db_xref="InterPro:IPR008580"
FT                   /db_xref="InterPro:IPR042266"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ51"
FT                   /protein_id="CAI72888.1"
FT                   /translation="MEDSTSNSTLSSSTLNSTTLNSTNTTNSTPNLPTTITTKDTTNGN
FT                   VNMEMMNEITNEHGMIAKEIVYNSILSGDFTPKNFHTNSNINNNIVRSNSTKSLNNFKI
FT                   NSPIKFNTNPGLIKINSNNELFKTFTSNISNDLTHTNTNSSINSIGISGISSISSIGPD
FT                   TVTEDIQIAPNNINLNEVYLNNEVYLNIYDLEKINYYVNSMANSMGIGAYHAGIEIYGT
FT                   EYNYGYNPKGGTGITSTIPKFHPYHKYRKTINLGKTKFTPLQVQNIIQNMKSYWIAYDY
FT                   NILHRNCLNFAKELSERLEVDEIPEWVMGLQNKINWTKKNINKGTNKLKVYNLFFSKSN
FT                   FFPTNFYSKFFSFSSKFFTKFSNFI"
FT   CDS_pept        complement(38037..38660)
FT                   /locus_tag="TA09700"
FT                   /product="small GTPase (Rab11 homologue), putative"
FT                   /note="Tap465h02.q1ca.cand.19 - score = 11.60"
FT                   /note="SMART RAB (SM0175) at aa 10-174, E()=1.66e-93"
FT                   /db_xref="EnsemblGenomes-Gn:TA09700"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72889"
FT                   /db_xref="GOA:Q4UJ50"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ50"
FT                   /protein_id="CAI72889.1"
FT                   /translation="MAEQTYDYLFKIVLIGDSNVGKSNLLDRFVKGNFKLDSKSTIGVE
FT                   FATKNVNLKNGKIAKAQIWDTAGQERYRAITSAYYRGARGAIVVYDIASKQSFYNVSRW
FT                   LSELNEYGDPNMIIALVGNKSDLTHLREVTFEDGERYARSNNLLFFETSCLNNENIDTT
FT                   FGELLNLICDNHEKFGETVTGSQVSKTITLTKPKKMKKKLSKCC"
FT   CDS_pept        join(39215..39397,39428..39634)
FT                   /locus_tag="TA09695"
FT                   /product="30S ribosomal protein S8, putative"
FT                   /note="Tap465h02.q1ca.C.cand.8 - score = 9.09"
FT                   /note="SMART pfam:Ribosomal_S8 (PF00410) at aa 23-122,
FT                   E()=7.90e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA09695"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72890"
FT                   /db_xref="GOA:Q4UJ49"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ49"
FT                   /protein_id="CAI72890.1"
FT                   /translation="MQRMCEMIIPLMKTDTYNQWCRYHILNVQILQLLLNEGYIRGYSI
FT                   HGDRINILLKHYKGSPVIRNIRVISKPSRDIWVTPHELKSRTKFNTGLWIIQTPIGIIS
FT                   HRDCINMGIGGKMLIAINNQFQHFC"
FT   CDS_pept        join(39696..39813,39870..41536)
FT                   /locus_tag="TA09690"
FT                   /product="cell-cycle-control protein (translation
FT                   regulation), putative"
FT                   /note="Tap465h02.q1ca.C.cand.9 - score = 28.09"
FT                   /note="SMART MIF4G (SM0543) at aa 101-284, E()-1.24e-24;
FT                   MA3 (SM0544) at aa 406-511, E()=6.25e-21"
FT                   /db_xref="EnsemblGenomes-Gn:TA09690"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72891"
FT                   /db_xref="GOA:Q4UJ48"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ48"
FT                   /protein_id="CAI72891.1"
FT                   /translation="MNETTSSNDSNMNPSNSTNPHSTTTNSTTTTDDTMNNINEMNLSE
FT                   NLENSKTSVTSKVSTSITLSRTGGIYIPPFKLQRLQYEIEPDDSIDYQRQEWERLRKRI
FT                   NSIVNKLTLTNVAQLVVELLECNLIRGRGLFARTWIRAQMASPGFTPIYASFLAIVNSK
FT                   FPEIGELILKRIILQFRRAFKRNDRIVCQSCIKCIAHMVNQKIAHEIVALQLLAILLEK
FT                   PTDDSVELAVDFVRDVGNFLHDNCKQGLDSVFDRLKSILQYGLVDKRTQYSIEALWKHW
FT                   RNGFNEFPSILPELDLLEEDDQITHDIDFLDENITGDEGINIFHPVDPEIYKLENIKWN
FT                   NIKIELLGDYNTDTSEDSELDTDTDVDDDDLVDRGDRGDKGNKVDKGNIEEGVEIKDMT
FT                   EQEIISLRKIIYLCIMSSLNYEECVHKILKLNIKGNEMEVCIMLIDCCSMERTYQIFYS
FT                   LQAELLCKLMLSYKTNFEECFNRQYKLIHRLETGKIRNISKFFAHLFYSNSIDWQIMKI
FT                   IRITEEDTTSSGRIFIKILLQELVQHLGIEGLSRKFHDEDVFNHMFPSDLPKNIRFSIN
FT                   FLTAIGLSQLTNTLRSLL"
FT   CDS_pept        complement(join(42287..42874,43150..43383,43502..43567))
FT                   /locus_tag="TA09685"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.18 - score = 14.98"
FT                   /note="SMART 2 RRM (SM0360) at aa 10-78, E()=5.08e-16; 177-
FT                   249, E()=4.52e-22; WW (SM0456) at aa 125-157, E()=1.32e-08"
FT                   /db_xref="EnsemblGenomes-Gn:TA09685"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72892"
FT                   /db_xref="GOA:Q4UJ47"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ47"
FT                   /protein_id="CAI72892.1"
FT                   /translation="MAESTSVNAKLFVGSIPTNVSEEELKEELSKYGQLVSLFYMPDQM
FT                   KQNNGWAFVTFESNQSASNAIDALNGKIVFEVSRYGARSTANHHYEFFSYIRLYISSNV
FT                   GLEVVYASQRSMVENQTSTPAVSVLWQQFTTAEGVPYYYNVRTGQTQWEKPAELMAPAR
FT                   AVAGGSSFGPPGANLFVFHVPANWNDLDLVEHFKHFGNVISARVQRDSAGRNRGFGFIS
FT                   YDNPQSAVVAIKNMNGFSVGGKYLKVQLKKGEEHYMQMEPIQSHYPQHTYGTQINNSNG
FT                   NTLTPKYQMHYNPY"
FT   CDS_pept        complement(join(44253..44513,44659..44788,44896..45391,
FT                   45621..45833,46223..46847))
FT                   /locus_tag="TA09680"
FT                   /product="sphingomyelinase,, putative"
FT                   /EC_number="3.1.4.12"
FT                   /note="SMART pfam:Exo_endo_phos (PF03372) at aa 5-364,
FT                   E()=3.10e-23"
FT                   /db_xref="EnsemblGenomes-Gn:TA09680"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72893"
FT                   /db_xref="GOA:Q4UJ46"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ46"
FT                   /protein_id="CAI72893.1"
FT                   /translation="MINILLIIIIKCVNCFFSLDSDELFGPISPFNPSKKLESELSFIK
FT                   HTLSNERHPYSLQNPIDQLLRCEFDLIDKYSIRIELLFESINILIPEEKQKILEPIIKR
FT                   NYENMLEIIKKSLILLQNNLLILTEEYEKPNYELKQREHRTFITYNYIEEIIIIIKNLL
FT                   ITLEMELNHELINIIKMKILLLTLSLRIIFLESIYNLGYLKGLNMIMSYNVQCIPWYLV
FT                   PGYNIGIRSRILPKYLVEIVNKYSIDVLILQECFDKNIFNSFKNSLYHLLPFSTNLIGC
FT                   KNEWDSTMNNSNRWLILINGGVCILSRYPIINRHQLIFKNCRNTCSLASKGACLAVINK
FT                   GNKRINIIGTHLQAYDGPSKFIRQQQFNEIIQWLMTLDVNINDPYILAGDLNTCCLTDT
FT                   SEFNTMLSNENFIKFTHTFDFKKDPTYCSITNDYCKICTLPRYGVSSLSHSSYTFSSST
FT                   LHNHRISSLSRSTLYGCKISSLSQGLFSYSFNSYCFSYCLTKHRNAVIGNVESISTVYD
FT                   YILAGPGVKVIHPQTVIHDKLESPIKVRKYYFFCIGTHTMETYNPSDHYPIYSILAI"
FT   CDS_pept        48407..49027
FT                   /locus_tag="TA09675"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.C.cand.10 - score = 15.35"
FT                   /note="Signal peptide predicted for TA09675 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.965
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA09675"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72894"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ45"
FT                   /protein_id="CAI72894.1"
FT                   /translation="MKFVILALLALVSGLHAAKLDLKDLGFVLFGKHGEGDKVTFTAGT
FT                   CPLTLPDTVFLHKTFKKGDHFFTWVRPVHAKVDEVVCGTHKVWKAAVGEVLLDLHFVGK
FT                   PSDVKFLHLELFHPAVGSHHLFLKFVAGGGLAGVLGMGAFVDGVHKLVAGLPELEGLPA
FT                   HPFVHALAAHAAHAAHVADASHQGHAADCGLTAAHAGGEGAAA"
FT   misc_feature    48407..48457
FT                   /note="Signal peptide predicted for TA09675 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.965
FT                   between residues 17 and 18"
FT   CDS_pept        complement(49214..50032)
FT                   /locus_tag="TA09670"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.cand.17 - score = 9.65"
FT                   /note="Signal peptide predicted for TA09670 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.682, signal anchor
FT                   probability 0.000) with cleavage site probability 0.519
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA09670"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ44"
FT                   /protein_id="CAI72895.1"
FT                   /translation="MLLIKLIILFILYNINSINSENSEINNDIIESFKLMYKQISYTSY
FT                   YIKRRIDKISYERPSLLSYVKSMKLDNENILKELGITILKELPLRTSSLDINYDINYDI
FT                   EYDKKHFEDYILVESKIKLTLELLFHSFSYWKVHFNHIVGFFNKDINRLKNDTVYKLIY
FT                   QDFILIFFPIIKLIYQHYNIKYINVLEQELFSKQIYIYGIKSFMDSECFIGFHNESSLI
FT                   QLIKKTYWTDIDLINRMIKDIYKHFNILPNDIKSLFNIFNIYKSNLNLIS"
FT   misc_feature    complement(49973..50032)
FT                   /note="Signal peptide predicted for TA09670 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.682, signal anchor
FT                   probability 0.000) with cleavage site probability 0.519
FT                   between residues 20 and 21"
FT   CDS_pept        join(50223..50306,50340..50372,50487..50623,50716..50920,
FT                   51811..52153,52323..52519)
FT                   /locus_tag="TA09665"
FT                   /product="ribonucleoside reductase, putative"
FT                   /EC_number="1.17.4.1"
FT                   /note="Tap465h02.q1ca.C.cand.11 - score = 9.54"
FT                   /note="SMART pfam:ribonuc_red_sm (PF00268) at aa 18-299,
FT                   E()=3.20e-11"
FT                   /note="1 probable transmembrane helix predicted for TA09665
FT                   by TMHMM2.0 at aa 175-197"
FT                   /db_xref="EnsemblGenomes-Gn:TA09665"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72896"
FT                   /db_xref="GOA:Q4UJ43"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ43"
FT                   /protein_id="CAI72896.1"
FT                   /translation="MIYKYLPYTSILKVQNDEILLKENHNRWVMFPIEHDTFWILYKEV
FT                   ENNFWAAEDFIFTDDIKLLYQLPKPIFNTLLNLLSFHINLDNKLICRPVDITLDLLSEV
FT                   QIAEARAFYGFQLTDENIHTETISSMFQLFNQQLDTNIVSSNTLFLSSYGMDKIIWLYN
FT                   ECENNKCFFKRVLLLVIMKLLFYCSINILRDYLLKEKLLPTFITAFDSITNDRIIHTRF
FT                   AHCTFRLLQNKMLESEVLEIIKQALKLEYQFILQYFTIQFFNLSTNVIKSYLEWIGNNI
FT                   LLVCGYKTLYTSEFDIDWLNHPIIDLNIQKQTNKIQKHNENLNDIKFDEDF"
FT   misc_feature    51874..51942
FT                   /note="1 probable transmembrane helix predicted for TA09665
FT                   by TMHMM2.0 at aa 175-197"
FT   CDS_pept        complement(join(52787..52972,53251..53421,53656..53782,
FT                   53901..54043))
FT                   /locus_tag="TA09660"
FT                   /product="vesicle transport protein, putative"
FT                   /note="SMART pfam:EMP24_GP25L (PF01105) at aa 4.00e-06"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09660 by TMHMM2.0 at aa 10-29 and 176-198"
FT                   /note="Signal peptide predicted for TA09660 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.728, signal anchor
FT                   probability 0.242) with cleavage site probability 0.670
FT                   between residues 23 and 24"
FT                   /note="GPI-Anchor Signal predicted for TA09660 by DGPI
FT                   v2.04 with cleavage site probability 0.11019999 near 173"
FT                   /db_xref="EnsemblGenomes-Gn:TA09660"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72897"
FT                   /db_xref="GOA:Q4UJ42"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ42"
FT                   /protein_id="CAI72897.1"
FT                   /translation="MFFILKYIKLILCIILFYSYTLSINITLSPKELRCFTSYASKGDK
FT                   IIGSVGVVPTDSMIEVNLYRVENNLIHNKRDNPIPSLDFSNLNFNVLENSFYSLCVTNH
FT                   HSDYVTFVISFRVETISNKGMSSLSTVEDLKGVITYAERLLTSTREIMERMEAYSTREY
FT                   LLSKIINKMNSRIITWSIIQMIVVVGLCCYQIYHISSFFEVKSFV"
FT   misc_feature    complement(join(52820..52888,53957..54016))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09660 by TMHMM2.0 at aa 10-29 and 176-198"
FT   misc_feature    complement(53522..53527)
FT                   /note="GPI-Anchor Signal predicted for TA09660 by DGPI
FT                   v2.04 with cleavage site probability 0.11019999 near 173"
FT   misc_feature    complement(53975..54043)
FT                   /note="Signal peptide predicted for TA09660 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.728, signal anchor
FT                   probability 0.242) with cleavage site probability 0.670
FT                   between residues 23 and 24"
FT   CDS_pept        join(54191..54394,54547..54915)
FT                   /locus_tag="TA09655"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.C.cand.12 - score = 14.79"
FT                   /db_xref="EnsemblGenomes-Gn:TA09655"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72898"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ41"
FT                   /protein_id="CAI72898.1"
FT                   /translation="MEVNKWNEMEGNIWKDNINMEEVELILNKAKELEIKEEIENFIIY
FT                   IQNIIKELNNYYFPNKPNPAIYTILNNSLNILNMKIKNKTQSKFKFKSNSNTVSDTVSD
FT                   TVSDTVSVTELGPTETTAPKGTEVTSNIGTNTKDITTKSTTTKSTTTKDTSTEDITAVV
FT                   PDTVTEKLNEVKIFNENYIIKNIQNQK"
FT   CDS_pept        join(56303..56420,56494..56567,56749..57121,57312..57370,
FT                   57402..57476,57530..57709)
FT                   /locus_tag="TA09650"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.C.cand.13 - score = 11.97"
FT                   /db_xref="EnsemblGenomes-Gn:TA09650"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72899"
FT                   /db_xref="InterPro:IPR006786"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ40"
FT                   /protein_id="CAI72899.1"
FT                   /translation="MELKDEINILQDNIRIILQEKKQINLTLKKLSNQLINFNNGDSNV
FT                   LLSNKVLNNNSFDSKRKLKDEENYKEYEPEKRPRIEDDNETIHRHKRLMKVGLFGYLLK
FT                   AKDALVKEKDNQLVCYPVTVLGHTANHQPRKGLLINSLVIQLYTLSSYITISTLHSCKI
FT                   SSLSRSIKSVYFLPFQGLFSYIPYRDTKLEEKQKEQSTLLQKDIQEQYDINKNKLEILN
FT                   KELLEKQTQLMRMKLKEHYESMGNFIATSTQPTIFWIPFKFNHHLNTLRNTTKNFINKK
FT                   IELILNTNYYD"
FT   CDS_pept        complement(join(58326..58390,58466..58694,58798..58869,
FT                   59245..59319,59370..59440,59552..59702,59735..59787,
FT                   59909..60008,60197..60463))
FT                   /locus_tag="TA09645"
FT                   /product="lipoate-protein ligase, putative"
FT                   /EC_number="6.3.4.-"
FT                   /note="Tap465h02.q1ca.cand.16 - score = 10.16"
FT                   /note="SMART pfam:BPL_LipA_LipB (PF03099) at aa 52-170,
FT                   E()=4.30e-15"
FT                   /db_xref="EnsemblGenomes-Gn:TA09645"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72900"
FT                   /db_xref="GOA:Q4UJ39"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ39"
FT                   /protein_id="CAI72900.1"
FT                   /translation="MNKLLIIFSKELNIYFNLSLENYLLNTISNGRLWKFVKNNFDRVL
FT                   YFWRNSECVIIGRNQNIYSECNLNNIHQNVNIVRRFTGGGAVYQDLGNMCFTIITDTKN
FT                   YNFNTNSQIICSAISKLIQQKCEPTGRNDMCINGLKFSGSAFKILPNVALHHGIPVTVL
FT                   GHTANHQPRKGLLINSLVIQLYSSLWRRTILLNINKSSLEKYLTPEKSKLDKHNVKSIE
FT                   SRITNLAQFKPNITYEQIMELDKNNEICNEKEFKECYDKLTDRNWIFGKKLNWKSLKKR
FT                   FDFGSIEFCLNIKNENVENVYIYSDMLNADFIDYLNIKFNETIFKYNTQSFEHIFNSLQ
FT                   FPNLQEQIQEIKNWILQSIN"
FT   tRNA            complement(60637..60709)
FT   CDS_pept        complement(join(60829..60938,61205..61408,61671..61813,
FT                   61919..61970,62064..62161,62246..62334,62552..62670,
FT                   62816..63109,63682..63732,63889..63955,64060..64173))
FT                   /locus_tag="TA09640"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.15 - score = 7.21"
FT                   /db_xref="EnsemblGenomes-Gn:TA09640"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72901"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ38"
FT                   /protein_id="CAI72901.1"
FT                   /translation="MFVKYLFKRLKIYYFYPIFKLTNTFTFCDSNTFFTNKQNVYMFGY
FT                   KNSLPEGLNNHKLFQTIDKNSKLYIWGSNKENIYVIKNINNILENINNHTNGTSSTTGT
FT                   NNTTNTTNTNANTTNTTTTNGPDTVTENEKIKFEMEEIKEFTNKLLYNNPKIIRMNIGQ
FT                   YHNAFISDDGTLYCSGNNEYGQCGQKPKQLYKDSTFLIYKQNNIIEHIPPTKVKFKENV
FT                   KIKDVVCGLTHTICIDTNNNIYSFGDDNKIQLFFGESRGKSIFEHRYYKTYLKYIYNFS
FT                   PINTSTIIYNNKEKHLQYVPIKINNLSFLKNYENIIKNSIINLQAGNYFTIISITPINH
FT                   NTNGSIIIGSGNNEYGQCGSMDPMTTVPKKIKISNKYVKQLSCGSSHCLLLTHDNYIYY
FT                   WGDNKFNQLNQNKKKIIIPEKLKMKENEEIKYIKCSYNNSVIITKTI"
FT   CDS_pept        join(64296..64421,64538..64758,64841..64978,65108..65903)
FT                   /locus_tag="TA09635"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.C.cand.14 - score = 19.83"
FT                   /db_xref="EnsemblGenomes-Gn:TA09635"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72902"
FT                   /db_xref="InterPro:IPR022209"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ37"
FT                   /protein_id="CAI72902.1"
FT                   /translation="MDEINKELIEKNKNQWISSNKIESEGLEWLYNDPTIQNNNQLELY
FT                   LLGKSIPGSREELKKLDEKSIGSLLNTEETNLYEQTLNKFREDPLYIIKKLETQQQQII
FT                   NKYTNLNQYIHNTSTKGEGASTVREKNNSTKIATTGKGANFTAMECTPGKGANFTAMES
FT                   RDRSRERTRDRRSSSRDKERDRYRSRRIRSRDRDRSRDKDRRSLSKDRYRDRYRRSPSR
FT                   DRHRDKDRTRNSYRKSKSNSPDRKYNKSNSPYRKSTNENSPDRKYEENLNKEKLKGPEK
FT                   PKKYNPMKYAFGVNDDICPPIEILQTAKLKQLQQEKEQSKEQLEQSKEQSDEQSVQREH
FT                   QSVQREHHSVQREHHSVEREQMLNEGKLYIKDKLDKLSNVNITNDITNITNVDENLKEE
FT                   YLMKIKRKLFENTNLSNIIKHKIHKHK"
FT   CDS_pept        complement(65960..66121)
FT                   /locus_tag="TA09630"
FT                   /product="cyclin-dependent kinase regulatory subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA09630"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72903"
FT                   /db_xref="GOA:Q4UJ36"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="InterPro:IPR036858"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ36"
FT                   /protein_id="CAI72903.1"
FT                   /translation="MLPREYIMNINGYGKRLLKEYEWKQFGIQISNEWIHIGYSPYELH
FT                   ILIFQKIN"
FT   CDS_pept        complement(join(66971..67676,67707..68103,68520..69461,
FT                   69834..69915,69949..70051,70157..70272,70365..70502))
FT                   /locus_tag="TA09625"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART pfam:GTP_EFTU (PF00009) at aa 123-280,
FT                   E()=1.40e-06"
FT                   /db_xref="EnsemblGenomes-Gn:TA09625"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72904"
FT                   /db_xref="GOA:Q4UJ35"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ35"
FT                   /protein_id="CAI72904.1"
FT                   /translation="MLYYSSIKLYKGKNNPIGRIGFRKILFNGRKQKSPEILLPPFISI
FT                   SELRLMLNLDYISCFRNAKISITKNLYKWSDSYGRTFQTNNKRNIIISYDISSYLSKLM
FT                   GYKPIKIDPEPKIPQKIKNHIPIISIVGHKNHGKTTLISNFTDVKNNNYIINSYNIIEE
FT                   KLKYIILDTPGDMNYDIIRGRAIYNSDICIIVISSQGPEIITRNVILQADKFKIPILFC
FT                   ITKTDLYFNLEILKSELQLQCEILYQSGHLSNNYFNEINNLILSNNLKTILNKYIKLRY
FT                   GDWSHGSNSTNSNPLTSTEVTTTIGASTVTEENNNTKIAASGKGANFTAMECTTGKGAN
FT                   SMGMECTMRKGANFMGTECTMGKGPNSTAIECTKDNMDTKEDPFGSSTEDTSLGGPDTV
FT                   TEKYKKYIRRSNSLIKSGNGIKGIGNIIEITKTESKGIIINLLVKFGQIVEGNYFIVGT
FT                   TYEKMNMVGVGELVSITGLKSLDGVGLDDTLLIMSQHDAFRLCQYRKQLEILKSSQIQG
FT                   PPIHSFNIQSGAIEGVDEGEVRVDEGIEYITKYSGNGMVVGGEGVRSTKEAGEVVGCRD
FT                   TVTVTDYKINKFENIESTIYLKPLEYDTVTVLGPTDSTNDSTVVPGTNSTTKDTTGPST
FT                   VTEENSTTHFAAPGKGANFTAMECTMGKGANSMVMECTSEKILNEIAVVTKTGESSTFV
FT                   DTNTKGTVGPSTVTVPVTGKKIIPIILRVNYMSILEIILNGIEEIEKEYNVRIPLIHGG
FT                   IGPIIPIDIVQAQIGNKFTYCPVYSFQVPIHNDAIKHAIINKIVIKSFNIQSDLFNDII
FT                   QRCKTTLHKYNNSIS"
FT   CDS_pept        complement(70615..74154)
FT                   /locus_tag="TA09620"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.13 - score = 52.74"
FT                   /note="SMART PH (SM0233) at aa 749-938, E()=9.43e-01"
FT                   /db_xref="EnsemblGenomes-Gn:TA09620"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72905"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ34"
FT                   /protein_id="CAI72905.1"
FT                   /translation="MENLDIERWKLYELSIILNNFNIKVPQITKSVINSFGKILDIFDY
FT                   NFKLKNPKFINQIENNNLFGNLENNNLLGNLENNNLLRNGLVNGLENGLENGLENGLVN
FT                   GLENGLVNLENGDLLGNMENILPINIEFLSKNTKIQYNNYLTNLNKYNKLIENKIGNGS
FT                   GSGSGNEGGNGNEKGNEGENGNQLENETRNENLNENKNLCLNCFIKFGINYCNKCFKYF
FT                   CNQCFIKHSPVTVLGPTDSNCASTGKDDNNSTNNNPLTNTDTTGTTGPTTSTKDPTGAK
FT                   DTIGPSTVTKGKGANFTLMECTPRKGANFTLMECTPRKGANFTLMECTTTNPLYTNPLT
FT                   TTITTTNPPITGLEVMLYNEIKTFPYELCNKHPNSPNTPVNPNSSLNPLNPNTTLSPLN
FT                   PVNPINPVKNELEKRLVCITCDFKLICEKCRLEHRNHKIIIIEMGIIEIKEYINDCIGI
FT                   LLEKKNSYIPIKLELRQIKLNENNRINNIIQSINDILRNKIYIIENEIKILQQLCTNQL
FT                   NYLLNLSNKFNNYLIKKLLRLKNFLQINDPGLQLNIFIEIKNDYESLLYFSQDLNDLIL
FT                   DIPHWQLNVNNINNLLNDLNFRINNNLEEFFTLFQFFINIINETREFILSVTSVTVLGQ
FT                   AESNGPKVSSSKGIKGVGEDIGTIGASTVTEENNSTKIAATGKGANFTLMECTSGKGAN
FT                   FMGMECTMGIKDTKGVGVDTKLAPFGVGGKGAKLAPFGVVGRGPVTVTEEIIYNGELRG
FT                   IFWRKDYIHRIICKRAIILYNNKLYIFNNDNPFNSVTVSGTPNSTSPNRSTGISTIGPS
FT                   TVTQGKRANNTFSTTGKGTIGASTVTEGKGAIGSRFESQSSNITGRGPDTVMEEIESII
FT                   ELKSVILRTYDDENLSDFSKLIRIRMPNGFELIEKNGKETRIWSFTNESKNLILLWISK
FT                   LKLLTKNNFTNNNFNNNNLSIGKDFNLPIPPINKVNSPVTVSGTTGKGDNSMVTECTMG
FT                   KGANSMGTECTTGKGANDSTPKGAVGTVGASTVTNDFKNISIELKKIKENSTLLYDKCF
FT                   NKFNSPVTVSGPPESTTTNITSPNRLTNSTNSTTKEAPFGAGNEDSSLGGPVTVMEDPV
FT                   TEEIELSVGRYKLPNPKHQKLNNNLKKEKLNNNLKKENLNNNLKNTKLIENDFYPQIIS
FT                   PKSIHQFFQSKYY"
FT   CDS_pept        complement(75362..79330)
FT                   /locus_tag="TA09615"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.cand.12 - score = 69.10"
FT                   /db_xref="EnsemblGenomes-Gn:TA09615"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72906"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ33"
FT                   /protein_id="CAI72906.1"
FT                   /translation="MKLIILIILNISLQNYSCNINSKNNPQQTINPLESTNLQESTNIH
FT                   ETTTKFRNTKNVETLENVENSENMEQSEKLDEIEFDEKLVLNILKRRPKGFEVIRQNYY
FT                   GIDILVFIPYGIITEIIDSNGIIWKNYNNIKYIKVTTFKHNSKLLHIQFFNSPVTVLGQ
FT                   TDSNGPKVSSSKGISSTTGTVGASTVTEGKGANDTFSTPGKGANSTLMECTPGKGANFT
FT                   LMECTSGKGANSTATECTSRKGANSMPMECTPGKGANSMPMECTIGNSTEGSKGAIGTR
FT                   FESQSSNTTGREPDTVTEVTEIYYHRNGRVWNEIDEENFYNIFNIIRMESSCLGKYTIY
FT                   LNDKNSHRNVIWNHSDERYATYAPASGIRINKLCDYNWGPICLKSIWRTKKNEYLLYTS
FT                   VFNKIKPKLVYIILSNGIDITEEYYFKYNSKWYQINRNTFFNKLYTYFPVTVTGPPESS
FT                   TQDSTVIPSTSTNGGTIGASTVTEENSTTKIAAPKVGTTVLTEPLGTSTTNSTGKGAND
FT                   TFGSPGKGANSTLMECTSEKNSTEIAAPKVGIGPFGTRFETQFSNTNTIRGPDTVMEKL
FT                   NKLMEIEIDFENINKEKLYTSTFGINRTIQIIYPRPGIKIISVRNGKSIIWKSNFNLYC
FT                   DYAYLIKTPELPILCYLLLSNNFTRKINYFIYLNYWININKSQFFYFITHNISTSQILK
FT                   IISNNTKNTNNIEDSIEDTENEEDSIEDSRDKDINVESTVKEDISVESKVNTDSILEST
FT                   VNYENEEDSIESEDELFTVKEIPIESAKEGEITIESENENTEVNSTKDTTGKGANDTFG
FT                   TSGKGANSMGMECTTGKGANSTAMECTSEKNSNEIAVVTKTGESSTFSEESKDTMDTNT
FT                   NTKETPIRAEGEDTNTKEAPIRAGTRDTKGVDEETGTVGASTVPEIETSNFINKKGLKI
FT                   RIYRSRIKESKGIIILTHGIGLHFIEVSMRNNLEWNYENFGFITHPFLICPNLNYYNLN
FT                   NLNINRFKHIFQHNFFSSNISTNLSPNILSTTNISSTTNKSENISENSKKSNKSENLTN
FT                   LSTNKSNISEKSNLLPNYEYKNSLMELLNNLGYDVYGMDLQSNGFSESYDSIRSHIHNT
FT                   NDFLDDLLQFIFIIINNQFYSNNNNLNNNKFNLNKFENLNNFVNLINWKKKKRIILFGF
FT                   SFGANLSIRIIQYYYQSIYKMKKKYKKFGLNKRFGLNKKIKEKIGKFEENKKIKEKNEE
FT                   LDNIFVEDLLVDGVISLSGMLNMDNHLGTRFIKLKILLIKFLALICPRNINKFKSLPVF
FT                   NQSYQYSILLNVRSYGACYSSSQSTTKPLVILITIVLK"
FT   CDS_pept        complement(join(80506..85005,85230..85340))
FT                   /locus_tag="TA09610"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.11 - score = 72.47"
FT                   /note="SMART 3 TPR (SM0028) domains at aa 29-62,
FT                   E()=8.77e+01; 171-204, E()=2.55e-02; 915-948, E()=3.27e+00"
FT                   /db_xref="EnsemblGenomes-Gn:TA09610"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72907"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ32"
FT                   /protein_id="CAI72907.1"
FT                   /translation="MTNQELKVGPTTSVQILSSKDASSFKTMMVIYILFILELYNNKSY
FT                   KKALKIADTILTKNPNHGETLSIKALLLLSLSHTNNTTSNTTHERSHDTTGKRTNEKKN
FT                   EKSNESTKNSSHDKSHEKSNEKSNETRKIVTNEKSHERTNEKTNEERDMSEIIDIAKRG
FT                   LRNGINSYICWYSLGMIYRNMRRYKDTIKCYIMAYKLDMKNERLLREICSLEIEINDYS
FT                   GFRKYASIQLKLKPKEYREWLIFAFSQHLCGNLKLAIEILEEADKLFTHNNIDELELSE
FT                   SIMYHAMLYEHLHEYVKCSSLLQLKSHLVKDQLTFLELKAKADFFSNNIKSANEIYKKL
FT                   IQLYPSNCKFLFLYFLTHTNINIRKLFTINIEYIQKDIRLRYGAWSTATNSTKDSKDIK
FT                   DSKDIGSKDSKGISSSKDSSKDIGTVGASTVTEGKGANFMPMECTSEKILNEIAVVTKT
FT                   GESSTFSVDTKGVGGTEGDIKGASDTRFESQSSNTTGREPDTVTEESCIILSEEIFDID
FT                   GEYSIGGWLLENKLYNNINYYLLHKNNGKNNNNGINGINGNNDKLLVNSINSINSINFG
FT                   KKSYNLINLYNESLYKNSESLYKIFENLDYKEYVKKMMRKLNKKIDIEKIISIEELIKV
FT                   INCYIEILDSNIIYRKIMKKDNYPLYILTRELKESEENLLLETLDELNLKDKFVYNSFQ
FT                   FLFSNNLNFYTRAKKFILTSIELGKINIIKTFTHVLTFKKFYILLYICYEFLGTVSGTT
FT                   DSNGPKVSSSTNSNKDISSTKGTVGASTVTEENISTNFAASGKGANSMGMECTTGKGAN
FT                   FTAIECTSEKNSNEIAVVTKTGESSTFVDTKAVGVGTKESPFGADDEKTTGREPHSVTE
FT                   KKIYNNYFKLIIIILMGQLYDNLGLYNEALEVVNKGFEITLTSIDLLCLRGKIYKHLCQ
FT                   YLNSFNDYNLASELDKSDRQISVKCSKAFIRINNFKLAHLKWKSFLIEDINNKFNNLNN
FT                   INKENINEKENIKENMREIENNIEIPSFKFLIMIYLQKYFLILINRINSITVTGPTNSI
FT                   GTSGKGANFTAIECTPGKGANFMGMECTSEKNINEIAVVTKTRESSTFSEESMSKDIKG
FT                   SEGTSGTVGASTVTDNLLEIYLGYKEILEKHLEIYTNQLDFHNYCLNRLSYRIYYNFLK
FT                   LKNNFCTHYYFLKSFKNIIKIVLELVSHVTVPVTELGPTDSTNSTNGNTTEENSNKVAA
FT                   VTNTGESGTFNEDGEGVSGTNDTNTTKESGTEETSLGGPDTVMEKYKDEINYCIEWMKI
FT                   VLGQRVYDPGLYALFYKLANITNMNILFKLQCIMRCYYSSKCNPFNHHLIQLISHLLIQ
FT                   LQFYIQFGQSGQSTQSTVHSTGLTVHTIGLNLTEFEKKLIIKVLKICIPYENLINKIIH
FT                   TVNTVTVLGPTANSSTSTKGPNTEETSFSSVGASTVMNNWSREYIDNIKEYIMNMRYDY
FT                   KGLKGLVMTSYNDREVEYLEDIFMDFKRIYEGIHYNDYIKIQKFLMEVICTCHKSQNQQ
FT                   FLITQLQLLQSQYTKH"
FT   CDS_pept        complement(join(85606..86059,86172..86453,86537..86597,
FT                   86655..86692,86722..86805,86873..86954,86987..87044,
FT                   87086..87210,87304..87352))
FT                   /locus_tag="TA09605"
FT                   /product="pre-mRNA splicing protein (Prp18 homologue),
FT                   putative"
FT                   /note="SMART SFM (SM0500) at aa 79-121, E()=7.40e-03 and
FT                   pfam:Prp18 (PF02840) at aa 261-408, E()=9.60e-47"
FT                   /db_xref="EnsemblGenomes-Gn:TA09605"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72908"
FT                   /db_xref="GOA:Q4UJ31"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR036285"
FT                   /db_xref="InterPro:IPR039979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ31"
FT                   /protein_id="CAI72908.1"
FT                   /translation="MDKLLSSIKKKRNELQELKGDKKWLKRSDEFEKRKLEVQEQINKQ
FT                   NQIKKKLIDNNFKKIEEFYETNENININNKIKDIPIEEIIKRLRKLRQPILYFGETHNQ
FT                   RCKRLFEQESDIVDLESNQNIYVDTIMGRNNYLISKYINKNQLQIDFFNDFTGLKEDTK
FT                   HYNTHFAAPRKGAKNTLLLLPERELILPLWNVPLERELILQPRNVLLLIVLLLKKILVP
FT                   KLLHLKYLLDLLVLGSNPTPVLLILRVLIVLLPVDQSPIYKWISMKLNEMEEEMMKKKL
FT                   ELIKEGKEFEIKKNEATLVQTKKDIKPLLKLIKLNKLDEEILEKMYNIIISCDEGNYKK
FT                   AYDIYMLLAIGNAAWPMGVTMVGIHERAGRSKIYTSEVAHILNDETTRKYIQMFKRLIT
FT                   FSQNKFLNQNN"
FT   CDS_pept        join(87783..88206,88500..88910,89003..89241,89276..89613,
FT                   89664..90711,90834..91313)
FT                   /locus_tag="TA09600"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="SMART 5 transmembrane domains at aa 139-161, 232-
FT                   250, 371-388, 422-444 and 451-468"
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA09600 by TMHMM2.0 at aa 139-161, 232-250, 371-388,
FT                   422-444, 451-468 and 899-921"
FT                   /db_xref="EnsemblGenomes-Gn:TA09600"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72909"
FT                   /db_xref="GOA:Q4UJ30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ30"
FT                   /protein_id="CAI72909.1"
FT                   /translation="MVYTYYLVPLYLTTPNTIGMLTGNMNSTTTNKAITSYNISATGHT
FT                   ITYGPANACNKTASASGDASIDNANDTGPTLNITGMQPNPDAALDTTGGPVDCTVKVED
FT                   KKLTINYGDDKCIEITLTSANTIKKEATTVPYGHIFTGIDIGVAIIISLVAAIVWTWAY
FT                   GICQDVATECDITNVDISKKKLTIKYKDANNAKVENAGYQDPPSGPPYKYTATDPKTKI
FT                   TYTFTLIDKIEMVLLIATIFPPVIVAILRRTSSFKHPQSPACEWSAEDGANFGQGSATD
FT                   VDPMCQITDVKTSQNKLKIKYKGAQDEKVKVKEATYTEKQIGSTANYKYTVKDHKTKIT
FT                   YTFTLNEQLADGTTKEAAVLIPFYLVDKIEMVLLIATFFPPIIVATLQKVKPEYSPKTK
FT                   FAGDGMGGWKSYSAFGTPYDASFYHAFDILIVIKISLAAIFIYSLHYRESHIVVLLRVK
FT                   LLILLLRISIKSSVTITTGTVDGDCTDAPQEFKTAPTATLNLADATATITTKDGKATLE
FT                   IGINITKIDANKAVLDALAHLASPFSPCKVEVTNNTLTITIKYKKDDKCNKTVITLTAD
FT                   ALKTLGLKNSTVYNATVEVAPPPNHLTIKYKDGSVEKTAAVDITEYIDIEDICPEGMTP
FT                   NGMTAITEEIAQKIKKDLKQTANYKTKYYHVKHPTTNIRYSFKLREDQATQLTTGKPIT
FT                   VPVIVQYGHIFTEGFSGTATASGNLDPNTITGITIKSITITDSTGKKTTYNKDPEGGAA
FT                   TEGTPSLAIKVGGGDTTATAYFKKAEAAAPGDPPGAPNSIILKYNDGGEKCITITGNAS
FT                   TATVHYGHEFSEILRELPVIVALLNRGIFGEGTKEYSPKTKYVWHGPNATNNGFGGWTR
FT                   YLDTGDNHEEPSEPGECKDPSKHVPAHAWIWHFFNILVPIMIILAYGYYTNTQKTAITS
FT                   YPPNPSIKTIKYGECPSPDKEATTSTTATITDPTDTEGPTLTITPTTIY"
FT   misc_feature    join(88197..88206,88500..88558,88769..88825,89312..89365,
FT                   89465..89533,89552..89605,91068..91136)
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA09600 by TMHMM2.0 at aa 139-161, 232-250, 371-388,
FT                   422-444, 451-468 and 899-921"
FT   CDS_pept        complement(join(91424..92140,92434..92568,92619..92746,
FT                   92917..93040))
FT                   /locus_tag="TA09590"
FT                   /product="L-lactate dehydrogenase, putative"
FT                   /EC_number="1.1.1.27"
FT                   /note="Tap465h02.q1ca.cand.8 - score = 24.51"
FT                   /note="SMART pfam:ldh (PF00056) at aa 5-198, E()=2.20e-12;
FT                   pfam:ldh_C (PF02866) at aa 200-366, E()=2.80e-42"
FT                   /note="high sequence similarity between lactate- and
FT                   malate- dehydrogenases but distinguished by comparison to
FT                   respective enzyme sequences from S. pombe"
FT                   /db_xref="EnsemblGenomes-Gn:TA09590"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72910"
FT                   /db_xref="GOA:Q4UJ29"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ29"
FT                   /protein_id="CAI72910.1"
FT                   /translation="MARNNKRKLISLIGSGNIGGIMGYLTQLTELADVNFFDIVPNIGA
FT                   GKSLDIMHANSIQGKAYKCKGTNNYEDISGSDVCIVTAGNSYEENNSTKIAAPGKGANF
FT                   TAMKCTMGKGANFTAMECTMGKGARLAKAPTKSNEEWNRDDLVGYNSKIIRDVGENIKK
FT                   YAPEAFVIVITNPMDVMVHLMLKVTGFPKNMVVGMGGLLDSSRMNCYIAEKLGVNPKYV
FT                   HGSVIGAHGDSMIPLVSRSTVYGIPILQFVEQGYITMEDIKEIEERTVTSAFEILKLYG
FT                   SGSSYFAPATAAIEMASSYLNDKKCVFPCSCYLEGQYGHRDIYCGTPAVIGANGVEKVF
FT                   ELKLTPEEQDKYDASIKEIKRLEALIK"
FT   CDS_pept        complement(join(93453..93880,93988..94201))
FT                   /locus_tag="TA09585"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.7 - score = 14.20"
FT                   /db_xref="EnsemblGenomes-Gn:TA09585"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72911"
FT                   /db_xref="GOA:Q4UJ28"
FT                   /db_xref="InterPro:IPR009548"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ28"
FT                   /protein_id="CAI72911.1"
FT                   /translation="MKLENNFNNLLNTNNVINSDVLDNKVLDELENKVILSNGKILKIN
FT                   NKKEINNENDIIIDKIQNVWGSSSGAGSDFLDKYRKQRNLELQRLEEMDRKWKEDMENK
FT                   LFHSQRLFKIQQQNYKTLKKKLKRIKKKSNQTRKSIESNGTNGIVSGSSGLVSESVDEP
FT                   SGSNPSDPLEVEKINLINNENFDNFNENENFDNLKEKNNKFIILDKSEDI"
FT   CDS_pept        join(94549..94571,94686..94822,95016..95195,96181..96701)
FT                   /locus_tag="TA09580"
FT                   /product="hypothetical protein, conserved"
FT                   /EC_number="1.18.1.2"
FT                   /note="SMART 2 transmembrane domains aa 15-37 and 156-178"
FT                   /db_xref="EnsemblGenomes-Gn:TA09580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72912"
FT                   /db_xref="GOA:Q4UJ27"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ27"
FT                   /protein_id="CAI72912.1"
FT                   /translation="MFIQHNSIYTIKEPLKCEIYSVERIGTNNLDRDFYHIEINHFGKY
FT                   HYIPGQYCGVTIKNRQYTPRSYSLSPSVTGNNNLFSICIRVTKPYKDNVGICSKFLSNC
FT                   KQGDIINITGPFGKELILSKEDETVNNLILIATGTGISPFRSFFKHILSNQINQLNTQK
FT                   LDMRNELENQSNGINLEKNLQKLNSEKKILENNFEEKIPNGINLENNFEEKIPNGLDIK
FT                   NNLNVLNWKRKIILFFGIQNNSTFIYKNELENYQKLFGNSMIFIPCFSNESNIPKCYVQ
FT                   VLQSI"
FT   CDS_pept        complement(97516..99618)
FT                   /locus_tag="TA09575"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.cand.6 - score = 50.66"
FT                   /db_xref="EnsemblGenomes-Gn:TA09575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72913"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ26"
FT                   /protein_id="CAI72913.1"
FT                   /translation="MGSDSRELDSEISRGLSSRELSSEGGIREEFSSEEFSPQESITSP
FT                   RELDTSHKGPISSPKGHITSQKGYITTPKESITSHKGSTTGHRYLVTSHKGSTTGHRYL
FT                   VTSPRELVTSNPEPITSHKETSSTSLLVTTEPISTGELTSTSLLVTTEPISTGELTSTS
FT                   LLVTTEPISTGELTSTSLLITGTEPISTAELVTSESVGSELITPCIKELSLDSLNFKIK
FT                   TFETNLNPLRSSKLEENYNFTDIKLDNFRRNFGSTELSEGTNGFTEGLTGLSEGLTGLS
FT                   EGSSGFLGEPREPVESTDKLPSGEFEDKLLPEPREPMDKLLTEPGHKLPFKSGEPMDNL
FT                   LTGEPTDVFLGEPMDKLLDEESKVWFAEFNFPVDLKTFKEIITESIKDNNQINTLIKSR
FT                   RTSNDLNDTISKDYSVTVLAPTAGNGPDSNTTNSLTNSTEDSKDTTTIGASTVTEGKGA
FT                   NSMPMECNRERELIYTFDTPRKGANDTFSTPGKGANSTLMECTPGKGANFTLMECTTSN
FT                   NSTKVAPYGVGHHIPSTLTGKIYNIKERNIYLKDKIYLKDKIYLRSEVFKDKSYLKSDI
FT                   FKEILSKCPYLNGPNKDNKITEKSNIIIKKLLKETNEDYKYFQSFNTIFQKYEQIFPNQ
FT                   NKYKKIKLFDKKIKLFDKKYIKFNKFNKFNKYLQYDTKTFLKVYSIELFYTVNYISIQL
FT                   IIYLYS"
FT   CDS_pept        complement(join(99620..99729,99763..99810,99841..100095,
FT                   100566..100824))
FT                   /locus_tag="TA09570"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 3 EGF (SM0181) domains at aa 23-60,
FT                   E()=1.00e+01; 78-112, E()=1.47e+01; 117-156, E()=3.57e+01;
FT                   1 transmembrane domain at aa 191-213"
FT                   /note="1 probable transmembrane helix predicted for TA09570
FT                   by TMHMM2.0 at aa 191-213"
FT                   /db_xref="EnsemblGenomes-Gn:TA09570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72914"
FT                   /db_xref="GOA:Q4UJ25"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ25"
FT                   /protein_id="CAI72914.1"
FT                   /translation="MLIKLKCILIICLYIYLTYCELECDDNKCQQDSKCIKISLGQNEY
FT                   NLCICNSGYTGWDCSIPIDYCNKHCRPLQKGISCKHTLCNQGNCINLLENPYYKCDCGA
FT                   FYKGENCEIEDNPCSYQNPCGKGDCEFVPGINQINCKCYPGWTNIPNQTNTKYNWNGVD
FT                   IYMTPPCLEEIKKGITGNAPILGPNSKVIWYVVLIISCIVFLWFSSTTLYELIGKKIHT
FT                   N"
FT   misc_feature    complement(99653..99721)
FT                   /note="1 probable transmembrane helix predicted for TA09570
FT                   by TMHMM2.0 at aa 191-213"
FT   CDS_pept        100997..101944
FT                   /locus_tag="TA09565"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.C.cand.17 - score = 16.90"
FT                   /note="SMART pfam:Acetyltransf (PF00583) at aa 222-304,
FT                   E()=3.50e-03"
FT                   /db_xref="EnsemblGenomes-Gn:TA09565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72915"
FT                   /db_xref="GOA:Q4UJ24"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ24"
FT                   /protein_id="CAI72915.1"
FT                   /translation="MYQKNLSDIQIKLLKKKIKYNKKFTISGLKLIIKNLDSYEEYVNV
FT                   YPIVQMVTRTNIYHSKEYIENMLTNPLYYPFIILLDSTENGVGLTDGRVGSGENGVDST
FT                   DNGVDSTEDGLSSKETGVDLKENRLGSSESGLSSREAGFYSNSVNSSDLTENRLNSTTY
FT                   SLNLKENSLNLKENSLNSTESGLSSKETGFDSASVNPLDPSDISLNSTTNSLDLKEKEL
FT                   TLGSGIVTVGYFEIYLMPHLGRLFDSRLERVIVHPEYRKKGIFTYMLTFVIDFCKSTLM
FT                   CNRIDLTSNNPIAERGYKTFQFEHINTNLYRKYL"
FT   CDS_pept        102295..112476
FT                   /locus_tag="TA09560"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.C.cand.18 - score = 261.97"
FT                   /note="SMART 2 transmembrane domains at aa 1475-1497, 1510-
FT                   1532"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09560 by TMHMM2.0 at aa 1475-1497 and 1510-1532"
FT                   /db_xref="EnsemblGenomes-Gn:TA09560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72916"
FT                   /db_xref="GOA:Q4UJ23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ23"
FT                   /protein_id="CAI72916.1"
FT                   /translation="MDPKEYPTPTDPPFSYNSDHLSNNPQITADESKISLIGSKISLNG
FT                   SKITPNGHQTTIDDPNISPNNAQITSTESHITFNELFKLLVYTKYTSLSRLKLVENVDE
FT                   KKEFLILQGSNRTINNLKSTLTSSRLLERSTLTSSTLTGSRLVSKEFTNLLEQLKRYDN
FT                   YFKKTSEQCKCKLPSESTSISIDYNLFRRTIPQNDTENPKFDPIEYSALEKSLNLLKSR
FT                   YEYDFSKLVSYQNIIYQIFLFDSHEFHLMAKYSPDIDPATQLRLNNTLPTLYYVYNEIS
FT                   KHRSEFLEKISFKRLSVSNSLDKQKFGSESQKLGSETRKLQLEQQRLGLDQQRLGSVGN
FT                   TFDALVTRLYETLMEHDIVLYIRIFKLNIVSVIDVESVILPVLRGILDELQSLECDYHW
FT                   ISLFTESYTVTEDPKLDYIYKVLYLILDFSFNNKLLTLVDVTIDVIFSFSIRNPNFSNI
FT                   LQCFNKYFKTIIYPILNTTGGKVVGGKVVGGISAELASGIPSSGKVSTSDLSTTLSTSP
FT                   MTNGILIPCLYNLESIVLFEYLSLQYPILSHKTDNSIIKEMSTLIPKIGNFIIRIDIEI
FT                   LDQITLDKLYKKDTFNFKLYIKNKRNFFLIFSHGNIFFSTQSNSNINPINNQDKDRDPD
FT                   KLVQDRVQEDKLNNSIQYNSIQDRIKIFNKGSKYLCIEILFNEYINIFINGKEFNNMKF
FT                   EDDIEFYQVDFYYNIDNVNVKQFSTLTTGFRKFLIQSNVIEYPVTVLGPTASNGPEVST
FT                   FTDGTSNTNSTEDSSKDIGSKDSSKDIGTVGASTVTEGKGTNSMGMKCTSEKNSNEIAV
FT                   VTKTGESGTFVDTEGGEDIKGAVGASTVTEGKGANSTLMECTMGNKADGINSIVDYIVY
FT                   FSKGLSSIHMVISNINFNISLDNSFNPLNPKVFESLNILFELLLNIFESISTINFTILS
FT                   TIDTSTTDSTHSIDSTDGNSIVMINLITIWRKLSESIISILSIIKIFFSLPINIEQIPL
FT                   GFLNNLTKILYESIKYKSYYMVPETVPETKDSETVPETVPKTKVPKTKDSDSKHSFDSK
FT                   NTIYSKYPDPKHYPDSKYPHSKYPESTYLHFQNLHHPIDLISLANTVNLISLDILGSNQ
FT                   LISTQLFSYTSTQLLSEILMNIAYTSYFITDLTIFTKNNTLNFLNQSLCIEIFTKRTLT
FT                   DVFIQNIGLGTGPSKVTRPTGPGKATRSTDPNKATKLNDPNKSTKLTTNNNKATKSTTN
FT                   PTTPTTPTDPSITTKLITNPVEINLWWKLIYELLESDKLLLKNDILNDNCKCNLKLNEL
FT                   MLLDPMFNYCNYCLRKYFNYFSSIESLNYYTKLLSNENFYTIPRPSMLLCRFLLKHGIT
FT                   ILLFNLYNKSNKSFTKSFTKSCNKSENGLESDSESVESKSDSQSSMVDSTGDLTVELTV
FT                   DKLFEEYLIIFIPNNLKLIEEIFIYLLKLNEQILYIFGDLLKFDFRLLNFLNCLSILDL
FT                   LTYFYEFIQSGTKYFLHIISCIKLLPYLIKVLLLYNKIFRILKYQKFNPINYLIYQFSS
FT                   LLIIYMKFIQYIYTNDFKLGDHNYRQVDRNYRQVVDNLTQVDQYISKQVEDELKDVNYI
FT                   FKFPKCLVTNLNFNFNSSNGAWSNGTSSSNGTVDSSNIDSSKSMDSSNMDNCDNLDNTM
FT                   NLDNSKTLNSCDSLDSSNTLDTDMEIIGSIRKLLLLVQDFKYIKGTSISFRNISEIESF
FT                   ITNSHESEYKISNLTRGLLNMENWATKIFSDSFDQVHPRLIKLRYTLIALFIHLGSDCE
FT                   ITERLVSDNEVSGHLGSDNNRLEYHEAKKYSRIVCMKIFNKFQTMRCQNIKDKDLMKEM
FT                   YLEDVISRCVWLIKNTPSHSNNGKLYGKNTMYVDTVSKMKTSTYHMMDYRTKLRSGTIF
FT                   RRSNSSTNLNTNSYSSLKIDNTTKFDSRGVRDSRVVKSSRDSRNYRTYSTDSTDYNSST
FT                   VFRNYITRDNRIFDDNFNELVEFILNGPTRLECEKRFLTHRLTSLIRISLLSSLKALIY
FT                   SFLDLGYVHTHILKYNFSPLVVDLLVNPNLNTLNNPNTVGNNHNTFGNTNPNTVNNPNT
FT                   GTNLTAVNSLNDILDLFWYIMINKLRPIMLSTYKDSNFELINGNKHVPDIYNRVVYDYL
FT                   CSILENICDWYIRSGITTIDSTNYNRPNMNFWLGISLSFFSLVYSLGLEPMTDTRYSFQ
FT                   IFNYMMSILHPLPLSNFKKAMSNQTSLSCYTVEVALVIYFSEYFLVNFGETVENLFHCL
FT                   KMRKFTRKDQLIVPGGTIYLMVKKSSKISETLKQDEPINLSFTHLWSFPKIENTSHGLG
FT                   HLIYNFYVNFDQSNTTVMDSVNMDTNTLNPIRNVSLEENDIIMWRMENYCYLISEVSLT
FT                   KRTSNNIAMVINTSREITVYLTLPKNITNRITNEIELSLVNYLGGNLEIEGVNGTWTQV
FT                   LGIKGLDYFYVVRSNLYLLLKYLLWVELSTNLHTANNNKDTNSTKDSNSTNRVDVGKLC
FT                   RNNVGKLCINRIDVGLVLGILFKYLRSTAIQIFNLSSVCNCKDNPEKVSIKYHCSNISC
FT                   QFKYSTTIKGYLVDSDNTADNLLVTRGCSTCSTNQIYKKELDFFWGNILSYLISLVRVC
FT                   ENYSLVYMVLNSLLTTFTLGERQAQAFLSMDSLGQKFCNLLVVTIKQLSATSNNIMGSV
FT                   NKGVNTSVNSGVKGCVNKFGVCDYGYMKTVLASPKIHALFVLKWLPPLKQVPLECIYAT
FT                   LRENFQSILISKSFKPVTKIEPNDPFVTLPHSDHFVTHRNSVDFEADISENTLQVIRAN
FT                   NMGGIVMYRIPTTLGTTAVQLTTNFYILNASRFGITVAPADCVFGTVSDLFERNDVVGF
FT                   SHSNSLGFTSQLFAATIGYTIGDVLTAHFTLDHQEDGQLCLRTELLIGGNSIGSVLEVV
FT                   FDPITQNDPSRRMSLVFIFQDPATLVLRGTSINPDRNTGTNPGTLSESNIMSTFLTTNV
FT                   RREIPTTNDRITSYNMNDRSNSYPNIRQINGELDRELDRELVNRDQDNRDQFNVGEVNR
FT                   EVVGGNEIIGSSNVEVVRALDRIVSRETSATARSRTVTEQSIPISDRTNSIEPFPVDTQ
FT                   SSSPRDMNETTLNETTLNENVLTFNYKKYFNVEDSEVSFDNVPEWDVKFDSVESDVVEE
FT                   SPITLCKDEFWDKLLRDDKYTCLFAQFSDSVQVYQSVLSVNVPMFSGLKRELVMKIKSS
FT                   FDDLYTLLSSNFKYTRLESTVRDCFSWLCVLCCDHDRQVWEKLSQKEFKVVSDFTLPFL
FT                   LGSSFPSKTTLVTLPNELLLELFASISKILTIRLVITSLTLCATKKGSVRFIHGDVQTD
FT                   SLIFVIASKSLLASTLILKVLSHRCFKHDLYSSTITNGISALNADFLHLLDGLTSFITQ
FT                   YLSSCEDFVISSNNIENVAFSNVESILQSLNINSTNISTQVLEY"
FT   misc_feature    join(106717..106785,106822..106890)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA09560 by TMHMM2.0 at aa 1475-1497 and 1510-1532"
FT   CDS_pept        join(112797..119729,119790..119969)
FT                   /locus_tag="TA09555"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART ANK (SM0248) at aa 895-925, E()=2.39e+02; 930-
FT                   960, E()=2.92e-02; 964-996, E()=1.21e+01; HECTc (SM0119) at
FT                   aa 1924-2357, E()=3.76e-13"
FT                   /db_xref="EnsemblGenomes-Gn:TA09555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72917"
FT                   /db_xref="GOA:Q4UJ22"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ22"
FT                   /protein_id="CAI72917.1"
FT                   /translation="MIEELIKKTLGVKFMNLEFNVKMFGTCDKSFHTSSRIPSVRRHFM
FT                   RRSHFYKLIEHDVFDMLQGLVHVFRDYFYRKILDQCKDTMILFRSSIIHFSTTFDSNSL
FT                   EYYELVDSNTGGNGVEEISKMNLFSAACDPLYSWQLLFYDPFKKEETGRNELVKVLFTE
FT                   IIYCMVVSMSSIRYLKLLECVFWILDTLPKHPLCPCNLRLALTNKFTLSLLNFLFLNGT
FT                   GSPPKLSQVSARITHKVIPSLSVWELEQLLELIMYLGTCAFMRVHSVCNYYSTSDLDMF
FT                   TNFDHKRHDHTTRLTTANILHSFLTSFVLACEWVDNNFKVSDVAIIRILEYSDFYNMGV
FT                   YLYLARNKKLNKQMLSHFLSLTPEIYTSMPLKVGKLVKDSDKVGEIGDFGSFSTFSAKN
FT                   FPSRKNSTMLKTSPILNQTDRNPQVHFISCSDRYHGLILKFKVELPTRFVFSQYKDFSK
FT                   VLAELIVSPPKTQELKLGQFYPLEEYVNNVPLIKYKLELDPKYIYTIGYTIETFDNINN
FT                   LFGEKIFDEQPFNQQQFNQQQFDEIFKNEKMVYKLINGTCVEMYMTNNYIFWNIDSNTT
FT                   STYFKHQVDLIPFIIVNSRLDGEVAKCIIKLDSFVIIPVTNCYVKKHVNEFGLLNLGNG
FT                   FVVRPAIRTGLSVHKTKVSFSGVTQLDLSTSALVKLNDKINLTLNPCLEEVMRYDPCLP
FT                   FRLSFKFEKGFNVNVRPDFYIGLVSDREKLLWFSNGDLYISTNFHVPSKDNEYRKINCL
FT                   PFYETDVISVSFNPQESSLYFTVTNQTVKLDFHSYYYHITSVYTDNIIASTNTNTNTED
FT                   TGTNTRALSTTNTNPIPTNKSTLSTDNSDSGSDYGYTCADRRNLINAVIFDDLAKIKSF
FT                   LEFPCELFENGCDDHFDVDGHDYFLYSPIYIACNLGKLSLLKLMALNKNINFDVKSGPY
FT                   KSTPLMGAVQGGHYDVVYHLLTIHSIDINAVDSSGHKCLYYSLFRSKEINFKIVELLLN
FT                   FGADVHSDGTGSISENLHSIPGNNNLHKKLIDNHKLQKGVFYKSNWSLLQNLHIFMSNK
FT                   LYVKYNIKVDPSVLGPISTLPQTATPVTAGMSSPEFLSPDRRIESPDDTDILELMGNFL
FT                   GKLTEDVKEGINTTMDLLTEGLQHLHSSKTDFSTKNSGFSALNSGISLNSIKNMTSLKN
FT                   TTSIRSFNSKTSINNTLGTMGTIGSSLNTMSSSNIKVVLNNIINEDTVQMSNLVMKYVE
FT                   ESLEIIRKTLYKMKTGLDETNPLMKSVWNELNLTLKEFIIYHLCKFIKAIESETDELLK
FT                   NFIALANSFINQLSECEGLSIVSETQYIILKFIRFENQLVSFGIANNELLFTQRLRRNS
FT                   QLLTNLQIIDSYSFDLGFYIYTSSHNALTDEINKLPSNTNKLQVNDKLRSNTNTLQLNK
FT                   NGMEYSTMVGGNMYMFDRLRMELNNEMTFELDRTLVSLLDLLKNSENQLETLAKILIYS
FT                   KNPDDMLVHLPPSDSQLWSPINITADTMFNNVQELRGKILKLKNTFPLSDMDLHLMYTV
FT                   LWKLLNQYTSCEFVEDQKNNTEMKIINLLQGIGLINDMFQFGNYKMTHFDKITGIESKS
FT                   FTNGENILRYNFMNSSSQNNEINLDGIGENLYIRPVSSPHLINRSDTNLSRNSGCSHLY
FT                   LDLFNNNINRSDLTVNTTDAIVNGDLDENVLYESNNINTLENIRSNGLNTFENINTTNN
FT                   LNTFENNRSNDLNTVLNRLNNESSKGLEANLGTNSGGNWNGRDLGSDYIFHSLSLILLA
FT                   DRIRYFEVISDVFRNVIPIISTILNQPLIQYRPINSLISKGFEDYYGIKQGENEYIYKD
FT                   SFINIQNDIEGKRNVYEDWNMSCLSNNSMNKSFSVCMGPIMPIHFTDYLKNKPLVKRNV
FT                   LNEMYEKIFTLGSLSVDRPYFSVRVDRGIAHTTKLLRNSLWFQSTAQILNCNPNILRAK
FT                   NNQRPFMVVFKGEGSTDFGGPFQELLTCISNEFMFPLTPDNDSQSATIKCQNTINNYGM
FT                   HQDTVLIKFSHYPVNNLFTQNSTLNDEKGLNKDQTERVDKGNSIFTLGCCDLGVCCSSG
FT                   CCCVLSTFPFDEPVGSKDIGSSCRCGASELYSDSCTQSVPMELSMYESLGRLCAMCLCM
FT                   MNPLNIAINPIIWKKLLCSNLKLIDLLDCDKMSVDLLQRFASLESSGAVTEGDVNGLVF
FT                   SIESAEGNTLDLVENGSNLPVSPSNLAKYLTLATLFRLTEGDLGCSFLAKGMNSVVPIG
FT                   RLRTLLDPRSLEFVVCGDSLVDLAVLRAHTVSYSLNLKKDLFDVLSRFTNEMLQLFLRF
FT                   VSGRSRLPHPNSDWCLRLEYDNKPDEDADKRLPTSATCSFRLLMPKYSSLDIMYKRLIY
FT                   AIENCIAIDLDAHVVHDEMQLSIN"
FT   CDS_pept        120108..120761
FT                   /locus_tag="TA09550"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="Tap465h02.q1ca.C.cand.19 - score = 14.50"
FT                   /db_xref="EnsemblGenomes-Gn:TA09550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72918"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ21"
FT                   /protein_id="CAI72918.1"
FT                   /translation="MSSQANVESNSKIKRVVKKKKEKLRLLEFDIVTSKAKRTGSARSK
FT                   TNGHIRLSDGNYLCKRNFFFYLIKEGNHVIWKAKNHHEYIKRLFVSCSGKDYIVIQLFN
FT                   GNFVVFRKLIDEKVWSEITYKLPDLTKLKLLDESGNEVKEQEFSYGLISTDFIITFNFK
FT                   CSEIKYDTHTVWKLEDSEEFPEALTISLKYQSILLLFKNDKKTEIDILSLVEKT"
FT   CDS_pept        complement(join(121010..121177,121251..121844))
FT                   /locus_tag="TA09545"
FT                   /product="ribonuclease P subunit, putative"
FT                   /note="Tap465h02.q1ca.cand.4 - score = 18.92"
FT                   /note="SMART POP4 (SM0538) at aa 159-250, E()=3.42e-13"
FT                   /db_xref="EnsemblGenomes-Gn:TA09545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72919"
FT                   /db_xref="GOA:Q4UJ20"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ20"
FT                   /protein_id="CAI72919.1"
FT                   /translation="MAKRKRNLTLESQKSDSRLDNSLYTSIYGNFDQKNELSTKTENKS
FT                   NKNKTTVGNLKDKDHLSFLAEKSGESLSLWKQRIENKVLHLKKESEKTSLVLGVSAVDH
FT                   YVRLPFSKFTGISNTKGKKLGLFTIKSVPYKHALEFNSLWQDYAKKLLGSPKTHLNASK
FT                   LVAMLDLHGSLLEVVKSNCTSYVGVIGIVLKETQNGFSIVDKEDNVRFILKNSSVFKLN
FT                   YEEWSFFIYGKHIMASASQRTKSKLKDKSTL"
FT   CDS_pept        complement(122118..122858)
FT                   /locus_tag="TA09540"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.3 - score = 34.74"
FT                   /db_xref="EnsemblGenomes-Gn:TA09540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72920"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ19"
FT                   /protein_id="CAI72920.1"
FT                   /translation="MINIVNKVESLRKELEHWKQLTNQPTEPEPAKVKEEPFTDATDHV
FT                   QMYQAPLSHTVVSKPFTKPKPTVTTVQQVQQVQQVQQVQQVQQVQQVSTVNQPTTVGVH
FT                   EEDPIQQQSRRMMVQGMPPQMKGMFPIKAQSGAASPQAFSQQMYPQFQQQMFHPQMNPR
FT                   VLQHHMQQRLMQQQQFQQQQQHFQHMIPMHQETQMGTTQMPSGQFSTNQYQPQFSPSQR
FT                   YYQTHNQQMMHHMGMQKGPNTNQK"
FT   CDS_pept        complement(join(122936..123610,123704..124042,
FT                   124123..124182))
FT                   /locus_tag="TA09535"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.3 - score = 34.74"
FT                   /db_xref="EnsemblGenomes-Gn:TA09535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72921"
FT                   /db_xref="GOA:Q4UJ18"
FT                   /db_xref="InterPro:IPR027109"
FT                   /db_xref="InterPro:IPR032563"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ18"
FT                   /protein_id="CAI72921.1"
FT                   /translation="MKDKEKEIPSVPTSYRILIKGASSNDNKQIRLNVDDKRHVWRQCS
FT                   FKNPARSDGLVLRHWRHFEKGTEYLSSARKQRKVVRNKICKNIDDDSTCTLARIDEEDS
FT                   VLDSYSFARVNPSVKIYRYSDDFYMFHLADLDPSWTKDETDLLFDLCEMFELRFIAIHD
FT                   CFKWRKDIPLEKLKQRYYSVTKRIVEFLFEEKIKNEIMKHGNPNHPVVLSLKDESARHP
FT                   LVKFTYNADHDRDRRQMLERSYRITPEQREMEAQLLSDIKAAETKLKSEEKKRSEMKRL
FT                   KRKFNVNESDVIPTPRLDQFQTKPVWLASSCISFYKSQLTQHHNDAVDEMLNELNISPP
FT                   VVSSQASNELYWYFYTI"
FT   CDS_pept        join(124667..124807,124903..125052,125210..125368,
FT                   125447..125563,125683..125840,125901..125971,
FT                   126074..126492)
FT                   /locus_tag="TA09530"
FT                   /product="ethanolamine phosphotransferase, putative"
FT                   /EC_number="2.7.8.1"
FT                   /note="Tap465h02.q1ca.C.cand.20 - score = 14.22"
FT                   /note="SMART 5 transmembrane domains at aa 51-73, 267-286,
FT                   291-313, 325-347 and 362-384; pfam:CDP-OH_P_transf
FT                   (PF01066) at aa 90-257, E()=1.50e-04"
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA09530 by TMHMM2.0 at aa 51-73, 178-200, 232-254, 267-286,
FT                   291-313, 325-347 and 362-384"
FT                   /db_xref="EnsemblGenomes-Gn:TA09530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72922"
FT                   /db_xref="GOA:Q4UJ17"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ17"
FT                   /protein_id="CAI72922.1"
FT                   /translation="MVFFKRIIPESQLPSLKDYTFKPGNFTFIDNLMLKYFWEPVVNFL
FT                   PKWLSANLLTLFGGLCVFIMNCLVFYYVPNFKTKSVPKWTSLLSSFLVFFYTTFDGIDG
FT                   IQARRLGLASPLGQLLDHGTDALVCSFFCYFTFLVKPTGFSHVNTLINVSALINAAAVN
FT                   WQEENFGTFSYTNSFFIFGVSEPLLAVALILMSDYFFPSFWLSPISKFVTKHKSLKFML
FT                   KYLPKDLDFFTPFLYFALSISYFTFFGFPYEMYKLHRNLKKTMKLAMYLLFNCILPTLL
FT                   IDFLPPSLHVSYSLFASTLGGFGIIFIIISNIRRSERLLFYPEFYPHYMVVLVGYLLVL
FT                   GRVVLGLKFDALVFKSPYLKPLLTTLTLLGTALSLTKAIRVLYEIKTYLCLPFFTTKRP
FT                   ENRSK"
FT   misc_feature    join(124912..124980,125528..125563,125683..125715,
FT                   125809..125840,125901..125937,126076..126135,
FT                   126148..126216,126250..126318,126361..126429)
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA09530 by TMHMM2.0 at aa 51-73, 178-200, 232-254, 267-286,
FT                   291-313, 325-347 and 362-384"
FT   CDS_pept        complement(126549..127562)
FT                   /locus_tag="TA09525"
FT                   /product="hypothetical protein"
FT                   /note="Tap465h02.q1ca.cand.2 - score = 21.57"
FT                   /db_xref="EnsemblGenomes-Gn:TA09525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72923"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ16"
FT                   /protein_id="CAI72923.1"
FT                   /translation="MYLETVESKWPDLDSNDLILDRSYSKIFKATYYTRDEIPKDHLPY
FT                   GLIHNRMKYSKQSPELNSTDTPNDIDPKEWAREIYADAIKYITEPTNPDRVFQWYHDFI
FT                   VLTNLQIAFHNYYNVESKSSSIFMNIVNRLIDWFLGRELINSEAELESLSLYVGNQTRN
FT                   LRSYVSKSSHLLIELLIETININQCKILCYRIMPQLFACTGSEKSVFREPAIKNLKLIA
FT                   ARFSKNFDEEILWLLMDQTLNLNKKISSVATSCAFEYLTLTDKKDLDSLDLVKLIDYFE
FT                   LGLNPKTVDAKRGHKKIMAKMSDVLSDKKYASYLNELSLRPTLAKFTKTELPSDLN"
FT   CDS_pept        complement(128076..128330)
FT                   /locus_tag="TA09520"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap465h02.q1ca.cand.1 - score = 7.05"
FT                   /note="SMART 1 transmembrane domain at aa 33-55"
FT                   /note="1 probable transmembrane helix predicted for TA09520
FT                   by TMHMM2.0 at aa 33-55"
FT                   /note="Signal anchor predicted for TA09520 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.928) with cleavage site probability 0.000
FT                   between residues 47 and 48"
FT                   /db_xref="EnsemblGenomes-Gn:TA09520"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72924"
FT                   /db_xref="GOA:Q4UJ15"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ15"
FT                   /protein_id="CAI72924.1"
FT                   /translation="MRIEDSKENSQKSFMGRLAKAKRSLVRLTKKTINVTGWTVWIIGT
FT                   AAVTLVGPVIFHYDKECHLLEIQHQLLQAQQSASVPVLN"
FT   misc_feature    complement(128166..128234)
FT                   /note="1 probable transmembrane helix predicted for TA09520
FT                   by TMHMM2.0 at aa 33-55"
FT   misc_feature    complement(128190..128330)
FT                   /note="Signal anchor predicted for TA09520 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.928) with cleavage site probability 0.000
FT                   between residues 47 and 48"
FT   CDS_pept        join(128647..128764,128893..129230)
FT                   /locus_tag="TA09515"
FT                   /product="RNA-binding protein (U1 snRNP-like), putative"
FT                   /note="Tap465h02.q1ca.C.cand.21 - score = 45.52"
FT                   /note="SMART ZnF_U1 (SM0451) at aa 1-37, E()=8.47e-07"
FT                   /db_xref="EnsemblGenomes-Gn:TA09515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72925"
FT                   /db_xref="GOA:Q4UJ14"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UJ14"
FT                   /protein_id="CAI72925.1"
FT                   /translation="MPKFYCEYCSIYLTHSSPAGRKQHSQGRKHISAKVEYFQRLVREQ
FT                   FFQPPVFLGQTPPIFPGNFRAINHSLGPPMMGVFPGFAPLQTPNIIPQGMMNGIPGGLP
FT                   GPIPGVPPVPVPMPAIPVIPTELPNMKIDLNQHNAPSVNSTSTTGAQ"
FT   CDS_pept        129465..131036
FT                   /locus_tag="TA09510"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="Tap465h02.q1ca.C.cand.21 - score = 45.52"
FT                   /db_xref="EnsemblGenomes-Gn:TA09510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72926"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ13"
FT                   /protein_id="CAI72926.1"
FT                   /translation="MDYLKASHNQNNRMVRFPFKLIELDITTGQATPSYSDTPTHTAPH
FT                   NYYEIGKPYGYKLGDHGSYTCEEGFAIAKLMRGRNLILRAVTSSDYMKRVFISCSAIDY
FT                   IVIQLFNGNFKIIRNRKDGLGWVKITYKLPDLTKLKLLDESGNEVTEPEFSYGLISTDF
FT                   IITFNFKCSEIKYDTHTVWKLEDSQEFPEALTISLKYQSILLLFKNDKKTEIVMRHFIN
FT                   NFKWLSPADVDGNIERSITQITYNGDLHKIYEANSNYCIRSFKLNNEIVWKAKDTSEYA
FT                   SAIISSVCYNMNRSILIIRYDKFTLLSKSHGNDWEDVTLNSFDFYQLKFFDENNNKLSI
FT                   FQCTAEFFGLKLCITFDFNCDHITYKEEKFWERESCGEYPLKLCIDLTTNSVCFFYRST
FT                   KIDSYSFKISGPKFLEHKPMTIIDLIEQIRHLTQELTTSKMPIKLFSESINKTIEGFEL
FT                   FNNESEEKMKKFNSLLGLNPNARLDEQLFALMHALSESSIFYRPYINYHMGQTSEELTY
FT                   ILSGKL"
FT   CDS_pept        131537..133108
FT                   /locus_tag="TA09505"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="Tap465h02.q1ca.C.cand.21 - score = 45.52"
FT                   /db_xref="EnsemblGenomes-Gn:TA09505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72927"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ12"
FT                   /protein_id="CAI72927.1"
FT                   /translation="MDYLKASHNQNNRMVRFPFKLIELDITTGQATPSYSDTPTHTAPH
FT                   NYYEIGKPYGYKLGDHGSYTCEEGFAIAKLMRGRNLILRAVTSSDYMKRVFISCSAIDY
FT                   IVIQLFNGNFKIIRNRKDGLGWVKITYRLPDLLKLKLLDESGNEVTEQEFSYGLISTDF
FT                   IITFNFKCSEIKYDTHTVWKLEDPQEFPEALTISLKYQSILLLFKNDKKTEIVMRHFIN
FT                   NFKWLSPADVDGNIERSITQITYNGDLHKIYEANSNYCIRSFKLNNEIVWKAKDTSEYA
FT                   SAIISSVCYNMNRSILIIRYDKFTLLSKSHGNDWEDVTLNSFDFYQLKFFDENNNKLSI
FT                   FQCTAEFFGLKLCITFDFNCDHITYKEEKFWERESCGEYPLKLCIDLTTNSVCFFYRST
FT                   KIDSYSFKISGPKFLEHKPMTIIDLIEQIRHLTQELTTSKMPIKLFSESINKTIEGFEL
FT                   FNNESEEKMKKFNSLLGLNPNARLDEQLFALMHALSESSIFYRPYINYHMGQTSEELTY
FT                   ILSGKL"
FT   CDS_pept        133664..134866
FT                   /locus_tag="TA16700"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="Tap821d03.p1c.C.cand.2 - score = 25.82"
FT                   /note="SMART pfam:DUF529 (PF04385) at aa 28-155, E()=4.50e-
FT                   07"
FT                   /db_xref="EnsemblGenomes-Gn:TA16700"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72928"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ11"
FT                   /protein_id="CAI72928.1"
FT                   /translation="MLKPLDLDILTLKSKSTGLKRLFELFLPFFDFNGVLENGKYTSKE
FT                   GYGISKIIDGTEDVWTARDESEYATKAFISSSYKKYVVIKLLNGDYEVFHNSRNGHGWR
FT                   EITEDCLYISKIRLFDESGNEVTEPELSHSLISSDFIINLNFKCSKIKYGTHTVWKLAN
FT                   SHDELPQALLVSLKYQHMSLLLKNCKKVVVFINYNIVKNVLQLKPVEVDGDIEMTTENI
FT                   VYREPFNKIYEANRGLGICSFKLNNEVVWKAKDTSEYAVKIIYSEYLTSKILLIYNNID
FT                   YTVLSKSFSETWQDATVHSRDLSKLRFFDDKKNQFDIFDTFFYSDESKIVIYFYCNCSQ
FT                   INYGDKVIWKRKMFQKYPLDISIDLMDNIVDFHFKNGINKYYFTDDGLGRFVLDKTESR
FT                   C"
FT   CDS_pept        complement(join(135117..135449,135482..135734,
FT                   135853..136134,136228..139601))
FT                   /locus_tag="TA16695"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="Tap821d03.p1c.cand.110 - score = 89.30"
FT                   /note="SMART 3 transmembrane domains at aa 183-205, 552-
FT                   569 and 701-723; STYKc (SM00221) at aa 964-1404, E()=1.34e-
FT                   04"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA16695 by TMHMM2.0 at aa 183-205, 552-569 and 701-723"
FT                   /db_xref="EnsemblGenomes-Gn:TA16695"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72929"
FT                   /db_xref="GOA:Q4UJ10"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ10"
FT                   /protein_id="CAI72929.1"
FT                   /translation="MESQSPPNFLHNSLIAQGISQSNSDPSRYSTHSNEDFDYNNVNNV
FT                   KNSENVDKEVKSTRFHPKQYQNRNTIKHIKFDKTNSINNLTWPSNKIGSTKDNKGLSDC
FT                   NIRLSEDDVGSSEDDIRLTNCKIKLCRNILEYKILEKNSEKNSEKSEFDSETQNFKNKY
FT                   TRIRTKLSRFNDKIWKRSKIFRCVLLWIIISIILGVFIPINSDLEIESFELSKLKVKSK
FT                   IKPVFVSFAKASVDDKVYSSYADMTLGTELKVPSGTELSNVEEVSLLVLDVEGLAYRTT
FT                   LSKKLVWATRLTEDLLRVKKPVRTKQQKDQMCSLEDIAPNNLNKTKIMTYQIFSNSTYS
FT                   GKVKSETEAKTNNRENYNRNNNRENYNRNNNVINKLKAHLVPSYDGYVYYVDDYNTKLL
FT                   QVHVKDIVNYTPFYTPLLEGVYLEGSRKSLVIALDQETGTYITRHDRENDTKQPFSLNY
FT                   LPNYSEGGRDQLHIGVTNWSVKAFTEKDHEHIWEFEWLEIGSVQNQSNQPLLNTLKQSI
FT                   KIANNRLIINSNNTNADNINYNTGGMKNNMVGDKLDGGLTFPFPITAVYYIYKSNRSGI
FT                   YTLELLQRVHIPPPPNFLYNQTNSLLTASNKLTHNSLYISNNNITLFDKGIKSIHNDKS
FT                   IKNIPNDKNVKDTQMYKRGVYESGTCEGGIENGIIEIGSSIINSSKFKRNGVGCFGRLD
FT                   KTTDFVLRWWWLLISWVLAMIFTPIFWLYRRIKNSRSKIPSELVTDWAGSRTDLSDSKS
FT                   ELYDSSDESNPDPNPETLHQRFRDEDYLDVSIERKLSIDKYSIDEKLSDDENLNHIRRV
FT                   RSEGNLELSSINDDFSVSVWMEERSLLDVITDNRLEFTKKINQLKSQILPIQESTNINT
FT                   NTHTTATNNTNAPNTNNTTTKVNTNKVNTITKVNASESNNNEANKVDYKDNLLMRENTV
FT                   GSSVSKEEEMSLSVIPRNSVLSKFLENGRFLRTFECIKMLGKGGFGSVYRARHKLEPGN
FT                   PVYAVKFVLLKLKSSEDLSSRRYFREVAANRDIYSKHVVRYYTWWCEEPHFLPLAQMSN
FT                   PLQMAAIDNLRFLIQNDILRSDIFSSGSDSTLKNGMYNNYIKEYRDIIYQYIQNPQQED
FT                   FVPSFSQIAQMNKNKHKQFMSSYNANREGYVVMYTEDSNIQFKDTNNTMPNTSGVRNSV
FT                   NFDLDNVRRDRKLSIINEYEGHNKISDNKQYQVVLLILMEMCNGLTLRQWLDKADRNVT
FT                   ENDMTKRIEFTLFKQIIKGLRDIHRNCFIHRDLKPENIFVDDRNNLKIGDLGLVGFIQE
FT                   NHSNSFQPIKTAQQHLLSDATQVSVRGQVIGTPGYTAPEGGGNCTEKVDIYSAALILLE
FT                   LLCPRFSTVMERLETLEKFRKTHEAPAFIKIKYKPWYDLMVQMADNNPENRPSADQVYT
FT                   QLKVILNSNFS"
FT   misc_feature    complement(join(137433..137501,137895..137948,
FT                   138987..139055))
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA16695 by TMHMM2.0 at aa 183-205, 552-569 and 701-723"
FT   CDS_pept        join(140584..141108,141209..141667)
FT                   /locus_tag="TA16690"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART KH (SM0322) at aa 165-254, E()=5.44e-09; 2
FT                   ZnF_C2H2 (SM0343) at aa 286-302, E()=9.87e-02; 314-330,
FT                   E()=5.04e-02"
FT                   /db_xref="EnsemblGenomes-Gn:TA16690"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72930"
FT                   /db_xref="GOA:Q4UJ09"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR031150"
FT                   /db_xref="InterPro:IPR032570"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ09"
FT                   /protein_id="CAI72930.2"
FT                   /translation="MSTTVKSEKRKFTRWGRIDDGKSLIIHNSTKSFLNELKMLSNRAY
FT                   NVSDEELGCRWGAEEDKPFLPPPYVDLPPGLTPAQIDQFLREQRHDELARKITSGELEF
FT                   VDAEIRPPSPPPVYDKNGSRVNTRDVRVKNSMNEEYNRLVEFLLKNLPGFVASADYKPL
FT                   KKVRKIIIPLDKYPEYNFMGLVIGPRGCNHKRLEAESGAQISLRGRGTVKDGKNRDHQT
FT                   DEDAAMPMHVHITADREECVQKAVELIEPLLDPFHPKHEEFKRLGLEQLALVNGVALGI
FT                   VDIARCSICGASGHRAHECQDMPAPSVPRVEIVPSLLHTGYYLLLS"
FT   CDS_pept        complement(join(141874..142161,142249..142336,
FT                   142387..142568,142598..142965,143041..143494,
FT                   143546..143710,143779..143856,143928..144059,
FT                   144187..144471,144530..144961))
FT                   /locus_tag="TA16680"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /note="SMART pfam:DEAD (PF00270) at aa 136-341, E()=2.30e-
FT                   02; HELICc (SM00490) at aa 355-446, E()=4.81e-15"
FT                   /note="Signal peptide predicted for TA16680 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.916, signal anchor
FT                   probability 0.000) with cleavage site probability 0.848
FT                   between residues 15 and 16"
FT                   /note="GPI-Anchor Signal predicted for TA16680 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA16680"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72931"
FT                   /db_xref="GOA:Q4UJ08"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ08"
FT                   /protein_id="CAI72931.1"
FT                   /translation="MVMLLVMLLYRRVLCSLKTIEKSFTTFDKKYDKCYNVLPFTQNEK
FT                   ILINNAIISLANDCKLSNLGQNLGIPLFFIKNSDFRNSLISYWDKSNEFKSFLRQNLTV
FT                   LKDSNLDEDLSLKFVKFIETFIKDNLPNIFITLNNLKHFSDFSRISHLYHNYNNVTNNT
FT                   SAPNGINVSSCRNVYLHVGPPNSGKTHDAIKALLSSSSGVYCAPLRLLAWEMFNTINNS
FT                   GIKCALLTGQEVVDNGESHVSCTVEMIPFERRFEVAVLDEMQMIGDLTRGYSWTKAFLS
FT                   LNVPELHICGSKSCISITANLANIRGDKLEVFEHERLGNLKVMDKTIGLDELEPGDCVV
FT                   CFSRFDAFTIRNNIESMNYTWNNMKEECVTSIVYGLLPPETRYEQIERFNKGVTKVLIA
FT                   SDVIGMGVNASIRRLIFYRLTKFDGNLLRPLTVSEVHQIAGRAGRFGIIPEGFVSCVRE
FT                   QDLKTLRELMNKEVSQIDKAVISPPLDTIGAFYTTLKQFTGEQHSLINTIQLYLVIFMY
FT                   IVTYECRIGSIGRVGERFQMCDFAQINSVSKCLEGINLPFEILKEYLMVPMGSTLVSLI
FT                   VRAFAASHSLLNSVKISNIIQPEFLSNNTNSNESSDSNDLSDDSLDNLCKNTQIKRLEI
FT                   LYEVLDIYTWLSNKFPLVYVDKIAVKELKSRVAKTLSKLVREPNEVVQEDENDLNIVKN
FT                   ILRPERVVLYHPRRVKAVDLDQALVAVFGQVKVVAVHTRLVECIHLTECMDSVVHKDWV
FT                   VHMVEFVSEGLHSIVASGYSTVDTVRFDIVVGSRPFDTVGISEHYPRLVELLPLILPPT
FT                   NLYNIVNILMV"
FT   misc_feature    complement(144917..144961)
FT                   /note="Signal peptide predicted for TA16680 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.916, signal anchor
FT                   probability 0.000) with cleavage site probability 0.848
FT                   between residues 15 and 16"
FT   CDS_pept        145373..146374
FT                   /locus_tag="TA16675"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.4 - score = 21.73"
FT                   /db_xref="EnsemblGenomes-Gn:TA16675"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72932"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ07"
FT                   /protein_id="CAI72932.1"
FT                   /translation="MVVPKLPLIVPKRPLPPNKTSDNTFNPSFTPSMTGVERLDSKVSL
FT                   PDNKPTDFTAEKLTKLVSNSSLNLKKHPSNYNSVNTVDNNMNNENENFYEDLSLRLNSS
FT                   TILSDLNSTHNNQNTTTTTNVNEMDEDDVGYTPWLKVEKRINEIRSFYSRTNPSTNNTN
FT                   TNNTNTNNKDEKKSIYCNYGTKYIEDGWNKEVDHPLKYSTIQKLKSKKVYENEFKDNWK
FT                   FVNGFLRPRRKPFTSISEMSKFYNKVDAKDQYEMIRLLLACRDLERLIEEQQTVLDMLD
FT                   HDLREARESFSDLSNSFNVQKLIGSAPTSEPQYPTADVPLFIKGKLTLLNNK"
FT   CDS_pept        join(147293..147631,147825..148229,148261..148456,
FT                   148578..148780,148834..149059,149230..149315)
FT                   /locus_tag="TA16670"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.5 - score = 39.79"
FT                   /note="SMART 12 transmembrane domains at aa 21-43, 63-82,
FT                   89-108, 113-132, 144-166, 179-201, 243-265, 275-297, 310-
FT                   332, 337-359, 379-398 and 434-456"
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA16670 by TMHMM2.0 at aa 21-43, 63-82, 89-108, 113-132,
FT                   144-166, 179-201, 243-265, 275-297, 310-332, 337-359,
FT                   379-398 and 434-456"
FT                   /db_xref="EnsemblGenomes-Gn:TA16670"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72933"
FT                   /db_xref="GOA:Q4UJ06"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ06"
FT                   /protein_id="CAI72933.1"
FT                   /translation="MDEQIEDSMYLKVKRRFFERIGVIFSVFNIATFLEYFNLQILPSS
FT                   MRGLEMSLYFTSKDNSMLSMAENLGLVSFIPIWGALCDKIELKYILLFGVIATGLINIW
FT                   LSTISNYSLILILRIFNGGLIGSVTPSAQKFIATNMQNKLPFGFGILHAVMCLGRMISG
FT                   LIATSFSTEVYRDIYGWRIVIFIFGATSLALSPILLLVPKVRRIDNNKITEQIRIGDKI
FT                   KRLVYYLLFITKESLNNATSLLLALLNFFSDGPFVAFNYVTLLIQYMRLSNVVSAVTTG
FT                   LTILGGIIGGIIGAFISGYFDRKWPKHGLLNFGILNVGIRITTFMISFLVIDVTNIDRL
FT                   YGLLAVCLIINGMTFMTVSCVDRTLLANVVMPSVHSSSISIIRCIGGVLSAVIFNPVLA
FT                   KLNESVFHFQSSSLAVKHMPFDLIKKNSDALRYSISIISLGTTGVVLLLYIIIHFTYGK
FT                   DCEKIKKRIEKESGLFEIKEIGDQSP"
FT   misc_feature    join(147353..147421,147479..147538,147557..147616,
FT                   147629..147631,147825..147881,147915..147983,
FT                   148020..148088,148212..148229,148261..148311,
FT                   148339..148407,148444..148456,148578..148633,
FT                   148646..148714,148772..148780,148834..148884,
FT                   148990..149058)
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA16670 by TMHMM2.0 at aa 21-43, 63-82, 89-108, 113-132,
FT                   144-166, 179-201, 243-265, 275-297, 310-332, 337-359,
FT                   379-398 and 434-456"
FT   CDS_pept        join(149660..149692,149724..149895,149984..150123,
FT                   150229..150344,150385..150437,150469..150720,
FT                   150870..151048)
FT                   /locus_tag="TA16665"
FT                   /product="hypothetical protein"
FT                   /note="SMART pfam:GATase (PF00117) at aa 20-266, E()=9.80e-
FT                   03"
FT                   /db_xref="EnsemblGenomes-Gn:TA16665"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72934"
FT                   /db_xref="GOA:Q4UJ05"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ05"
FT                   /protein_id="CAI72934.1"
FT                   /translation="MLNENSELKILIFVPCDNDLFKDRHGKLVKQWLVYVSEYYNKKVT
FT                   FNFTEFNIISQKIPPLNQVLQYNGLLITGGFASIGRKDAWLDELRHLIRQLFLHKFPMF
FT                   GICFGFQIISQALGSSYLIAPYGFNFFVLDYKLESKASAFFKPFLNYYHKCEHKLNGNK
FT                   NGVTDLKKANFNSIIGLFSHNDVITSLPDPSNIDFGAYEGQNQAEIDEALSDMVVTKIS
FT                   SSDKFPVLGILAGNSQRTFIISLQHHPEFHTQQGLKYFNDVLNLKLSQGLMSPDQFEKN
FT                   IEMIQLFNESNSGKIYGLMVLSLFSNGFIKPEQ"
FT   CDS_pept        complement(join(151238..154260,154324..156339,
FT                   156439..156544))
FT                   /locus_tag="TA16660"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.107 - score = 92.14"
FT                   /note="SMART transmembrane domain at 41-63"
FT                   /note="1 probable transmembrane helix predicted for TA16660
FT                   by TMHMM2.0 at aa 41-63"
FT                   /db_xref="EnsemblGenomes-Gn:TA16660"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72935"
FT                   /db_xref="GOA:Q4UJ04"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ04"
FT                   /protein_id="CAI72935.1"
FT                   /translation="MNKKKNKIDKNCSIEHVYNFNQNNILNNHKLKYQNRNWRSICLIL
FT                   IIVLLYNVRTVGCELVGLNSNLSTGINPELLRQSLDLAEKSRKRTNSGLPKNKSHKTFQ
FT                   NTSTSTSTSSSSYTSAGSSDISSSSGSDDSDDEAPVKTDSGLYKKKDLQKDRPNRILTD
FT                   PEVRKRRPTKPLLNSRSDNEPRENEPKVVRPTPTRPNDQNPPEPSKTEDKPETPNEKIG
FT                   PFSERLFRPISDNIDFSNLPFNSNTTSNTTSKKDKFKRMTPPNSPTITSESDDFDLHEV
FT                   EVVNQSKVDPSITQGRENIITGKPQISGTEIPVATSFEYNRTAHVLEPKFEQPKVMGGI
FT                   IQTLTDKESKLRRMNKRKLKIQHDLTLYISKESANVVNMLNNGEVSKLQKVHPLVYMRL
FT                   QQVFQTQYALNQLLKKDGEKVKIYDKNWYLNSTPTAKASFIEEIRKYTKEPELYGKFKQ
FT                   PKKIKKSRKLLYEKLELFHNDYICQRIVRENQFSDKIIRSFEQQSGLYIAPNYHNLVPG
FT                   LGNLWLIKNFERYYMEASRSKVTTFSKIAPTLVGKFMLMVENGTVLPSPPSSQVAIHSL
FT                   SVILSMVMEGVREPKLFLGKKKFYGLMSLCDTKCIQTLYDNDNKSAKKGVNKRSIVGRR
FT                   AVQFLKWVQLFHTEDLLLIDTYAQRILLSIMYAITREDFYRTSPRNVQLRIQSQFSTKK
FT                   STPSFLQQDTDDIDEPSLLEIGPDDRERKLREANKRLIEDYNKRRQQEYERRRSEQFEN
FT                   PRKEYTSRQEYLRDQSGRVLDEQSKEVNKQKEQRAREAFENALKGSDTFQKSMRQREEI
FT                   LRRAKYNSRAPDYGEQEKSLFTNIADTNANENPETTDGEKSNTNEDVRSRLEKMGNVYK
FT                   KFYNMFMSGYHEPGKSVNPENTSEQITPFHVFTTGNNSRVSGNVGYDGQFLDVVNMITE
FT                   LTNLANKDYNVYYHSVNTIIMIRSIHLALHSFDNNKTKQIMSSKTLGSLFRYLNTDSNG
FT                   YVMNLTKQFLPTTSLTLQLIFFIQELIERYNHGVLGLVKTFFKNLLVRGIVKGPSNFRS
FT                   LNNNLSTYVIYDDKKYKGTLETVYQLVKVFKDTFITKASIPIPIIQYITIFLSLWSQSD
FT                   SQTFNISDRTDNIGRKMFLLSYLVNKRSLADIATEMILKHCAGLKMLHLGCISKLNNDN
FT                   KECKDFSVLLKKKKVLYIMRMIESTSMDPLDVIRIASDTCRRCVANLTVRPHVGAPTLL
FT                   QLDQSLDDDDDVDDSYLELNDDSDGEKVNAETGESQNSRSNTKSDSEKNNKKWYDPLKN
FT                   PKNIFKKKLTPEEEALMLPHFVDRLMLHSEITHRIHCYYTQKSLVKRLIKELGKAKDEL
FT                   EMKQIITNVFGEFRTIEIIQSGMASSMHHLICPFMIESPNELRIPHQTNILRYVIAQLC
FT                   KKNKLNPVKKDLFEQFRGKIGVLVPDLEGYLKIDVVGSVFVGLRKYNGIYYSGGYAPFD
FT                   KIDKPTNILLKPGEGRLVYDGDNFVPELVALNDIPALESINIIHEYDYDRIVYQINTGG
FT                   GDGASIVMSERKFALEYPNFIIRAHVLITAKALMRMGFDMGRVVWCGDKYGWVADFSLE
FT                   NIVPVSDVPVYNGQYWLLTSQLTVKDVVGNVPIRILDRNSRSYVDNSTADSSVDEKGLN
FT                   EITVEIISSGKKVGEMKPHKGEAVGEDEEALEILVGAGGENLSATPGAVKTVKTATYNP
FT                   GTHGLTLDLDMPDFINV"
FT   misc_feature    complement(156257..156325)
FT                   /note="1 probable transmembrane helix predicted for TA16660
FT                   by TMHMM2.0 at aa 41-63"
FT   CDS_pept        join(157317..158094,158166..159016)
FT                   /locus_tag="TA16655"
FT                   /product="hypothetical protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="Tap821d03.p1c.C.cand.6 - score = 19.79"
FT                   /db_xref="EnsemblGenomes-Gn:TA16655"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72936"
FT                   /db_xref="GOA:Q4UJ03"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ03"
FT                   /protein_id="CAI72936.1"
FT                   /translation="MLKLLNFLDHKLIHNNFNFNILRVNFNNLRINNFSTNVFNEKTVD
FT                   FKNLPFNEKFVNNLKSLGINNLKLFQYYTFKLLTDKLTFLPTNTPINKEETLKIVLYND
FT                   LNSGKTIGTLLPFLYSFTTTHSNSNKTGLNNNLVKKLLIVCNNNEVKKLINFIISVNPS
FT                   LNIVQLTGYNNNNGVKGDIILVSDKVFMKIYETIYRLNDIEFVLFTNFTETINCINIDK
FT                   VVKALSDSNVICLINSLDNFKTFSNKFYNFSLYNFVQGTRERLIGDKRTDLLKLEIDLN
FT                   KSIPITTNTTNNGNKVVKSGVVETCLCKVLKNSNKIAVIRNLIYCNYDLPTFLPVNMLQ
FT                   KFTSVKFRNSCVIFTNRKNLNKMAEIEPFKSLSVQLQTCINSYEKAEKINLLNSLTKPI
FT                   LLTSQLLHLRSQLLNNSSWAKNVNLVIFHTFPKEEFYKHLLENLSNNGKIIILYSKKEY
FT                   SKLVEMVKSSTKNVKVQIIPSNQFISNHNFKILNKLITNVINEKKEELVPYLKKSEELI
FT                   KKYDNSIINYSVDLLLNDNVSNFKN"
FT   CDS_pept        join(159178..159321,159403..159422,159454..159587,
FT                   159650..160965)
FT                   /locus_tag="TA16650"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA16650"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72937"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ02"
FT                   /protein_id="CAI72937.1"
FT                   /translation="MAYGVGTVFLPMIRRFLVVTIALEIGYITYDCVIKPTAKSVNRAL
FT                   FPSVPKKPKSHILCQTNHYSSFTQSNTNISNIITQFNNFKPLLNHYPITPKHTQMIREE
FT                   KKSIKESMNGLINHLEELDLESLYQILTNCHNISHKLVHTPFNQKLIKAISSQILNQEP
FT                   KENTVSQSLNERELLFKLFISISTLNKQNGLHEELRVNFDGLYHLLNKHLSYYIIEQLI
FT                   ELLISLGNIYVKTNLEGIKSLNQKIVYLLCDKIDKSNTKPSLYTFIQIIKSISKSNLNH
FT                   LIKLISPFINPNNLVDVGNNDDMRLEYKLTKLNVHLLTILLQTNYIDFPLFNSIIGRVN
FT                   SFLLRYYKDTSINPLSTEITINQYNVENKFVNNLLYPQCTNKLFRIPQEQTSKSDHRME
FT                   SLDYILISSVNKLMINGKLAFVRGLKLCEMYFTTLYPQEYSQLTSDLSYLKLLNYTNDK
FT                   EYLITSNLLEKNRKLIESQLGAPKNLIVVRVGIYYIIALDPERKLYIEMVPKDDKLTIQ
FT                   LAFRRKYLHSNGWNPISIQQ"
FT   CDS_pept        complement(join(161087..161362,161378..161595,
FT                   161657..161729,161859..162075,162092..162203,
FT                   162264..162316,162349..162605,162700..162858,
FT                   162995..163113,163186..163431,163519..163948))
FT                   /locus_tag="TA16645"
FT                   /product="ATPase, putative"
FT                   /note="SMART 2 AAA domains at aa 121-256, E()=5.62e-20;
FT                   418-568, E()=5.09e-09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16645"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72938"
FT                   /db_xref="GOA:Q4UJ01"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ01"
FT                   /protein_id="CAI72938.1"
FT                   /translation="MKKKRNMNEDKVNSGLSMDLDEPIINLNNTLTNNYKLTNTNNKIN
FT                   GINHGNNFMNNGNNSVNNDKQSDLDEEMEYKFIPELNVKTKLKDVGGIDKIKGEIEDLV
FT                   INPLKYPQLYKHLGVQPTKGVLLHGPPGSGKTKLAEAIAGEIGCPFFRVAATEIVTGMS
FT                   GESENRLRSLFDQAKACAPSIIFLDELDSITPKRENTFREMEKRIVSQLGICMDSLQGH
FT                   FVIVIGATNRQEYVDSMIRRNGRFDREISMGIPNQESRYDILQALSENIKISDDVDFEE
FT                   IANLTPGFVGADLQAVLRESAIHSISRLFKSHNIDDTDMNDLMKNLYINREDFLIGINK
FT                   VQPSSKREGFITIPDVTWSKIGALSFLKSELEKQIVFPIKYKKLYQRFGIGISAGILLY
FT                   GPPGFTSFPAVYPLQGHLSTLSWCGKTLLAKAISNECNANFISIKGLTYLQLVTLIYVV
FT                   CSMTEIYLGPEILNKYVGESEKAIRLIFQRAATSSPCIIFFDEVDSLCSIRNDSNQVYE
FT                   RIVNQLLTEMDGIQNREYVYIIAATNRPDIIDPAILRPGRLEKLFYVPLPNEDDRVDIL
FT                   LKLTSEVPIDPLVNFQIISQMTDGYLSLLLIYSIVSEGLSYIPEELIFTTYSLNNYLLA
FT                   IFRDNSGDRFSGADLASLCREASIIAIDEIRLSLSESPVSDYKLSAPENSVVKMEHFQK
FT                   ALLKVKPSVKQQQIDFYHNFKLKYS"
FT   CDS_pept        complement(join(164735..165019,165135..165325,
FT                   165460..165589,165639..165866,165957..166061,
FT                   166136..166237,166272..166446,166576..166835))
FT                   /locus_tag="TA16640"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.105 - score = 24.41"
FT                   /note="SMART pfam:DDHD (PF02862) at aa 190-435, E()=5.20e-
FT                   09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16640"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72939"
FT                   /db_xref="GOA:Q4UJ00"
FT                   /db_xref="InterPro:IPR004177"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UJ00"
FT                   /protein_id="CAI72939.1"
FT                   /translation="MEELNEKLEKLKSMLDLDFGVQKEDACDCILIAVHGIGTTENMLE
FT                   NDYKSLKHSLEVVRKHWFYNQKLKIHLCFINWKRYIVDAQNNDIVCRLFDNYCIDTMKG
FT                   MRRVFNLAVMDIIFYQNPKFSDYLMNNIANDLNNEIARLRNHVSGQFKESKIAIIGYSM
FT                   GSVLVYDLLSVNPCRLSNIEASKRPRLEHKIDLFFAIGSPLSAVLVNQNPQLMKLGLKL
FT                   PEDIKYYNIFHPYDPIASRWEKLIYLNINVPKPVIVPYWYNNGLKNWYNLDQQFQVCHT
FT                   GLFPNYYIIYCKSVIAENLTDFSNTITKGIYNLFGTNQNNSILDQNITNNSNKLKGKVP
FT                   DERLNINKSESSMSDELASETVRDDDFFSDFEIDLSSTNALEKANSNNTLPKRYDYQVQ
FT                   EDVTEHFLNPLAILQSHISYWGSRDVSFFILSAIHPVKERVPLTTLLSFVESKAKALSF
FT                   STDNEDLKKEFLKVSEQAKKLLEQINREVCIRN"
FT   CDS_pept        join(167270..167390,167492..167533,167594..167903,
FT                   168020..168176)
FT                   /locus_tag="TA16635"
FT                   /product="Fe/Mn superoxide dismutase (SOD), putative"
FT                   /EC_number="1.15.1.1"
FT                   /note="Tap821d03.p1c.C.cand.8 - score = 12.68"
FT                   /note="SMART pfam:sodfe (PF00081) at aa 1-93, E()=1.80e-
FT                   39; pfam:sodfe_C (PF02777) at aa 97-206, E()=1.60e-36"
FT                   /db_xref="EnsemblGenomes-Gn:TA16635"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72940"
FT                   /db_xref="GOA:Q4UIZ9"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ9"
FT                   /protein_id="CAI72940.1"
FT                   /translation="MSFKLPPLPYGLKDLVPHLSEETLTYHYTKHHAGYVNKLNGLVNG
FT                   TALENKSLEDIVCNNYLYVLDLLKTESGAVFNNAAQVWNHTFYWHSMSPSGGGEPRGTV
FT                   RKLLDEKFGSFDNFKKEFSSVLVGHFGSGWGWLVLKSDGTPEVVQTHDAGNPLRYIYGI
FT                   CCSDNTGTPLLACDVWEHAYYVDYRNDRASYVNGTPCFHSFPQRIL"
FT   CDS_pept        join(168413..168867,168898..168971,169026..169201,
FT                   169215..169288,169320..169421,169566..169761,
FT                   169824..169895,169947..170086,170108..170192,
FT                   170225..170437,170507..170623)
FT                   /locus_tag="TA16625"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.9 - score = 8.72"
FT                   /db_xref="EnsemblGenomes-Gn:TA16625"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72941"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ8"
FT                   /protein_id="CAI72941.1"
FT                   /translation="MYNIAENVRKGLSKKVIKNIKSIERLYKPPEKDFSPNSTLNSLYN
FT                   IDSNNLINNYGLKSTEKSNITLISPNNGLTFEKNPISLVNNGTNQVIGTNLENNDVNKL
FT                   LRNVYKSSSNGIYNDSLWHRYAQRLRVISSLLQPTDIVTVFYSFGKIRYKDIHLFNTLF
FT                   PILIKNLQTISATVTLYSSIYLNSYNQLENVIGLSIIMNSMKKLEIRNYDILDLITNEV
FT                   FFIHIITHINGVTNDKANIQDITLVANSLSFFNIYHIKFWNSLYKLILIRNNQIDPLQA
FT                   SLLISSVAKLDIRQLCGKCNRNVLMLRLLKRRLRPAIENNELSPELISLVLHSLTKLDF
FT                   EAKHFYNSCYNSFHHFILQDKVDLQGIVLYLYTSVCILEPNLEMVERCLKILDKSRGSL
FT                   KSYKILKLKYIIDHLQHKHQSIFYTFLRQFRRFTIFHQIHQRSKNQTGSHIYINYTNFN
FT                   KMPRWSYEMSLLLKDCGVKHEKNIYFDYLRADIYIKDFNFVILCAGPYSHYTKSHQLNK
FT                   FTQIHQSTLSLKGFNIGIIPYYEWNRLKTRDDKINYLNNFGQLSSLTLLN"
FT   CDS_pept        complement(join(171591..172002,172158..172432,
FT                   172588..172959,172990..173067))
FT                   /locus_tag="TA16620"
FT                   /product="DnaJ-like molecular chaperone, putative"
FT                   /note="Tap821d03.p1c.cand.104 - score = 25.13"
FT                   /note="SMART 2 transmembrane domains at aa 79-96 and 244-
FT                   266; DnaJ (SM00271) at aa 127-184, E()=2.45e-22"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA16620 by TMHMM2.0 at aa 79-96 and 244-266"
FT                   /db_xref="EnsemblGenomes-Gn:TA16620"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72942"
FT                   /db_xref="GOA:Q4UIZ7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ7"
FT                   /protein_id="CAI72942.1"
FT                   /translation="MEANKDESIKCFKIAKTAFSRQDYQKALKFANKANNMFPSQEYQT
FT                   FIDKCLKFTQNTPNDTPINSNDLPNNSKDPPRKFFTTIIIINYIIMNLYNWRLMYNFVE
FT                   NESSSRNATEEQESLCRMIVKSKNYYEILQVAKTDSVEKIKKSYKKLALKLHPDKNPSP
FT                   LASEAFKKVSTAFQCLTNPRAREEYDLHGDEERFVNQQRYQQDFVTPEQLFEAFFGIHQ
FT                   HNNVFHFTTRRTGGNRNNTRRGGLTQFVPLLVLMIFMLMMNLFSRSPQLYQFEKSSKFG
FT                   QMQSTSLNGVVYYVDSRTFERTYPKNTAQRIKIEFEVEYKYFEDKCNDSKRENQRQIYS
FT                   YLSSFRNPPPELYETPKSCKVLNDLRHSYTKLLQKYEF"
FT   misc_feature    complement(join(171930..171998,172750..172803))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA16620 by TMHMM2.0 at aa 79-96 and 244-266"
FT   CDS_pept        complement(join(173442..173760,173812..173896,
FT                   173946..173989,174027..174095,174150..174253,
FT                   174350..174508,174558..174697,174792..175686,
FT                   175793..176020,176061..176203,176365..176419))
FT                   /locus_tag="TA16615"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 4 transmembrane domains at aa 416-438, 473-
FT                   495, 560-582 and 592-614"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA16615 by TMHMM2.0 at aa 20-39, 416-438, 473-495, 560-582
FT                   and 592-614"
FT                   /db_xref="EnsemblGenomes-Gn:TA16615"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72943"
FT                   /db_xref="GOA:Q4UIZ6"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ6"
FT                   /protein_id="CAI72943.1"
FT                   /translation="MEQITQPEQQPNRNNRQTNWIIQLIFQLIILRVIFSLFSNYKKNS
FT                   PLNQTEVLKTFKNYLKPDELFDVYGVITNDIRIDLENIEPSQIVYRNENKSYFYKRNAP
FT                   FEPFNLKYKPSQKFLKDKHDKLFLTVFIIPHKAYQHKHAEFNKSTFKEGMEGHYILKTV
FT                   PLTRYKKNVKQSAVSLMNSETSVEKVRGDEEVKYWVPRVDVNLVYDDKEHLQVKNDPYF
FT                   DTFTKYYEYHLYDPVLYLSQFWVLEEHLVPILVDSDSVNNGKTERYNPAKVFKEIEYEK
FT                   NLFLNSFVTDPNLSPSNNLQQINSLFNNTVNTLNSGDSVKDTDKIDVEEEMKKLNMAVD
FT                   DVDRGLIEGVVDNGLVKKEHESLISDVVELDILINFSICSPMYYMFMSQMNVNKNILGI
FT                   DNTKELDTIKKMLLNTSPYYLVFSFVFILLHSIFSMFAFKNDIQFWINNKSMEGLSTIT
FT                   LVINLVSEVSIPNLTSYFRELGFINTSYIIIIALYVYDDENRSYMILFEILLNIFSSFW
FT                   KLTKAIKVKFHPFYPFITISHTTNRNKIHVDVINTLRNSLEYTNFSYIYIYIPYWGIIT
FT                   SRGIHILSQFWLDQSILLVMNYFTVYLFSYTKLYDLGFIMMTPQLYINYRLKSVEHLPW
FT                   RALIYRSLNTFVDDVASFLIDMPMLHRLSCFRDDIIFFCYLYQRWKYKVDPNRTIHKTN
FT                   DTNAIENTPNTTDNGGNTVDDGNKTQELADNNVKDNNEGSDEKELESVRRRN"
FT   misc_feature    complement(join(173892..173896,173946..173989,
FT                   174027..174046,174074..174095,174150..174196,
FT                   174485..174508,174558..174602,174799..174867,
FT                   176142..176201))
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA16615 by TMHMM2.0 at aa 20-39, 416-438, 473-495, 560-582
FT                   and 592-614"
FT   CDS_pept        join(176554..176705,176764..176867,176957..177069,
FT                   177184..177274,177307..177416,177524..177854,
FT                   177968..178503)
FT                   /locus_tag="TA16610"
FT                   /product="aspartyl aminopeptidase, putative"
FT                   /EC_number="3.4.11.-"
FT                   /note="Tap821d03.p1c.C.cand.11 - score = 15.88"
FT                   /note="SMART pfam:Peptidase_M18 (PF02127) at aa 21-475,
FT                   E()=6.60e-115; pfam:Peptidase_M42 (PF05343) at aa 170-470,
FT                   E()=6.30e-02"
FT                   /db_xref="EnsemblGenomes-Gn:TA16610"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72944"
FT                   /db_xref="GOA:Q4UIZ5"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ5"
FT                   /protein_id="CAI72944.1"
FT                   /translation="MSLNSCKLKEAQVLARKFVDFLNATGSPFHTVKQLSLYLTNHLPI
FT                   KHLNELRCVTEQFFSENWKLENGQSYYVTNNNGTMMAFNIGKKFDPSKGGLILVCSHTD
FT                   SPCLKLDFKCHVNNKGFNQLSVTTYGGGLWHTWMDRDLGLAGKVVVKSNGKLEEKLLHV
FT                   QKPLILLPNLAIHLQNSTEREALKLNKDNHLKPLISTEVVHNLNSTQTEPLLKLVSSYH
FT                   SLAIHLYYIVNIITVIAICFSELKCEVEDLVDFELCLMDSNPSCLSGVYEEFVSSGRLD
FT                   NLGSCFGSISAFTDFVLNQGEDNDAVVVTVSYNYEEIGSSLSYGADSNVTFLWLEKLFG
FT                   ALGCSLMETRDRALVVSADMTHGVHPNYSEKHISTHSPAFHAGVVLKWNVNGRYATETH
FT                   SSSLLRTAAASAGVPLQEFRVGNETPCGSTVGPILGSRLCVPVADVGFPQLAMHSCREM
FT                   CSTVDLLNFKLLLQVLLFMV"
FT   CDS_pept        complement(178672..179787)
FT                   /locus_tag="TA16605"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.cand.101 - score = 30.82"
FT                   /note="SMART 1 transmembrane domain at aa 324-346"
FT                   /note="1 probable transmembrane helix predicted for TA16605
FT                   by TMHMM2.0 at aa 324-346"
FT                   /db_xref="EnsemblGenomes-Gn:TA16605"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72945"
FT                   /db_xref="GOA:Q4UIZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ4"
FT                   /protein_id="CAI72945.1"
FT                   /translation="MAKPCPSCQSKKEASENYSGDACGLLMSAYVLAGLAMMLNIRLSY
FT                   SSAPYALIRFRLPENLFSVFVRRMASALELWCLPSMLLGNIMDLIQKLFDGGAELRAIK
FT                   VKATKLQEKAGELKSAPGLSGAGEVSAAAGTLAGKAGTLNSEASQIKGGDLDVLKTDAT
FT                   ALASAAGSSGLQQKASELVSQSTDTGKAISVIDAFGKVKAAYTTLSAAAKEKEKEDDGK
FT                   VTAVDSAWGNVNTELEKLCKALIKQYADEVGSKAGALQSSPSVGTAQKFKEAYDEFGKV
FT                   YNAIPDENAKTAVQTEWNDLKGVISGEMKWWKFYWITAPSIVTQWLNFLTYVILLIIFF
FT                   TVVIGLEKIPSQMPNRCSPTIYKIDYPCSTI"
FT   misc_feature    complement(178750..178818)
FT                   /note="1 probable transmembrane helix predicted for TA16605
FT                   by TMHMM2.0 at aa 324-346"
FT   CDS_pept        180077..180982
FT                   /locus_tag="TA16600"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.C.cand.12 - score = 19.17"
FT                   /note="SMART 1 transmembrane domain at aa 5-27"
FT                   /note="1 probable transmembrane helix predicted for TA16600
FT                   by TMHMM2.0 at aa 5-27"
FT                   /db_xref="EnsemblGenomes-Gn:TA16600"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72946"
FT                   /db_xref="GOA:Q4UIZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ3"
FT                   /protein_id="CAI72946.1"
FT                   /translation="MVLVGMGLVYMIYPAIAPGMIVPFYLVDKIDMILLIATDVPPVIV
FT                   ALLKKYNYGPFVFLGNWGGNHNAFGPAESDPITQATLDLTDLTSGHTLTLQKSDGGAVQ
FT                   VVKYTVDSEQKSKITRIKQQTGTATINLTLTLTEVTLTLNGNTLKATGSITVTRNVTPS
FT                   GGQKLETALTGSHTLEFTSSSTLTQGNLDSGGSNSVTIGPSSGATNSLNLTAADPGDNQ
FT                   SRPTKLNLTLKAGTKRDGDGGELPNESLTLDSGNNSLTLSGGIEGTLTYASASSGTLTA
FT                   NIINISFDPNDFHYRYRTQY"
FT   misc_feature    180089..180157
FT                   /note="1 probable transmembrane helix predicted for TA16600
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(join(180933..181259,181284..182420,
FT                   182507..185296))
FT                   /locus_tag="TA16595"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="Tap821d03.p1c.cand.100 - score = 179.37"
FT                   /note="SMART 4 pfam:DUF529 (PF04385) at aa 171-317,
FT                   E()=2.20e-38; 363-501, E()=2.30e-76; 566-704, E()=2.40e-
FT                   75; 789-929, E()=2.40e-51"
FT                   /db_xref="EnsemblGenomes-Gn:TA16595"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72947"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ2"
FT                   /protein_id="CAI72947.1"
FT                   /translation="MFNQVVKTFGTSCCWSTCCDGEVVIWETNDPQKYASKVFVDKSGH
FT                   NMSIYLLNGRILHFGRSEEGNWQYSSNKIILDLDKTSSTIGYDFAHHGETRTFTAKPGY
FT                   QFKTVMVSKTLSEDHIFWEAERDDEWSNMVTVYGVETSVKNINIFLNNNKVEHFHEVDG
FT                   KWVTKTTIVLDIDKNTDNDLFEYRSTRNFGHFNPKPNLTIEKIVKKDLEIWTAKPDDHG
FT                   LKAVLMGSGKDEKFLSILLQSGNFVLLRKCGKGQCWEDITKEKSDFSGIKMYSLEEGTS
FT                   KYHELTKNDYDPIVFESRYGYEFKEGVKCVKITYNDKTMWNHTDDPEFGYLKGLYLDLP
FT                   KDQFSVTNLRDQTKHLTKAVTTVALDIEKTQSTDLFYYSDKNGVITYAAKSGHVFNKVS
FT                   QGTTDIWESINNVCGTLVRTMTSDGVKYLAILLDNNMFMLFHLENNTWKDITSTSHDVT
FT                   KLKFIGENDLVLTSSDYRVTIVDLSFTYIFNDGVECRKVKLGDLEVWKDSDDPEFSSIM
FT                   KFRFGLLSNNFYVLNSDNETKKLEFKPTPETAAVITTVSVTKPAEPTKVTADISKTEST
FT                   SEFEYTDQNGVVTYTPKDDHVFTKVTKGSTDIWESKTNVFGTLVRTKVSKGVKFLVVLL
FT                   TNNMFTVFQEDGGTWKDITSDRHDVKKLRFFGDNDAEITTSDYSVSIVDLSFTYIFKDG
FT                   VKCKKVKFGDDEVWKHTDDSNFADIKSFSLGLSSNAFFVKNQSDQVKKIEKEAEEPEPT
FT                   PVTPAPEEEAPEATPPATTPETQQETTPAEPTVTKVTLDIEKTQSTGQFDYTEHNGIVT
FT                   YRVKPGHGFTKVTQGSWGIWEYKDLCGRLVRTKLFSNNERFLAIILYNNSFRLFRQSEE
FT                   DTSWEDITSERLDVTKLRFLSHNDRGLRNIDLTVSFVDFFYSFNFRIISRCLKVKYGNQ
FT                   NLKTAAGTSATEGTLRGLAKTLHGNATSLAGAAQGDSAESNEALKQKAGENERTPGTLR
FT                   KLARELHTAAKALADKVTGADSGAAQNLATAVGVTETASVIRQKLKELSDETDNSKLQS
FT                   KATGVTCQYGQVSGAYTEVQGQNAASKYDGDKQPLYQAVDKAWEAFNDLYNADLKQLAT
FT                   NLKNAIGEVGAPGTLQQTLQLLGDHQDADSELTSKATAVRDAYQSSTATEGVKPKFTDL
FT                   KEKESAYQAIASISPLYDAVVSAMTAFDNVYRPEELLKNVVGENDQAPSGPDGAKTLRE
FT                   ALYQLGTAGAGDLPELVTAVKDKYSNFFGTGVKDRFHLVQAQADAYEQGNTIKSEKYKE
FT                   LLQSWTNFNDNYYKAVSYYKYYTIISDSSGKTKYVFHKPNDPKNGFGGWRPYPEHKANS
FT                   GGSGCDSNEPLVHAWIWHFFDILIVTKIYLEIIFIYSLHYRDSNISRAIINQPKMSTFL
FT                   SIVFYIYNESHLDQN"
FT   CDS_pept        complement(join(185409..186861,187030..187116,
FT                   187212..187539,187692..187769,187842..188045,
FT                   188207..189637,189816..190809))
FT                   /locus_tag="TA16590"
FT                   /product="inositol phosphatase, putative"
FT                   /note="SMART pfam:Syja_N (PF02383) at aa 75-426, E()=3.00e-
FT                   15; IPPc (SM00128) at aa 1.59e-22"
FT                   /db_xref="EnsemblGenomes-Gn:TA16590"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72948"
FT                   /db_xref="GOA:Q4UIZ1"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ1"
FT                   /protein_id="CAI72948.1"
FT                   /translation="MDGVYILRTFTSWYSITLSTGNEQYSQDSSEVFSEFKEFVSGYGT
FT                   KQLWIDRSTCHITESLVSLTDEEPIEQTSINAFLGVVEVLNTYHLAVVVQSELVTELDL
FT                   PNLSLDKAERGRIYTIKQARFFPINSSSFVYTPMNLVNVTNFGNLSNFTNLKNFGNVGN
FT                   LGNIAVSGCGEQVELTTEVYRIIENLEKILSTGYFYSFDTDLTRSLQNLYSHKYFPINK
FT                   SNPVLNTKSSDDSNKDKSSNEILYNISDEEYNWCYNMSKNIPKGWTTVLIQGFVGYITS
FT                   EVDGDFVEILLIGRRNVKRSGTRFVARGIDEQGNTANSVETEMRVRINFKDWYSYVQCR
FT                   GSVPIFWEQLNFTAPVNLYNHHLNIDAFSNHINQLKERYEPLELVLFINLLDIKDNERI
FT                   LTNSFQNLVQQYSRNNPVKSDNGSGDVGGMVKLVMENYNYNVNAKWCTNDVLIDYISEN
FT                   LLTHLNTISYFHETYGHKNDGDSGDRKVELQKGVVRTNCLDCLDRTNIFQYVLSWVIFN
FT                   NILQNHTKRGFETGNKVSSVDQSQQLITPINNSGMDEDSELENNDLLNKFTQLWCDHGD
FT                   YISIHYSGTQSTLSERVKQNNTSINSLLHYGKTMVQRVYSSVFQDSQRQQIYDILTSYN
FT                   YNGVGREPLKRSLLYSKYYIQDPFSQADNPQNDSGLSDPPQGLNQGEGDEEDNLEDEDE
FT                   EDEENIDVDLEVSSIFDRLNDKISKITGKSKPKPELLDFQPDSTDVKDGEYNEEMMRLN
FT                   SDDLKVWFGSWNIGAHVVEVDDNLINWIELDTLQCDLYVFSFQEFVELNFINIATGKRD
FT                   ENKENEFERLIENVFEIATDEKYYKVSSIAMTGLYLVIYAKLSLKPHIKELLNTNVKTG
FT                   LNLNIGNKGCVGIRFKIYDHHMSFLNLHLNFGKNLNISRIDLIDYVLKNSFKDHNISVL
FT                   EDDLFVLGGDFNFRIQLDKDVVINHLKRLEFAKLFQYDEFNMSKMIGIPVLQYLNEPKI
FT                   QFLPTYKYKDGTKFYTTKRSPAWCDRIIYGGKLNQKQKVHVLNYKRNDNLIMCSSTSSS
FT                   STSSLKLYLHNTTITTTKDGLIAIATIKVTKQGGSTPYSGDINSITANLGKTGTQLQTN
FT                   SPLNGGDILNLNGEAAVAGSAPITIKGTIIVTKSGTLGGSLTLNGRLAGKLTLENGSGN
FT                   IKVTIGTGNTLNATNPTNLELAGINVTGGSNLKGTATITITTTKPTDDLTNITGPVNIT
FT                   ISKLTKADGGQLRVSTTLNQGDTLILVGTATAGTKRLNVSGTIKITGTGQLSSPLTFGG
FT                   DITGSLNQFTNATDGVKVTGSGTLTLNGAKLPVLKNTNFSLTSDNKRALTSRLVTKSTI
FT                   SVGTKTNPGKVTISGLTIVPVCTTITGTSSSNGLKADLTDVTFTQTATGLTKYTGQNID
FT                   LSTGLSNATVEITKDKVKNLSGGTPLQTGTNLDPDDTLNLKITPQSGTGTKLEGKIHVK
FT                   SDGKSLGNNLNLAGGIETSINGLNGSGGTLTGSVTITNMKYDPNEFHVNHQSDSCVLVP
FT                   LNYI"
FT   CDS_pept        join(191515..192283,192379..192841,192934..193181,
FT                   193269..193428,193588..193659,193760..193901)
FT                   /locus_tag="TA16585"
FT                   /product="DEAD-box family helicase, putative"
FT                   /note="Tap821d03.p1c.C.cand.14 - score = 21.44"
FT                   /note="SMART DEXDc (SM00487) at aa 87-346, E()=1.55e-03;
FT                   pfam:helicase_C (PF00271) at aa 415-485, E()=1.80e-02"
FT                   /db_xref="EnsemblGenomes-Gn:TA16585"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72949"
FT                   /db_xref="GOA:Q4UIZ0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIZ0"
FT                   /protein_id="CAI72949.1"
FT                   /translation="MSFVLLAKFANNLLRLKHTSCSNINRINPLSTLNFIYFNRRFIHN
FT                   NNIKQDDLDENKNSCNSGYKLCDLVKKNDLGTKTRFLINKLKFNHFDKFQSQIFQHIIF
FT                   QGYSMNSLPSDPGKTCENSNNIDLNDKNSVLYVVGNSNSGKTSSYLLALNELINNPKSQ
FT                   YYHVYRDNHRHKMILYSKLRGGKLCKPRGFRRINGAPRLNPDSFTVPLAIILVPFRELG
FT                   QNIFQTCDQMGIRSRLITGGFGYKLLNKSSSDSGGDDTNGMFIGLGNFDVIISTPEMLL
FT                   RIINGEYEDFRLDVKYLKFLIFEDSDLLVEEMYLPKINEILNLLLIDKLSLVYVSRVKS
FT                   SNLTDHVNAIGSPTVLEKAETHNLDHFKKIFVYTYSNDKLEVLIDLINEITHNNLQKTK
FT                   IVIFTNTTNCNKFLKYSLLDRGYRISNLFGGMNYEERTENLRNFESDADILITTNFASR
FT                   FKFNCTINNIILFDFPKNIQQFIHHTSSFTNNSNNKMYLMFNNKNIGLMKEMISLSSNL
FT                   SGFEYRNLTPKLSKKLSLYQKSLLKHNFKRAKAVKKVEFLRKRGILKKSQTLPKMCDRN
FT                   VEMSDSQEYLRMERTPDGFLQIIPKRRSRIRNYEVTKILSF"
FT   CDS_pept        complement(196343..197059)
FT                   /locus_tag="TA16580"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.99 - score = 21.06"
FT                   /note="Signal peptide predicted for TA16580 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991, signal anchor
FT                   probability 0.000) with cleavage site probability 0.579
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA16580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72950"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY9"
FT                   /protein_id="CAI72950.1"
FT                   /translation="MNSVLIFFTLVATLVTCNRYYNDMVRLANFSYYNSFEDTIEYVRQ
FT                   LDLIADKYLQLIKKMDNDISLELRESSNYDLKSSSDTVNKTGANIINKMHARQMIVDLL
FT                   MYQVHYAYRMYQTACAKYKGETVNRLFEDLNFSFPMNRMVIYEWVRQMELNVRKIMELE
FT                   ELENLSDGWKEVRESINTSPVQNSNQEPTDTATTPETATTSTTGTTTPATTTGTTTPTA
FT                   TPEPTIAEQVSKPAGT"
FT   misc_feature    complement(197009..197059)
FT                   /note="Signal peptide predicted for TA16580 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991, signal anchor
FT                   probability 0.000) with cleavage site probability 0.579
FT                   between residues 17 and 18"
FT   CDS_pept        complement(197514..198215)
FT                   /locus_tag="TA16565"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.98 - score = 18.91"
FT                   /note="Signal peptide predicted for TA16565 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.884, signal anchor
FT                   probability 0.000) with cleavage site probability 0.376
FT                   between residues 17 and 18"
FT                   /note="GPI-Anchor Signal predicted for TA16565 by DGPI
FT                   v2.04 with cleavage site probability 0.152 near 202"
FT                   /db_xref="EnsemblGenomes-Gn:TA16565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72951"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY8"
FT                   /protein_id="CAI72951.1"
FT                   /translation="MKFISVIIFVSIKLAFSTSSILFGPGYPSKFACVSDSYALEAALY
FT                   KLPKEYIDKFEKISLDVSRVVEPPEEIGIDRELVESALTIFDESKTLRNGMVYTSIEFK
FT                   LQEHLARDYVSAQMVLASLNSLKTITYVRNVLNAFAKANITKYTGKVTDEAKYGLCSSF
FT                   VYSDVAQLLEEYKVKELQKVKMENKRITHNISQLGRVKSTGNLWLLTGKANVSYINMLF
FT                   LIMSFITISVV"
FT   misc_feature    complement(197571..197576)
FT                   /note="GPI-Anchor Signal predicted for TA16565 by DGPI
FT                   v2.04 with cleavage site probability 0.152 near 202"
FT   misc_feature    complement(198165..198215)
FT                   /note="Signal peptide predicted for TA16565 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.884, signal anchor
FT                   probability 0.000) with cleavage site probability 0.376
FT                   between residues 17 and 18"
FT   CDS_pept        complement(join(198592..198957,199073..199882))
FT                   /locus_tag="TA16560"
FT                   /product="inositol phosphatase, putative"
FT                   /note="Tap821d03.p1c.cand.97 - score = 17.77"
FT                   /note="SMART IPPc (SM0128) at aa 22-376, E()=2.99e-07"
FT                   /db_xref="EnsemblGenomes-Gn:TA16560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72952"
FT                   /db_xref="GOA:Q4UIY7"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY7"
FT                   /protein_id="CAI72952.1"
FT                   /translation="MYKWVDDKNSVQINGDYLDHWEPIRIFVGTWNMGYKKIDAKQFST
FT                   DVMCSCNTHFPENYECMTCNARFSHPLSDWIGLDYDLYFITLQECVSPNFFELVSRFLE
FT                   KCKHPLERVFFKTDRILGFGEGAVVSRKMTCIAAWVRKDFLANGVVRVCGSKALYLSVY
FT                   NRSKGVVCLQIKVFGQLICLLGCHLPSDYMERQKSFQTILSKLTCLFGENEKLIFKDVF
FT                   HHIIWAGDFNFKLNIPLEHAVTNIVNGTLDKLIKYDEFHLSTSPLKDQKFCEDVIRFDP
FT                   TYKKRENREVLDKGKKNWFEMEYLTSESKWYTLNTERVPSWTDRVLKWSDKTLETCLFF
FT                   EPTSYRSAVPKNKTPLLISDHSPVSCAFMLRPLNRNIAMPVKLNSHTFKFD"
FT   CDS_pept        join(200602..201353,201389..201508,201588..201704,
FT                   201812..201931,201962..202172)
FT                   /locus_tag="TA16555"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.15 - score = 24.65"
FT                   /note="SMART 1 transmembrane domain at aa 368-390"
FT                   /note="1 probable transmembrane helix predicted for TA16555
FT                   by TMHMM2.0 at aa 368-390"
FT                   /db_xref="EnsemblGenomes-Gn:TA16555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72953"
FT                   /db_xref="GOA:Q4UIY6"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR017336"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY6"
FT                   /protein_id="CAI72953.1"
FT                   /translation="MEENKRPRVTSLEDLKLEFVEKRRKKYLRHLEFFSTFTQTHQPTT
FT                   SNDQYTPLNYENTTLNGDNSPLNDDNIEINNDNVVLNDENDHVNEDIVQLNNVTKLNEN
FT                   ITKLGEPLELNQLLRLSGGICEILVFPEFITCSDSLISEEINQIRNSLFFVRPEGSRVL
FT                   IHINNYTASVHNKQNYIRHVFSTDIKGPTILDCVIPSRLMSELPNFMDKTANNTDVTVV
FT                   YYIIDILMLNGHILTTSDLECRLFFLDSIFILLNSVFRLDELNSDSKILFKFVKYYQVN
FT                   FDQLNKTYQSIMNKEFDYETDSIIFVNKNSNYIGGYNPNWLCYKDYNINKYCLCDKVIC
FT                   KVYNKSGNLYTHDNVLIGKSNYGSKHKILSYTIIVYYINIICFSILIMDIEDLKISYKI
FT                   ISHSKWYKSTDTLRKIYVNFINRKPGNDNFNKLLQSLSND"
FT   misc_feature    join(201924..201931,201962..202022)
FT                   /note="1 probable transmembrane helix predicted for TA16555
FT                   by TMHMM2.0 at aa 368-390"
FT   CDS_pept        202420..203847
FT                   /locus_tag="TA16550"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.C.cand.16 - score = 17.31"
FT                   /note="SMART 10 transmembrane domains at aa 12-31, 51-73,
FT                   93-115, 125-147, 189-211, 231-253, 266-284, 314-336, 356-
FT                   378 and 388-410"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16550 by TMHMM2.0 at aa 12-31, 51-73, 93-115, 125-147,
FT                   189-211, 231-253, 266-284, 314-336, 356-378 and 388-410"
FT                   /db_xref="EnsemblGenomes-Gn:TA16550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72954"
FT                   /db_xref="GOA:Q4UIY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY5"
FT                   /protein_id="CAI72954.1"
FT                   /translation="MGDQPEDPKKDLKISAYILAGLAMMLNIRLSYSSAPYALIRFQLP
FT                   ENLFSVFVRRMASALELWCLPSMLLGNLMDIIRKHAFTDNKKKEAWGYHWQSIFWSWAN
FT                   FLTFVILLFVYRGGGEHGRLTMFYWIIAISGFVFGINMVMVYALEAKYLTWYMIGENSF
FT                   PAVTSLMHYITTLIFGNRRKWNSDYVIVYIDIWVAIIISLVAAAVWTGAYSSNYDGGAD
FT                   FGATPNQNLISPVAMVIVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATAVPPIII
FT                   GILRATDTKGFPGGPQTPTCKWYNDTTDGNGSFWHAFDLLIVLKISLAGIFIYSLHYRD
FT                   SSLARSIVNQPKMSTALSILFYMCHEILLAIGFPGIFGGNSGGDQVMLPAQYVGALFMI
FT                   FLAFYSEGYIIEYKSHDPAHWPTDGMTPWNALCYWAKRASKITNHNLESLFTTNLHRYL
FT                   NFKSLHYVLIHIIHFKI"
FT   misc_feature    join(202453..202512,202570..202638,202696..202764,
FT                   202792..202860,202984..203052,203110..203178,
FT                   203215..203271,203359..203427,203485..203553,
FT                   203581..203649)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16550 by TMHMM2.0 at aa 12-31, 51-73, 93-115, 125-147,
FT                   189-211, 231-253, 266-284, 314-336, 356-378 and 388-410"
FT   CDS_pept        complement(203864..204154)
FT                   /locus_tag="TA16545"
FT                   /product="acylphosphatase, putative"
FT                   /EC_number="3.6.1.7"
FT                   /note="Tap821d03.p1c.cand.96 - score = 10.41"
FT                   /note="SMART pfam:Acylphosphatase (PF00708) at aa 3-91,
FT                   E()=1.20e-16"
FT                   /db_xref="EnsemblGenomes-Gn:TA16545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72955"
FT                   /db_xref="GOA:Q4UIY4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY4"
FT                   /protein_id="CAI72955.1"
FT                   /translation="MANVYKFKFNVRGKVQGVFFRKYTKLEADKLGIKGYVRNEEDGSV
FT                   SGEGQTNDESKMNEFKHFLESVGSPNSKIESCSFTLDNDSTSNYDSFNILY"
FT   CDS_pept        205426..205932
FT                   /locus_tag="TA16540"
FT                   /product="protein tyrosine phosphatase, putative"
FT                   /EC_number="3.1.3.48"
FT                   /note="Tap821d03.p1c.C.cand.17 - score = 12.59"
FT                   /note="SMART PTPc_DSPc (SM00012) at aa 10-155, E()=1.09e-
FT                   01"
FT                   /db_xref="EnsemblGenomes-Gn:TA16540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72956"
FT                   /db_xref="GOA:Q4UIY3"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY3"
FT                   /protein_id="CAI72956.1"
FT                   /translation="MSSHSYVLNKPTRIEYQKLKILILDAPNNSNLKLYIKEMLEFGVT
FT                   CLVRTCESNYNDQLLLDNKIEVRDLFFNDGDPPPYEIVTRWLELIHQCLETNSAIAVHC
FT                   VAGLGRAPVLACIALVEYGMQPLDAICFVRDRRKGAINRRQLEFLKTYKKQRRRNYRCL
FT                   TCTVM"
FT   CDS_pept        join(207047..207458,207582..208325,208530..209146)
FT                   /locus_tag="TA16535"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.18 - score = 44.72"
FT                   /db_xref="EnsemblGenomes-Gn:TA16535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72957"
FT                   /db_xref="GOA:Q4UIY2"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY2"
FT                   /protein_id="CAI72957.1"
FT                   /translation="MLSQNGNQLKPANFFQVTRLELSSEAKDDVEINHGDDILDFILGQ
FT                   DLTNGTQRSQKRSEPDPSSDPAQTQVKSTGNDKNCSEKLKVMEQNDTSVVEKETITTST
FT                   TSTCSNLDFNSIRNFNITINTAKGNNKGNESINNELLNGTKLEEVCKGGLEGIKESVTK
FT                   QEGKNGNKKRIQEDKESSNDCTLTNSRLDRLLDELPKIEGIYYEPEFRCFKSRIPSRYS
FT                   RFTEQSSFSVKRYGLKNAWLKAVSHLFTNIASSVFDFPQTNQTSCGHLPEGSGRSTSEV
FT                   YGVSEVVSDVKENNVKGGSDDMDNLDYDSFYETRQKKAKVSDIELKNIKHIKRFMINSL
FT                   DNENFEDRGYEALLCSSRTNNKHVLSAEEQSDPKKIAESLRPWHQSVFWIPSISRWRTL
FT                   YYDENSVRHTKTFTPAIFGGVREAYYAAVEFRNMIDNMDELTLPTIRRSWVKSNVTNTS
FT                   KRPTPTGEDNFDSPERNLDNISKVNSNFNFSIQVNSTHKTVNCINTTNGTNVNGNHKTD
FT                   NPLNKSGKNNSNNLENKVCNNNREKDLHNNENSSNTSKEGAQSNILKGVDIDFLSGLDT
FT                   KGLFIPIPLDWKQD"
FT   CDS_pept        join(210788..210932,210962..211123,211153..211218,
FT                   211271..211431,211526..211691,211722..211981)
FT                   /locus_tag="TA16530"
FT                   /product="ubiquitin-related chaperonin, putative"
FT                   /note="Tap821d03.p1c.C.cand.19 - score = 31.28"
FT                   /note="SMART UBQ (SM00213) at aa 3-74, E()=5.71e-23; 2 STI1
FT                   (SM00727) domains at aa 137-167, E()=2.37e+00; 171- 206,
FT                   E()=3.71e+00; UBA (SM00165) at aa 278-316, E()=1.34e- 06"
FT                   /db_xref="EnsemblGenomes-Gn:TA16530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72958"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY1"
FT                   /protein_id="CAI72958.1"
FT                   /translation="MGLNITVKVSGGETFTLDVEPEMTVLQLKEKCSDKANAPADKQRL
FT                   IFKGRIIKDEEVLSALNVEDGNTIHLVRSGLKPASSPPTTTPTATTTTAQNTTTPTTGE
FT                   NQPFGQVPGFNQDFMSQMFQGGMGNLPGMPELNPQSAAALLNSPVVQEMLTQISSNPEL
FT                   FRTLVESSPFLQPMMQQNPMFGQMLNNPELLRTLMRPGMLQAGLQMHQAMQQSNANNQG
FT                   NGNTATQNPPNTENPFANFQMPANMAGTMAGTTPFQPTTMPFQAPPVDTRPPEERFSSQ
FT                   LQSLQEMGFTDQAANLQALVQTNGDISAAIARLLNRTQ"
FT   CDS_pept        complement(212155..213273)
FT                   /locus_tag="TA16525"
FT                   /product="membrane protein, putative"
FT                   /note="Tap821d03.p1c.cand.94 - score = 10.73"
FT                   /note="SMART 3 transmembrane domains at aa 19-36, 51-73 and
FT                   164-182; pfam:DUF250 (PF03151) at aa 204-372, E()=1.90e-02;
FT                   pfam:DUF6 (PF00892) at aa 230-360, E()=2.20e- 06"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16525 by TMHMM2.0 at aa 19-36, 51-73, 164-182, 187-206,
FT                   219-238, 253-275, 287-309, 314-336 and 343-361"
FT                   /note="Signal anchor predicted for TA16525 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.995) with cleavage site probability 0.003
FT                   between residues 33 and 34"
FT                   /db_xref="EnsemblGenomes-Gn:TA16525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72959"
FT                   /db_xref="GOA:Q4UIY0"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIY0"
FT                   /protein_id="CAI72959.1"
FT                   /translation="MTRVEISRRLKVRSYLKCLFYVLGIYVCFLSFGYFLEKLLKFKYE
FT                   ENRVYGFPIFVVVITTFSNLVMSSALLLIHHNKTTVLSIRQSHRNLKHPVKFQGSSDES
FT                   WKTSSTATSDSTDKLEVTSSLFSVLEKKHLIKLSISSSFCVLAQMTSTCALRHVGTPTQ
FT                   VVIKSSKMVPILIGGYLLFKKKYAWYDVSCVICVTLSLILFNYDHFVNYKSNKNSVFGI
FT                   FMCFLSLVCDAFVGPIQDDVLSKVDVHPHVLMFITNFVSLPVSFLVCFLTEGLDPFYIL
FT                   FKHRYILRLVFFLAVSGSLGQLFVFLCIKTYGSLYTGIITTLRKAFTTLLSVYIFKHKM
FT                   TQLQWFSLTLTFSSIFFQQFFKNKSRKSFKSK"
FT   misc_feature    complement(join(212191..212247,212266..212334,
FT                   212347..212415,212449..212517,212560..212619,
FT                   212656..212715,212728..212784,213055..213123,
FT                   213166..213219))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16525 by TMHMM2.0 at aa 19-36, 51-73, 164-182, 187-206,
FT                   219-238, 253-275, 287-309, 314-336 and 343-361"
FT   misc_feature    complement(213175..213273)
FT                   /note="Signal anchor predicted for TA16525 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.995) with cleavage site probability 0.003
FT                   between residues 33 and 34"
FT   CDS_pept        join(213623..213829,213925..214300,214330..214432,
FT                   214489..214768)
FT                   /locus_tag="TA16520"
FT                   /product="ubiquitin-fusion degradation pathway component,
FT                   UFD1 homologue, putative"
FT                   /note="Tap821d03.p1c.C.cand.21 - score = 23.26"
FT                   /note="SMART pfam:UFD1 (PF03152) at aa 156-318, E()=7.40e-
FT                   07"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA16520 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.772, signal anchor
FT                   probability 0.032) with cleavage site probability 0.595
FT                   between residues 29 and 30"
FT                   /db_xref="EnsemblGenomes-Gn:TA16520"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72960"
FT                   /db_xref="GOA:Q4UIX9"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="InterPro:IPR042299"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX9"
FT                   /protein_id="CAI72960.1"
FT                   /translation="MYHNLVLCKKFLNTLSLCILLFSFNRLESIKTNNGRLNYSISIKS
FT                   PSELLGKLVNKLVNVSTESYNRAKKELYVEDVNGTIGKPVKLFLVLEQSDLFKRCNNTN
FT                   YSEDGSEISFSDHDKVLLPPSFFECLKDGDYNVPFQLLVHKIHNPQEVIDPKRSNNLAN
FT                   KGPKKDFIKLTDKEEINECTIQSNNEDYISQNKISEECISCSAIEFRTDENYIYLPKWI
FT                   INNLKLKPYDIVLVEPVKLSDCTNVELKCLEKGFYDLKNVKKILEDRLKYYSTLTINSV
FT                   IPITVDKKTYNFQVVKLDTAEYQNVNHVSIQDVDINLKLL"
FT   misc_feature    213623..213709
FT                   /note="Signal peptide predicted for TA16520 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.772, signal anchor
FT                   probability 0.032) with cleavage site probability 0.595
FT                   between residues 29 and 30"
FT   CDS_pept        215248..217821
FT                   /locus_tag="TA16515"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.22 - score = 45.64"
FT                   /db_xref="EnsemblGenomes-Gn:TA16515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72961"
FT                   /db_xref="GOA:Q4UIX8"
FT                   /db_xref="InterPro:IPR031595"
FT                   /db_xref="InterPro:IPR033495"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX8"
FT                   /protein_id="CAI72961.1"
FT                   /translation="MLWVFKIFYKIWVFTAIESYLTFENVFHNYRSNTNFVHSFKCSNF
FT                   NKVRLKSVINTPVSYEKARNYALFAEVTETEVRPEILRKTSVIDLDYLGHLTGDLIRYS
FT                   KSVDKNKPEICYEQLKNIFGKFSHVISELFTEPVEVDYQSKLEQIRQEFGEKIDKIEPH
FT                   HLLKINPTEYRNNTTTFAYEYLVDYDPLNSEKVPRVFRRDLRTDVPKILRKRLSYIINF
FT                   FSKTLGLFFVTFYQSNLPISELYKESTTLGLESTPQLLEGITLLHLTDNYYGTDLRKKI
FT                   DKSLELFEYSSIVKQGRNKSFSLIINHFFQNKDYESIFYVIKYITNNLDKKLNGLYLVQ
FT                   FLVSLAHKFKSLKGDSNNDKFTHNIPLNNSVSENEEGLDERKRFKKMMFSELKQWIKQS
FT                   LELYEKCNLHPFNMIYEFAEILERNYRDLVPGLFRIVTVSSSGDSAVPHGLCDLCNTKI
FT                   NFQDISDPDRFEIFSNMLKTIFNTTVKEFFPLFNFYKFLLRGTVRGKPYTCIIDGQNVG
FT                   FYKNNCWVLDWNKLLDAFYFFESAGENPLIVLPFRIYNKLMAHLEKMDKPSFDLFDILN
FT                   ENKSIYLTNNYSYDDNYFLLAGIVKFTEDEIKLFDHFINQTSVDESYYASIEYCLSKIK
FT                   NDQFKKSDKNTIIVTNDRLSNLLIEDVNTEVLNTWKNYSLINFTAFNPKGRLTMGRRIN
FT                   YTFSVVSDNDKFHIPIGYDRIFTNSNEIHKFELGLNIPSGTSNFSGSSRSPETGKISIK
FT                   FLNQEETPNKNWIRDNQHLLFDSTNLTPNPVTTDNDTFKERGSSYHPYGSTDNDFKHSN
FT                   DRYRNVFCEIYHNSPEIVEQMFIPNSKSKWLCIDLSRIDSLIENL"
FT   CDS_pept        join(217858..218151,218297..218621,218687..218836,
FT                   218873..219021)
FT                   /locus_tag="TA16510"
FT                   /product="orotidine 5'-phosphate decarboxylase, putative"
FT                   /EC_number="4.1.1.23"
FT                   /note="Tap821d03.p1c.C.cand.23 - score = 17.54"
FT                   /note="SMART pfam:OMPdecase (PF00215) at aa 60-282,
FT                   E()7.60e-10"
FT                   /db_xref="EnsemblGenomes-Gn:TA16510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72962"
FT                   /db_xref="GOA:Q4UIX7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX7"
FT                   /protein_id="CAI72962.1"
FT                   /translation="MGFFDKVEARISSNSTILCLGLDPRDEQVEKFSKTAEFERLFQLN
FT                   VDKKENWYKLDKNSTYVKLKLYCLHILDNTLDHVCCVKPNLAFFLSRLTDGVQVLVELC
FT                   NYLRELNVPVLLDCKLGDIGTTTEYYKKFVFEELRADSCTVNTLLGSDVLKSFCSDSSN
FT                   NFVNDLFVLAKCSNESSQEFQSALLKDGTPLYLRVIQQSEKFLENNSCNCKFGYVVGSN
FT                   CVDEIRRIRESYECYLLVPGIGSQGGDLEQTLRYGLNKNKGGLIVPISRSITDTDVCLK
FT                   FLIVFQDPNKSAVYYKNLINKYIK"
FT   CDS_pept        complement(join(219025..219276,219306..219494,
FT                   219524..219716,219778..219947,219991..221519,
FT                   221572..224413))
FT                   /locus_tag="TA16505"
FT                   /product="DEAD-box family helicase, putative"
FT                   /note="Tap821d03.p1c.cand.93 - score = 158.47"
FT                   /note="SMART DEXDc (SM00487) at aa 787-979, E()=2.88e-36;
FT                   HELICc (SM00490) at aa 1436-1519, E()=1.10e-23"
FT                   /db_xref="EnsemblGenomes-Gn:TA16505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72963"
FT                   /db_xref="GOA:Q4UIX6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX6"
FT                   /protein_id="CAI72963.1"
FT                   /translation="MEPPENNKNTTPNCNPNGVTILKWFHKKEDQIGECVKEESQYKEN
FT                   PLLVQENEAKQTQNLEENRENLGNEGSQSKENMGEEEGENRRSKRTAAINQRLLMKKIA
FT                   SHEPNIEDMSQDELKYSDKGVLKKKRMKRENQQLYTSSSDHEEFIRSVSATYAANQQFF
FT                   GLQWQPQPYFNPQLGFVQQRSLSETSAASYIKYNNSYSLENYVNKPTQEQLEHEEMIMN
FT                   QLNELKGAEVFNFNEYEYLASKQKKKKKIMINKEHIFIKGLNYIENYFIQNRESLLRKD
FT                   ISELRKLGLDNVQVDPVFLIELGGNYEQFKDEIKDINKLINSLQSKLNELYSEMGKSIP
FT                   NKINEPSVFSCSSLSPTSSRDKDKHILKFEEILEEMKDFQDLVNDEHKEKRKIYKNLVT
FT                   NTSKYIIKMEQDLEKNKTERNKQVLLIYRNLSNSIDLFWKKIEKFAWEHLKKDLQQELI
FT                   KKKKQNLDKFIQDAIKVSINDQDRYILDKKIKTVTTQPQTTQNINHSEPQNHIPKPKNK
FT                   NQQDKVGSPKPNVSNDEDQVEDEYVLNKDEERMELDDLKLEDEMDSDKEENELNDLQKE
FT                   AEMPLEELLKMYQNQTDEQSEEPDYDEIEQVTDSDEAQASDRDEAEKVSDSEADRVSEL
FT                   SMSDDPQSPNSDRYESSKPNVSNDEDQVEDEYVLNKDEERMELDDLKLEDEMDSDKEEN
FT                   ELNDLQKEAEMPLEELLKMYQNQSDEADVPVPKKKYKYKKDDSNKVEIKTNKTQKDEES
FT                   SKSKMEKVLTEEQNNRVQVNQEEDDVDIEVPFLIKGVLRPYQKEGLRWLVSLYERNING
FT                   ILADEMGLGKTLQTICLLAYLACNKGNWGPHIIIVPTSILLNWVMEFNKFCPGFKVLAY
FT                   YGTPAERAKKRTGWNKPYSFNVLISSYTIVVQDSYILKRRAWEYMILDEAQNIKNFTSK
FT                   RWQTLLTFNTKFRLLLTGTPLQNSLQELWSLMHFILPNIFTSHTQFNIWFTDPLNQALD
FT                   NMYSNNPLFTDNELEKKNKEREEMNKNNMELVEKLHAIFRPYLLRRLKKDVEKQMPSKY
FT                   EHVLKCTLTKRQQVLYDEYIHLYNFSSNKEASKEERLSYRSMLNILIQLRKICNHPDQL
FT                   KSRDAQIPIEFNINTLQLPYLFQISDKLKHNFDNRNLTNKINNSGKSFLEVCSKRKRTE
FT                   RLIVDKRIKKRRVDLNSQLSFLSLNNLVSSTFDDNKEVLNQNFVTDVDLEKPNNYNHYN
FT                   GYGINSEKLKSEPQNNSEVTKRNMINKLSREQLLQGQKINLGPMNDNFKARKLTVNQNP
FT                   SDELSNKMLSQKLLNRQDNILNLNLKNNLEINKIIESYLILILNFLLISVKVVSKPVKL
FT                   YFSGTQGINYNNKNDWYMNEVKTKLLKRDDKKYYKENKVTVEAVNSNYKLLFPSRRSIN
FT                   DDCGKFKVLGPLLLKLKSEDHRCIIYTQFSKMLDILENWINFMGFTYIRLDGSTKIDMR
FT                   QKIINRFNENTKIFLFISSTRTGGVGITLTGADTVIFYDTDWNPAIDRQAMDRCHRIGQ
FT                   TKDVNVYRLITEHTVEENIWRKQLQKRKLDDLIVDQGQFDVQHNNWFSNLDTLINIFQN
FT                   KRDEQDEEDIYGKKILHESNVDETQFQTKGVQNIKMLIEVEDADDSMALKKLKKENENI
FT                   NKQDFETDLINSIPGLVTYCIQFLLKYQTVTLERQVENMKLKIQIEDYQNQQNNEQEED
FT                   EDDIYTDYTSSENEELSQEDELSEDSQ"
FT   CDS_pept        complement(join(224457..224852,224902..224972,
FT                   225004..225078,225116..225331,225461..227303))
FT                   /locus_tag="TA16500"
FT                   /product="phosphatidylglycerophosphate synthase, putative"
FT                   /EC_number="2.7.8.5"
FT                   /note="Tap821d03.p1c.cand.92 - score = 56.58"
FT                   /db_xref="EnsemblGenomes-Gn:TA16500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72964"
FT                   /db_xref="GOA:Q4UIX5"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX5"
FT                   /protein_id="CAI72964.1"
FT                   /translation="MEEDLVLEYITESKNLSFLYDPKSYYNQLCSMIRNAKETVVISCL
FT                   YIGTLPLEQDFVNCIFEAKENNPNLVVELLLDKQRSMRKENTGKCILDLIKPLLSQNNV
FT                   SLRLYHSPLCDPLLNGILKPPYSEILGTLHMKIYVADSVTVISGANCSTPYFTNRMDRY
FT                   MIINDQLFANLMHTIVKTVGTMAYKTTENLEFVWDSDLINPLDDSFLFKKQIYRRFVTM
FT                   IKMCNDALEPILMAKVFANISSEQKKSKSSKIFNKLVQRRKSITSSGSGLSSQSVSHEN
FT                   FDFSNRDSFDYYTPRDANENESLEEPCIKESLSGLYSLTPRSYLTLSKNSSINSWRYMN
FT                   GSAKSGRNLNGVKTMRHNGKHEYCSICNNYTGTVLDDIDHTPYRIMRRYPPMEGFTRFM
FT                   IFFQLGFTDPPFRQDEELCKDLMIKFRKSGHSLVLATSYLNFTKEYSDLVTYMLNCKSS
FT                   ENMGSFYVLTSSPTANDFHNCSDSKKIIPKLYCHYQNLLLDYVFKRSPRDYKDKEEEEN
FT                   DSFYYEYHNPGYTFHHKGIWAFQGELPKNAKELTFEEFKKNIKGPCAMLIGSSNLSRRS
FT                   HNKDLEMNILVETNSVSVLDPIKYEIYALFSNATPVQKRNLCNKWCKKVMIYVFHLLLV
FT                   YVYKFQAETVSLNFKNICFIYFNNTSPETYQLKATSSEIVDFSVIESPSDHIIDERFFN
FT                   ISENPKYNRKNKENLDKLKWATFEARRFTYKLGKFNKKLRKVKNRRKLIYSNFDVDENE
FT                   LKKINIESRDINKSIQTFRALRKSFLNFIRGLRLNNNPEVPYVPVSLRSDKISDKYYQL
FT                   ANKPNLKRSKRIGDNKGVKNKTKIKRDKSGVEKKHKDNENLEFLRLLEEIKARR"
FT   CDS_pept        join(228010..228543,228693..229535,229602..229685,
FT                   229732..229851,229888..230013)
FT                   /locus_tag="TA16495"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.24 - score = 9.92"
FT                   /db_xref="EnsemblGenomes-Gn:TA16495"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72965"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX4"
FT                   /protein_id="CAI72965.1"
FT                   /translation="MPTSISTRDSTKKSSFFSINTFKIRKLRIVKNRLVFLISHIKLFN
FT                   LRRLCLWVRKWFRKNKVFSFLRNCFSKITKLRLFEFILNNDMSELLVDSSLPGANECVP
FT                   TSTELVLKEPSETDSNSPSELNNKFLFNYTKIIKDLGGDKDTDGTITNSNEDSTSDDLI
FT                   TGCKKSSKTVSFSSKKTPKFLGAYNFNKLRSFTSEFRNDLNDIEEYKDAELEFEEYCEE
FT                   VKDFVVLDRLNEGKNLGSLLTRLNVNGPDHYLKRFEGLKVDNLNLVLNQLNQLKIHSNA
FT                   LYNFTTCGFQVSQDHLKKLVSLAHNHYIELLSSYALEESGDQENNIKYHNEVIQNDTDP
FT                   SGSKNSRADIFKLSEILATLLLTSSESGLFKDDPNRVCRILESTLFGKMFEPFAKFSSG
FT                   RLINSVLFVYSISQLFEKDYDVQMEGIFDRVIQTISIKEIDINLSDLFYLKLSVKFILN
FT                   RNPGLGKKISKESSSFLSNVVFQNYIKEKELHGLEDVVPLKIKEIDSNIEGGVFSIGPF
FT                   DFTHVSLPNKNVYISNKPHYYFNSSPKFGKREYLNWMDTFLKINGWNLIHL"
FT   CDS_pept        join(230052..230095,230124..230572,230605..230750,
FT                   230783..230902)
FT                   /locus_tag="TA16490"
FT                   /product="ribosomal protein L23 (or L25), putative"
FT                   /note="Tap821d03.p1c.C.cand.25 - score = 52.25"
FT                   /note="SMART pfam:Ribosomal_L23 (PF00276) at aa 17-111,
FT                   E()=1.80e-07"
FT                   /db_xref="EnsemblGenomes-Gn:TA16490"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72966"
FT                   /db_xref="GOA:Q4UIX3"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX3"
FT                   /protein_id="CAI72966.1"
FT                   /translation="MFFTRILLSPPKSPRNIFFPWQNICVHRTGAFLERNRLALRVPIN
FT                   LTKFEIREYLRKLYDAKVIKVNTLIKIPKIKRDFSSKVPKYYRNGPMYKKAIVTLEHSV
FT                   PDEVKMLGMDFELGKNPSITKKNVHYGKKSDFSYLPDRKNDPFTGEYEEAWKLPIPNLL
FT                   ADDEWEIIPELNQNVDYMRMKPDPTEPHIHGGSYTYNRKPDTVPAQENQIMDLTPWRRK
FT                   LKKMEKTSDKDTDFESEEAKPTPWNFPPAH"
FT   CDS_pept        231843..233504
FT                   /locus_tag="TA16485"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.26 - score = 46.59"
FT                   /db_xref="EnsemblGenomes-Gn:TA16485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72967"
FT                   /db_xref="GOA:Q4UIX2"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR028078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX2"
FT                   /protein_id="CAI72967.1"
FT                   /translation="MKATKFGFFDENTVNSETITKERYKAYDASDPDFTVAEAVRPKRR
FT                   GRQRINPYGYNRLGYYTRGVNVEKANDLSQIYKETNDLEENFRNLKQVYEEHDYKVNEE
FT                   NNLDDKDRDNLKDKNDTDTRLTSSSEVLSNFNYETIDNYEVSDNHETIDNYTASDDYIT
FT                   SLNDNCEFPLKTNDSTFNTEESTLKDLEKEEFPFDKEQLLEKEKELEGVTKEQLVEETN
FT                   ELLKKAQKTSFEEQNQTPDSLQINEQVLEKEKKISEPENVYVISEELRQSYIRQSKLLP
FT                   KIRGVWFNSTVRRMGWVGQAYKKCKRIEKIFSINKHGFEGARKLAIAFRNSQKPTNKSD
FT                   LPNYPDISLKDVIKPISQLRINLQQQINQNNSKEAKNNIVNERIQTSSSTKDKSDYVPS
FT                   KHKDEVVRLETRSSKMNLKGLYANEIEVDDYEYPVDYYELIDHYKSQLNNEEKQVRDNI
FT                   CKEALLFMLYELEALVELDIPIPPISKSECKRGINFHINFLENSKKSVEVLPYINSLAH
FT                   YICKGITPTDMTHFELYSLIHTLSHCIPLKMEFSST"
FT   CDS_pept        complement(join(233688..233764,233791..233836,
FT                   233866..233924,233954..234065))
FT                   /locus_tag="TA16480"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.91 - score = 12.07"
FT                   /db_xref="EnsemblGenomes-Gn:TA16480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72968"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX1"
FT                   /protein_id="CAI72968.1"
FT                   /translation="MNCLLFKLLNVCSTFPYLNVYYNFDPKDWSKIREQQSRLANFRKR
FT                   LSRLRRQVVTDMDRISQFMDIEKNLAINARGKLFQTALSKNVLPIKTGNKLI"
FT   CDS_pept        join(234726..235880,235950..236053,236110..236257,
FT                   236310..236388,236463..236563,236601..236760,
FT                   236817..237010,237045..237872)
FT                   /locus_tag="TA16475"
FT                   /product="DNA topoisomerase II, putative"
FT                   /EC_number="5.99.1.3"
FT                   /note="Tap821d03.p1c.C.cand.27 - score = 76.72"
FT                   /note="SMART HATPase_c (SM00387) at aa 131-315, E()=5.52e-
FT                   16; TOP2c (SM00433) at aa 135-913, E()=1.17e-142"
FT                   /db_xref="EnsemblGenomes-Gn:TA16475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72969"
FT                   /db_xref="GOA:Q4UIX0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIX0"
FT                   /protein_id="CAI72969.1"
FT                   /translation="MISKSSFFIWNNEKCRLLYTLIILCNIIKVSSGYLLNGNGIIRNT
FT                   QINIPNLVNLSTSGDNFKTNNSKINKFNLKDQNIEDAVPSPVTDGDEKGENVNQLQDTG
FT                   EYSSDDIIVLEGLNAVRKRPGMYIGNTGERGVHQLLYEVLDNSVDEYLAGFCNRITVSL
FT                   MKDGSVEVSDNGRGIPCDISPKTGKSGLETVLTVLHSGGKFQDIFPPNSTSMSSEDQND
FT                   LKSRKKGEKEHEEKKVYEYSSGLHGVGLSVVNALSELLIVDVYKGPKSYHIELSKGNIV
FT                   KPLAEFSEPETTEKSNNNLKRYGTTIRFLPDYKNIFKTHHQHTETEKEEDYDTTTNKSG
FT                   LDTKCSGCKNGFILELIKTRAKELSYLNPGLSIKLVDYRITDENNEPWEETYRNTGGTR
FT                   SFLEELIKDKTPLYKPISYITIKGVISNINVEVSFSWSLESYTALIKGYANNVSTIAGT
FT                   HIDGFKISITRCVNGLLKKYGYFKGNVKPLNGEFIREGMTAVISVKLTGAEFDGQTKTK
FT                   LGNALVKTVTEKIVNEQFTNILENNKELLLAIHNKSQAAKKAFDAARTAKDLIRQKSSS
FT                   IVSNISGKLTECSSSKVENNELFIVEGESAAGNAKQARNRQFQAVLPLKGKILNIEKIT
FT                   DNSKVLENQQIQLLMNSIGISINPVTWRQNDLTEGTHMAMDRFIEMNSSKLTRKQIWLD
FT                   LSKLRYGKIILLTDADVDGSHLKSLLLCLLYRLCPSLYLHGRVYVASPPLYRITNLRNK
FT                   KYIYSWSQEHLLKTIKELNSKYSPKETTERVREKDNADDLGNEYEDEFNDDEDDREGNV
FT                   EEIELKTELGSNITKDEKSDELDLYNINKSFSKNNKHLIIQRFKGLGEMMANQLWETTM
FT                   DPKKRILKRIVVSQEPEISEIIRLLMGSDVQSRKQYIFNNSGAFNLEDLDI"
FT   CDS_pept        complement(join(237934..238184,238231..238332,
FT                   238362..238533,238564..238665,238694..238755,
FT                   238785..239253))
FT                   /locus_tag="TA16470"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.90 - score = 31.41"
FT                   /db_xref="EnsemblGenomes-Gn:TA16470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72970"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW9"
FT                   /protein_id="CAI72970.1"
FT                   /translation="MNNIRCIISKVISFNSFPSALIRRRYCTISFSNFHGTLPFLNHFY
FT                   SDFYTPKQTLRSIDSTNFSTKCYSSSRDSDGPVIESGREFDEIQQQLSLSEFASNYWRS
FT                   LRLSKPFLLTFNVDKSVEARLMDAVMGSGVFCKNVPSLDTLFETILQYKETKDLIGCYM
FT                   NLDNNYDAFLNMNKDLFEKIKLSCNSLFLDVTYTYYQSVDDYMKTSKIINLINPHVIRF
FT                   CSGTLKFLLNTDLECPLLKENSTKEDFSLERCYYLSEKYNSTVIDSSDKIAVSNHNNME
FT                   MVVFPKLPQILNKIHGMLICNRYNNCSGAIIASMTTLSSEDFLVPSSAAIYGLDFVSSE
FT                   SAKKANGPGSMVCKRFFIFCSFIISSTPYTTYQCLPTIYSNINLQ"
FT   CDS_pept        join(239830..240532,240576..240731,240764..241273,
FT                   241328..242376)
FT                   /locus_tag="TA16460"
FT                   /product="metalloprotease/cell division cycle protein (FtsH
FT                   homologue), putative"
FT                   /EC_number="3.4.24.-"
FT                   /note="Tap821d03.p1c.C.cand.28 - score = 78.41"
FT                   /note="SMART 1 transmembrane domain at aa 159-181; AAA
FT                   (SM00382) at aa 263-403, E()=5.27e-25; pam:Peptidase_M41
FT                   (PF01434) at aa 461-666, E()=3.80e-73"
FT                   /note="1 probable transmembrane helix predicted for TA16460
FT                   by TMHMM2.0 at aa 159-181"
FT                   /db_xref="EnsemblGenomes-Gn:TA16460"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72971"
FT                   /db_xref="GOA:Q4UIW8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW8"
FT                   /protein_id="CAI72971.1"
FT                   /translation="MYNNPDHRVPIVTNSRYTGHGFTEEGNISDINSDNTMQTRPVFQY
FT                   DDMNDESYRFTTASGENDLLLSHSDANLQYYYPSNASVNFNKYSQQHRTGLGFQVPYEC
FT                   INTSQNADSNGSSKITTEISSGFSSFIGFFTKFSKEASSKSVDVFTTILSIAKSFFLNV
FT                   IGIALGVFLSMLFFTIISFLLYNGKNIKDFKNEPKKKSPPPTPPPKTQIKQQDPPPKPE
FT                   VTFEPVHFKDILGIDEAKEDVQEIVKFIKQPFLYKKVGAKVPKGILLVGPPGTGKTMLA
FT                   KAVATETGIPFIYTSGPEFVEIYVGQGAQRIRALFQKARKIAPCIIFIDEIDAVGSKRA
FT                   TGSLSGQNREHDQTLNQLLVEMDGFNVSTGITILAATNRLSALDRALLRPGRFDRVVHI
FT                   PLPSIQGREEILQHYLKDVNYNKESINVKELSKITPGYSGADLKNLVNEAALITVKQDR
FT                   LMVELADLYEARDKIIMGNKRKLLMPDIERKMTAYHEAGHALVAYYLYPNTDPIHKATI
FT                   ITRGTALGFVEQLPNDDYDKSSYKLIEMKSRLAVCMAGRLAEKLVFGSDNVTSGASSDI
FT                   IVATDLAYKMITQYGMSNKLASLNFHNLNNLNNKLSTDLNVKIENEIIELIREAEHIAE
FT                   SILRRKRSQLELLASELLKYETLTGDQITTLLKTNKSLNLPINGLPEESSDLEKDAKAN
FT                   AKTDSSSETNADEGVNAKTETNTDNTPTNSETNSNTEGDNDTHNDVDNNDVNDSDNNDD
FT                   NVSDKNDDNDTNNDTDNTSPDNNNSEMDTDDTKNDNDDVNDSEDAPNDDDNS"
FT   misc_feature    240304..240372
FT                   /note="1 probable transmembrane helix predicted for TA16460
FT                   by TMHMM2.0 at aa 159-181"
FT   CDS_pept        complement(242436..245225)
FT                   /locus_tag="TA16455"
FT                   /product="vacuolar sorting protein (Vps16 homologue),
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.88 - score = 56.83"
FT                   /note="SMART pfam:Vsp16_N (PF04841) at aa 1-480, E()=1.70e-
FT                   02; pfam:Vsp16_C (PF04840) at aa 616-925, E()=7.20e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA16455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72972"
FT                   /db_xref="GOA:Q4UIW7"
FT                   /db_xref="InterPro:IPR006925"
FT                   /db_xref="InterPro:IPR006926"
FT                   /db_xref="InterPro:IPR016534"
FT                   /db_xref="InterPro:IPR038132"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW7"
FT                   /protein_id="CAI72972.1"
FT                   /translation="MENWCQLGDKNIRREVWPTSQINSAPEDIKAVAPLGSMLAIVSGD
FT                   SKNLNTDEENVKCVLRIYNGSCVLVTSVKWYVSFENILGIQWTDSLELVSVFTNGCVRV
FT                   YSAHGELLRTFYLHSYGESNNNRIDPELIKYKIWSNGLVFVNFADQRLYFQKGFETQNT
FT                   WVVELNEFALSVTALGVVANRSWNQVLVIFSTLNGTNFIKMDHLMKCTNFEDFQKCLLQ
FT                   VNPCTYTHISTSPYHFSQTNLSTCDFEDLKEEQDVNSNINKKVKSNKYFIGMGNNEEGL
FT                   LTSLCIDDRSVKILWEIKIEPFNNIYTMSEGILAVTFTTKTDNLSNDPKSPNNPQILEN
FT                   ESNENDNTEQMLRRDRESNLIKLIYNADYDLNIYTQVIEILSDIGGGLRVFTRSKMEYL
FT                   DIVSISSELALSPDRCDVTNSLLRTYEMFKNGDEKSSESLYSIRDKLHRASKVCLEASK
FT                   DQWNFETALLLIEFSIFSSSMNSLNDSTAKNNNNSEEDSVSDQKFKNIELARENESKGD
FT                   RGHILIICYLRVCKNLVEYNIYTNINQLMLFGLKRLIVLLTSLKLYLLSIRICEFFRIS
FT                   PVLVLIGWITTRIKLGTHLTDSELFSIISNRLDKYLGTVLSFSKVAQVVFKQGRDVLAL
FT                   SFIEREKCPYKQFKVLIKWNELSRAAKVANECGDPTLINFIILKTFNNHDISNIITLSN
FT                   EYSLIKNMFVHQLLLSGNDKVLQVFYERTNSVFEAGLNSINIYNRNNPFLTNREGEPDG
FT                   KDKRDDLNRERKYSLNYSNGYFGNKTNTDATFWHEAVNNEMLLLEHQITLENTHESLKS
FT                   IKLVGRSLMETIYELYKLNLTKEVEVLVNAFKLPINQTRCAKIAAYHKTHNVQELFNLI
FT                   QDKQFSSVYIKPNFTYFHLLLQTLISLGANTHVDTIIHNMKPSQHNYWRNFVNQFNKN"
FT   CDS_pept        complement(join(245555..246402,246457..246586,
FT                   246617..246718,246819..247088))
FT                   /locus_tag="TA16450"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.87 - score = 33.65"
FT                   /note="SMART 7 WD40 (SM00320) domains, at aa 68-111,
FT                   E()=1.10e+01; 116-155, E()=2.57e+00; 159-198, E()=2.30e+00;
FT                   205-243, E()=3.64e-02; 246-285, E()=2.93e- 06; 313-352,
FT                   E()=7.64e+01; 360-399, E()=8.04e-04"
FT                   /db_xref="EnsemblGenomes-Gn:TA16450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72973"
FT                   /db_xref="GOA:Q4UIW6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW6"
FT                   /protein_id="CAI72973.1"
FT                   /translation="MDDPENILYNQCIGIDRLCNDYSSTIVTYLNRGKYIKKGKKVYHK
FT                   DVPSEIPNVLPVSFYTKYPNRYNGVCNHLVHAASNRNKFPNISLKWFPNGRMLLAGTQG
FT                   GKFIMWNGITFQFDDIKRFPVGTGSVTCFEWSPFGDFLVAGDEYGKLALLSPALSLLNT
FT                   NLYEGMNNGILDLSLSPNGSKFVACSDTYSPHIFDIQTTTLEGLLAAENIGSTSISCLQ
FT                   WNPYKNLVVTGSRTNIITLWDPMNKSQITSIYAHKSPIHKILWNPNGITFLTTALDGLV
FT                   KLWDVRILKPLLTYKIAASNQDESVYLTNINNINLLKSSKAVTVVTAMSWNPVQTNVFA
FT                   VGDNKSRLFHFTTHFTEPVSTVDLRVTDEKTPSTTSMDFHPFGHLLATCSDDRYVRFWS
FT                   RSILGGHNRLYTQDSHFILDDKVKHAPFTRFDFKNEIEVERIPSMKNIDK"
FT   CDS_pept        complement(join(247130..247253,247297..247633,
FT                   247668..248286))
FT                   /locus_tag="TA16445"
FT                   /product="chloroplast ribosomal protein L1 or 50S ribosomal
FT                   protein L10, putative"
FT                   /note="Tap821d03.p1c.cand.86 - score = 28.37"
FT                   /note="SMART pfam:Ribosomal_L1 (PF00687) at aa 128-346,
FT                   E()=1.80e-10"
FT                   /db_xref="EnsemblGenomes-Gn:TA16445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72974"
FT                   /db_xref="GOA:Q4UIW5"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW5"
FT                   /protein_id="CAI72974.1"
FT                   /translation="MKLLNLFKFYSVCHLLYTDYTYCFVFYNFLNLELNKLGHSPFILL
FT                   ASKNPKSSKYFKGEKVKSEEDFQRILETAKSLNLTEKDLNDYALKHLPEESLRKRFLYL
FT                   IKPKKEEKVLPKRLRKHLAILPQKNIEYPIDEAISRIKIISGTKFVEGIDVAIRIPVTN
FT                   KKAKSTAGQYSKLITIPYKSLKSKRTKVGIFGIKDTVEEIKSKGLENLVFIGGEELIKE
FT                   FKEKQEIPEVNLVLSDVETYPKLSLLGKLLSKQGLMPNLSVGTCVESKTDFLEIIDDLI
FT                   NRNVLVIKSDKTGDIKCNFADVSMPLDEIRTNLLEIFRYLKKNKPPYSTQKFVNKIFIS
FT                   SSMGPSFRLNVKQLKSNSK"
FT   CDS_pept        250106..252058
FT                   /locus_tag="TA16440"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.29 - score = 55.09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16440"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72975"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW4"
FT                   /protein_id="CAI72975.1"
FT                   /translation="MEDIIKYNYYKSFGRRYQYIDNVNDIIANTIKNELQIYEKGNDKL
FT                   LDKESGIKSEDNSGETSEHSEDLDHIRENPYSYILDQFKDVISSEQSSDFEDLSNENKT
FT                   TVRIKFSEQDQTKNDDPLDSGQNFRLGPKSKKIQEKEQNQTDLNSLENFGADEDKKINF
FT                   YLPHVVLRKLNSNKDPLNLNKVFSNLERNLSDVRYKYQKTLSNLALKSSAVRRNYRLTC
FT                   FNPVHPKNIRKIEPDQEHNQDKINNKRDVDKNNFDLNKWLDELPNDLKNFIEDESISNS
FT                   LNSIKDFKESKQLKDNEINKMDLNNRDAKDLHETHSEEETESVINIEKEDENPVSDKGY
FT                   MEVIQKDYIDPLKDVISEDIKTGLDEIKQGITDLYNNSPKIFQNIFGSSEPDKELDKSR
FT                   KPSKELNSYYLETNRDAVENLDSPDGEYDPFDNDYKIFDMKEKYQSFDISDKKPPQDST
FT                   PVVNRDFNENYVVYKENQVKSPEKVVKSVGEYNIGFLSNLWTINEKCKLMRNENARTNT
FT                   INPWFGSPAKEAMYRQRSLDNSNQEYKECTTVLDKERNMKYKIVMDENNKPVYLIDNIE
FT                   PGDEERAKKYKDTVLTIQRNRIKNRNNNLDSNLEDGVYDPLKQFQQTIEQTKLINETDL
FT                   AILGRPKVKRTNRKF"
FT   CDS_pept        join(252654..252725,252757..253728)
FT                   /locus_tag="TA16435"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.30 - score = 26.33"
FT                   /db_xref="EnsemblGenomes-Gn:TA16435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72976"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW3"
FT                   /protein_id="CAI72976.1"
FT                   /translation="MALDFLYRNLEQMSFLHKPLNYGKDLCHSTANVYGTDDVCKSPTM
FT                   AVENPDSQDLSSLGLQYSDPAATNKKPKTILPKKPPLSSSEFLASNCTNKFCDDKYYYG
FT                   NSFLWNSMINNLNYEKGSWTDSNWRNNDWNCVASDLTTNSGTVNSLNEEKNSDIFQSGS
FT                   NSFSFLNSGSNYLLSKSLSSDVNKNESTAETTPETMVTNSFQSVNLTSLSGYQFPPFSK
FT                   SFKNVNSFMNNHPPLSNSPSCDKVEEESYKEKGNKLKKDLTFDKDLDLTTITHSNGPPV
FT                   TMKVYTSWSSDSENTTSVKKSEKVQLVARSGNWIYVRVNSNPNRYGWIPEFTLVESEML
FT                   SRKMTTN"
FT   CDS_pept        join(254026..254286,254319..254383,254416..254542)
FT                   /locus_tag="TA16430"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.31 - score = 15.93"
FT                   /db_xref="EnsemblGenomes-Gn:TA16430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72977"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW2"
FT                   /protein_id="CAI72977.1"
FT                   /translation="MESVTNRIEKLKFSENKLESDGNLKLSDNSFPLVHTERFTVTDSN
FT                   GTLNPQFHYHNSDEDTEYTLTALKFSNSWQLFLTYSGNVGTWLCSSADLSHLDIYSTKV
FT                   LLGDRTKEYYQIYSRNGIKVLCDCLREKNKIDKYSPTGFKTCLSNF"
FT   CDS_pept        complement(join(254738..254806,254836..254864,
FT                   254952..255660))
FT                   /locus_tag="TA16425"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.84 - score = 19.49"
FT                   /db_xref="EnsemblGenomes-Gn:TA16425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72978"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW1"
FT                   /protein_id="CAI72978.1"
FT                   /translation="MNSVDTSSAEDDLVENFQQKMVLRRFKRPLLTLNKRLNDVYLTRD
FT                   VPLCVYYRRCVKLLRWHLPLISKVFSSEFMQNNNNNFSVTELLSKNKVLVSFSYLLILK
FT                   VPTDTNGQMYYPDGQNSLQKHLEDPMLRIFGSGFCVKKSFYLLQDLYYHIVTMYKLSFT
FT                   RFLHKSGVLKYCDDCKNKINTGLKLSDNQLSKLFECELCMSLNKAMFEDLFKSVFEVVI
FT                   STDSICCSDDLWILDSTSNDPKLSVEPANRYISSVSITLKPCDFNL"
FT   CDS_pept        join(255936..256532,256587..256839,256940..257295)
FT                   /locus_tag="TA16420"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.32 - score = 18.69"
FT                   /note="Signal peptide predicted for TA16420 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.671, signal anchor
FT                   probability 0.000) with cleavage site probability 0.640
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA16420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIW0"
FT                   /protein_id="CAI72979.1"
FT                   /translation="MIPYFLLTFIIVKYSFSVYDPKFYIHDKDFSLNTNSLFNELCLDT
FT                   PKKNVVCIILKPDILNNLICYDKCCLMCVNRLQMNKCYYLDTLSPKCSGTILYPLIDAK
FT                   SSNAVPSNSDTSLIELGNFENPDGCATLIDETCRINRDFSHSLDLLVPGRKSNVLSIRL
FT                   NPSKAADRNFIIQELDFNLPPRDEFLEYLNTIITDNFYPHVKQYLKNVEKMLKFRECVL
FT                   LNELDIIFHNITQFPLTTYRRFELHYLYTTSLTLFLRIMTFKTFLVSGFSNFAYIVYKK
FT                   LEELWINIVESDLKSVVPSISKFLSVYDSYEVDLYSELRLIMDPAVYNEILTNSTSYSK
FT                   QLEDTKGELPRIERDKLITESNEFLKRINLLLIKQCEPPSTYGPQCTVRFFKALEDKYN
FT                   KF"
FT   misc_feature    255936..255986
FT                   /note="Signal peptide predicted for TA16420 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.671, signal anchor
FT                   probability 0.000) with cleavage site probability 0.640
FT                   between residues 17 and 18"
FT   CDS_pept        complement(join(257355..257675,257709..257819,
FT                   257870..258638,258670..259346))
FT                   /locus_tag="TA16415"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.83 - score = 57.77"
FT                   /note="SMART pfam:DUF408 (PF04181) at aa 158-339,
FT                   E()=6.20e-03"
FT                   /db_xref="EnsemblGenomes-Gn:TA16415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72980"
FT                   /db_xref="GOA:Q4UIV9"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="InterPro:IPR038534"
FT                   /db_xref="InterPro:IPR039693"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV9"
FT                   /protein_id="CAI72980.1"
FT                   /translation="MVQSAGTVHFDQSEPLVFYYESFEHNYPETGSNNNNNNINKKSFI
FT                   KQNFENEGDLTFVDPYSDLESQQVYDQKSYNYRDSTDPSNKQDLNETFSSVYNTDDNHS
FT                   PVFISTGSSSVVPDPDASLKNGVKSENSPKKETNGTEPVSEEKVTNATYFYKILFHLID
FT                   IASDGSRFKCCKKSMVNPCEPCKVVEKLIYTYFDLTTLEDVIAERSKNGICGYIYCCNQ
FT                   IKKSTGESKYKIDVASNSIYEREECDSFCSTNCLDDNEKVNAKVSLSPVELGTFTPRAM
FT                   RNANNESLKKLYENVFSLRKCFGLPKNFNVNNIVTASTIDLGTQGPNSQDTDTKHKESD
FT                   QMVLDTNKDEENKNKSKFDGESKKPKDDKRQRIDTFEIFEDFDSADEMTEPPMSEANVK
FT                   FYKNPEKLVSIYKPSPYNTDLADNTTSTRSFDQESLDLSESEDFPEDEYLGIFSWLWYV
FT                   LSNFITNKTRDFLNSGIISQNRHNENFDDLYKQCLKGIPNNLLDTLKTHIQNILSTFKP
FT                   AKNNLLNTKIIEPLAYTIKYVILKNRHHLPLNYNSNLSNNSNEASTNQPQQDQIVFEEP
FT                   EQNNNIICNEELKEADYQIMLQDVNNVLNNRFLLDQESIDILSELFLEP"
FT   CDS_pept        complement(join(259531..260762,260823..261246))
FT                   /locus_tag="TA16400"
FT                   /product="chaperonin (T-complex protein 1 (TCP1), theta
FT                   subunit homologue), putative"
FT                   /note="Tap821d03.p1c.cand.82 - score = 47.24"
FT                   /note="SMART pfam:cpn60_TCP1 (PF00118) at aa 36-537,
FT                   E()=3.20e-139"
FT                   /db_xref="EnsemblGenomes-Gn:TA16400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72981"
FT                   /db_xref="GOA:Q4UIV8"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV8"
FT                   /protein_id="CAI72981.1"
FT                   /translation="MFQHKFGARALMREGGKFLGAADNPTLRNIEAIQQISDMLKTSLG
FT                   PNSMKKLIVNHIDKKFVTSDCNTILAELEVVHPVGKIVLSSVESQKLQFGDGSNTLVAL
FT                   LGELLTNAGELLQDGVHISDIRKGYEIAFNKLMEHLPSLVCYNIKDLRDHESLRRVLYT
FT                   AMNSKFSYMSEFLSKLVTDAVISVMPTDVSMFDPENIRVVKLTGGSLMESNLVNGLVLI
FT                   REPLGSVKKAYNCRVLVLSVGLEFSGPETKGTVLLKTAEQLLNYTKGEEREMETVIKSI
FT                   SDKGVGVIVCNGAVSEMALHFCNKYNILVLKLVSKFDLRRVCRTTRSQAVMNLSQLLPQ
FT                   PADLQNGETPEVNEEFGYVESMELTEISSKKCVIIRAKDSRVNTIILKGATNNQLDEVE
FT                   RGIDDAVALVDNLKVDGKFLPGAGAVELQLSVLLKKFSDTVSGLERYAVEAFAKSLQVV
FT                   PKILATNAGVDCETLLTNLLSLHENGKIHSCVDIETGSCGDSVELKVFDHYQTKHNLLT
FT                   LCYEALMTILTVDQIIVAKPAGGPKPPGQNNPDF"
FT   CDS_pept        261754..262941
FT                   /locus_tag="TA16395"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.33 - score = 13.64"
FT                   /db_xref="EnsemblGenomes-Gn:TA16395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72982"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV7"
FT                   /protein_id="CAI72982.1"
FT                   /translation="MTLLNLSNVVDQLGVSVSSLIARRNLLSFSINQLELLRDTCKKIS
FT                   RIDSFDSNYPKNQILTDFLRNGSRVLEESITLRTNIFSNNDLPLFNRKISNSEKFRYRH
FT                   NPTDLVSNQLPQNSISDFNKFDHVLNDTLISFITILGNSGLFLNSLDFLRSILSEIRID
FT                   SSNYSGLVCTVGIINKCDLFRYKDFLNFTRRIFSKFTRNYKILNYINDLDITLLLFHKI
FT                   SMLYMSQALLPNNDISTQDETELLHLLVTSLEKVLEISKFRDGSSSSVSMKSINNLIQS
FT                   IFLLYDYDKMLVCKLSLDKLYKINRILSINSDSHYATSNFDSPEQKTESGSTSSTTSIQ
FT                   IKNTSDLHLKVKTVLDNISIANNSYKDVENILKNKKILNEIRIGSSLYFVDLLIN"
FT   CDS_pept        complement(join(263040..263112,263143..263934,
FT                   264023..264069))
FT                   /locus_tag="TA16390"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.81 - score = 22.41"
FT                   /db_xref="EnsemblGenomes-Gn:TA16390"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72983"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV6"
FT                   /protein_id="CAI72983.1"
FT                   /translation="MPTPSDSNSSGKARRKSRFDDPNPVKRSGFSDSKNASSNVQPNFN
FT                   LQNVTTPSNNLNNLQQNVTLQTMGFQPQILPPFVPPSGFQPFPPFQIPNQNPVFPVVPV
FT                   QLSHFNPPNDPNLNGVDNKFDLDTCNVGVMASILIESRDKMRDFVPYKEFEDLDKIGGK
FT                   KEDEPVQNLTLTQRNKVEDFYDELEEIFEQYRSEIHPEDPSLNYSRRRKFNFSKQTNQQ
FT                   PKILSQDDLINPAKRDYYASEFYSNTAKENPGLGCGDDMFETFRRKRSTKYHEDYAIRE
FT                   AVRKDPNCIVVSPGEVCYPCNI"
FT   CDS_pept        264399..266837
FT                   /locus_tag="TA16385"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.34 - score = 61.36"
FT                   /db_xref="EnsemblGenomes-Gn:TA16385"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72984"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV5"
FT                   /protein_id="CAI72984.1"
FT                   /translation="MSSETSSESEVDPNSDLLDCTDEELRDFKINNDLPKNTDPSDEDK
FT                   TLDNNRNQNDLYSSENKELEEDENFGTDNTFSNHRFYNNEDKNSDDELDAQNFQSLNAN
FT                   TDECEQFQNSETITNETNTQNVDYSFGDSIPPQDPSENDLEQKSEVDSEQLLEPDSEPK
FT                   SPEPSCDPSEYSESNKDNQPEEHEEKDSFDNETPEQLSDQVSEKLSESVPDQNSEQLSE
FT                   PQVEQMSETTPQTEVAQPESPRTDSKSKHHKRFKSTTKTFESLFHKSSIGKSSKSKTKS
FT                   SSKTEETPSSKDVVVTSTSSYTSSATKKKDKGPCWTYYEIPGKPGRKGPTLGVFCDSMR
FT                   SNKSYQRTDTSKDQKCIVLQTPDSLERYLHPFQVVSNYYLNTNYIKYYTNSNNMEDSVV
FT                   NSYYYTNMMTQRKTLFPYCVTKTISGNVPGMGRVLACGTQCGKIIIYSFFTLDELIVLD
FT                   TRTVYDRYLSRENSIDSETDFDIDKAIDSTIFEVNSLAFITTFENYSTILAIGNHLGHL
FT                   LLYQIPKMQLIKLIYPSNMSNANMYLRSNSSNTITSSMSITSSCCDESESESVLIDELE
FT                   LLKFRRHKILNPNNQQDSESQNDEVAFITCLGYCPTTGDLWVGYGNSSFAIYSSTFKLK
FT                   KFYTSNSLSDTNNNIVIDDNVYGVNNFEYCTYEQIVLVVYGNVKVDIFTFSGNFLSTIS
FT                   STRLTNATTPISSVHVSNNPNGSILYIGLMDGSLLVKQIMYNTNKNIIAKENGDHNDGL
FT                   DELVINTIEFILLYKFIYKFDGEINSGAPVTCICPVPSQQLVLLGDASGGLSVISNLTI
FT                   "
FT   CDS_pept        complement(join(266913..267572,267605..267715,
FT                   267757..267855))
FT                   /locus_tag="TA16380"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.80 - score = 22.18"
FT                   /note="SMART RING (SM00184) at aa 237-275, E()=8.56e-06"
FT                   /db_xref="EnsemblGenomes-Gn:TA16380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72985"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV4"
FT                   /protein_id="CAI72985.1"
FT                   /translation="MGNLNSKSPRNNLEFEVLEQEIIPTDNQYILDESFDPPEYIKPVD
FT                   NFVISKLEHKKTIFLLKTVTVNPYPACNKFSICFEYDTAEPCTVIFKFGQKHMGLNNGI
FT                   PRYFININVINFSFSKPNRISKEFNLEVGTNKKFELKYSYLLRLRNVTLETASFTTERK
FT                   FVPILIVINSLNNDFTYFAMCGLKKDLNGKWHIYVTKRRIKVGSCGYLVQEVYGLNESE
FT                   YGIKKDQKDERIRNCAICLETPSNTILLPCSHICLCSDCSKTVSIQFGACPMCRSVVNQ
FT                   ILHINQQS"
FT   CDS_pept        complement(join(268258..270014,270138..270192,
FT                   270283..270384))
FT                   /locus_tag="TA16375"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.79 - score = 58.28"
FT                   /db_xref="EnsemblGenomes-Gn:TA16375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72986"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV3"
FT                   /protein_id="CAI72986.1"
FT                   /translation="MLITKFLFGILAIIVSKIIYKPIESIRDDFDINNVKSSFIQKALV
FT                   DNNSPESVKSGETVDVITNKNDGEESDKTKQEASNAETKVESTTTKEQVHHHEQLKEQS
FT                   EPPKNSEEGTKQPETAENPPKDNSHQHQTAHSQAGHHGHKGQHSHSHHHGHSHGHQDEE
FT                   DEDEDFEDLHGHEEDEEFHHSGKGHNHTSDHKTKGDSTHRSLESSKVEQDKDTGKPENS
FT                   PKLEDNQKTENEQKVENGPKGGETEKVESDQKTEEAKPANEPENKKEDVVEQQNNEEKA
FT                   AENGPNKEETSPNQNAEQKTVVEEQTKVPEATNEEKEAKKSENENKVAEENGTAVQEQH
FT                   ETQEQTPKSESESSNDQTQQVSVETKGGELGESQDNSQPSCTCEKEVKPHEQPESSEQT
FT                   DNSKEQNEGGTSVKAHLKAKSEAEELYKVNMGTLSTDQTQKVEEYYKKPEANCSIDCSK
FT                   SCRTQFQGPTQCFTQDGKGVTCSAFADSTSLTCSLGSSPCSTPLVTSLNSYTMKNGSEE
FT                   VGTLEVMGSNFNKCTGLSLAPADGKCTRENLLHNLLYTSGKLNLDYNMEVGPGKMVFSN
FT                   LKIQNGDYKVCLFQRHDENGSPGPLASILYKLLTYVNPTHSLENGSKTLLSVEVGSLKV
FT                   SD"
FT   CDS_pept        complement(270921..273932)
FT                   /locus_tag="TA16370"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.78 - score = 46.08"
FT                   /note="SMART 9 transmembrane domains at aa 95-117, 159-181,
FT                   248-270, 285-307, 442-464, 507-529, 575-597, 612-634 and
FT                   737-759"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16370 by TMHMM2.0 at aa 95-117, 159-181, 248-270,
FT                   285-307, 442-464, 507-529, 575-597, 612-634 and 737-759"
FT                   /db_xref="EnsemblGenomes-Gn:TA16370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72987"
FT                   /db_xref="GOA:Q4UIV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV2"
FT                   /protein_id="CAI72987.1"
FT                   /translation="MTKLKNPNKSPKMEEVRETINEHKSDSSLVRRMSSSSDRPKVESS
FT                   DPNKNDMLETYRSVSEIPKKKKKTKYGDLFKFSLNNPIYQRMSPSNKRWLYIYKILSIL
FT                   GMSLLVVGYTFFFLVLFTPLIYVDEGQIVDPILFQPTHESLLHSLVTLWHQKAYIVIVI
FT                   VVIFSISLPFVKMIATLFAYLVTSLHRSRQIDLFYGSKLRVESQVRAYTSRSQSLEQNL
FT                   YEPSNLESMDYSVYEDRKITKYAREVLLILKLISKFQMVDSIILLLNICFLRSAFTWSR
FT                   RGNGLLYLVIYCLTSILGTQLLNLSVEGEHHMFEYWKAVRLLCLNNTVNYDSYYSSFQN
FT                   EDASEELEFKNSMLEHSVKYKTSNIEMNETVQPEKSTEFNKYTSGSNTTGNSSSSSGKP
FT                   PAVFNLKSREKSHSFEAISNTTSEPYFYEFIYKDKKKDFKTRWYISEIFVTILVIMNLV
FT                   AAGLIITNEKLFGITFTPDVEKQLGVDGTQMTFFEIVMSLRDCWNYLPFFIFYVLSVLV
FT                   PVLFHTTFLLGLILYKVSVSNKDFSSISKFDPGNPLIHPCHSFNLSVKFTRYLLNFSNL
FT                   LSEWSLGEVLSLGIIAGYVSLYTAPNVRFYLPPPKFVSVFFIIASFGVSSFLINIQFFM
FT                   WYTRIMNRLSDVTIYVESINSATSQENSDYNINSKLNQTQLVNDRTLMIGDSKNNLQRL
FT                   ESSIEHSVHDVDNQHQRTRKRNKVRIMFIKIVDFIRHIIYSKIIVSTFFAILFLLSLCL
FT                   FGFGFLSSPPPTKIDERKMQNFLDFGLPEIFSIVKRNLPKSFGNCNYIYPPPEPCTGST
FT                   SIYHSKETIYFELVWISGIDTIHFVDTNFIVRSDNRMEITSHIKFTGLKPYVKMGACIS
FT                   GRCNTVFSGENLCCGDDLHVVIGVSAVCDDTFPHIRDFRFEQLKIKNLKFLNELQYLVS
FT                   KVVSIESFLERQIVNHVNEFIARQEHIFGWKGLPFSVVDFINFLTQINFPYGLKCPPTT
FT                   PVSNQSNFASLPDQ"
FT   misc_feature    complement(join(271656..271724,272031..272099,
FT                   272142..272210,272346..272414,272541..272609,
FT                   273012..273080,273123..273191,273390..273458,
FT                   273582..273650))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16370 by TMHMM2.0 at aa 95-117, 159-181, 248-270,
FT                   285-307, 442-464, 507-529, 575-597, 612-634 and 737-759"
FT   CDS_pept        complement(join(274186..274976,275034..275508,
FT                   275576..275731))
FT                   /locus_tag="TA16365"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.77 - score = 102.13"
FT                   /note="SMART 2 pfam:RCC1 (PF00415) domains at aa 111-173,
FT                   E()=2.20e-02; and aa 176-226, E()=4.40e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA16365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72988"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV1"
FT                   /protein_id="CAI72988.1"
FT                   /translation="MWATKTIKKYWKSYKFRKFINSQKDELMQDLYKKEVQQITRNEII
FT                   TSLSLLQKYKYGLLPLHVNVSTKLDEFYPNGWSNSLGMVLRVNEDKQITNAAMGMFHTV
FT                   LVLNGSQVYTYGLNDYNQLGYTNRNELTGNVTFRDKSVEKSIRLEPMVMIKEGLKVKEV
FT                   TCGLEHTVMLLNDGSVYSWGLNRNGQCAQMQCYEVISTPTLVTFTNDSPVRVVTSGNHH
FT                   VCCLNHDYELFVWGKAFHLGLNCSDLFRPMKLETKLNLKSVYAGKQVSYLLDQEHNLYS
FT                   FGTTYNGQLGYPSNSLDKSFEVNRRKNELGNLTCSGETSGSTTFRFVLNQVADVSVGNN
FT                   FTVALDVYGNLWQWGTFLVVNSSTETFEQKTEYNPFLVRVDKKILKSPLAKVSAGWWEV
FT                   NLLTESLSLYGYNYLRLENKPVDENSQKLEEGGQENSTVYSPILFSYPGLAGMMPKDVK
FT                   TLASPTITVTMVRTD"
FT   CDS_pept        complement(join(275835..276017,276097..278462,
FT                   278520..278805,278861..279220))
FT                   /locus_tag="TA16360"
FT                   /product="myosin, putative"
FT                   /note="Tap821d03.p1c.cand.77 - score = 102.13"
FT                   /note="SMART pfam:Myosin_N (PF02736) at aa 38-81,
FT                   E()=1.10e-03; MYSc (SM00242) at aa 84-802, E()=2.64e-186; 4
FT                   IQ (SM00015) domains, at aa 875-897, E()=6.16e-02; 940-
FT                   962, E()=3.35e-03; 969-991, E()=3.68e+00; 995-1017,
FT                   E()=8.00e-01"
FT                   /db_xref="EnsemblGenomes-Gn:TA16360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72989"
FT                   /db_xref="GOA:Q4UIV0"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIV0"
FT                   /protein_id="CAI72989.1"
FT                   /translation="MAMRPSSPIGATRLVNKQKGEHFRKQESKVQNLDYLGGNTVWVKV
FT                   DTDELFVESTVKSVEGEQLRVNCKGEELLVNLKDCLNSLPDFDSLKVNDLSKIPHANSA
FT                   VVLKILRERFNQDVIYTYAGKLLVALNPFKKIPNLYDDNVIETYKKADTTLGFPTDLEP
FT                   HTYAVGQCAINGLFNDNKNQSCIVSGESGAGKTETAKQLMNFFAYSRTNLNTSTSVQDI
FT                   ILGSNALLESFGNAKTINNNNSSRFGKFLKLNLLPTGGIVGGEMSSYMLEICRVEFQNE
FT                   NERNFHLFYQILKGLKKEELQQYSFMDLKDYNYLNQSNCYEAPGIDDVSDFSNVLVQLK
FT                   KLFTPERLNNFFEIISGILLCGNVDFVEESRMGVDSAAKLSNPSLFRKLTELLGLDYDL
FT                   AEKAMIEKVIKIQDNMIESPVTSKVAQVNVRALSKDLYGFLFQYIIQLINQFTTGKSDE
FT                   SNSYDKESYVGILDIYGFEYFKHNTYEQLLINFANEKLQKYFINNVFTSELALYEREKI
FT                   DATSIVYSDNSVILEIFEKKNCGIFPFLYEQCSMESGTSDAFTRSCNTRIKNENFIPPK
FT                   GNVNEFTIVHTACKVVYNTEEFITKNKHSLSEVVVALLLNSTNELLKDMVIHSMALEAS
FT                   MECSPTNQTPGRTSRTTRSSTKLFVGNKFLKSINELVKCLEETNSHFIRCVKTNQVKQP
FT                   GVFDVKGVYGQLNSLSILEAVQIIHKGYAYKSSFANFINDNQFVYNILIGGKSSDEDDT
FT                   GTEDREKEKENAVNMLKLLEIPENEYQVGLTMIFLKKNGWMLLEQSHLKFSQLLAPLSK
FT                   LLNAYYQSYVNRKSYQKKLQMVKRVQSLARKFTLMGDKYKKLKLVNEFIGFVVVSNWLN
FT                   FDQRVHTSALIIQSNYRMLVQRRKYLREIEELRLLHKKRVIRKRLGKFKTYVWYSVFCL
FT                   YLQKVYRIYQLNKAATRIQAMWRMHQCVSNYNHIRYSYLKDYAATVVQKNVRCYLQVKN
FT                   YEFIRYAIPSVVLIQSYFRGWLVRKFVDSKVNVLKSIRNRLALYSKLYVLQNTIRSILS
FT                   THRFKLLKQDLSTLQG"
FT   CDS_pept        join(280143..280368,280403..281181)
FT                   /locus_tag="TA16355"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.35 - score = 22.72"
FT                   /db_xref="EnsemblGenomes-Gn:TA16355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU9"
FT                   /protein_id="CAI72990.1"
FT                   /translation="MAYYVAHDRVFINNNKRSTGLNPIKTTNSLGLNKNFFQQNFRPTS
FT                   LHAIKHDSNYLLGSSIVNLNFVNNVSNPNRGFEGCRNIPITKKSFCQGVNLNDSKYPSA
FT                   INHYPLLPNVSNHEHMYPFENYTYYKPLPEYCPHTPKNNLNFGDRIISMGTTDSIEFKQ
FT                   CDDSNDSQDPIITRNYLSNLQNDQNNEVNEEIPDDSPLRENNHDFKCVSDSRINERKSK
FT                   LDEYLEKSKTLKDKTDNSHKTVKITSGKPTYEFVAKYPDPVEKELERWHNSHNSTLKWE
FT                   RIRHGLYSVGGSIVRLVKVNGSLFVEGHGFKKYKGQLGIQKFVEEKESRLLRE"
FT   CDS_pept        282009..283472
FT                   /locus_tag="TA16345"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.36 - score = 35.90"
FT                   /note="SMART STYKc (SM00221) at aa 263-485, E()=1.98e+00"
FT                   /db_xref="EnsemblGenomes-Gn:TA16345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72991"
FT                   /db_xref="GOA:Q4UIU8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU8"
FT                   /protein_id="CAI72991.1"
FT                   /translation="MTEVPYNTAVEEFLSSNRSDISKDGIVAEGQDSTILSDSLTFLSD
FT                   YNLHDHNSLNDLDLTLGHYDPEFTNLIDSDLFNQLVNEDNGRINRRFSWPCVYSDDYDL
FT                   YLDSNNSNNALTDHRETKARTTLSRFRSLDGVKSFSILRRNTWGSLMYRFRKFCIEHNR
FT                   NNLVGKSRGSSLDSNSSLSGSSDLNTKSLENILNLKNDVVQYAIFKPANLNINNREFMN
FT                   GFVKNKEEKDDIVTVVKSLSNKRVSTYGLTRIIKCTSRQEYEVLDHNTGNYFLLKLTNN
FT                   LNTFNIYKTLFDNPHPNFVEVIQLLTNSDFNSTNDNQSPQNQDSIYYILLNTCNHMRLS
FT                   DYHINTLPSLIDFKVLRNIIKGLLNFVLYLHSKSLVLSKLSMKSVILCNSSSNGLENGI
FT                   NEDVRPKVLDLEDVRECEGKNDIKHDLWIIGNLLFNFIEGKQSDENYSFKSNLWTLCPK
FT                   MFDFCIIALGKRSSFNSALEALIHPWFTS"
FT   CDS_pept        283640..285211
FT                   /locus_tag="TA16340"
FT                   /product="ADP-ribosylation factor (ARF) GTP-ase activating
FT                   protein, putative"
FT                   /note="Tap821d03.p1c.C.cand.37 - score = 41.33"
FT                   /note="SMART ArfGap (SM00105) at aa 21-141, E()=1.03e-21"
FT                   /db_xref="EnsemblGenomes-Gn:TA16340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72992"
FT                   /db_xref="GOA:Q4UIU7"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU7"
FT                   /protein_id="CAI72992.1"
FT                   /translation="MDWILSLKVDQRGFVSEADREEFFRRQFRIPENTTCFECGFSNPK
FT                   WLSLSFAIYLCLNCSGRHRQLGSHISFVRSVDMDRFMRDQLIRLHVGGNQKFNAYLSSE
FT                   NLLQKPTDYDNSKVLSYSYTLDDEVAKARGEKVPEDESPTKEDESPNLDPEQMQNLLQS
FT                   DQYSFADLEKLINELSLQSSLKDDAEKFADLKNLDFSDLGNLEIPSFDPSVSSSAKAPE
FT                   QGNTSDNFDFSKFDPSNFDPANFNFENFSEFASNVQIPNTLDTNDAFLNMDFPNEVPST
FT                   SSFNQVPNSNLGTNKSSGSRRKRSANNKFSSKADDFDFETFEKENNLESAFPGPSLHGD
FT                   GDVVGDDPLASFVSPQSASPNQSSSFPFSKSPPLSSTMPSTIPFPGGTQNPLQSTPLTV
FT                   GGTSPLDGSVPNAFLNNEFLQAVNSQSPPDLSKFEGKSSISSDAFFGANNPQGFSPTQF
FT                   NPETMAFSSDEYFGKPRPPNLHYVPTIEEQALQNLNELRENLVNAISKGGALLEKAKQW
FT                   LNTNQF"
FT   CDS_pept        complement(join(285263..285762,285824..285941))
FT                   /locus_tag="TA16335"
FT                   /product="cyclophilin, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="Tap821d03.p1c.cand.76 - score = 17.95"
FT                   /note="SMART pfam:pro_isomerase (PF00160) at aa 27-205,
FT                   E()=1.10e-60"
FT                   /db_xref="EnsemblGenomes-Gn:TA16335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72993"
FT                   /db_xref="GOA:Q4UIU6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU6"
FT                   /protein_id="CAI72993.1"
FT                   /translation="MSDDKNERLLGGPPYLSHLLTNPENPVVFMDISLGSQFLGRLKIE
FT                   LFADKVPKTCENFRKFCTGEHKQNMVPVGYKGTKFSKVIKDYMVQVPMIICIECLQGGD
FT                   FVKGDGTGCISIYGSCFDDENFTVKHDKLGVVSMSNTGPNTNGCQFFFITKECDWLDGK
FT                   NVAFGTLIDDESRLVLQKMQNVSVGENYAPKLNLLVTECGQL"
FT   CDS_pept        complement(join(286040..286121,286216..286358,
FT                   286426..286966,287021..287464,287600..287826))
FT                   /locus_tag="TA16330"
FT                   /product="tRNA pseudouridine synthase, putative"
FT                   /note="Tap821d03.p1c.cand.75 - score = 78.60"
FT                   /note="SMART 2 pfam:PseudoU_synth1 (PF01416) domains at aa
FT                   73-226, E()=5.10e-09 and at 302-408, 3.70e-07"
FT                   /db_xref="EnsemblGenomes-Gn:TA16330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72994"
FT                   /db_xref="GOA:Q4UIU5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR041708"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU5"
FT                   /protein_id="CAI72994.1"
FT                   /translation="MNKRDRKRNRNEARSKFRKLWKEREQFLKNKVPHEDGIIDDDSSN
FT                   LKDSEHIDKLNQNLGVKRVHAPKTKYVIAFGYLGTGYHGYQKQVEYKTGEMDKVKTVEG
FT                   TLENCLFRIGAINEAFRNMTHKLQMSKCSRTDKGVHAACTYLGGRFNIEMEDVPEDHVP
FT                   QVNNHSEINNSSKPDTSDNVELQSDGKLSKEEKFVQRLNAALPEDIRCFKIQRVTKGFD
FT                   ARSLCSKRKYEYIIPEWLLSKKFVLPNEEHEKHFRNLEVIFEENTKTKDIIKLSKLNDT
FT                   LYEVKGGFEETEIEHSRLYEILKLYQGTHNFHNFTVKQKEEINNTSRFIHKISIKSHKI
FT                   QELEVVKILIVGQSFLYNQIRKMISLALQVYLGIAPKNSVEFSLNKSHFLNINLVPSEG
FT                   LILHHPYFDSYNMNRCNPPEVPYIEYKDVKTKVEGFKNKYIYPEVKKSMESDLWEGWLE
FT                   NILKYPFYLENNFVPDGESE"
FT   CDS_pept        complement(join(288078..288164,288234..288285,
FT                   288339..288518,288550..288928,288959..288989,
FT                   289046..289141))
FT                   /locus_tag="TA16325"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.75 - score = 78.60"
FT                   /note="SMART pfam:ATP-bind (PF03029) at aa 1-242,
FT                   E()=8.10e-66"
FT                   /db_xref="EnsemblGenomes-Gn:TA16325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72995"
FT                   /db_xref="GOA:Q4UIU4"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030230"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU4"
FT                   /protein_id="CAI72995.1"
FT                   /translation="MAGSGKTCYVRKLVDVLKSNRKKVYVINLDPAVTKIHYKANIDIR
FT                   DSINYRQIMKKYNLGPNGAIMTSLNIFVTRWFTDKLNELRFDKILELLDKRSEVVDYII
FT                   LDTPGQIEVFNWSASGTIILGSISINLSFLESLSSSFPTMVNYLIDTTRSQNPITFMTN
FT                   MIYACSVMYKCQLPFVASFNKIGNQTRGFIYGYFLDVNRHEVCLDWMSDYEKFYEAVTH
FT                   DETYMASLSRSCALMLNEFYMNIKCCGISCMTGEGFEEHVKLLDECVDEYNR"
FT   CDS_pept        complement(join(289342..289435,289486..289592,
FT                   289693..289904,289937..290096,290132..290677))
FT                   /locus_tag="TA16320"
FT                   /product="mitochondrial phosphate carrier protein,
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.75 - score = 78.60"
FT                   /note="SMART 3 pfam:mito_carr (PF00153) domains at aa 26-
FT                   116, E()=1.30e-24; 125-217, E()=7.50e-05; 228-31,
FT                   E()=2.40e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA16320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72996"
FT                   /db_xref="GOA:Q4UIU3"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU3"
FT                   /protein_id="CAI72996.1"
FT                   /translation="MTDKWDPRVSAPISRTPHPVVHDCKYYGKCMLGGILSCGLTHTFV
FT                   TPLDVTKCKMQTNPQVYKSLFSGLSVIMKQEGFSGLVKGWKPTLLGYSMQGLGKFGLYE
FT                   FFKDFYGGQLGEEMAYKYKGAMWLAASASAEVFADVLLCPMEMVKVKVQTAPLTEQWPT
FT                   QLMKATCKMNSMRAETKFPFGSLRPLLSRQVPYTMAKFYFFEKVVQLFYDHVFTKPKNE
FT                   YPKEVQLGITFASGYLAGIICAVVSHPADSLVSQMGKSENKGKSFGQMAREVGAFNLFT
FT                   KGLGTRVLMIGTLTGLQWWIYDTFKCFILYCRLPWEWERVGEDQSRKHKIPLILFLFLL
FT                   SLLFVSMDSDPPVVDRPVASSGRKTLAIVVIG"
FT   CDS_pept        complement(join(290834..290938,290973..291051,
FT                   291084..291187,291220..291569,291626..291680,
FT                   291742..291819))
FT                   /locus_tag="TA16315"
FT                   /product="cyclophilin, putative"
FT                   /note="Tap821d03.p1c.cand.74 - score = 33.27"
FT                   /note="SMART pfam:pro_isomerase (PF00160) at aa 8-202,
FT                   E()=4.30e-21"
FT                   /db_xref="EnsemblGenomes-Gn:TA16315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72997"
FT                   /db_xref="GOA:Q4UIU2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU2"
FT                   /protein_id="CAI72997.1"
FT                   /translation="MNKVPNPRVFFDISIAGRRAGRMIFELFMDKLPYTAENFRCLCTA
FT                   VYRGNWTRILSPAKVVQEHTHTSHCYRICEINNLINQFNRCAKEVILIPGTLTEENLFM
FT                   DNICVTSPIHTCTPKEVIVTIYLSSGVLGMCKTRFKNSNSSQFYITFKPCSFLDNKMVV
FT                   FGHLEYGEDVLDMIEKQGTMVGKTKKKVNIYNCGEIPIETIYDPRIKNEVTEAKYIART
FT                   DIERPLFNEKMYNLEQSYKTIIPEEVYKRAHFNF"
FT   CDS_pept        complement(join(292131..292226,292279..292561,
FT                   292595..292629,292683..292763,292831..292978,
FT                   293100..293236,293308..295428))
FT                   /locus_tag="TA16310"
FT                   /product="kinesin, putative"
FT                   /note="SMART KISc (SM00129) at aa 371-699, E()=4.95e-92"
FT                   /db_xref="EnsemblGenomes-Gn:TA16310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72998"
FT                   /db_xref="GOA:Q4UIU1"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU1"
FT                   /protein_id="CAI72998.1"
FT                   /translation="MMKRKLDPTNTIHMASNDSLLSPKSSKLNHVSKIRKLSNNTNNHK
FT                   ISTTPKVTINNKTPEKLNKSKKMDDSLSRKSTSDTESNMNFEPLNKNTNFTYENDILKD
FT                   FIELSNPVSSTHQQNFVDQTLPLEHNPITDSQIIRIIDNNNEYDYQKLAENDNYPQITK
FT                   GVDNEVPKEQCENYLGNSELGSIINSQILEDNLKEKLTPSRKANYVHTLLSGRTSLDDS
FT                   INILNKLSQSELNTQVSPVYSPVNSQNSIPENQNDKYYEVESIKEALDNEYVYTDTTVI
FT                   DTTSTITNNETDHNDESNNVTPYREIEYDNSEVTKADESVEFREAREEEDYSEMDSDVI
FT                   EFNHEHDVEELISRYKTLYNNSFFNCSKTGTGKLRVVVRCRPSTCRNKAIQCERSCVKL
FT                   FKPGNKNSVLKSQRPGIFEFNFDHIVMENESTEKLYTISCMDLIEKLFSGISVTIFAYG
FT                   STGSGKTYTIAGTESSVGLLQLMITDLFKSSQVIDKELYLSYYEVYNENVYDLLQENEI
FT                   NLHLQENESKVFVKGLTRVKISNYEDFKRLFEIGDKNRKVFSTNANRSSSRSHAILQIQ
FT                   TSLNTKLTIIDLAGSERMKITDNAGDRLKESSYINQSLLALINCINTLAKKSNSMSGSG
FT                   GTGERVKYRDSKLTHLLKNSLTNNCFILMIAHVNPENKFYQDSYNTIKYALRAKDVEIS
FT                   QVITNSVSPVLNLKSGKEVIKKFSKELLFLVNLMKNNISENKLELIRKHISQSHLVGRP
FT                   LHYIGQLSLESFNRQVIQGLIFKTDLISIATIDKCSKTHNPRILEAIKQSWIENLNKRL
FT                   NSVKYQSKKSHSKLSKSVREVLEENKESEKPETSEDEFLDADVVLAKQSSSSVSPVLRP
FT                   TNPVTSELPKNDEFSLNIEKAGDNSEKENPDTDISISDISDLDDEEPETDDLVIGMLDK
FT                   VLNHSVTRPSSKKFGPPLWKLKLKYGIMQVCILFII"
FT   CDS_pept        join(296018..296309,296375..296805)
FT                   /locus_tag="TA16305"
FT                   /product="translation elongation factor E1-F beta,
FT                   putative"
FT                   /note="Tap821d03.p1c.C.cand.38 - score = 29.86"
FT                   /note="SMART pfam:EF1BD (PF00736) at aa 127-240, E()=2.50e-
FT                   15"
FT                   /db_xref="EnsemblGenomes-Gn:TA16305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI72999"
FT                   /db_xref="GOA:Q4UIU0"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIU0"
FT                   /protein_id="CAI72999.1"
FT                   /translation="MADLKVDFDSLGKTEGLLNLDKFLSYHSFVGGVKNATTDDVAVFK
FT                   KLGKAPAEEEYPNVYRWYLHVSTWCNSPPKELPKGNFPVKEDKKTDDDIDLFGEADEEE
FT                   DDSLKKKMEAMKAAKTKKKEVAKSSLVIHVEPASVDVDLDEVLKLVRGLKVEGLTWGEA
FT                   SARIPLAFGIEKLQVMCTIVDDLVNTNEVVEMIENLGLSEEDKAKKNEREDEDEEYDSD
FT                   DEVLGLVQSATIVSFNKL"
FT   CDS_pept        complement(join(296878..297043,297093..297198,
FT                   297239..298168,298252..298425,298491..298722))
FT                   /locus_tag="TA16300"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.72 - score = 33.72"
FT                   /db_xref="EnsemblGenomes-Gn:TA16300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73000"
FT                   /db_xref="GOA:Q4UIT9"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT9"
FT                   /protein_id="CAI73000.1"
FT                   /translation="MIKITLLRNLNSNFSSKTRKYARNFSSSSGFSEIVMKVLSNYKST
FT                   KVKNVFVLEKITKYDLEIQNGLSPSQIYKTFPLAYNTHLKHKKIMKSLIYHLKNVYNLE
FT                   TQVVKAQSKELLPFEGSKNTERIRPDLLIAAGGDGTFLEGASLIPADQLSDKPIWLAGL
FT                   NTDPERSMGTLCMSYFGPKNEQHFNCGYYDYEKCQPTSKDSSSPSKSDSPDQSYDSSIF
FT                   YKNLKEFCSYSYNRISEKRLHFDDPSLYYAEDNSQIPVKGDDVLITYDQYVRVLLDNLL
FT                   NFNLHPIPRQRLRFKLFKRKMLNFNRLKSDESNETSTNCFDNSVIEKILVRNASSSFEE
FT                   KELINDYHPSNTDSYSLPYGIVNDVMITGEDFGKSFYSIVQVDDRPLKRVKSSGILITS
FT                   GTGSTAWAYNISKINFFKGTSLIKCLLEHPDVPKSLEKAISNQIHIYDEIIKESIDCFN
FT                   HKLKMDPSSSVMRCLIREEISNKTTDETSFYSCKQVKVVPLCKNAVACADGSTRVKLDY
FT                   GDVALIKTFERDLIWSLI"
FT   CDS_pept        join(299020..299259,299299..299379,299464..299579,
FT                   299620..299962,299991..300134,300192..300320,
FT                   300351..300531,300611..300756)
FT                   /locus_tag="TA16295"
FT                   /product="cysteine desulfurase, putative"
FT                   /EC_number="4.4.1.-"
FT                   /note="Tap821d03.p1c.C.cand.39 - score = 59.28"
FT                   /note="SMART aminotran_5 (PF00266) at aa 74-445, E()=1.30e-
FT                   08"
FT                   /db_xref="EnsemblGenomes-Gn:TA16295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73001"
FT                   /db_xref="GOA:Q4UIT8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT8"
FT                   /protein_id="CAI73001.1"
FT                   /translation="MASVSYTLNINNKRNTLFIKPIFNKTLDFSKQTPMDLSMTEIEAI
FT                   AREEFPILNREDHDLKDLIYFNNATTTQKPNYVLNALFNYYTTNNFSVYRGSGSYHDQL
FT                   STQIYENARKKVAEFVNAPSSEQILFTSGVTDSINFVSTTWGPQCLKKDDVILLPLSEH
FT                   NSNLLPWWVLCDRVDCKIEYVKVIFISIISIQLHQNGQIDLYHLESLLKTKSPKLLCCG
FT                   HASNVLGVIQDMKTISKLAHKYGCLVLSDSAQTVGKVKIDVQDLDVDFLAGSSHKMYGP
FT                   TGVGFLYYRKSLLEDLEPQKCGGGTVKDVTFESCDYIEPPFRFEAGTPPVAQAIGLGAA
FT                   VDFINSIGIDRIRKHDKMLLQYLYERMKDLVNLYNFDPTLDRLPIIAFNVDDVDPFDLS
FT                   ALLASKNIITRAGKHCAYLLHKTFYCTNTVRVSLAMYNSSSEVDKFIEVLKESISILKK
FT                   Q"
FT   CDS_pept        join(300813..301140,301208..301334,301399..301455,
FT                   301487..301705,301768..301860,301893..302223,
FT                   302242..302373)
FT                   /locus_tag="TA16290"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.39 - score = 59.28"
FT                   /db_xref="EnsemblGenomes-Gn:TA16290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73002"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT7"
FT                   /protein_id="CAI73002.1"
FT                   /translation="MHNSLYQFCISRTVSTDLGQKFTILRVNSKLVDAKNLNKYFKKIL
FT                   KKSVKREEFRYLLNYTVSNMPQALDDLNLLTILIIMSKLDIRDQLLFNSILPFLYKIND
FT                   FNKIIECLLYSSMLFKDDDNLKLFATKLIFDLPSHLDSINYNNISKLCESLCFLNLYSE
FT                   EFASLISTLVDKKTLARGEIEMLNFSSILNYLSRVRSGDEAVWSMYANYSLNNLLTTNY
FT                   KPVIKLLQSFVNRNIHHKVLFRNCGDFLVKFIDHMHPKDVSNLSYLYFKVNHPHYVLFN
FT                   EIFKVGEMITTNLDGISSLRLLSGYYLYHSSLPNLLSHTISGPGLLQNQTPLHHYRTVY
FT                   LIYNNISRDLNSFHFEDFLLLFKTLELFKFINTKNLQVFSVLANLTFLSFPANVDKSLL
FT                   SNLDLVRLRYKEKKLINTNQQSFIRLLIS"
FT   CDS_pept        302569..303957
FT                   /locus_tag="TA16285"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.C.cand.40 - score = 15.85"
FT                   /note="SMART 10 transmembrane domains at aa 21-40, 111-133,
FT                   145-167, 172-194, 207-229, 259-281, 294-312, 335-357, 378-
FT                   400and 410-432"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16285 by TMHMM2.0 at aa 21-40, 111-133, 145-167, 172-194,
FT                   207-229, 259-281, 294-312, 335-357, 378-400 and 410-432"
FT                   /db_xref="EnsemblGenomes-Gn:TA16285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73003"
FT                   /db_xref="GOA:Q4UIT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT6"
FT                   /protein_id="CAI73003.1"
FT                   /translation="MKCPVCGSATEASQNYGGKNSCPLLIAAYVLAGLAMMLNIRLSYS
FT                   SAPYALIRFQLPENLFSVFVRRMASSLELWCLPSMLLGNIMDLGVKGGIKYIARGDTDK
FT                   KWWKFGGIIIPSILCQWLNFFTYVLLLIVYVIGGDQGRLTMFYWVIAISGVVFGINMTL
FT                   VYSVDFYYIPVYIAGENSFPALTSFIHYLATLMFGNRRKYNSDFLLVEIDIWVAIVISF
FT                   VAAVVWTYGYLCEVGEGVGQMKHIHPNAFDGKPSEHLISPFLMVIVGMGLVYAIYPGIA
FT                   PGMIVPFYLIDKIEMVLLIATFFPPVIVAILRKHAPEYSPQTEYPFKKWSQYGAGYFYL
FT                   SLNILIVTKITLAAIFICSLHYRDSNISRSIVNQPKMSTALSITFYMCHEILLAVGFSG
FT                   VIGNDGGDFILIPQYIGALFMIFLAFYSEGYIIEYKSHDPQHWHKDGMWYLYGYYQLNP
FT                   DFLL"
FT   misc_feature    join(302629..302688,302899..302967,303001..303069,
FT                   303082..303150,303187..303255,303343..303411,
FT                   303448..303504,303571..303639,303700..303768,
FT                   303796..303864)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16285 by TMHMM2.0 at aa 21-40, 111-133, 145-167, 172-194,
FT                   207-229, 259-281, 294-312, 335-357, 378-400 and 410-432"
FT   CDS_pept        304080..306779
FT                   /locus_tag="TA16280"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.C.cand.41 - score = 51.80"
FT                   /note="SMART 11 transmembrane domains at aa 20-39, 504-526,
FT                   533-555, 560-582, 595-617, 653-675, 688-706, 739-761, 782-
FT                   804, 814-836, 871-893"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16280 by TMHMM2.0 at aa 20-39, 504-526, 533-555, 560-582,
FT                   595-617, 653-675, 688-706, 739-761, 782-804, 814-836 and
FT                   871-893"
FT                   /db_xref="EnsemblGenomes-Gn:TA16280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73004"
FT                   /db_xref="GOA:Q4UIT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT5"
FT                   /protein_id="CAI73004.1"
FT                   /translation="MPHICSAKQAGVGVADCDLLIIAYIFAGLAMMLNIRLSYSSAPYA
FT                   LIRFRLPENLFSVFVRRIASALELWCLPSMLLGNIIDLIQKLAVNTDGDLKAAAGTEKS
FT                   KGTLRKLAEALHTQANSLNDAVNNPGATENAAKVLKFKAGSEDEEGKLRKLAKDLYTAA
FT                   TQLENKAPDNSDDGLKQKAGTHQNDGLRKLAGELYIAAKALQKKVGTGVSGHDEAQSLA
FT                   NAVGESESSGIRAKLQQLAENEGTADAVRTAYEDGTGDGVKKKFDEVQKLKGSAYTSDK
FT                   QAAYDKVEAAWNAFNALYTTDLKELAKDLKNAIGNGSQSKLRQALAALGNLQETATGVQ
FT                   LTGPAGNVKTAYDGGEGVKPKFTKLKAKESSYQAISAIRPNYKEVVDAITAFDNVYKPE
FT                   ELLKDAVGQGETTGLTKALAALGNDNGSGQLSGLAKAVKKEYSESFGPTVKSKFELVMA
FT                   QASAYEKGGTIKTNEYTQLLQAWTAFNDKYYGVISYYKYYSIVVPSVITQWLNFLTYVI
FT                   LFVVYVAGGETGHLTVFYLVIAISGFVFGINMTLVYSVDWNYIPIYIAGENCFPIITSF
FT                   IHYITTLMFGNRRKWNSDFIVVVVDIVVAIIISLVAAMVWSVAYLSKPKYASAKDKEAS
FT                   WYHHIFTNKFEGEFKPEVISPFLMIIVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLI
FT                   ATIFPPVIVAALRRTTKGWPPPPQSPMCQWTLDIRGFDGQSKGTGLFWHGFDLLMVIKI
FT                   SLAVIFIYSLHYRESHLSRSIINQPKMSTFLSITFYMCHECLLALGFPGLVGANGGGDY
FT                   VLIPQYIGALFMIFLAFYSEGYIIEYKSHDPAHWPTEGMTKWNAFCYRCKRASKITNPI
FT                   LMYLFTTELQNYSHFLFIFIQYYLDYSK"
FT   misc_feature    join(304137..304196,305589..305657,305676..305744,
FT                   305757..305825,305862..305930,306036..306104,
FT                   306141..306197,306294..306362,306423..306491,
FT                   306519..306587,306690..306758)
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16280 by TMHMM2.0 at aa 20-39, 504-526, 533-555, 560-582,
FT                   595-617, 653-675, 688-706, 739-761, 782-804, 814-836 and
FT                   871-893"
FT   CDS_pept        complement(join(306854..307177,307207..307263,
FT                   307304..307405,307436..307727,307780..307933,
FT                   307963..308008,308107..308196))
FT                   /locus_tag="TA16275"
FT                   /product="eukaryotic translation initiation factor 3
FT                   (eIF3), subunit, putative"
FT                   /note="Tap821d03.p1c.cand.71 - score = 31.15"
FT                   /note="SMART 5 WD40 (SM00320) domains at aa 1-38,
FT                   E()=1.07e+00; 41-80, E()=2.44e-03; 144-183, E()=1.98e+01;
FT                   200-239, E()=9.52e-06; 304-343, E()=1.55e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA16275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73005"
FT                   /db_xref="GOA:Q4UIT4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR027525"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT4"
FT                   /protein_id="CAI73005.1"
FT                   /translation="MKPIILRGHHRPLTCVKTNKHGDLLFTCGKDAVLALWRTDTGQQL
FT                   GRYNCGRGAVWGCDITFNSKLLVVASGDSKVLIFDAERGNLLLEILEEGSCKYVEWNKN
FT                   PAGQNKFVVCHDDFGESVKMATKVYEVTTRMLQDGTVDLNYRILWVQRGYRNRCLQCHW
FT                   GPLDKTVVTGHDDGVINVPSYEIFIIYINLVVWNAYDGSHLKRLEAHKLSVSSISFDLY
FT                   SLLMLSCSSDGTAKLWETATWTCIKNYKTDRPLNACDISPVFNVEDGKKAHILLGGGQE
FT                   ADQVTTTAASEGKFQALIYNLIHEEEVGSIKGHFGPINTLTFLSDGSGYVSGGEDGFVR
FT                   IYHFDRDYILDKYD"
FT   CDS_pept        complement(308456..310156)
FT                   /locus_tag="TA16270"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.70 - score = 58.73"
FT                   /note="Signal peptide predicted for TA16270 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.910, signal anchor
FT                   probability 0.000) with cleavage site probability 0.630
FT                   between residues 25 and 26"
FT                   /db_xref="EnsemblGenomes-Gn:TA16270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73006"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT3"
FT                   /protein_id="CAI73006.1"
FT                   /translation="MDYSLLVLVSTWIFGIYNTPTPALCSFPSSFSLNSLDDDSPLNNA
FT                   FSFKDEELIDSYTTKRSSELTEPDSSGDPEFVPGKLNAKSESPEVIASVESIVLSETPD
FT                   DETVSENDYTEDLNSEVDQSENVTRDDNNEDEVQPTRFFDKLSTEYSDDFKKSTEEGID
FT                   MDSEKSYTVRSLLPVDNLLVLTTPSGCSLLDFSGEDDGLQVVEFNFKTSELEECSKLTE
FT                   DIIREMNEQLARDLVAHRNSQATPRTKMVEISVRDPMRNRQLNIKETQEVFSRSEPSNN
FT                   ENLSDSSSFRFGDEVDVTEEDRKEALLLLSRTLDFDYYPTDADSVYVMSFSLSDNEGLD
FT                   SNREQLLNEFYQLFNTKTESRGTEGDSSGKTMNKESTGEKMNLENIFKNLSSYSEEKLE
FT                   KLLDEMKAFLETDEGKKAVEKFQSEMASKLKEVEKLYREESELGKKILSDLSKHGVENV
FT                   QCSKLTTDDCTSYSKCQVLKVDGKDVCFVSPKTIYWLLQTKCGLQSKAALLSIARDLNN
FT                   IGIISNKHVNNLEQSFDLNKICNAITHSYLSKLSPNLTNLNSRSTNSNN"
FT   misc_feature    complement(310082..310156)
FT                   /note="Signal peptide predicted for TA16270 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.910, signal anchor
FT                   probability 0.000) with cleavage site probability 0.630
FT                   between residues 25 and 26"
FT   CDS_pept        complement(join(310543..311012,311067..311243,
FT                   311273..311744))
FT                   /locus_tag="TA16265"
FT                   /product="apoptosis regulatory protein (programmed cell
FT                   death protein 2 (PCDC2) homologue), putative"
FT                   /note="Tap821d03.p1c.cand.69 - score = 28.31"
FT                   /note="SMART pfam:PDCD2_C (PF04194) at aa 171-361,
FT                   E()=3.30e-09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73007"
FT                   /db_xref="GOA:Q4UIT2"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT2"
FT                   /protein_id="CAI73007.1"
FT                   /translation="MDSVDGETVELFATLSKAEPWRLQRQYFPSKFGGLPAWLDPVHLP
FT                   KESELKCEKCGSIMTFFLQIYAPDDLCEENDSFHRTIYLFVCQPCGNQWKAFRSQLARK
FT                   NEFYDFHPSEDNIMFPDTEMARRCCLACGLPSDNPSKEPIHINNSKIQLVDTQDVRELH
FT                   DRCKIAVKHQTVSCTFDEWILNICEGEIPISDNYLSHEKELYNRYLKEKKLNGEIMDES
FT                   EEQVFESIQEENMYKDESFLKFSKKTTPNEVLYYSREGEPLWISDKTPRPVIIQSNQSS
FT                   KKAIDEVSNENSCAGNDLNVVNLCENCGSDRSFEFQVLPQLLHYIKSDRIDFGSLSVYT
FT                   CSKSCKIENKYQKEVVILERDYSLVPRPQNPK"
FT   CDS_pept        join(312127..312190,312272..312861)
FT                   /locus_tag="TA16260"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.42 - score = 23.55"
FT                   /db_xref="EnsemblGenomes-Gn:TA16260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73008"
FT                   /db_xref="GOA:Q4UIT1"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="InterPro:IPR039974"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT1"
FT                   /protein_id="CAI73008.1"
FT                   /translation="MWMGKIGNKSAAFIRHKHFHPGTYQNMEKVWLAEEKQKAEERRQK
FT                   EMKEKREEELKTLEIKRQIREQEELKRMEMILEEKRNKYKVDRNFVSENQSGLILTGNT
FT                   TSSASPTAKTTNTNKEEKKLVIRSQYTEDVFKNGHTTVFGSYYDRDNKSWGYKCCKLTD
FT                   KDVRCPEAKPKYKRKNPDSETADRSSNKQAKKSTNQGSGLTDSLKLLKQMDALE"
FT   CDS_pept        complement(join(312882..312950,312982..313068,
FT                   313201..313457,313493..313577,313627..314002,
FT                   314059..314506,314541..314861,314923..315031,
FT                   315096..315203,315235..315417,315458..317095))
FT                   /locus_tag="TA16255"
FT                   /product="elongation factor 2, putative"
FT                   /note="Tap821d03.p1c.cand.68 - score = 90.31"
FT                   /note="SMART pfam:GTP_EFTU (PF00009) at aa 12-333,
FT                   E()=9.00e-61; pfam:EFG_C (PF00679) at aa 1081-1170,
FT                   E()=6.00e-17"
FT                   /db_xref="EnsemblGenomes-Gn:TA16255"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73009"
FT                   /db_xref="GOA:Q4UIT0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIT0"
FT                   /protein_id="CAI73009.1"
FT                   /translation="MQNISDVLELTENIRNVCFLAHVDHGKTTLSDSLISSVGIISEKL
FT                   SGKLRYLDNRDDEQMRMITIKSSSISLLYTKYGHLNHNSNSNSPKNDKVLINLIDSPGH
FT                   VDFSIEVSTAARLCDGALLVVDVVEGICPQTRAVLRQAWLENVKTVLILNKIDKLILDL
FT                   NMTPLEAYKRMCNLVEQANALIYQLFMEEVMKKSDTPDVTKSEKWFYSPSEGNVVFCSA
FT                   IHKWCVYIPEFVCQVGQRLGISQSKYDVIQKSLWGEYYYCNKTKSVKVCKNQEKPMFVQ
FT                   FVLDQIWKVYDAVLKCDINYIKKLAAHSNVKLTSRQIKILENANEQQSNNSSLKNFELS
FT                   PDDRDDLLQTILSNWLPLCSGIFRLIVDSLPDPITACRKRLKKICPSITNYDNYRKIVN
FT                   LEQDAPVVLHIAKFLGSDLSHMRLTRDLLQGYERADDFVAFSRVFSGKVSKGDVLYICK
FT                   YNDNKLKSGTLDCVNELGNLLIIPKLILCFNFCLDEDYESTHIKVSINKVMILMGSELI
FT                   EVDRAYPGNIVALSLSTNQTNLNTDTQDHVKDVMAWLLSLTDPHRRNLYTLEGGYNRDK
FT                   ISRTKTLCSVDRHLTLSSDPQFPPFSPPTHELNNSIIRVSVEPQNVKDMDQMLTGLALL
FT                   YTADPAVEIDILKTGEYILACCGEIHLERCISDLTNLYAKIPINVSKLRVSIREGIVDL
FT                   KNNISLHLLSKKVNFPPWKSSSSDDQIKNPSEDPQKNAVQENEEGYKSEDKSHIQITPE
FT                   LWITQESQNQGLVYFKISDEFVLFLTARQMNNSVLQYLDENSKDLKGLIYSGEVPNRFE
FT                   GHTLNDSLNLVQTEIYKLMNSNAKPGKSGVKMNKDKGSEGGTALGDLWGISLNKGTRCL
FT                   LFYRNNSQYFANKSQNLLTKMQWTFIDSYNRSSIFSLQNSKLISNIISGFELASQSGPL
FT                   TEEPLRGVVFVIEGIYLNKEDQLIGSPSSSVSYNHLKMQKNKESIEDNLNSLTMGLNKD
FT                   FGNILNKYTNAYKDGELRHKDGGNKELDDISMAKSDQHNEVGSCAASPETSIRFSDSCT
FT                   ITSKISQTLTPWRIMTNMRHLCRKAYMQRGRTRIYEVILRLDLQCEQNVLGKIYNVLQK
FT                   RRTQILSENVKEGTTTFVIEATMPASESFGLAQDLRSKASGGVIFHLQFSHWEMLPEDP
FT                   FPETTMTDSELEDDGFNITLLLQSNIPRKIINHLRKIKGLATEEKVVVAPEKQRTLSTK
FT                   K"
FT   CDS_pept        complement(join(317286..317461,317505..317794,
FT                   317847..318007))
FT                   /locus_tag="TA16250"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.67 - score = 16.82"
FT                   /note="Signal peptide predicted for TA16250 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.673, signal anchor
FT                   probability 0.178) with cleavage site probability 0.328
FT                   between residues 30 and 31"
FT                   /db_xref="EnsemblGenomes-Gn:TA16250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73010"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS9"
FT                   /protein_id="CAI73010.1"
FT                   /translation="MHFRFIKNAVGLILYTSLYSSFSTSLFCSAAKTYYGDIKESNSSY
FT                   NQNKYKNNQDMFNLGTFNDNKFLSGELTLVKSQLNSDVTYKLLVGSQITTGSCWFVADI
FT                   YAGSEYKFTNNNYNDLKMMLTTDYKTHLVKNGLVKHNFKVDPFKESEDIVPPMEGMVGY
FT                   PERMYTFLTVSKDIKPGDYVVLFAYGRSFSDDLPSRFKEFRVKVL"
FT   misc_feature    complement(317918..318007)
FT                   /note="Signal peptide predicted for TA16250 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.673, signal anchor
FT                   probability 0.178) with cleavage site probability 0.328
FT                   between residues 30 and 31"
FT   CDS_pept        join(318681..318733,318800..318852,318883..318986,
FT                   319018..319176,319246..319365,319395..319616)
FT                   /locus_tag="TA16235"
FT                   /product="nucleosome assembly protein (NAP), putative"
FT                   /note="Tap821d03.p1c.C.cand.43 - score = 29.31"
FT                   /note="SMART pfam:NAP (PF00956) at aa 30-219, E()=1.80e-09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73011"
FT                   /db_xref="GOA:Q4UIS8"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR037231"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS8"
FT                   /protein_id="CAI73011.1"
FT                   /translation="MKRNHDNAGTSNDSATNSSEATNNPLLPYISEFDEVQKKLLSLDE
FT                   ECANEQMNLQRKFDKKKQPFFDKRQEIIDKIPGFWCKALTHHPALSYLTSADLPVLEHL
FT                   KSIQLFDNLDNNGSYKLTLNFTDKAKEYMSPLSLTKHVVFDLNKESVKECTKITWKPGK
FT                   SPVEEALKARKNDKCIDWSLFEWFTEDEWLNRPDVGEIIRREIWHAPLAYYMDTVSIDY
FT                   FDDEYDMIDDEDDM"
FT   CDS_pept        complement(319687..322212)
FT                   /locus_tag="TA16230"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.66 - score = 44.32"
FT                   /db_xref="EnsemblGenomes-Gn:TA16230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73012"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS7"
FT                   /protein_id="CAI73012.1"
FT                   /translation="MFLSKISGSHIKIYNFNLKLCRRFSNNPEIQSKLFKTLKDEENIT
FT                   NFPVHSLKLDLIDKYKENHLTNEVLSKKSLDLSKIPRCVSSDSPLTSDILTHSHNCDNL
FT                   SAYKDNKDFIINSFINLLNFKNKNPDLFQFLCDSLSVIIKDLNFDESYKLIKVISNEKL
FT                   CKSNFNYKISNIFHNLLTRLNHLITEKLTYNGGILKVNELPKYSGYLKETCLDRAEGIN
FT                   FDSDNHLEKLWNLWFILSKQTFEESKYTASLILALLEQESGSIFKFDLRRVCRALDVVV
FT                   GDCKFFSKLEERFILILLKRFSAILSNIDNKHDPEFYIKSNNVTPIQIKKFFCNISKIS
FT                   KISHKILENFLKLENSHKSLQDFVNLSSVLLNNELDKLDVSQRSFENLDSDWNGYFDKN
FT                   LKEVNYKRNKLFLKIFVDSLEIVKFLDHLILCETNESDGSNVSDTEELRDKLLKLSHDL
FT                   LIKISVESEEHLLQECRSMYYMLLTCSLCKPTIPDTLSVSKLTETISNKIALNVDKLTS
FT                   DSRILAGDLNSGENKSLGMKTVQFMLYCDKINSLLRLLGSCGETSNKVNLSCEKLVIEL
FT                   FKNQEKLLSSNQSQGLKTLYVTLLNKYGVLSPEIYYEFLNTLEDWPNWERNELSMLCDI
FT                   LSRTYPNYCSKIVGGDDFPDNQQLLNSRVSDKIIGLLVSLTNYVFVDDNVCKFSNKELI
FT                   SILNFLNTCLDGSKDKPISTDSYNPTFIDSMKPTIMNKLSERISDMNFSQLVKLLSFHN
FT                   VIEESFRDDIVQRILNLDYLGDISCLVELNDPKITSKVLTKFKIKVVEESYVTREKSLK
FT                   TKFLKHYKKPQLKNNFVSKSNYETLKMLI"
FT   CDS_pept        complement(join(322379..323049,323082..323232))
FT                   /locus_tag="TA16225"
FT                   /product="haloacid dehalogenase-like family hydrolase,
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.65 - score = 25.08"
FT                   /note="SMART pfam:Hydrolase (PF00702) at aa 10-243,
FT                   E()=4.50e-03"
FT                   /db_xref="EnsemblGenomes-Gn:TA16225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73013"
FT                   /db_xref="GOA:Q4UIS6"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS6"
FT                   /protein_id="CAI73013.1"
FT                   /translation="MEQNNPSEVKKYLGVDIDGTFYVEDPEKFKNNVEAFKNLKQNNIV
FT                   PFFCTGRVLSSAMKVVGDNFQGETGYNGYPGVYANGALVYDSDGNIISHSDFSEEFLRK
FT                   FVQYIIENNLDDITIFKGADKFYIIKDLREDFKNYPKSKNIDNLKLITPEEIVKQKILA
FT                   ILLSIDANIDDLPSKFSCEICTNDKSYHLSSQNITKAYGVKRLLDYLGVSPDQCSFIGD
FT                   GENDIEVLKYCKLSYAVGNANNEVKMAAKIVLNENYDQGAFEKAVQLVSSS"
FT   CDS_pept        complement(join(323701..324428,324455..324692))
FT                   /locus_tag="TA16220"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.64 - score = 23.63"
FT                   /note="1 probable transmembrane helix predicted for TA16220
FT                   by TMHMM2.0 at aa 7-29"
FT                   /note="Signal peptide predicted for TA16220 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992, signal anchor
FT                   probability 0.008) with cleavage site probability 0.977
FT                   between residues 26 and 27"
FT                   /db_xref="EnsemblGenomes-Gn:TA16220"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73014"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS5"
FT                   /protein_id="CAI73014.1"
FT                   /translation="MKFKARSRSLLVFVIFLGTFFSNVLSEPISNFTKPTTLPKYFAID
FT                   VDGTFFIKDETKFKRNIAALKLLKEKNVIAFFCTVQMYLLNNHFTFCSSIFSGTSFNAI
FT                   KNKFGADFQREAAYNLLPGIYSNGSIIYDNYGILIHKSVFKSDFIEKFIKFVNDKNYRS
FT                   HVVFFGVVDIYSLEASLEPKDELTLNLTPIVKSDSELKNLDITGIRIKKINIEVEGLTE
FT                   GTDFVKFDEAKVNVIFPELSLKDLSLKKLIERWDGKISECAYIGNDMNDLSVMSLPDIM
FT                   SFAVADAKDEIKNNAKWVLDLKHDECAFEKVVNLLYGDQN"
FT   misc_feature    complement(324606..324674)
FT                   /note="1 probable transmembrane helix predicted for TA16220
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(324615..324692)
FT                   /note="Signal peptide predicted for TA16220 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992, signal anchor
FT                   probability 0.008) with cleavage site probability 0.977
FT                   between residues 26 and 27"
FT   CDS_pept        complement(join(325090..325763,325878..326097))
FT                   /locus_tag="TA16215"
FT                   /product="haloacid dehalogenase-like family hydrolase,
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.63 - score = 19.62"
FT                   /note="SMART pfam:Hydrolase (PF00702) at aa 33-267,
FT                   E()=1.20e-02"
FT                   /note="Signal peptide predicted for TA16215 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.985, signal anchor
FT                   probability 0.000) with cleavage site probability 0.934
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA16215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73015"
FT                   /db_xref="GOA:Q4UIS4"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS4"
FT                   /protein_id="CAI73015.1"
FT                   /translation="MPKILLNLIILIIYWRNSLSAPISDFTKPTTLPKYFAIDVDGTFF
FT                   IKDQTKFQNNVEAFKKLKEKNVTPFFCTGRDLVCTKRLIGDSFFNETGYQGFPGLYLNG
FT                   ALIYGSDGNLLFVSKFTKELIGKFVKYFSDKGLVNKVFYYTIEATFSLEEIYTEGMQAI
FT                   RSCSITVPAVVTLEELNSKDIISMTVFKDDLSDCEHMKEVHSVVYTSHAITSITPSKNN
FT                   KKAGLKKLLEHLGSNENECAFIGDDLNDIEPMEYCYLSFAVADAKDEVKTKAKWVLEEK
FT                   HDECAFEKVVKLLYDD"
FT   misc_feature    complement(326038..326097)
FT                   /note="Signal peptide predicted for TA16215 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.985, signal anchor
FT                   probability 0.000) with cleavage site probability 0.934
FT                   between residues 20 and 21"
FT   CDS_pept        join(326392..326451,326493..326721,326757..327273,
FT                   327309..327662,327693..327783)
FT                   /locus_tag="TA16210"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 1 transmembrane domain at aa 91-113"
FT                   /note="1 probable transmembrane helix predicted for TA16210
FT                   by TMHMM2.0 at aa 91-113"
FT                   /note="GPI-Anchor Signal predicted for TA16210 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA16210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73016"
FT                   /db_xref="GOA:Q4UIS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS3"
FT                   /protein_id="CAI73016.1"
FT                   /translation="MNLHPICRHIYTFHPTNTFDMKLCMLIFLTTILNSVPSSCKILLN
FT                   SGLVTSQCYEDSQNMNNQIVDSNQPLRENSNLPQITNNIPHIDFKLCSYVFGTYLCQAL
FT                   FLNGLFFLLTNLSQKMQKELGIDTASILSGRMSGIVTVTVGSYVSYKLSEFLLDVILSL
FT                   FKAHGVAIKLKGIINPCNTKLACIRVPLLVFYKCSKYLHNQIPLTMGSLDIYVKNKILK
FT                   RDKEADEVDENVKILVKSKRETKKKLIREFAVISTYSLATFALLGGKLHSFTPSELSHP
FT                   GAYSVPKLSLEADGYSYATKSQRNIIQILGKKYGCHTCGLISDSERYIADHQPPSGVIK
FT                   RRLKGKYISFLLRNYIIPIQLVKPKQHFYPQCNKCSLKQSKAVANNKRVSITHYGRLRN
FT                   YHLCPTAFFVSRFLSKP"
FT   misc_feature    join(326703..326721,326757..326806)
FT                   /note="1 probable transmembrane helix predicted for TA16210
FT                   by TMHMM2.0 at aa 91-113"
FT   CDS_pept        327906..328385
FT                   /locus_tag="TA16205"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.44 - score = 22.81"
FT                   /note="Signal peptide predicted for TA16205 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.779, signal anchor
FT                   probability 0.000) with cleavage site probability 0.427
FT                   between residues 21 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:TA16205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73017"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS2"
FT                   /protein_id="CAI73017.1"
FT                   /translation="MKYIYFVILLCFVRNVDIVNSLVADSSCFHKKSLLLLEKTSKEKD
FT                   QTFYESLSKLENNPFTLVVRYCLGADGNVSSRKFVECVSSLSSCPTNWYSTINWQFCLC
FT                   NTVYCVLKGCFQYWIETFDFTNTKVLYTFSLFSVLRSLSPRRLFMHFQADWNDPL"
FT   misc_feature    327906..327968
FT                   /note="Signal peptide predicted for TA16205 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.779, signal anchor
FT                   probability 0.000) with cleavage site probability 0.427
FT                   between residues 21 and 22"
FT   CDS_pept        complement(join(328472..329193,329226..329415))
FT                   /locus_tag="TA16200"
FT                   /product="haloacid dehalogenase-like family hydrolase,
FT                   putative"
FT                   /note="Signal peptide predicted for TA16200 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.812, signal anchor
FT                   probability 0.000) with cleavage site probability 0.526
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA16200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73018"
FT                   /db_xref="GOA:Q4UIS1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS1"
FT                   /protein_id="CAI73018.1"
FT                   /translation="MLHVVILTFYIITIKLGLPTPIKIYFGVDIDGTFYVEDPEKFKNN
FT                   VEAFKNLKQNNIVPFFCTGRVLSSAMKVVGDNFQGETGYNGYPGVYANGALVYDSDGNI
FT                   ISHSDFSEEFLRKFVQYIIENNLDDITIFKGADSFYIIKDLREGFIDNGNETKVVSVEK
FT                   ILPEDLYKKKIVIININNNINLTEFDGSFFAKVSSNGKTSHLFPKCVSKEYGTKKLFDH
FT                   LSMDFDSCSFVGNGRNDMEIMKSCKFSYAVADAVDAAKEGAKKILTKKHDDGGFVEAVD
FT                   SLISDMVKQDQSALVELADSYA"
FT   misc_feature    complement(329365..329415)
FT                   /note="Signal peptide predicted for TA16200 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.812, signal anchor
FT                   probability 0.000) with cleavage site probability 0.526
FT                   between residues 17 and 18"
FT   CDS_pept        complement(join(329799..330472,330505..330712))
FT                   /locus_tag="TA16195"
FT                   /product="haloacid dehalogenase-like family hydrolase,
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.61 - score = 23.28"
FT                   /note="SMART pfam:Hydrolase (PF00702) at aa 29-263,
FT                   E()=4.00e-02"
FT                   /note="Signal peptide predicted for TA16195 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979, signal anchor
FT                   probability 0.005) with cleavage site probability 0.746
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA16195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73019"
FT                   /db_xref="GOA:Q4UIS0"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIS0"
FT                   /protein_id="CAI73019.1"
FT                   /translation="MSILSIIIFILIYVSSVPISNFTKPTTLPKYFAIDIDGTFFINDQ
FT                   TKFQRNVEAFKKLKQKNVTAFFCTGRDTHCTKNLLGDSFFNDTGYNCFPGVYSNGALVY
FT                   GSDGNLISELKFEVAILEKFIKYIEDNQLKDKAIYLTKEGFYSFESLFDNGKQVLNTLK
FT                   FKEPTIVTKDELKQKNVVSILIFKDNLDDCDFKNEVYKIVYKKYNYIQITPSKSNKKEG
FT                   LKKLLENMGSNENECAFIGDDLNDAEVMEYCYLSFAVADSIDEVKNKAKWLLDKKHDEC
FT                   AFENVVKLLYDD"
FT   misc_feature    complement(330665..330712)
FT                   /note="Signal peptide predicted for TA16195 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979, signal anchor
FT                   probability 0.005) with cleavage site probability 0.746
FT                   between residues 16 and 17"
FT   CDS_pept        complement(join(330967..331637,331670..331877))
FT                   /locus_tag="TA16190"
FT                   /product="haloacid dehalogenase-like family hydrolase,
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.60 - score = 24.07"
FT                   /note="Signal peptide predicted for TA16190 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979, signal anchor
FT                   probability 0.005) with cleavage site probability 0.746
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA16190"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73020"
FT                   /db_xref="GOA:Q4UIR9"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR9"
FT                   /protein_id="CAI73020.1"
FT                   /translation="MSILSIIIFILIYVSSVPISNFTKPTTLPKYFAIDIDGTFFINDQ
FT                   TKFQRNVEAFKKLKQKNVTAFFCTGRDTHCTKNLLGDSFFNDTGYTRFPGVYLNGAVVY
FT                   DDKGEVIHMKTFSEEFLQAFYKFMDKESISDKVIFQGKDGCYCLGELYEDGKKFMESKK
FT                   LSLPTNATKDTLNNIVGISLPFMPLVIENMKEGTDYNVKTAYNVITQITPPDSNKKIGL
FT                   QKLLEHLGSNENECAFIGDDLNDIEPMEYCYLSFAVADAQNEVKNKAKWVLDKKHDECA
FT                   FENVVKLLYDD"
FT   misc_feature    complement(331830..331877)
FT                   /note="Signal peptide predicted for TA16190 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979, signal anchor
FT                   probability 0.005) with cleavage site probability 0.746
FT                   between residues 16 and 17"
FT   CDS_pept        complement(join(332132..332805,332865..333027))
FT                   /locus_tag="TA16185"
FT                   /product="haloacid dehalogenase-like family hydrolase,
FT                   putative"
FT                   /note="SMART pfam:Hydrolase (PF00702) at aa 14-249,
FT                   E()=1.60e-02"
FT                   /db_xref="EnsemblGenomes-Gn:TA16185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73021"
FT                   /db_xref="GOA:Q4UIR8"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR8"
FT                   /protein_id="CAI73021.1"
FT                   /translation="MKSISKFTKPEKLPKYFAIDIDGTFFIDDPEKFKRNAEAFKRLKN
FT                   SGVTPFFCTGRSFNCTLQLIGELFLDEVGYTGFPGIYLNGAVVYDENREVIHSKIFSED
FT                   FLEEFYKFMNKEGIADKVIFQSEDGCYCLGNFYEEGKNFMESKKMSLPVNVTRDTLDNI
FT                   DIVGISLPFMPLVIENMKEGRDYNVKTAYNVIAQITPPDSNKKTGLEELLKHLGSSGEE
FT                   CAYIGDDFNDAEPMEYCYLSFAVGDAQSVVKEKAKWITGEKHDECAFEKVVSALLD"
FT   CDS_pept        complement(join(333634..333878,333910..334018,
FT                   334049..334309,334341..334507,334541..335273))
FT                   /locus_tag="TA16180"
FT                   /product="calmodulin-like domain protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="Tap821d03.p1c.cand.58 - score = 48.05"
FT                   /note="SMART S_TKc (SM00220) at aa 50-307, E()=8.70e-106; 4
FT                   EFh (SM00054) domains at aa 357-385, E()=4.06e-02; 404-
FT                   432, E()=4.74e-03; 440-468, E()=4.60e-01; 474-502,
FT                   E()=1.53e-06"
FT                   /db_xref="EnsemblGenomes-Gn:TA16180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73022"
FT                   /db_xref="GOA:Q4UIR7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR7"
FT                   /protein_id="CAI73022.1"
FT                   /translation="MEKATQLRGKNDPSPRSGRKDTLESKETVVLKPTPGMFVRRSKAS
FT                   FKDNYKAVKLLGKGSFGEVLLCIHRVTGIRYAIKVICKSSMKKKGDHEALLREVEVLKS
FT                   LDHPNIMKIFEFFEDEKYYYFVTELYTGGELFDEIVSRKRLNEYDAARITKQILSGITY
FT                   MHKHKIVHRDLKPENLILESKSINSNIRIIDFGLSTYYSEDKKLTDKIGTAYYIAPEVL
FT                   KGVYDEKCDVWSIGVILYILLSGYPPFNGQNESEIIKKVQLGKYSFEMSHWQKVAESAK
FT                   DLIKKMLIYNSEKRISAAEALEHHWITFMTREKNIDLPCLEFTIDNMRSFHYKQKFIQA
FT                   AMLYIGSKLLTRDECKSLTAIFNSMDKNGDGQLDRSELIDGYTQYLKFKGKGMELVERS
FT                   EIEEQVDMILQDIDFDNNGYIDYSEFLTVAMDRRTLFSKERLENAFKLFDFDNSGTICC
FT                   NELAKMFGVDDVGKESWQQLIREFDTNNDGVIDFKEFKAMLTKYSK"
FT   CDS_pept        complement(join(335659..335759,335793..335934,
FT                   335963..336038,336066..336271,336300..336495,
FT                   336532..336632,336662..336786,336818..336953,
FT                   336996..337136))
FT                   /locus_tag="TA16175"
FT                   /product="queuine tRNA-ribosyltransferase, putative"
FT                   /EC_number="2.4.2.29"
FT                   /note="Tap821d03.p1c.cand.57 - score = 82.19"
FT                   /note="SMART pfam:TGT (PF01702) at aa 128-368, E()=1.50e-
FT                   102"
FT                   /db_xref="EnsemblGenomes-Gn:TA16175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73023"
FT                   /db_xref="GOA:Q4UIR6"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR6"
FT                   /protein_id="CAI73023.1"
FT                   /translation="MALKFNVVASDGRARRGELVLTHGLVETPVFMPVGTKGAIKGLCY
FT                   DQLESLGCVLSLGNTFHLAFHPGSEIIRKGGGLHKFTNSRCNFLTDSGGFQMVSLFSLS
FT                   RVTEEGVEFKFPYDLQREIFLTPEESIKIQNDIGADIIMALDDVVSSLVRDKERLEVAT
FT                   HRTTRWLDRCIKAHSNPETQALFAIVQGSIYPDLRIISLNELKKRDLPGYAIGGLSGGE
FT                   NKTDFWRIVELCTREGVGLPSNKPRYLMGVGYQIDLIVSVALGCDMFDCVFPTRTARFG
FT                   TALNDHGNIRIQHEIYQYDFSPIDQDCDCLCCLKYSRAFLHYGLKKTILVSHLLTLHNI
FT                   RYMVRLFERIRKSISSGNFKGFVRRFLTNMYINNGELPPLWVRDSLLSAGIDILDLYPD
FT                   NSNVVKPY"
FT   CDS_pept        complement(join(337279..337893,337924..338176,
FT                   338206..338534))
FT                   /locus_tag="TA16170"
FT                   /product="transcription factor TFIIE, putative"
FT                   /note="SMART TFIIE (SM00531) at aa 45-204, E()=1.49e-03"
FT                   /db_xref="EnsemblGenomes-Gn:TA16170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73024"
FT                   /db_xref="GOA:Q4UIR5"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039997"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR5"
FT                   /protein_id="CAI73024.2"
FT                   /translation="MFDTTVSKGQSSMPNMAGEINKKSYDKETFSSLLECCTRLFFCDE
FT                   EIVIVDLFLATERAISEKDLEDELGLPENRLREHLSRLERHGILTRFSNTSVTNIFQKP
FT                   QRAYKKDSTRESSSTHTYWRINNHVIIVIHYKLTKMEEILQQKLKGLYESDKFICPKCE
FT                   STYDSLTVQTLEMDGFDAHFICKCGTKVELDDRSAKEDIYSSQHKRFQEQVKNLKKCLY
FT                   DAWGMEVPEFPVFVKKHEKLLSETKTNNLESSSVVGDSSSVVGGGSSVVSDGSESAVKK
FT                   VPSSIVSVDRGKLDSSFGGRTDNKKIKFHMKVGLKGPSQPITSPKQHHTKQKEKPKEDA
FT                   VYSSPVSEKSTGNIPTFQILIDVIPDFYISSLNKTVTLIGVFNHCIITFQTPSSTNST"
FT   CDS_pept        339163..339558
FT                   /locus_tag="TA16165"
FT                   /product="ubiquitin/60S ribosomal fusion protein, putative"
FT                   /note="Tap821d03.p1c.C.cand.45 - score = 7.87"
FT                   /note="SMART UBQ (SM00213) at aa 1-72, E()=4.28e-36;
FT                   ZnF_NFX (SM0043) at aa 110-120, E()=0.00e+00;
FT                   pfam:Ribosomal_L40e (PF01020) at aa 77-128, E()=3.20e-29"
FT                   /db_xref="EnsemblGenomes-Gn:TA16165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73025"
FT                   /db_xref="GOA:Q4UIR4"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR4"
FT                   /protein_id="CAI73025.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLVILAQKYNCDKLICRRCYARLP
FT                   PRATNCRKKKCGRCSQLRPKKKIKGGN"
FT   CDS_pept        340651..342075
FT                   /locus_tag="TA16160"
FT                   /product="hexose transporter, putative"
FT                   /note="Tap821d03.p1c.C.cand.46 - score = 29.09"
FT                   /note="SMART pfam:sugar_tr (PF00081) at aa 12-473,
FT                   E()=2.80e-34"
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA16160 by TMHMM2.0 at aa 7-29, 58-80, 92-114, 118-140,
FT                   147-169, 189-211, 279-301, 316-338, 345-363, 378-400,
FT                   413-435 and 440-462"
FT                   /note="Signal peptide predicted for TA16160 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.961, signal anchor
FT                   probability 0.018) with cleavage site probability 0.293
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA16160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73026"
FT                   /db_xref="GOA:Q4UIR3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR3"
FT                   /protein_id="CAI73026.1"
FT                   /translation="MAPKISAHLLIGVTIASLASLNFGLSSVSFNISKEFAIVDLEWCL
FT                   NESSIYDCDKSQLYAGLANGSTFIGAALGSLMIGFAGKIGRRRSLMIINWLFGLGSLIA
FT                   MGAVNFGMLFIGRLISGMGIGLSALAPVFMVEICNPDSRGKFAVIYPLFITFGQLLSTG
FT                   WQLLHFRIVTNTGPDGGVFKLDDMDRFIWRSAQGLPIIFSAIGLVLIHMAFKFDTPYEL
FT                   IAAGKTSEAREVIEKLHDITLVDKIYNEFDKDQEIAKTTPNIPFFKAIKTPKYRKQIIH
FT                   SFVLAALQQLTGITILTSNVAELFAQFMGRTYKSTVLCSLINIINFICTIVLSVIINKY
FT                   GRKTLLAYGMSISTAFCAIAAFSKPVGKEAAWVGISTAVGSFGFVLGFALSMGGVTWVY
FT                   LSEVYASEIKNGAYSIAVFINWLCASVSLIVSEFLISYSEVLVNTILFGFCVFNLIYVV
FT                   VFIRETKGLPLGKAYD"
FT   misc_feature    340651..340722
FT                   /note="Signal peptide predicted for TA16160 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.961, signal anchor
FT                   probability 0.018) with cleavage site probability 0.293
FT                   between residues 24 and 25"
FT   misc_feature    join(340669..340737,340822..340890,340924..340992,
FT                   341002..341070,341089..341157,341215..341283,
FT                   341485..341553,341596..341664,341683..341739,
FT                   341782..341850,341887..341955,341968..342036)
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA16160 by TMHMM2.0 at aa 7-29, 58-80, 92-114, 118-140,
FT                   147-169, 189-211, 279-301, 316-338, 345-363, 378-400,
FT                   413-435 and 440-462"
FT   CDS_pept        join(342194..342224,342254..342512,342646..342778,
FT                   342834..342911,342944..343227,343351..343555)
FT                   /locus_tag="TA16155"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.47 - score = 17.70"
FT                   /note="SMART HATPase_c (SM00387) at aa 18-133, E()=1.02e-
FT                   01"
FT                   /db_xref="EnsemblGenomes-Gn:TA16155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73027"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR2"
FT                   /protein_id="CAI73027.1"
FT                   /translation="MKEVYQFFSENLGLTGFDEKSVLYTISKELIENAIDACKDEQKEH
FT                   KIKLQLKKNDDVIEIQCFDDGSGINPNSIESIGHIFNSSKSDQETSGTFGLGINENMIM
FT                   KYNVVLSEDLKEPFVCNVLTEEVTLDEWPYNTGVITKFKCSVPNNFKELISSYLDIVSI
FT                   HHPKINISLDMFGNLISKGNKQESITEGILSVFLSGVEIYTASFTTDQVGFKKVDVSCF
FT                   IGKFSLKFKNYATLHVLRCINGIPMAKNSSSYCAIYSTIRNLIKKELKEYGIRSSGRIS
FT                   KQLMEELDSQVNTPEGVLNHKPVRTHHLTMFSFLGTFQLKLHQILLGT"
FT   CDS_pept        complement(join(344123..344235,344265..344603,
FT                   344636..344768,344801..345006,345037..345118))
FT                   /locus_tag="TA16150"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 5 transmembrane domains at aa 63-82, 103-125,
FT                   140-170, 226-245 and 260-282"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA16150 by TMHMM2.0 at aa 63-82, 103-125, 140-170, 226-245
FT                   and 260-282"
FT                   /db_xref="EnsemblGenomes-Gn:TA16150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73028"
FT                   /db_xref="GOA:Q4UIR1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR1"
FT                   /protein_id="CAI73028.1"
FT                   /translation="MSDLSRDNWSQSSSPLLTDLNVPKIDIDDVDIGANYVNMEGSSFD
FT                   NSSEQPLLNNEPSRSGVWALRFMVLTWIVTTFLFFFYREQISKLIRIIATFCAEQGSLV
FT                   YLYYILIYAGTVPLLMSTEILTVTAGFIFAHIHGNALGIFISVLTSFIGYAAAMSICFV
FT                   LARYLIYDFVNRRFRSYRYYNALMSATENVGFKMVSIIRLSPFFPSAICSYIFGTTNVS
FT                   FRDFFWGSIGYIPALTFYSYAGSLLESLTSDEPVHGWRTVLYISISLVVSIAGMIYASN
FT                   LTREHLPDV"
FT   misc_feature    complement(join(344150..344218,344290..344349,
FT                   344515..344603,344636..344639,344682..344750,
FT                   344843..344902))
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA16150 by TMHMM2.0 at aa 63-82, 103-125, 140-170, 226-245
FT                   and 260-282"
FT   CDS_pept        complement(join(345973..346250,346282..346441,
FT                   346472..346591,346621..346742,346772..347056,
FT                   347094..347199))
FT                   /locus_tag="TA16145"
FT                   /product="DnaJ-like molecular chaperone, putative"
FT                   /note="Tap821d03.p1c.cand.53 - score = 24.75"
FT                   /note="SMART pfam:DnaJ (PF00226) at aa 58-126, E()=4.00e-
FT                   03; 5 transmembrane domains at aa 5-27, 138-160 173-195,
FT                   210-232 and 333-355"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA16145 by TMHMM2.0 at aa 5-27, 138-160, 173-195, 210-232
FT                   and 333-355"
FT                   /note="Signal peptide predicted for TA16145 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.636, signal anchor
FT                   probability 0.002) with cleavage site probability 0.267
FT                   between residues 16 and 17"
FT                   /note="GPI-Anchor Signal predicted for TA16145 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA16145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73029"
FT                   /db_xref="GOA:Q4UIR0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIR0"
FT                   /protein_id="CAI73029.1"
FT                   /translation="MGLNVLLCHTVISAVANNLLLVGDHFVVKKFNSIFRFTLHALIAS
FT                   FLFYHELPKLGDTYFSYLGLPITATHSDVLKSYDRIQEFLKVSWKINNLIQTGSPDVVA
FT                   KLKKAYQTLSNQESRMLYSAYGDVDIDAKNPQDFTIIVLTVSLSYYCVSAILCCALNRS
FT                   NRLKFAKYITVLYNAVGFFLEVELRFLYACFMKNIFYLNKLLPYQHVEFLRAIPPFVMM
FT                   VASLLTHSFVTDMDKLNMLLWQSAVATNGIILEKMANVVNATDYLKSLGRDNLSLPEDL
FT                   FKFEARGSGFGEFLDSLDESQKKKLVDLLNNGVSLLLINSFQNGKAKTPKSRIIEFLKP
FT                   ALIYIVMFLVIRVFLK"
FT   misc_feature    complement(join(345979..346047,346379..346441,
FT                   346472..346477,346520..346588,346654..346722,
FT                   347119..347187))
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA16145 by TMHMM2.0 at aa 5-27, 138-160, 173-195, 210-232
FT                   and 333-355"
FT   misc_feature    complement(347152..347199)
FT                   /note="Signal peptide predicted for TA16145 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.636, signal anchor
FT                   probability 0.002) with cleavage site probability 0.267
FT                   between residues 16 and 17"
FT   CDS_pept        join(347517..348347,348382..348947,348977..349113,
FT                   349142..349269,349299..349469,349501..349695)
FT                   /locus_tag="TA16140"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.48 - score = 58.70"
FT                   /db_xref="EnsemblGenomes-Gn:TA16140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73030"
FT                   /db_xref="InterPro:IPR019163"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ9"
FT                   /protein_id="CAI73030.1"
FT                   /translation="MNEPSEVLNSIKESYFTEKINERTKRHLDHSYSGDSIFSFVTPLF
FT                   NPPVSEKFVQKESKRHKKVNFKNSNLALDLEYVTKVCNDTKFFIKPTEDGLHYVNESLM
FT                   LFESFLHSLPNFSFKDSTKEDAESYFDALFESLLSCIEKEKYEVEIKEEPADDFSSLEI
FT                   KNINKPEFSNEDDHQLMKQLLISLLLAYNWSLHLYNLTNIAFKISKSDLSDCANESILK
FT                   TALGIKESNRNYIFYKNVSQQLWYLLKSKEENVNSFISEFTQKIAFINNIVDIEMAYEP
FT                   NMWNKLKSEIPDSEKKTPFPSRNHHEENLNIIRNEMGRRINNQTKCEYLRRELDDVTSQ
FT                   MLNLESKNEEVLTKLDSLRKQLEELMGSFTTEIDNTKAGDSKKLPAPMSTLYTHLNNFS
FT                   QSNPLRDISFKVLKEENGFQMSLSAPRDVLFPSLEATKFSFPLVYQFEVKGKEIKVTQV
FT                   NSPKLISSKTAMDLAMNKFMGIEQQGDFDFGLKRYQDQLPKDFQENMETLYKLAQEFVW
FT                   NLYILESYKTNNKSILSKILPEELQNRKIHSKYTYKEKNIWNVSNEAASAVVQVESNGN
FT                   FKFKFSEFKKKGKIEVTESSKLMEHLKEKHVVKIENFGDLSKPIMDYFNKGYNLNHLSV
FT                   LFESYLVSTIKNNKYRYYSTFCLPRNTWNTYIIPLILVLP"
FT   CDS_pept        complement(join(349697..350701,350743..350907))
FT                   /locus_tag="TA17100"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.52 - score = 23.99"
FT                   /db_xref="EnsemblGenomes-Gn:TA17100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73031"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ8"
FT                   /protein_id="CAI73031.1"
FT                   /translation="MHSVHFPVFQYSIPKPWYKIFLILQNQISNRIKYMYILYLITYSI
FT                   FLDIARTLALSKNFVSTVPGSLGSSTYHETFLHNLDDVADLGADSKGTSSDKMHELEEI
FT                   LEDESQSPDEQVAYKYAENSKVFDNPVVLEVTSKPTVDEVKDFEKVKAHELASEDKHFD
FT                   SLSSLVSQPGNLKVTGTSFTVGFIPLNNIQTSLGNKSLGDNGLNVNHLVSGLSGLNFGP
FT                   TEHNGVLNDAVKHGILEPQDLPPVNVNAQAHNHFHVLNVNHHLSPIGDLNFNFQSPNTN
FT                   PSTNTGKECFERTSKDGSKTTECYCSRQGDCRCTKSFVMVASFCDTMINDNFFNDFCTY
FT                   DVKSDLQNNQWSSKKSSETIYDAFLSLKNGLCNNVTLDYCRYTCKQHIF"
FT   CDS_pept        join(351276..351934,351967..352111,352143..352261,
FT                   352293..352485,352516..352591,352632..352719,
FT                   352752..352905,352938..353099,353132..353217,
FT                   353241..353291,353362..353545)
FT                   /locus_tag="TA17095"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.49 - score = 44.21"
FT                   /note="SMART SANT (SM00717) at aa 209-263, E()=2.74e-02;
FT                   ZnF_NFX (SM00438) at aa 476-496, E()=0.00e+00; 1
FT                   transmembrane domain at aa 600-622"
FT                   /note="1 probable transmembrane helix predicted for TA17095
FT                   by TMHMM2.0 at aa 600-622"
FT                   /db_xref="EnsemblGenomes-Gn:TA17095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73032"
FT                   /db_xref="GOA:Q4UIQ7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ7"
FT                   /protein_id="CAI73032.1"
FT                   /translation="MKDDDCFLELFKLHKMFENSFHITNPKQDNSIEKVYNNDIISINI
FT                   LLKPTDPDFDRTILSINDGIKINLNLHRVSVNNYPDSTTNPSEDHRISNLNTNLDHLPN
FT                   FQSDQYRSGTYYDVKDISDISIDDNTLSEHFKNSIRKVLLDYISKNSKLRKYVIYESLK
FT                   FLDKNLLKIYTISESVRNSRTNNVATQGTESKGGVEKNNTTKSANSDNPWTLEEQKCLE
FT                   DGLVRSKGISDPREKWLFISKMVKTRTPEECRKRFLRCREVLVRNNRTEEIKEPEQPTY
FT                   SLDRTGSLSFSRLEMIKLSLGRIGTFSMDIVCLRCTDRFEVTLADLGEKTIIYSKNCQK
FT                   CSVPIRCEFTPSLFFPSQLTFGNLSLLNSDFIDLNHAEFKLTCEDCETQLRIREVKIGD
FT                   KKSMNCRGCFTKFLFSFGNVQFGRGEEPSRESSVKKVIKYERKTPTVKGIKVGTPLPAN
FT                   GTCKHYKKSFRWFRFPCCGRLFPCDTCHDEATDHKCEYANFIVCGYCSTQQAASNKVCK
FT                   FCSKGCTASSSSHWEGGKGCRDGTKLSRKDSKKYKLISKNNGKNQCKVKSQIEFITNSQ
FT                   SSNKSLSSYLRYKMYQYPPKSCGIVECRLLVVLILFSILYFNYFVFHQNIFVVYLFKRC
FT                   LNQ"
FT   misc_feature    353426..353494
FT                   /note="1 probable transmembrane helix predicted for TA17095
FT                   by TMHMM2.0 at aa 600-622"
FT   CDS_pept        join(353728..356338,356406..358706,358754..359136)
FT                   /locus_tag="TA17090"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.50 - score = 128.10"
FT                   /note="SMART pfam:Noti (PF04054) at aa 1377-1760,
FT                   E()=1.00e-06"
FT                   /db_xref="EnsemblGenomes-Gn:TA17090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73033"
FT                   /db_xref="GOA:Q4UIQ6"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR024557"
FT                   /db_xref="InterPro:IPR032191"
FT                   /db_xref="InterPro:IPR032193"
FT                   /db_xref="InterPro:IPR038535"
FT                   /db_xref="InterPro:IPR040398"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ6"
FT                   /protein_id="CAI73033.1"
FT                   /translation="MDNTSNVKSDPDPLVDQVDFDNWPDYTNDEDVVNKYFYKLYVSQI
FT                   TTDQMIEVMRHLSASPKGSRNKSVYNTMIKILFNECRFFPKYPLQELSITAELFGKMIK
FT                   HGLLLSNGPLLLLASRCILEALKRGKTSKMFQFGTIALSQFENSIASYPWFSNSLLSIP
FT                   DVKETFPQLYKTCEKLQTIMTDNMKNSTYIDQSKGIVIGQVEEVTQTQPEQNGQTSPPS
FT                   YGLDIRASVGEWELIMGDVEVDATVPPDSLVDHVYSIFNNMCPDDVEKKATEVSALLDQ
FT                   KYNTWLLLYIIRTRASKEHNLHDVFANFIENMNYPKLFDQAIQITYLCINSCLKNVEQH
FT                   KEVLAYRTLLKNLGSWLGRITLSRNVPIIHRQLDVKTVLTKGYENGYLVVVLPFICKSM
FT                   ESIKNSKIFKPPNPWTTAMLSFLMEIRDLPNLKTNLVFEVEVLFKHLNLEMKDYANKTN
FT                   LLTSKNPPKNSPDFEPPNPANTVQTTSSTTTKTNGVQAGANTLEEKNVQYPGDREKLNQ
FT                   LLSKIIREGTLTTSSSKFNAIYTPDVPTNLNNVVTQTTNNAPTKVTNTVPTGGSPSNVT
FT                   TTPPPAVNLPTTANFAHAQINMSMTRFIDNMMHNLHNNVVISPSIALFEIQPQFRSLVP
FT                   IAVERAVRHVLSVVCEHSLSLARMCTKVIIAKDFSNQEDENVTRGATRMMFETLATNLV
FT                   VATCKEPLKVAFHESLRSSIQTHRTQDCNDQVLVEQLVQVLSQDNLAVCVNVVEKITQE
FT                   YAIRESDLLFMEILKPISREPKLPTNFLPTLINNWNTRNNNQHALVVYKSIFGNSRTTP
FT                   QRVQLHSPSSVSQHSIQSQQFPVNQMNQQFQGQVMMGQPPISSPANQMPTSSLQQSSPN
FT                   GLHTVLTLFEECLSELREPLREISMFPPPLYNTGLEPGKTEHIFSTQSLHVLYSLPHDH
FT                   EVFSCIIKCLNVVETSGCREVASMAIAKCLLMFLCEGLGSNAGLNVEVLLCILDGLNSI
FT                   NPAVKQMLGNMLYSLPLDQNNNLFNIIVVTGLLRYKLLEWSELTHYLILAMERGKNVYA
FT                   IEMSIVATAIALIDQKSAPPTVGAPLVREISSLSCGLEPCKTYPGVLIKDAWSKLLKDI
FT                   VDVQNEPKPTILVLTTILKQNLNTLFGIHHFKTNPSTQVQVGTEYNDQRSDDQIDGFGG
FT                   ARRVPIPSPVNDSHRFVFGALFGKWVECSKNVEGDSLLLSWRQFFQKFNLQSLFKMEGG
FT                   TDSFFSSCLYTIIHFEKTSKLFNMANKDPNNQKVNGLTTMPNMRPQASTNTSSMMTSLN
FT                   ASNDPSTKSESMSDESNTNSSASSSASSSSAQGLSAPPITLFDCLEGLCKMIDVMLRLV
FT                   GGVGDIPPCSALQKLLSSLSSIIVHQGHYLSSYNIWLSLMVYFDRYEEPNYVYAKLTFL
FT                   YALEYINPTRVPGFSFFFMRLLVHPALINGSLRSSKCWRILSRIFNLLSIYTADINNYP
FT                   NTNKESNENKDLMVKEDSLESEKDTVRDIDNYVEYFTSVYFNCVEHVSNLCPEFVSINY
FT                   LNFFGTFAIERLASSVGNKGPSVLKGFLGVKGVDVIPEMKVAPKVSNSWSNHISRNRLS
FT                   LLVTKVLTKLSKFGLSSLVSCQDLETICLILTEQVNNTPAQSVMTFNSLTLEIVTTHPN
FT                   VSQDLHDTNARLFLFLWLIKALPIKAKYQLVCSIVRHLRDPNAHTFFFSCLIITMFDEC
FT                   KNDLDTKHVILRVLLESFIAPGKCPWGVSLVVLELFTNPRFQQIPNYSPQTNALIESIT
FT                   HTINNIAT"
FT   CDS_pept        join(359237..359289,359320..359377,359423..359569,
FT                   359599..360108,360137..360232,360259..360374,
FT                   360403..360469)
FT                   /locus_tag="TA17085"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.51 - score = 60.96"
FT                   /note="SMART WW (SM00456) at aa 13-45, E()=8.47e-07;
FT                   pfam:FF (PF01846) at aa 64-112, E()=3.60e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA17085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73034"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ5"
FT                   /protein_id="CAI73034.1"
FT                   /translation="MDDVGVPTSWNQLEESSWYEVKTSKNYKYYYNKETKETKWERPSL
FT                   KNEEKQDLKDENDKEVPKEDMDNYKELIRSLNFPNNVNYEQCIPKLIFDQRYKNIPKSH
FT                   RKSLFNKFMRELLAEKSSTSVTLETKEDEKDTETRNEKKRRLEEPSKTRESSKKLDKVD
FT                   EKSHRDTHLRKLAEDNFLNLLHEKIKMPFKDGEVEPLQEEILNNDPRFTNKYLEDKNYI
FT                   YKKFTREFLKARVELFESKLRLLNSDNINLDLDEVVEKVGIRLFKDLPSYNLNQCLNKW
FT                   KEDKVCEKGELMESFKMMLKKSLHYNPGTKKDNLESAKLYFRNDESRYQRLESFPHERD
FT                   KLIMERLE"
FT   CDS_pept        join(360639..360839,360875..360947,360985..361098,
FT                   361137..361255,361288..361350,361383..361621,
FT                   361652..361721,361756..361932)
FT                   /locus_tag="TA17080"
FT                   /product="replication factor C subunit, putative"
FT                   /note="Tap821d03.p1c.C.cand.51 - score = 60.96"
FT                   /db_xref="EnsemblGenomes-Gn:TA17080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73035"
FT                   /db_xref="GOA:Q4UIQ4"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ4"
FT                   /protein_id="CAI73035.1"
FT                   /translation="MLWIDKHCPKNLNDFTSHKDLSELLLKLVNKSHGELPHFLFYGPS
FT                   GAGKKSRILATLRSVFGNKVDKIKTDVLSYKDTSEVVVCQSEVHIQIPCQELGTRDRYI
FT                   VQDIIRSLSSAPSASNFFSKGPSYRAFLFEDADTLTQEAQAALRRTMETYIKNARMFLH
FT                   VRQLSRIMPPLRSRCLCIRVRSHTNDEIVQILRKICNSEDITPSQASDQMLRNIAESSK
FT                   RNLRRSILTLETIAMGGFTLQTKNFMMPWEKNITQVVQSVVSSQTPSTLSAVRPQIYEL
FT                   LVCCIPGDLILENIVDQLVPKVKPSLVPSVFHLAAHFSHTMKLGSKDIWHIEAFLAQIM
FT                   SLIAKTRTSKN"
FT   tRNA            complement(362133..362213)
FT   CDS_pept        complement(join(362289..362921,362952..363120,
FT                   363150..363217,363246..363360,363391..363641,
FT                   363670..363819))
FT                   /locus_tag="TA17075"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.49 - score = 44.54"
FT                   /db_xref="EnsemblGenomes-Gn:TA17075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73036"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ3"
FT                   /protein_id="CAI73036.1"
FT                   /translation="MIKLTVRRSVSDGFKSFFNNLERYKNLSYADKNKLLSQFDLKVHI
FT                   SLLIMEVGPEVISEINKKLDLPDNTHVSDKKSDVGEFDHLTFIKRELKRLKSSPLKKKQ
FT                   LLRKEIVIKGPNKFYFGIDPTKELDPIEIKSPLFSTEKESESLVSDVKKATRYELVQQI
FT                   LEDSRPVPQHALTDDFLDVLSRAIEENLSNLERPTLVNELSDYRPAYALKRAAFRNLLL
FT                   NKCVRNAFEDSRVEKFIDSQIEVYKQRLNAPLPPEVLEPLLAFRGDVYYSFSPMKRLQQ
FT                   KLNGINIIVDSISKGLFEMVFMSLGEDVLSKLPEFAKKTDYPFNNYYGFKSSVPNEVTG
FT                   SIRMGKENREDDLRYPNLQCVAHSLPKDPKYRAIVSHSIKVLERSKGWDQTSKIKAINR
FT                   LINVYNSMSSSDYYSRVMEKSVPTDDSKPKVIKTLTRQEVFNKGLRYIQSLFRNHWNRS
FT                   KRK"
FT   CDS_pept        join(363932..364084,364125..364250,364285..364578,
FT                   364610..364781,364812..364900,364932..365054,
FT                   365092..365184,365214..365363,365393..365446,
FT                   365503..365601)
FT                   /locus_tag="TA17070"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.52 - score = 117.86"
FT                   /db_xref="EnsemblGenomes-Gn:TA17070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73037"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ2"
FT                   /protein_id="CAI73037.1"
FT                   /translation="MYRFITNLKTIKCNSIYRRFYTPNATSTFLSNAVGELSNDQIIYS
FT                   FDTLSRSKVRDSNLWDHLCDKIRFNLDTLDSKDLLKIIHSLAKVSHKKLSLLSVINRII
FT                   LRKHKLIDPRDLTQYLIDLNKLDLLNINTFAPLVSAKIPDDISLFTNFDLCFILHLCSK
FT                   LQYKDQLILDSICSRFLLNDYNYQELCSDKSLLAMVFRSLSFLQYKNELYKKLLYQGLP
FT                   SSLYHFGSQELCNSLLSIVVSNLEANFDEQVKDIINSLIDRISERLSSLVEIEVNQLGI
FT                   CLYFLKYNMASFPGRFESLFNSIVELNIIYTPNTSKMQLGRLLDELKLKHKSELKIGPY
FT                   TLDYAIPKINVAIEVNGYTHFFHNSKELNALTQLKYKILKDMGWNVVGINYYNWKNRNK
FT                   QSRLDYIVKKITPFLEEKKIGEKYRKRRLVRSENSKNLICNIIVLIIKNIL"
FT   CDS_pept        join(365735..365880,365926..366112,366148..366521,
FT                   366553..366745,366778..366921,366953..367039,
FT                   367073..367185,367247..367676,367707..367783,
FT                   367818..368035,368067..368221)
FT                   /locus_tag="TA17065"
FT                   /product="Myb-like DNA binding protein (CDC5 homologue),
FT                   putative"
FT                   /note="SMART 2 SANT (SM00717) at aa 6-55, E()=1.62e-13; 58-
FT                   105, E()=3.32e-10"
FT                   /db_xref="EnsemblGenomes-Gn:TA17065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73038"
FT                   /db_xref="GOA:Q4UIQ1"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR021786"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ1"
FT                   /protein_id="CAI73038.1"
FT                   /translation="MLIQIKGGVWKNTEDEVLKAAVMKYGLNNWSRVSSLLVNKSAKQC
FT                   KARWFEWLDPHIKKTEWSREEEEKLLHLAKLFPTQWRTIGPLIGRTAYQCLQHYERLLD
FT                   QAQGREEDDQFDPRKLRPGEIDPQLECKPSRADAVDMDDDEKEMLAEARARLANTRGKK
FT                   AKRKAREKALEQSKRIAMLQKRRELKSAGINVRNFKMKKITMDYEKEIPFEMQPPKGFY
FT                   PPDEERPANLSIKNIEQLEGIRRDQEMNKLRKDDIRKLKRLQSDDTPAAMSIFEKYDKS
FT                   KTLKNKLVLPEPTMTDDEINQIIKMGADIQLLENVANSTVARTPMTTSIMEEARIAAMA
FT                   NRLQTPLEGEMNFPDSSFPVPPTPSQFQTPNPIKQLMAQTPLTIFGSRSSSAFTPRPSE
FT                   PSVYDDASDSDPIGSKARLDMARLYVKASLSNLPEPEGNVEVTIPDIETMEEEEVEQDL
FT                   DMEEIERRKQELEKKKQEERELLETQVIQRKLPRPVVFNSIVFVNDLENTFNESQSKYN
FT                   QLINEEFVNLLAYDSVKHPIPHGRPADQYKPKEYFDLKLIEESRKLIDSEAENLSKGLE
FT                   DSNLLLEWKTSNFKYSHLQKRYMPCEKLTLQEQKLAEEMLCKEYEKHLENLSKRIKSLE
FT                   NKYNVSTGGYRSREEKILKEIGEMYDSIIQSTNDCNSFKEMEQVERRSSEERISFQLSQ
FT                   LQKEKSMNRKLQV"
FT   CDS_pept        join(368770..368881,368925..369036,369068..370403)
FT                   /locus_tag="TA17060"
FT                   /product="ms1orf2 protein, putative"
FT                   /note="Tap821d03.p1c.C.cand.53 - score = 45.89"
FT                   /db_xref="EnsemblGenomes-Gn:TA17060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73039"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIQ0"
FT                   /protein_id="CAI73039.1"
FT                   /translation="MDKNWNNETNSEENLSNMSLESLSLGQRLLSKCLKKTGISVSVRG
FT                   IAVNTTSQIKTAGSAWKSEVKYESNVESKTGTLDDVSFPDLLGSSNRDVSVNNRISETS
FT                   SVTNDQDRLSKEPRSTRYKFKHRISSVKSVASPGFHSSRDSSYSNSLSFRNSNSDDTDN
FT                   ILGTDFLMPGMKGNYPLGFTNFIGRGVESPPPPPPSVPYPANPNGIYQGFQQYATRLKS
FT                   NSRPQMFKPNVMVESPTVSESNWMDNKSDGYNEAELTTAIDTLNHSILSDRTRDDRLTI
FT                   KQYVSDKLSQPFLDLTNYKDNSLLLQESLTNKLDERLVGQLESRLTNQLENTLSNQLEN
FT                   TLSDQLEPTIHETLTSDLSPLAEKRKKDRYPRRKKPTSTSSNAQTVNTNQPNINAKSQK
FT                   DKKDRLFTNPDPTKTNDVPTSQPPDSTAPPATSSVSEQPPDPKNDKLPTSGTGSGRSRR
FT                   SRHRPKSHHRDEDENWRNSANEKPQNNAVNSEKNTHERKYFKSKPKHKHQQNTEPNTTK
FT                   VD"
FT   CDS_pept        370622..371227
FT                   /locus_tag="TA17055"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.54 - score = 13.99"
FT                   /note="Signal peptide predicted for TA17055 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.001) with cleavage site probability 0.417
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA17055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73040"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP9"
FT                   /protein_id="CAI73040.1"
FT                   /translation="MKYLLLVIFYLSSSWTLCYFEINLHNLEFNSNIRVRKHLGYTLDT
FT                   TIITSIGRDKINRILDNCIVVWTGAGSEGVVEIFLREKNGNHLMMEIYSVNQDDVRKDY
FT                   HFVFTRRCWLRTSFIQYQNLLRDLRLYSRPINEALGVVEDDYDAYSEFDRLFSKINNFI
FT                   FTIHLIFTGSLHTVERDDESEEEAAITRVCCSAFSWLA"
FT   misc_feature    370622..370669
FT                   /note="Signal peptide predicted for TA17055 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.001) with cleavage site probability 0.417
FT                   between residues 16 and 17"
FT   CDS_pept        complement(371415..372260)
FT                   /locus_tag="TA17050"
FT                   /product="merozoite-piroplasm surface antigen Tams1"
FT                   /note="Tap821d03.p1c.cand.48 - score = 27.39"
FT                   /note="SMART pfam:EMA (PF02408) at aa 1-280, E()=1.40e-191"
FT                   /note="1 probable transmembrane helix predicted for TA17050
FT                   by TMHMM2.0 at aa 261-280"
FT                   /note="Signal peptide predicted for TA17050 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995, signal anchor
FT                   probability 0.002) with cleavage site probability 0.953
FT                   between residues 22 and 23"
FT                   /note="GPI-Anchor Signal predicted for TA17050 by DGPI
FT                   v2.04 with cleavage site probability 1.1019999 near 247"
FT                   /db_xref="EnsemblGenomes-Gn:TA17050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73041"
FT                   /db_xref="GOA:Q27399"
FT                   /db_xref="InterPro:IPR003407"
FT                   /db_xref="UniProtKB/TrEMBL:Q27399"
FT                   /protein_id="CAI73041.1"
FT                   /translation="MLSRTTLKFLYLSFFVISSVNAANEDEKKKEEKKDVVLDVTLTSC
FT                   ENVTFKNVDSNTTELTVADGYRFKTLKVGDKTLFNVDTSKHTPVQAFKLKHESDEWFRL
FT                   NLHPAQPKMFKKKGDKEYSEVKFETYYDDVLFKGKSAKELDASKFEDTSLFTSSAFGTG
FT                   KMYTFKKEFKPSKVTFDKKEVGKPNNAKYLEVVVFVGSDSKKFVKLYYFYTGDSRLKET
FT                   YFELKDDKWVQMTQADANKALNAMNSSWSTDYKPVVDKFSPLAVFASVLIVFSSVLYFL
FT                   "
FT   misc_feature    complement(371421..371480)
FT                   /note="1 probable transmembrane helix predicted for TA17050
FT                   by TMHMM2.0 at aa 261-280"
FT   misc_feature    complement(371517..371522)
FT                   /note="GPI-Anchor Signal predicted for TA17050 by DGPI
FT                   v2.04 with cleavage site probability 1.1019999 near 247"
FT   misc_feature    complement(372195..372260)
FT                   /note="Signal peptide predicted for TA17050 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995, signal anchor
FT                   probability 0.002) with cleavage site probability 0.953
FT                   between residues 22 and 23"
FT   CDS_pept        join(372803..372949,373016..373087,373169..373333,
FT                   373379..373442,373472..373698,373730..374214,
FT                   374249..374354)
FT                   /locus_tag="TA17045"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.55 - score = 31.14"
FT                   /db_xref="EnsemblGenomes-Gn:TA17045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73042"
FT                   /db_xref="InterPro:IPR013893"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP7"
FT                   /protein_id="CAI73042.1"
FT                   /translation="MSCPYPPSLSSECDVFEFNQSPSDITGPDFENFLQQILHPIYSPN
FT                   YVKSATVLYPYQENPCIDSFRENLFNSKDTCFVVSNITLTSLLNLDFIVNYLVPKRLSV
FT                   LNIYYNYKSKINFIISSKGVLTINLDLEVFRTIGLSNCNITHRNEDESVTLEINLLDTS
FT                   YLKPHSRLYERLLFSLSKISPSTVIILSEILNSMDLNELRTSLKAGQEVTISPCRTNVE
FT                   HFRVPLNHKEYSLKFFSENIEKLVEEQSHELNGSCGKRLKTDTDNDDLEHRYEKMESQR
FT                   EILVKVFSTLKKKPLKSKQVIKDMIHELNRKNLNEFSEKKTPIHNLISFIDHINLESLK
FT                   VGSCNFSNSNDTDQQNAVNNTETYELLKLNNGIISNEYSFNLLKEAWVLLREVGLVIIS
FT                   LYYINGKKVGCESLSKGKVLGF"
FT   CDS_pept        complement(join(374921..375512,375563..375782,
FT                   375815..376834,376869..377220))
FT                   /locus_tag="TA17040"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.46 - score = 31.98"
FT                   /note="SMART ZnF_NFX (SM00438) at aa 144-163, E()=0.00e+00"
FT                   /db_xref="EnsemblGenomes-Gn:TA17040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73043"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP6"
FT                   /protein_id="CAI73043.1"
FT                   /translation="MDHSFSIDTCLYSKDDLSTANRKSSIESFIRYATEGSINKQIEQE
FT                   LGTTNNEELKSENKDDRKFTILKKCLDNLSKTIVSDTLSFLKEYFQIKDTFEYSVHTSI
FT                   DTFHQDLSKVLDDSDRSQTRKDTFETNDLPSVDRNASKTCSIHPVSETCSIRELVPESE
FT                   IEYELDPETLEKALLVFVDYSHKLATKAVEDNRHLFADKLICNIFRRLKQVYDRNYDNN
FT                   YTNSLDSTGRYPLFNLSFNLPSGTPKSVRIRLEEMSKDPLFVNNLAERIIIFDIMNRFK
FT                   MFDLTELCFKFNQRIIEELWHLSVHSVFSKTNYDVERLFQCRNSIFTTENADKFLYDKN
FT                   LSSKIESFTDANLYPQVSVHSNYETKESNLENLPDLNSDDMSQDLNSPWLSYDSSRTFR
FT                   DLGSSRDKWPEGLFVGSHDTLNYILRTNRLLNYERIDLLKGHFNLRKTEGSGFWVKETN
FT                   KPLETFYFLEKNCVSIKVRGKLPCDIITALTIISQTELRLEWVSFLKDSQDLHTFSKTS
FT                   RISRQASHSYIIRKYEYPVVGHKESLVYALSTNLLDEANCVIICCCNPPSNKKEFETVV
FT                   KSMRKSGLEDTSGFISLDSKNNCTLSRYNISSSVPKRKNQKSGDICFLLFPYGENETLM
FT                   EVYGNVTQEVKLVPMKFITFLIKKIMVGMIRKLANISKGFSETKFAQSMSSRSEFYDWM
FT                   VKIYRDQKGSNPQLSTFDYDNYVYTYNPIAKKS"
FT   CDS_pept        complement(join(377564..377614,377648..377733,
FT                   377825..377990,378054..378896,378939..379063,
FT                   379095..379487,379540..379616,379649..380088))
FT                   /locus_tag="TA17035"
FT                   /product="glutamyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.17"
FT                   /note="Tap821d03.p1c.cand.45 - score = 65.46"
FT                   /note="SMART pfam:GST_C (PF00043) at aa 56-172, E()=1.90e-
FT                   03; pfam:tRNA-synt_1c (PF00749) at aa 214-520, E()=4.20e-
FT                   131; pfam:tRNA-synt-1c_C (PF03950) at aa 522-696,
FT                   E()=1.90e-35"
FT                   /db_xref="EnsemblGenomes-Gn:TA17035"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73044"
FT                   /db_xref="GOA:Q4UIP5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP5"
FT                   /protein_id="CAI73044.1"
FT                   /translation="MYNKGSEQLVVNYSVQNPPYGAVILSSISKYLQKSDSSKVVFNLD
FT                   NKLQNNEFSLNGDKFNEVDLLKNLCSVLPYCDKLLDVVNNSELEYWFKVLLSEKSKLAE
FT                   NKGNFTENDSYLENMNKHLAQRTYLIGHRLSLSDILHFSLLRRTCNVNSLKNKYPHLAR
FT                   WYNFISNVPGTSGCLNGYETPSSATYKKPFTKQEQQDNSYKGVLKGAKEGCVVTRFPPE
FT                   PSGYLHIGHAKAALLNFYFAQKYRGKMLVRFDDTNPSKEKDEYVDSIMEDLESLGIKYD
FT                   ELSYTSDYFDTFQEYAVKLIKKGCCYCDDTDVETMRKQRGEGVESLARNNSVEKNLELF
FT                   SEMLKGSEVGVKNCLRAKMDMTSKNKCLRDPVFYRCVTNVPHHRTGDKYKAYPTYEFAC
FT                   PIVDSLQGVSHSLRTNEYSDRIPLYYWVLEKCELRHVEVYEFSRMNFVRTTLSKRKLRW
FT                   FVENKLVTGWDDPRMPTVKGILRRGLSVKALFEFILDQGPSKSVNLMEWDKLWAKNKQI
FT                   IDPESPRYTAVVSDHVVLKVVNFQEPAVKTRPLHPKNPELGEIELVFGDQVMIEREDFN
FT                   LIDQSEEVTLMKWGNAFVDKANLQLKLNLQGDFKLTKKKIHWLPVKTTKTAVDCDLVEY
FT                   GHLLKVDKVDSEILGDDDNNMKEFLEPQTEWVTKALGEWALSNLKKGTVLQLERKGYYI
FT                   VDQPHDSGRLVLVQIPDGKAAKPKQKKCFNIT"
FT   CDS_pept        join(380992..381049,381130..381506,381540..381596,
FT                   381633..381758,381790..381936)
FT                   /locus_tag="TA17030"
FT                   /product="3' exonuclease, exosome component, putative"
FT                   /note="Tap821d03.p1c.C.cand.56 - score = 21.14"
FT                   /note="SMART pfam:RNase_PH (PF01138) at aa 15-135,
FT                   E()=1.40e-06"
FT                   /db_xref="EnsemblGenomes-Gn:TA17030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73045"
FT                   /db_xref="GOA:Q4UIP4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP4"
FT                   /protein_id="CAI73045.1"
FT                   /translation="MESSNDILMSDSFNELRPLEIKMSTSSTFSGSCIINLGNTIAKCL
FT                   VNLPKISTKKASTEYGQFTLELTSNYLFHTPKYLETLKSHIIETFERHILLQNYPSQII
FT                   EAYIIVSNDDGGLLPALIMGMCLALIDCGIQVYDVISACSVCIFKDHDGNLVTGLDFNK
FT                   TELSYYQSKDPYFTVVNLGYCCNLRNVAFLESKGNYSAEHIGKALEVAEVACNLISGEL
FT                   FKILKENHTWRCENSNFALQTEYIQPDVDLNK"
FT   CDS_pept        join(382462..382480,382621..383378)
FT                   /locus_tag="TA17025"
FT                   /product="60S ribosomal protein L2/L8, putative"
FT                   /note="Tap821d03.p1c.C.cand.57 - score = 21.90"
FT                   /note="SMART pfam:Ribosomal_L2 (PF00181) at aa 11-90,
FT                   E()=3.20e-22; pfam:Ribosomal_L2_C (PF03947) at aa 96-231,
FT                   E()=6.70e-64"
FT                   /db_xref="EnsemblGenomes-Gn:TA17025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73046"
FT                   /db_xref="GOA:Q4UIP3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP3"
FT                   /protein_id="CAI73046.1"
FT                   /translation="MGRVIRSQRKGRGSVFRAHTHKRKGAVKLRRLDYAETHGYIRGVV
FT                   KDIVHDPGRGAPLAKVVFRNAYKYGLDRELFVAVEGLYTGQFVYFGSNASLAVGNCLPL
FT                   GKMPEGTVVSCLEEKKGDRGRVAKTSGSYATVISHSDDGKTTRIRLPSGTRKTVSSAAR
FT                   GIVGVVAGGGRIDKPLLKAGVSYHKYKAKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHP
FT                   STISRLAPPGQKVGLIAARRTGLLRGSKKKKFAKES"
FT   CDS_pept        join(383818..384053,384147..384251,384282..384552,
FT                   384615..385323,385367..385542,385625..386213,
FT                   386259..386598,386675..387038)
FT                   /locus_tag="TA17020"
FT                   /product="iron-responsive element binding
FT                   protein/aconitase, putative"
FT                   /EC_number="4.2.1.3"
FT                   /note="Tap821d03.p1c.C.cand.58 - score = 80.20"
FT                   /note="SMART pfam:aconitase (PF00330) at aa 79-586,
FT                   E()=2.90e-210; pfam:Aconitase_C (PF00694) at aa 716-898,
FT                   E()=1.30e-62"
FT                   /db_xref="EnsemblGenomes-Gn:TA17020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73047"
FT                   /db_xref="GOA:Q4UIP2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP2"
FT                   /protein_id="CAI73047.1"
FT                   /translation="MLVSFGEKLGLKSGHSVLRQMKNFSSSRPNPFEKVKKTLAGTNKK
FT                   YFSLRDLKDPRLFELPFSIRVLLEAAVRNCDEFSTTSNDVEKILGWAKNSLNQTEIPFI
FT                   PSRVLLQDFTGVPTIVDLAAMRDFVAKSGKDPTRINPLVPVDLVIDHSVQVDFSRDSKA
FT                   LALNQETEMNRNSERFRFLKWGAQTFKNTLIVPPGSGIVHQVNLEFLARCLFDKNDVLY
FT                   PDSVVGTDSHTTMINGLGVVGWGVGGIEAEATMLGQPISMLLPQVVGFELVGKPSENVF
FT                   STDVVLAVTSLLRSGAGVVGKFVEFFGEGVKYLSLADRATIANMAPEYGATVGFFPIDQ
FT                   LTLDYLLQTGRPNEKVDLLERYSKENLLHTSTSEAGSIKYSTVVRLDLSTLTPSIAGPK
FT                   RPQDNIPLHLVKTKYSELLTSKDTKGYGLDTLSNKVKFTYKGNEYELDNGSVVIASITS
FT                   CTNTSNPSVMLAAGLLAKNAVEHGLSVKPYIKTSLSPGSKTVTRYLELSGLIGYLEKLG
FT                   FYIAGYGCMTCIGNSGELDPEVTEAILNNKLVVSSVLSGNRNFEGRVHPHTRANFLASP
FT                   PLVVAFALAGNVNFDLMSEPLGVSSKTGKPVFLNDLLPSKEEVSSLEAQFVKASLFNEV
FT                   YHNITEGSDSWRKLNSPKSELYPWEELSTYIQHPPYFKGMHLDKLNEVKPIKDARVLLL
FT                   LGDSITTDHISPAGNIAKNSPAARFLMENGVEQKDFNSYGSRRGNDKVMSRGTFANIRI
FT                   NNLLCPGQGPNTVHFPTNKLMSVYDASELYQKENTPLVVVAGKEYGTGSSRDWAAKGPL
FT                   LLGVKAILAESFERIHRTNLVGCGILPLQFLDGQNATTLNLSGNLHFSFQNLTGTEKFT
FT                   VQLGNDVEPGSLVRVTTDTGLSFDTKCRIDTQIEVFLPLIIFIFRVSTTNTVEYYNMF"
FT   CDS_pept        complement(387115..388746)
FT                   /locus_tag="TA17015"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.cand.44 - score = 21.90"
FT                   /note="SMART 9 transmembrane domains at aa 30-52, 143-165,
FT                   175-197, 239-261, 291-313, 326-344, 395-417, 438-460 and
FT                   470-492"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA17015 by TMHMM2.0 at aa 30-52, 143-165, 175-197, 239-261,
FT                   291-313, 326-344, 395-417, 438-460 and 470-492"
FT                   /db_xref="EnsemblGenomes-Gn:TA17015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73048"
FT                   /db_xref="GOA:Q4UIP1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP1"
FT                   /protein_id="CAI73048.1"
FT                   /translation="MSAPAETEQGQASYCPVGCMPAEDDRGNCTFLMSAYILAGLAMML
FT                   NIRLSYSSAPYALIRFKLPENLFSVFVRRMASSLELWCLPSMLLGNIIEICLKLYYQIQ
FT                   GYTEDDNSEWGKHNGNLVLSSGNYPDKLTQPRHEKFNTIIIPSIVTQWLNFLTYVILLI
FT                   VYLVGDDQGHLTTFYWTIAISGVVFGINMTLVYASDFNYVPVYIAGENSFPAVTSAIHY
FT                   LTTLMFGNRRKWNSDFIVVCVDIVVAIIISFVAAIVWTIAYLVYVDGPTAGNLKHIFTY
FT                   KFSANPKATMISPFLMIVVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATIFPPVI
FT                   VAALRKTAKTAGHWSHYQSPMCKWGADEEDKESKWTNTGNNYNGGANHAANAQDAYFWH
FT                   AFDILIVLKITLAVIFIYSLHYRDSSLSRAIVNQPKMSTALTIVFYMCHECLLALGFPG
FT                   LVGANGGGDMVLIPQYIGALFMIFLAFYSEGYIIEYKSHDPAHWPTDGMTWWNAFSYRC
FT                   KNSIEITNKIFKSGFDNYSGNFVKII"
FT   misc_feature    complement(join(387271..387339,387367..387435,
FT                   387496..387564,387715..387771,387808..387876,
FT                   387964..388032,388156..388224,388252..388320,
FT                   388591..388659))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA17015 by TMHMM2.0 at aa 30-52, 143-165, 175-197, 239-261,
FT                   291-313, 326-344, 395-417, 438-460 and 470-492"
FT   CDS_pept        complement(join(388937..389257,389319..389472,
FT                   389541..389619,389683..390267,390321..390387))
FT                   /locus_tag="TA17010"
FT                   /product="patatin-family phospholipase, putative"
FT                   /note="Tap821d03.p1c.cand.43 - score = 87.19"
FT                   /note="SMART pfam:Patatin (PF01734) at aa 78-279,
FT                   E()=2.80e-05"
FT                   /db_xref="EnsemblGenomes-Gn:TA17010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73049"
FT                   /db_xref="GOA:Q4UIP0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIP0"
FT                   /protein_id="CAI73049.1"
FT                   /translation="MILIYSNSDRQLLEFTLTPSTFDSKPKVAYKLFYSGPLLSVQFPL
FT                   KFKRRYYRLNYLTIYNYECNKYLYNKLISLRVLSLDNSENLGTSVIGSLYLLEKKLSEL
FT                   KKKKINLADYFDYICGTGSGALIALCLLKGYSMKDLRVKWNQIVSSLFKWAHSLPSGII
FT                   FDYYYIEEFKKSFINILGTDFMCSKSYPHCMVTCSNVRSNPYGMFLFRNYGNSKFGSLD
FT                   GTSYAPLWLVGWSSCALPTYVRGPSNSHLTNIGYNMINKVHMVDGSVVSSSPSLVSLQE
FT                   LTNIYNINLRTLVKDNMDLFLSIGTSKSENDSGSINSSTWQILLNSKNLMYNTQLQHMH
FT                   LTSLFEEYENKYHRIQLPIYPGCKHGKTSKEDVDAVLTSTIQYISRHDNNRIEQIVKIL
FT                   NQ"
FT   CDS_pept        complement(390530..392536)
FT                   /locus_tag="TA17005"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.43 - score = 87.19"
FT                   /db_xref="EnsemblGenomes-Gn:TA17005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73050"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN9"
FT                   /protein_id="CAI73050.1"
FT                   /translation="MNHKSEVLVKDHKHDDHLIKDSSKSSDRQSDTLDYDNKLMLIEKK
FT                   ENIKMIGLKDKENEDRLSDSKESDDDFLECESDYEFTNESDNQIFNNIYGSNLCKDSEI
FT                   LDEKISNLNAAKKLNVKNFMKSKSYHCLPSYYNGFGDGGQFGYIPKSYVPLDPELFSHA
FT                   NREGGYSSGFQGQFIDPELVQNRTIPSKSFLSRQKRKGSQDMSNVISQDQNENSASDSI
FT                   YEDASDIPSEVNSELESRIIEFHEAKKSLSTSENGEINEDPTKQDSMSNMVYEPEDEID
FT                   ELFDRVINCEYDPDFTFLPVALDPYVKISNKLIAKRTKRYGRQMLNSKGTKKSPGGSSA
FT                   ASSASSCSGECGNISTDHKDVDSKLKIKPIDNGSSLSQYVQDEPLAAKDGLILDESRGK
FT                   QKHKPVDNERERLKAKEIDEYRQVLRLDTSIEPRIKFHDVQEYDSTDSEVEKQKEFARV
FT                   LFEATKDDEREQYVDSDDEDLSPNIKSLKLSKKSGEEKVKSEKKSKKSKHKSDTESEDE
FT                   KVSKTDKKSDKKSSKSSKHISEVDIEKDNGKVDKSEPEKGGKVDKSEVVEKPEKGDKNE
FT                   KHKDKKPEKIKKVAWKSTDYDMIFNTLGECFSSGHIGHDTNPIVLNRKGFYTLFFRNSK
FT                   YPYDSNIDFYLFRIGFKYSLVNEPKNQPLIIGI"
FT   CDS_pept        join(392914..393320,393384..393558)
FT                   /locus_tag="TA17000"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.59 - score = 14.44"
FT                   /db_xref="EnsemblGenomes-Gn:TA17000"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73051"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN8"
FT                   /protein_id="CAI73051.1"
FT                   /translation="MVIYNSLKSFNRIAYRFNGLRNTTRPYTNSPRLFSTSRDETQQNF
FT                   CSPPFESKLFKDYVEFSVNSYKSSKDAVDSEMTNLLANHKLLLFMEGSVDAPKSLCAGN
FT                   IVKMFTLLQVLNFHTLDVLSNPPVFGFLCSKFGEPVRNILFKDGAPFAGHDELLELFRR
FT                   GKLLQALGVPKTTNKSTPKEFANHLPIANY"
FT   CDS_pept        complement(join(393619..393819,393852..394009,
FT                   394041..394107,394138..394214,394280..394422,
FT                   394455..394706,394737..395023))
FT                   /locus_tag="TA16995"
FT                   /product="porin, putative"
FT                   /note="Tap821d03.p1c.cand.42 - score = 40.81"
FT                   /note="SMART pfam:Euk_porin (PF01459) at aa 101-375,
FT                   E()=8.40e-06"
FT                   /db_xref="EnsemblGenomes-Gn:TA16995"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73052"
FT                   /db_xref="GOA:Q4UIN7"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="InterPro:IPR037930"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN7"
FT                   /protein_id="CAI73052.1"
FT                   /translation="MSWIRSFGASSSLFNSTFKGITFNDQREPSSENVFKTYFQNFKEY
FT                   KFKNTLKSKALDAKSINGFVSERLLPLLSVAHCSEQKQESKEEQQHQQQSPFDLLVYEN
FT                   LAREYKNVITQDNYDGFRLEADRQLTKNLQASHSLYLGTLLKDVGYIYQIGANYASDDG
FT                   KKFLMFKVGLDGNIALKAFAKLGDRLELKAVTNSRLKIDNQSTFEVGADYLSDYWTATL
FT                   KCCWQGTFIWNICYTHQILPCFTVGSEVTYIDANGASIGSLSARYVRGDNIFTCQLTRQ
FT                   PDFKRMDFSKKEINCARVQYTRKVNDRLSLATELELSPSIKESALRVGWEYLFRHARVQ
FT                   GNIDSCGRIAMQTQDYNGFGVSGCIDYWNNIYRFGFMMHLLPQPEQNQETPQPT"
FT   CDS_pept        complement(join(395568..395833,395863..396590,
FT                   396639..396728,396746..397043,397073..397160,
FT                   397191..397359,397389..397539,397573..397975))
FT                   /locus_tag="TA16990"
FT                   /product="GTP-binding protein, LepA subfamily, putative"
FT                   /note="Tap821d03.p1c.cand.41 - score = 65.19"
FT                   /note="SMART pfam:GTP_EFTU (PF00009) at aa 106-289,
FT                   E()=2.70e-52; pfam:ras (PF00071) at aa 120-287, E()=9.50e-
FT                   03; pfam:ParA (PF00991) at aa 140-242, E()=7.80e-02;
FT                   pfam:GTP_EFTU_D2 (PF03144) at aa 319-394, E()=1.40e-02;
FT                   pfam:EFG_C (PF00679) at aa 520-621, E()=1.30e-14"
FT                   /db_xref="EnsemblGenomes-Gn:TA16990"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73053"
FT                   /db_xref="GOA:Q4UIN6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UIN6"
FT                   /protein_id="CAI73053.1"
FT                   /translation="MLYKYLFIYIVTKISLSSSLYHNFCTINNTNGSNFNVFDTNNGRF
FT                   LNKNNRIRNILNKNINKKSSFSFINGNSLKNFKNDHKYHDFTKFTKIPEFLEEDNEPIV
FT                   SELIRNFCIIAHVDHGKSTLADRFLEFTKSVPPERLKEQYLDNMELERERGITIKLQSA
FT                   RIKYNSILDGKTYTLNLIDTPGHIDFNHEARRSISACEGAILVVDGTKGIEAQTVTTAN
FT                   IAIEKGLKIIPVVNKIDLEHCDFKSTAESLKKFFGFKESDILKASAKKGIGIEDILEAV
FT                   VVSIPPPKVDLEKPFRALVFDSFYDPYRGAICYIRVCCVFRLYFQVFEGSTKIGDEITL
FT                   MNADITSKVTGLGIMLPEMKQTHSLQLVNSSGQVGWITAGIKKTNEIHVGDTISLKSYV
FT                   KKNLVEPINKFENSKPTVFAGIYPCIGGDFDKLQTALEKLKLNDHSFQFERSDSSMVGM
FT                   GFKCGFNGLLHLDITVERLEREFDTQVIVTSPSVPYRCTLRDKSVVTVDDASKWPDESQ
FT                   IKSSEEPWTDVTLRVPEEYFLSFINIILSSVGSVMSMLSKMRGRFKEKNKVKDTNMVVM
FT                   NYDLPLSEILSDFFNKLKSVTNGYGSYDYEGTFYEPIELCKLKILLNGTEAKGLAVVTP
FT                   RNRAYDRGKLIVETLVNLIPSRQFKVPVQAVIGKRVISSSNIPAVKKNVIEKCSGGDPS
FT                   RKKKLLENQARVLLVLINDVIGKETNGSGRMCNNPF"
FT   CDS_pept        join(398805..398925,398958..399290,399320..399454,
FT                   399486..399641,399672..400019,400051..400371,
FT                   400402..401594,401628..402429,402459..402567,
FT                   402603..405467,405506..406628)
FT                   /locus_tag="TA16985"
FT                   /product="cysteine repeat modular protein 2 homologue,
FT                   putative"
FT                   /note="Tap821d03.p1c.C.cand.61 - score = 156.85"
FT                   /note="SMART pfam:TNFR_c6 (PF00020) at aa 1058-1092,
FT                   E()=2.80e-02; 3 EGF (SM00181) domains at aa 1489-1538,
FT                   E()=4.83e+01; aa 1612-1682, E()=4.74e+01; aa 1720-1760,
FT                   E()=4.83e+01; 8 transmembrane domains at aa 1770-1792,
FT                   1799-1821, 1877-1899, 2023-2045, 2073-2095, 2102-2121,
FT                   2141-2160 and 2167-2189"
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA16985 by TMHMM2.0 at aa 1770-1792, 1799-1821, 1877-1899,
FT                   2023-2045, 2073-2095, 2102-2121, 2141-2160 and 2167-2189"
FT                   /db_xref="EnsemblGenomes-Gn:TA16985"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73054"
FT                   /db_xref="GOA:Q4UIN5"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN5"
FT                   /protein_id="CAI73054.1"
FT                   /translation="MYKYIYTKCVCVEWKTKRDYFTEEILKRFKKAEQIRFKNRNQIYT
FT                   KSLKQYLADLNCKSKNPGSRARCNETTTDCKCIKKTFSANSLANSCIYEDDLINCIGSS
FT                   YKDREFIIERKPKSKDIMICPSDPKWKIHDEIIKEDKDQNSLDQGLYDKFLKEKTRLSE
FT                   STIEKVLKTFGKNPINDVFSDLYYYNTRRRETIENDEEYKHKDQTDYCDYFNIIQEVHG
FT                   LNFSRGKCPGTFKRCDPKEPYSHCKFVKKRYYKTKGEEFYLEFEDFSLSSIFSVYLEKE
FT                   DNKCGQSQTNSKNEEEKNMFLKVKIYNEIDFPPRRFFNLGPFGPFDTEGKMKVCACSNY
FT                   TKDKIYSCVKLEDYDLEIGELIIRDKIDFKNEEIYTLSDVEIKLENQKAFMIESKMING
FT                   DCTNISEKYKIDWKNSIVEEMPNLSEHILYNKNNRIETKTVLTPYQGGKFNVCLINFEN
FT                   AEIITQPVIYIVKGVKNNVNVVAYCNSENKIVVQPILVELIKMEKTDIESIYISDSKDR
FT                   CIYNGLGSYKGSEYEYNSPNKVEGTKFLLYTGFKFVVEKDFDVKVICAKYKNKSKDSGV
FT                   GYVYKKRYVDFNQENFDKVLGLDGIQHDSMYNYEVKNKDLFKTWIEKFKGTSTQESPIL
FT                   KDGDLDSLFDKYFDVIQIRTFNQMNLVTLWITNKDEILMFPVYKLTLESPSKIRMAVIS
FT                   GKIYWYVLMREKRLIVKYDFTEIKDKYVIEETTNYNIHTLHNPSDFELLQNGERVRIVL
FT                   IDSYVSCILLLNESLTKVNSLDKNNKDAGIVNPTSLSCTKTGEQSSVFNCFVTETTTDE
FT                   IVWFSVNIENDELKYVSRYTSGTQVNDVDPILGSIVSLETLNYSDANHSVILLFIIREN
FT                   YKYGAILSADSKENQINFLSTINKIPGYWNLKSINVAYNGPVQYKLFLTRESYINDPII
FT                   IGSEIEDIFNKMRDRSNVKWAITWIPLMELISLPELNYDIKGHLTINEMLTVMPQFKDN
FT                   ELLNKRIYFYIQAYIDSKDYVDSIININSVTGELKINVNKVKFKVLKFNIISKILVIEK
FT                   KSEISIKFSCLDGEYYDNGSCSKCPKGSYNSIELELKSDTWLECIQCPKDTVTEAVGSK
FT                   SIDYCTCDKGYSFFVDPNTRKEVCMPCPPGTYKSTLGSHPCIGSCYKNSISKVVGSTSE
FT                   DERKCECLPGFYWKDDENTKECLECEKGNYCTGGFKSKAIKCPENTSSNSRSTSINDCK
FT                   CKEGYEPIWDDEKVSIIEEPESESKNTLEFKCFPCKKNMYKDTKSNEKCKQCPKYSNTL
FT                   ETGSTKLTDCNICDEGFFETKIENEPCRMCKKDSYCVGSLYEDNKGRRISGKNASCPEH
FT                   SITIKPYNKNVSMLNCLCVEGFVPVTSGSSVKCIPAPKDHYKDVIGNVPAVPCPHGSLT
FT                   MSNGATSKDACVCDKGTYFDIVSKHCAICPAGKYCLGGKDDKMNDRQPMECSDSNAQTK
FT                   APGASSSSECACKEGYYMDVDAQNTCKECPENHYKSYISNDMCSRCDENSSTTGKKGAT
FT                   SKEQCVCDPGYYFDRGCVSCNFNDKYCPGGVIEIKDDVGRSRVVTRSPIPCPPNTEIPP
FT                   GVDNASSINFCKCTKGYYFVSEDLENNKKVCNACAPGTYKSSVMDSSCNGLCTQNATSF
FT                   PGAESSNHCFCLMGYFYLEGGICSKCMEGAKCEGGLINYKMKTLKNFVVNIDDHVKPVA
FT                   VEGYFLDKINPKLRKPDDWKFIKCPINGSCLGNDKCSDTMEHYLCSECKKGYTNNFVKG
FT                   ALCQKCPRMRPNISITILYYFGLLLINIVMARLNISSGYNRRSIHSVVIKIALNFGICT
FT                   SVVNVVNFSDLKLPVGLRKMINKWVKVFDSDDAVYYTSIDCVIRSLFNLEHSDSFFYTM
FT                   LYMACFPLILLFIVTLMMWIIMVLFKLVKYNDIRRKLALLQQFKAKYEGDNQDSLIEQY
FT                   RNERLLMILRYIPLPNETSWDRFKNFLEDMIPIYVTVLFSVHGKITSRLLSLLDCTYID
FT                   LGRSFPGKYVLRPAMSIRCSINPSEGYLRYLILGLCGLLVWGLGIPFLSFMALFVNRNN
FT                   LYAPSIRMKYGFLHNGFRQDYWYWETVVFARKCLVLVIGSIVIVPSENYSGSRIWMALV
FT                   VAVTFLILQLIYKPFDERDYFVLGRLENHSMITWTFTLILVSFIIEANFTPSYNMSLLS
FT                   FIVFINFLFLFELIFQLFVAYCHNFRIQNTSPKSFFTRFFYHFLTKISNKIKNAEPIIY
FT                   FDPSTCTTNLRSSKKFINKSIFDNIDVISYNEKDYFSYVMNEIICFANIRMKLDVIPCD
FT                   FPEYITRLTFAVYFNESSKQKMNNLVKSFADGNIDKLVNISMINDNYNNQHKNNKKTYI
FT                   DDNIVVDPYLMFDNELLSKGMPLSDFYVALSIIKLKDLRSIANTYVYFREYKNNEKIFN
FT                   LGRESKKLNDLDEIAKKLNEPDSCENIEELFCSEAELEELYKKIEEVEEKIRMFKKNPL
FT                   NALKIYYSDEYSHIESGDFESDLIAFGFRKKSGDPRI"
FT   misc_feature    join(404392..404460,404479..404547,404713..404781,
FT                   405151..405219,405301..405369,405388..405447,
FT                   405543..405602,405621..405689)
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA16985 by TMHMM2.0 at aa 1770-1792, 1799-1821, 1877-1899,
FT                   2023-2045, 2073-2095, 2102-2121, 2141-2160 and 2167-2189"
FT   CDS_pept        complement(join(406644..407868,407907..413262,
FT                   413294..413686,413716..414126,414158..414400,
FT                   414437..414679,414710..414982,415015..415165,
FT                   415197..415238,415270..415329))
FT                   /locus_tag="TA16980"
FT                   /product="cysteine repeat modular protein 2 homologue,
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.40 - score = 150.90"
FT                   /note="SMART KR (SM00130) at aa 269-336, E()=2.14e-02; 5
FT                   EGF (SM00181) domains, at aa 1309-1368, E()=4.37e+01; 1369-
FT                   1426, E()=7.23e+01; 17521801, E()=4.83e+01; 1875-1925,
FT                   E()=4.74e+01; 1983-2023, E()=4.83e+01; ZnF_NFX (SM00438) at
FT                   aa 1540-1579, E()=0.00e+00; 8 transmembrane domains at aa
FT                   2033-2055, 2062-2084, 2140-2162, 2286-2308, 2336-2358,
FT                   2363-2385, 2405-2422 and 2429-2451"
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA16980 by TMHMM2.0 at aa 2033-2055, 2062-2084, 2140-2162,
FT                   2286-2308, 2336-2358, 2363-2385, 2405-2422 and 2429-2451"
FT                   /db_xref="EnsemblGenomes-Gn:TA16980"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73055"
FT                   /db_xref="GOA:Q4UIN4"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR038178"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN4"
FT                   /protein_id="CAI73055.1"
FT                   /translation="MIKIVSVIAFVLLYNNKYTEVDSKAIKFNTSNMDISEEDLAAYSV
FT                   TRAAVENKLMKTREFKFKVKTWLKNDKRIFGLKSNTSGFGDFYYSRVQIWANNYCNMKS
FT                   NVVSNSARFKNEKGNLHFYCVENIYLDYSIVDHSCISNCGELVPCNGVVKSFTNREPIN
FT                   MKLVNSQIKKYCKISQIQESLDELCERENYSAIVDQNFNVKCYSSNDINYDQNGLCLED
FT                   CRKFVSCKRVAMNPVKGISINQAKIDWNALTNGCPCKEGYHDDYETADKYITYEGCQNM
FT                   TNDNSVCLNWDEFLRKSHSLYDKRFVFPDNYCREVHGKKGIWCLTDMDKLSKCTPKEIP
FT                   KISIQPGTLFDIWITPYIPKYRLRIIFIDNSNICGDLGMIATENIVQSYELEVFNLTND
FT                   KELESDENDIFEYSDSSFSEASYVFKGYLALEHLESSSKICACMYSSYYEYANGMKHPC
FT                   SSNINYTITIGNLIVEGTSMGKIEDMEDNNISLINQFQQRHAVASLVNESDSLVCKRSK
FT                   FLKREICMKSINKLLDIEKNSRTEKICVPEINRRSNLKYNVKSILRKEIGLNETIKFEV
FT                   EKSGEYSLIYENTNDPDKNALIIHRYNIMGYYSNKIFTLITDMGSENKFREQSLFFESW
FT                   KVKFPPTAVVISKYDKNSKLCKNPFAYSINIFPVSDSTIDMSLTTWRASDFEITKTLSL
FT                   MESKVERFEVCVFTQDLEFQSLGFGIFTEFVNHELSEIYPESQLQIPQNIFNYKIYDKW
FT                   DMMRLKTYINDDKTFKYDSSSSNAKFERDYTGFIMEMMRSNYKGDFDNIDFDGFKLGNH
FT                   LEYPAIMSFWSYTDEDLIRIWVFRPNRLSPTYIGKINVKSPLAFGTYISVNKLIGIVLT
FT                   EGEPGIMMYEIEIDKNSSKHNVFNMNFIKSSCDESNNSCTKLLSPVDMKIITYSFDCTN
FT                   KHSILVTDVGLNCIILYDSSLNEVSKICRDSGSVGIFEPTYISCSNPSNEVGPCINTLD
FT                   GFKYENDGESSFIHCFITQPHEGNLLWVQVDVLHNKLTLLDSYTGGHMSDSISGGHRSM
FT                   KRFITPLLMNPISVETLTYGKTILIYVVESENPAMSLLTLDLDKEIKKITYYGRTELNM
FT                   ISYGNFVHISKLEMSSESNDQMDDQDYVMLFRLGPRENYYNGAGSSSINIININDTISI
FT                   NNFEYNTPEWIVIGDELSFKPKIDSGNKQNLMRYELDILNDTDHNLPEQESDDIKNLKS
FT                   IKRNYDWNGNPSHKNVIKINSNTGKITININYIYKLILSIRVTAFGFIESKSIYLNFKV
FT                   ACKDGYFFTENDINDPNNESNGCKMCQIGEFNSLAIIKSFILNWKKCTKCPGREITISE
FT                   GSTSSTQCLCAPGYEYVSDGINNCEPCEAGKWKSSAGLQKCIGNGCYNNSFSNKIGSIS
FT                   EEDRECACYEGYYFKNIGGVKECVPCEEGYFCPGGIHGKKNKCPKNTTTVINLNSNGLF
FT                   VKLPLSIDECMCKKGYEIVDENRLIDHYSPEYELKLRIQEEIKLLNVDTQNLDINKLIC
FT                   IPCGYRRYKYVEGNTKCTDCPEHTFSESMSPTSIRDCHLCDKGYYETEDPQNPCEECSE
FT                   NHYCVGSDPINENVKMYSKKKIKCEEHSITIKPYNKNVSMLNCLCVEGFVPVTSGSSVK
FT                   CIPAPKDHYKDVIGNVPAVPCPHGSLTMSNGATSKDACVCDKGTYFDIVSKHCAICPAG
FT                   KYCLGGKDDKMNDRQPMECSDSNAQTKAPGASSSSECACKEGYYMDVDAQNTCKECPEN
FT                   HYKSYISNDMCSRCDENSSTTGKKGATSKEQCVCDPGYYFDRGCVSCNFNDKYCPGGVI
FT                   EIKDDVGRSRVVTRSPIPCPPNTEIPPGVDNASSINFCKCTKGYYFVSEDLENNKKVCN
FT                   ACAPGTYKSSVMDSSCNGLCTQNATSFPGAESSNHCFCLMGYFYLEGGICSKCMEGAKC
FT                   EGGLINYKMKTLKNFVVNIDDHVKPVAVEGYFLDKINPKLRKPDDWKFIKCPINGSCLG
FT                   NDKCSDTMEHYLCSECKKGYTNNFVKGALCQKCPRMRPNISITILYYFGLLLINIVMAR
FT                   LNISSGYNRRSIHSVVIKIALNFGICTSVVNVVNFSDLKLPVGLRKMINKWVKVFDSDD
FT                   AVYYTSIDCVIRSLFNLEHSDSFFYTMLYMACFPLILLFIVTLMMWIIMVLFKLVKYND
FT                   IRRKLALLQQFKAKYEGDNQDSLIEQYRNERLLMILRYIPLPNETSWDRFKNFLEDMIP
FT                   IYVTVLFSVHGKITSRLLSLLDCTYIDLGRSFPGKYVLRPAMSIRCSINPSEGYLRYLI
FT                   LGLCGLLVWGLGIPFLSFMALFVNRNNLYAPSIRMKYGFLHNGFRQDYWYWETVVFARK
FT                   CLVLVIGSIVIVPSENYSGSRIWMALVVAVTFLILQLIYKPFDERDYFVLGRLENHSMI
FT                   TWTFTLILVSFIIEANFTPSLSLILFFIILFINFLFILELLFYFIIFISSHIFYLFSVF
FT                   FPRFFSRNIKISHPLSYKEPIVFYDKQDSHILLNRQIKPFGSLISFQNLSSVYSNYFTT
FT                   TLSHIFNLTACYLNLDVIPSLFIDFLIRYSISIGNIENKVIEKNFSTKSDNEISDLIEG
FT                   VTSEKYENKNKYLNIDKYKKEHSSDTFITEIENILEGYGIESDEINGIINSLYDESYLK
FT                   NNLYLSDFYQSIENLYNLDKTTLCLLYELFKHYKTYFEDQINKKIDLQINNLMNQKTEF
FT                   ENSLKDRESIYHVTQEIGKINAEIEDLKIEREVKRGRLLKLKESGNIYKNEYDKVIGRK
FT                   SKYDNERNLFCKQLIENVGFKPINREDTISEVEHKDYQE"
FT   misc_feature    complement(join(407688..407756,407775..407828,
FT                   407924..407992,408005..408073,408155..408223,
FT                   408593..408661,408827..408895,408914..408982))
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA16980 by TMHMM2.0 at aa 2033-2055, 2062-2084, 2140-2162,
FT                   2286-2308, 2336-2358, 2363-2385, 2405-2422 and 2429-2451"
FT   CDS_pept        complement(join(415554..415692,415727..416152,
FT                   416183..416249,416334..416349))
FT                   /locus_tag="TA16975"
FT                   /product="ATP-dependent Clp-like protease, putative"
FT                   /note="Tap821d03.p1c.cand.39 - score = 28.44"
FT                   /note="SMART pfam:CLP_protease (PF00574) at aa 15-208,
FT                   E()=1.20e-69"
FT                   /db_xref="EnsemblGenomes-Gn:TA16975"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73056"
FT                   /db_xref="GOA:Q4UIN3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN3"
FT                   /protein_id="CAI73056.1"
FT                   /translation="MFIITRIPKVSYKHPGSNQVEWEDIHNRLFRERILFVSQPLDDEY
FT                   VNQLIAAILCLDNETSEKPITLYINSPGGNMHAGLSLYDTLEVKTNKDKFNQHVRSEIV
FT                   TINVGLCASTATLLLGSGTPGKRYGLQHSRVLLLQPSGLAEGTAEQIKIEAQHILEIKK
FT                   NLIEIYSNITKQPYEKIASDIERDNFMSSEEYKSYGLIDEIITNSETKLIQK"
FT   CDS_pept        complement(join(416797..416912,416951..417047,
FT                   417079..417156))
FT                   /locus_tag="TA16970"
FT                   /product="ubiquitin-related protein, putative"
FT                   /note="Tap821d03.p1c.cand.39 - score = 28.44"
FT                   /note="SMART UBQ (SM00213) at aa 19-30, E()=3.50e-09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16970"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73057"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN2"
FT                   /protein_id="CAI73057.1"
FT                   /translation="MDENTVKENNQPEPENEHIQLKVRSPDGSEVYFKIKKKTKLEKLM
FT                   NTYCSRLGQSPEAVRFLFDGDRIKGDATPEELGIENGDIIDAMVQQTGGTI"
FT   CDS_pept        complement(417432..422543)
FT                   /locus_tag="TA16965"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.38 - score = 99.86"
FT                   /db_xref="EnsemblGenomes-Gn:TA16965"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73058"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN1"
FT                   /protein_id="CAI73058.1"
FT                   /translation="MFELISMSNLDSGAHSSHGNFNLNSNSIGISCENENLSKCVTPTL
FT                   KSRKRSSPEDKPLSKSENFESFDNPISDELMDSVKNFSNEVEDKLNSIEEKGVIHKNPS
FT                   TENHSVKYLKTPNSRVKSTNSATTGDMCCETRKISEQTPKPSGVHRLSMLDLLMNNDNC
FT                   LDETSDNVSEVYSSLTSSVNRLGTPVRSNSKDYTKKYDSFQSLSTTDIESSNAEIDRNR
FT                   SEETFSSSEPVISDDTVRTEEMVTAESGYSTDIEPVVDEFEHLIKCLRDPEYFEKLENL
FT                   PTLLFLSELEFDKLLKLEDILVPILKQLQEASNFFYKLYVMNVALQIMEPKLNIKTFYE
FT                   NITSLIKVACGPNTPFNPENIENGGLEQMFIQLLNSTSSLLVHLGSDELDVLFKLLFPF
FT                   FYNFYPIDMIIVAAFGVCKEIVKRLHLDQVKSALKYITSNFIFFNTRLYNTNTPTSNDS
FT                   SCISKSTSTENSAKVRKEDDSVKIYTRDRDTGNTNNFYYVEIIVILFEQMFINTSRIDE
FT                   NNIGEGIGDEKESYGIFKNNFRDFVNDTFYMENVTFRSRKVFFQILIQKLENPKHPFVS
FT                   FMVYELLSMLIAHINGNYLNGKRPNEKEDVKEIKGEKNTKKLQSLRFLLIISSHLFELY
FT                   NRVLRIPFVNRNKTKYLSDLDLSKNMKEITFENIKENIMGYLNYISIKDATSELNNLGT
FT                   CIFYTFLKDYCYINNVKEMQQLLLFLKIFKYLGVNNANFSGVSGSNKKINYIFNNINYS
FT                   HVFNYPYLSEAKYHNSPAHRIDLLILDLYVYNIVRELYDSILDTVINLIHTINENTTLR
FT                   LCIDFIYEVVSKNYDYLLDKKIKTMLLISISDYNVYVRQQVINIYTNFLVHFYNKKGVS
FT                   GKNARDDIEFEDELMRYISEILIDKMLLTTKDLNYKIRLGSLKFLHMFLSLVQIERYFD
FT                   VVSALAGRSLDSYREHQQVKRALYNLLCSAFFIYSIETLNSDSFSSIKHTYENKSNSQV
FT                   SPEEQFLKRSLDHQKKMFLERFVRVILYKMESYKGKLNPILIMFNYYQSNTEVILDPIG
FT                   YYGGSRNSNMTRKDVVGNNTNLTDPETIVNNWLENLLDLFLMKRSTGARYFELTEALSV
FT                   FKLFGEVYPKLFVKHLVYFIPYLKLVDGILLDVEQVNLIIAINNLIIIVYRYLKNSKPA
FT                   TKGDAVKDEDEILCELNNIANNVVGLVNYNSPILVRSIIQLLTYNNQEYLMKIYETSFK
FT                   YLNNIKKILSSFLNSNLGKDKLELRSSVLNHKMLGNLNVSIYSWQLACISEFNDTEFKV
FT                   FKLFIEIFKLYNGLDIESISGLLIQCCCRYMSNLNNLYKVDHKELKSVLSEIYEYYQTK
FT                   PDKYNNLILILNRMLNTYHALSSSSDSETPDSENIIDQDNKNQKEKRDLINLMYIMIQK
FT                   YTNAFMSLITNYYDNEGKAGITDLENHLYFNKEENQEKLFGEVLYDKYDKVVYMEIIEI
FT                   IIVNRLTNVQELLPFVFAQLISPDLHVQRVAENNLKIIIKQDINLFLGKMNTCFETLFK
FT                   SVVHQFFRNSFVLGVAGEFIHSALQGVFRIYLELLQAKRSNTKMFITSLLMQTKTIHTI
FT                   EFKDWIEREIKLGNRNDWKLLNSMKVYEGFINKLKELVDKIKVEKGEERNKLFLEYFQY
FT                   LYANLICVLLDGLTFKNKKDSAFAITKIRDVVNDNTHILTSDDKITKFVNTRLKRISNR
FT                   IKNTYK"
FT   CDS_pept        join(422554..422860,422900..423186,423221..423307,
FT                   423392..423611,423661..423797,423887..424027)
FT                   /locus_tag="TA16960"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.62 - score = 34.15"
FT                   /db_xref="EnsemblGenomes-Gn:TA16960"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73059"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIN0"
FT                   /protein_id="CAI73059.1"
FT                   /translation="MSYTYPIYHMSKLRKRLGKFNVFGINFLYTENMNYKYRRRSLSRD
FT                   SYRRYSSDDLSVSRSRSLRRYRRSVSRSKRSYSKPRRRFSRDRRSYSSGSTDGRHHRER
FT                   RRHRSPSAEKTNTEPVSVNGNEAETPKVAQRKRIRNMSWKLPNANDFPDKNTNFNAQRR
FT                   TRSNKFNFNNRFDHSLSKTSLENFRYESDEFKVQKEKMHQALKEKEDSSREAKKLLSDY
FT                   TKELNTLVGNLSKLPKDSEEYKESSEKIQSLKKAMKDLISQERQVTKSKPMKPAFDKNI
FT                   SLDNRETKIFFPNLPDCAKGKGNLAKWISENSKFLLPQKIAMLASHGTTYEAAVIEYKT
FT                   HDVAQRVLNSCKLHGITVTWMHASEISSETTENNKGSESATEVIQPDSLQII"
FT   CDS_pept        424207..424518
FT                   /locus_tag="TA16955"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.63 - score = 11.92"
FT                   /db_xref="EnsemblGenomes-Gn:TA16955"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73060"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM9"
FT                   /protein_id="CAI73060.1"
FT                   /translation="MSSNLRKLRFMQKSDEKPQTTTEKTVNTLIGDKSIWIREGFEEIH
FT                   KFHDEKADNKQKYPKIRYMTRFEKKSILIFRRSYNGANPSTEGFMSKLKKKTTTQTNK"
FT   CDS_pept        complement(join(424537..424714,424768..426314))
FT                   /locus_tag="TA16950"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.37 - score = 22.94"
FT                   /db_xref="EnsemblGenomes-Gn:TA16950"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73061"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM8"
FT                   /protein_id="CAI73061.1"
FT                   /translation="MIQISSSFNVKYKRFLISHSIFKCVSSNGRFCFNTQKQRNPLFHP
FT                   QSDPINFHKSFVYHFRPYSTQNSTFNQTSTYNPIHSPAFKFSNWDNHKDDSIGPGDLYL
FT                   ENMFNFSPNEWLSLIKNSEDNSHFLTLLTHFQRYIRHLKCSDLLYIIEKCVKFGVRDNN
FT                   EGIDVCYVLLCEILYRFLHENNRILRIKDISRLTKVLLKIKFNKESPESSTVPVCSMNF
FT                   EYNKEVSVCENCKLRYGDLLNLNGSDLSNILMVVLGKSLLLQSKDMRKLHENSVVPYLV
FT                   LVGNRNSVLCSHLVRRISSVYSKAFLLSNSIHNISILLHTIKRTKTRAFALLKMIVNRL
FT                   STKGEIESLLDKESNLHVKLISISQIIQFCINCHYSYSQFNLKLDTLIYSILKYVYNIF
FT                   SGENMEEIIKFPNFVSQLNLLRKSINLERVHLKKLIEGSEISCFLDSLEHIKPTFAPNE
FT                   FKTSNIHSQVDTILKSFNYETLLEHYVCPYIVDIFVPSKNVIIEVDGPYHYSTTINPRI
FT                   NKILKREVDNYRLGYTLNSKLKSRILTKSGFKFINIPFYQWPQTTNEQVYFISNLKI"
FT   CDS_pept        join(426463..426525,426556..427665)
FT                   /locus_tag="TA16945"
FT                   /product="hypothetical protein"
FT                   /note="SMART SANT (SM00213) at aa 19-30, E()=3.50e-09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16945"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73062"
FT                   /db_xref="GOA:Q4UIM7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM7"
FT                   /protein_id="CAI73062.1"
FT                   /translation="MSEKNSSTTPKITKYDDDFKTGKFTKEESDKIKKAVDDFISENYN
FT                   CPREAALKRLIRKRGNVPSPLIYIAQETLPNRHPRSVYNFFRRHILYNKTGKWTNEELF
FT                   ALLKTYFLNEESGINSWKSVTKQLKRSPEQIHDKFREIKHYISKFRSVVQNSELSEADK
FT                   ISRIGKMTKGTTKGSTKKGSKASLDVTPDFQQKLYDLVREIMSKDTNLSLENVPWARVQ
FT                   SNFPQHSITRLRIHFNMTILPKVYSTLYPGFNPTMVSRICFRWMRKLLKRPNSSNLKFL
FT                   SEVDFKSKFPQVPLMYIRYCIRRTLIRMVRKFKFQVMNQETLSESVGNLDLEVLQKIPS
FT                   DSVEGIFSRREFNLLVKFTYTDLEVKRWKKHDKEILKKIKNDILPLCKLC"
FT   CDS_pept        complement(join(427727..427987,428050..428383,
FT                   428615..428918,428993..429478,429511..429695,
FT                   429754..429980))
FT                   /locus_tag="TA16940"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA16940"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73063"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM6"
FT                   /protein_id="CAI73063.1"
FT                   /translation="MNYNEKVTQGFASVLCTDKLIFLGLLGPNSRVSIFKFQDGSFDIK
FT                   FVGFLSPLIGTVTKMFFTKDGSKLICKTNCGYIYVWDISHETINTLESLTNNPLYIDGY
FT                   IPIESRVTPVAIIEPNNSADCADVDLLYNDTLIVVEKWPELNINLYDYSKGNKLTTFSS
FT                   LLGDNFDKKKYVRSLKADSQMATLDGVKGQWVSVGTESGTLHLCFIPEFDKPMEETDKS
FT                   DFFKELDENLKTYSFNLMENVDINTLGWRFRNKTSVNLTVLCGCSDGTVRCCIINSETS
FT                   HLKLSKNVSYSYSKASISGTVNRIICVRDNKNGTPFVIGSCNIIGEIGNFEFGDLATNC
FT                   VFEGIYQRLTQEFSDDIVSFAKVQDFITDLCISPQNNFVILVSSNENVYLCNENTQVEE
FT                   RGVGRNNSLAVLRRLRIYGSRYKIEKIQKLCENFEKACWRSVRVAEESAYIRKYHFLKH
FT                   CMNVIKLYRQNKLYTPSAYEFDPTRFKLSQYILDKYDLDNAKDCLDTANHLLSQVTNVD
FT                   NLNDSTPNITKEIKENGELNRHLDVKSLIRGMDNQTLNHDIEKLKNIISKLEEKVQLID
FT                   VHGKDPHVVGYSKSQLESMIKL"
FT   CDS_pept        complement(join(430129..430416,430506..430658,
FT                   430700..430846))
FT                   /locus_tag="TA16935"
FT                   /product="nucleolar phosphoprotein (Nopp34 homologue),
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.36 - score = 48.72"
FT                   /note="SMART RRM (SM00360) at aa 14-87, E()=4.81e-26"
FT                   /db_xref="EnsemblGenomes-Gn:TA16935"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73064"
FT                   /db_xref="GOA:Q4UIM5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM5"
FT                   /protein_id="CAI73064.1"
FT                   /translation="MERKVSYKKNENNVIYVGNLPKQLSEEQLKTYFNQFGDVIKIRLM
FT                   KSKKTNGSRGYAFVQFEDHEIAKIAAETMDKYIIDGKSLKVHVKEGDQIVKHLFKRGKK
FT                   ISVKKNKVKLINNKLELMSRNFETKLENILDSIKNGNKHDSHEEIKSFIDKLSAKVEKL
FT                   KDKQKRFDTDLYNGQIEVYSKALITLKNHINS"
FT   CDS_pept        complement(430953..432266)
FT                   /locus_tag="TA16930"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.35 - score = 32.38"
FT                   /note="SMART pfam:AAR2 (PF05282) at aa 1-424, E()=1.10e-04"
FT                   /db_xref="EnsemblGenomes-Gn:TA16930"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73065"
FT                   /db_xref="InterPro:IPR007946"
FT                   /db_xref="InterPro:IPR033647"
FT                   /db_xref="InterPro:IPR033648"
FT                   /db_xref="InterPro:IPR038514"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM4"
FT                   /protein_id="CAI73065.1"
FT                   /translation="MSGEIENSTVVVILDQKEDEIVGFDFISFPEANIVSGIWNLTPGS
FT                   HFMYIKNKEKGNIFNYNNSSDECRLGEFLYLKKGEIKVYKRSQVEEGSLFELVEEYCNQ
FT                   KYKESIVMGHLRGKMSKIPENLSNLWANITDCINPELILRLRPINKVITNQPFPASKSE
FT                   NSEIPPENNINTDLRSDCELRNCTTRLELSDSEEDPSKTLEEYKNVASNLSSFKSKVDV
FT                   NLIKSSDKSNGCSFNDTKKSENHVDDSVEKDYESIYYSDIPMCNDRIRKMKEITPEQLT
FT                   KMHMDTSYIIDSISNDNRSNGYKMAEFNNKYLYVLGELQYSFLVFILCFNFESLEQYKR
FT                   LLRAFCNAESLLINDQELTRNFLRTLRFQIEIWDEQHDVYQKDNFLTHHLCNLREIMID
FT                   NSDKLKTCLDHFKLLEDSFKLKFGISLNDLNTIHSNII"
FT   CDS_pept        complement(join(432366..432909,433011..433135,
FT                   433168..433520,433579..434029,434085..437879))
FT                   /locus_tag="TA16925"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.34 - score = 103.92"
FT                   /note="Tap821d03.p1c.cand.34 - score = 103.92"
FT                   /note="SMART 3 WD40 (SM00320) domains, at aa 168-206,
FT                   E()=8.96e-02; 209-255, E()=1.46e-01; 745-785, E()=1.07e+00;
FT                   pfam:PHD (PF00628) at aa 1275-1336; BROMO (SM00297) at aa
FT                   1567-1668, E()=8.72e-04"
FT                   /db_xref="EnsemblGenomes-Gn:TA16925"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73066"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM3"
FT                   /protein_id="CAI73066.1"
FT                   /translation="MKPENDQTTPQTQVKAFNIEAFNLLQSTFSKHIKKREFVDSNQSD
FT                   SHQIDPSDENNENVELNTISELISSALYEFLDNLQAKVNFDTFDVVQKSLDSIQNKLKA
FT                   IEYSKWNRPISSRYRNVYNRLLQRTIKPQYTPNTHNISLDYVILSRKLTHLINIWSHQN
FT                   SVDDSLEDDSTYIEPPQVTVVKFDKTGEVIITGGSEGIIKLWDVTTCKLIMSLKRHSGP
FT                   INHIDIHPTNSFIISSNTTLSTEQYNSEIYLWEINVNFYRPHKVINNVNDIVFLKFATS
FT                   TATWVPKNIEDISMKGVDFNDRKNWEASIENTIIISLDKNNVLKVYRMRDMITSSSGNN
FT                   IYNEVAPKYIVDLFNHEVTGCDISINFSDSNCLAALGIKPMEYNNSSSRNVTFNSIVHC
FT                   IKNDTFHDNNFNVKGKYRNLTDKNGVILLKIPITPSDNDNSVDDRCECDSNMKNTSTCV
FT                   NMCTLCGRVKYNKSNIFENDVEENEMEPNRSGIINKFLWESDHSSSIEKYFNTVIPDFT
FT                   FVNASLFESFTFNFPVMHYLKNSSNLIMPAFIGKTPAFVKESGDLDNLFVNFLGNECGI
FT                   SPQIRFSNTSMDYVTASKDNKFFLWQYENGKFVPKQLYSEDLNFDFENYVLTLGTNNAT
FT                   NTITDSVSRTSSVNRTVNDKSMYNIVSLEWSCNDKYVCIADELMNKEACVNGSSGTNSV
FT                   FRVSFFTDYGKFIAEKRVKLHVVKVKYNPVSEDLCIILCQPSDVMVYNIATRTVINTIS
FT                   FENSASWLDIQWHPMGHKFVTCGKYGSLSLFSTDSQTLMDKTPNYQLTVSDYNSHIQSY
FT                   INAPYRGFEPENLRLKRYFSSFSDSQITMEGDSTYEMITKALFGGPVAFLNEQLNTVLL
FT                   HIGATISRYHNVSYGVTNDVDNNGLLYGVMMRLGGFDEYFRSHNTETDVNLLRIVDQFL
FT                   HLLQNSNDKNGENNNDGVECSIEDCIVCKNYANKVEQHSNYILSKDSYVTLRSVTDKNG
FT                   IVILSLPPSQRPSEFVEAIQIVQSEDLHTPRRFSNTVATTQPPSDLHSVVNSTSSDGVL
FT                   TSAGRTVTIEPQVLEREEDEEESEDSDYEESPEESDSESHENDASVRRSVRASTRRSYE
FT                   VEEDSEKYSLRAKRGFNEDSYKIKEIDSAKKLSNTIGAISILNQNKPGELEEEEIEERF
FT                   CILCGMSSDGYYTNLTRSQTQKFSTTLFSQGHSFNPGCKFYENTIVGPMNIHRRYRSYL
FT                   EDYHNLSKRINSNGNIFAHSACIITSQVKIDQSTKLINFPEILVTSSYEKCGFCDSNFA
FT                   TVPCVDCGRFFHYPCAVAQYKGHMRYDKDMEIVNYFDPLLCKRYFCIDCGVKSENGKQD
FT                   YLTSICFLKPDTRDWLTNKSDVFENKFNVQVGDYIVLTPDCIFERYNTHVPWITQQWFP
FT                   ILVKVLDKSYVFTDDMSVTGCILVESVFGEPGQFCVFTSPEIMLTLLRDFLISPYNLSS
FT                   VKVGSKVKCKINGQIIETEVKNVKQTLNGLNFNINGEIPDETLELTELKRVIEDVYKIG
FT                   HNSVSISYDKKIKWVDCWNLDLNDEIKPKLEEVFGKIKSKGLNQEHKDKFLNLIQDPKY
FT                   GIFEYVEEYGLRSHEWVYEYWRYIPRPISLNEIREKLRNDYYRTPKGVWAEIKLLISNC
FT                   INFNETSSNYSKIAREVDVNLDNLMINMANDYNWTVIFEHIWPFIRNFVKPSVQPSSQP
FT                   HRKNEINQVEQEFGEYNVSKRRKVNVQEPVRRSSRIVQKVEKQVEEVKVRKKTLYNLR"
FT   CDS_pept        complement(join(438037..438323,438386..438496,
FT                   438562..439109,439196..439407,439493..439555))
FT                   /locus_tag="TA16920"
FT                   /product="protein kinase, putative"
FT                   /note="Tap821d03.p1c.cand.33 - score = 23.11"
FT                   /note="Tap821d03.p1c.cand.33 - score = 23.11"
FT                   /note="SMART STYKc (SM00221) at aa 12-273, E()=2.31e+00"
FT                   /db_xref="EnsemblGenomes-Gn:TA16920"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73067"
FT                   /db_xref="GOA:Q4UIM2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM2"
FT                   /protein_id="CAI73067.1"
FT                   /translation="MGFFSAKFENEYTLGKRIFNGAKFQVRECRGIKDERDYVVKIYAS
FT                   DLEEVNTIRYEYHLFVKNKINSIPNVLRLKDCFFDKYYVYYVIQRYYGNDLFRTVMNGH
FT                   KYSEYDLSCYFRQLFRCLSALHGMNIVHRRISGKNLVFLEKENKTLVLKGTRYILSTHE
FT                   FSKFNVVVEHSIQYLSPEIISQETNLHNIMKSDVWACGVILYTLLFGNNLFPIEFPYEK
FT                   YAQNIVKCRINWLHDSPLLKSKLAVDFCKSLLKQNPSERFSAKEALFHPWISGDKMYSH
FT                   NTELASDRFYSEVKNAIDELDTLDENTSRQYRHKFNDEKPLNSSSHLTLNKVSPGHTFG
FT                   TGTSVSSRSSRLTTADSTVRIRNKCLPFNFRIPSFKFFKFKSKQRDKKPLMENPVVDKY
FT                   IKDDEAE"
FT   CDS_pept        join(440193..440387,440578..441536,441601..441916)
FT                   /locus_tag="TA16915"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.65 - score = 30.85"
FT                   /note="SMART 6 WD40 (SM00320) domains at aa 31-70,
FT                   E()=2.28e+02; 73-112, E()=3.68e+01; 115-154, E()=1.40e-03;
FT                   157-197, E()=1.75e-04; 201-238, E()=2.23e-01; 242-281,
FT                   E()=3.71e-01"
FT                   /db_xref="EnsemblGenomes-Gn:TA16915"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73068"
FT                   /db_xref="GOA:Q4UIM1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM1"
FT                   /protein_id="CAI73068.1"
FT                   /translation="MGEYFRVRSVEGLRQSASEPTDQDQNLRSYFKWLKVVGKGKESST
FT                   ISNLSLSQSDHLCSISFGTKVKFYDYEEQLFCYTYNSSKSFVRCASFRSDSKLAAVSDD
FT                   SGNVDVVALELKSLLRRFRAHEGACHCHSFSYDKLSLLSGGDDSAVKLWDVAQETCSLT
FT                   LDGHTDRVRSLTPVPGDCNLWATACYDKIARVYDIRTPEKPVTKLEMDSPVEHVSISSS
FT                   GFRLITTAGNQVKVWDISSGLKLELTVSPHLRAITRSFLSDDDNLLITSSLDGTVKYSD
FT                   INNGLKVSHMYRFDGEVTSFDFKYNNVLAVGLSTSDWLIRYNNKLDSGNDIGSYVQNGL
FT                   ETVRVDTVRDSVEVMGYKPMKLGLLDRLVKTFQYKAAMDLALTLTTAHVYNLIELLIVR
FT                   GTLSTAVKNRDEKSILPLLKFVSTQLNKDINNTNLLLEFLITILDNNHWLKECTDEAVL
FT                   AEMKRIPNKINLELYQHTILLRLKGLIDLII"
FT   CDS_pept        complement(join(441971..443093,443149..443258))
FT                   /locus_tag="TA16910"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.32 - score = 20.58"
FT                   /db_xref="EnsemblGenomes-Gn:TA16910"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIM0"
FT                   /protein_id="CAI73069.1"
FT                   /translation="MNGLTKFSNVPSTKWLHFNFVTSIYNLYTKNNTQPTGELPNPDHK
FT                   SVFKSDEKKKNDHIYHLPGRLICHLNKHKESLLRNDHYDDVTKWAYYGLFSVVIHNWNS
FT                   IHKREKLALINSIVKIIRSISNNRTEINVNDHNLNNYRESLIIFLKFILLSDSNTLSKI
FT                   NGKRFYSHDYISNWKYLHDFLNECVYDLNSFNGVGNGIFMELINEYNYAKDFSKLLSII
FT                   YWVKSLKIVDNQLEPASKAVLSRFKSVYTEECDLRDVINISYYATKIDPKLLSDGFLSH
FT                   CLFKRFGNKFYQLNVIDCYHLLYFLKTYIDSGLSNKLNCLYLPMAFNILANIHVYINGG
FT                   ELDTQELEELSSSIFNGKVDLSNLFKEQVNDKKYYKLKVINDLLKEISEHLGILEPFCI
FT                   KVHNEVSNIIN"
FT   CDS_pept        join(443557..444511,444573..444793)
FT                   /locus_tag="TA16905"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.66 - score = 25.07"
FT                   /note="SMART 1 transmembrane domain at aa 5-27"
FT                   /note="1 probable transmembrane helix predicted for TA16905
FT                   by TMHMM2.0 at aa 5-27"
FT                   /db_xref="EnsemblGenomes-Gn:TA16905"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73070"
FT                   /db_xref="GOA:Q4UIL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL9"
FT                   /protein_id="CAI73070.1"
FT                   /translation="MIIFLYNYVLFSIILSVYSISLSYINTHNTFFTHNKRKGLNVVSR
FT                   TGVCVPEDVGLFGRTMISYECFYTKDGRTQTGDEWEAEMREETKRNFPGVDKKVKKVKR
FT                   VDVNSTEPDAGFKRFEIPAPFNPTKMLLREGIPYLTISVWAPGLNVRDFTVFLNYSQND
FT                   YPDAYTQDCTILPSDTTEPSELDEYYTTFENAEWEKPHKFSYHSTYNDLFNRMEKPDYG
FT                   YADVDNDLVKPPLILINFPKNTIVNQWERATFGSKRDPKKRKQLSRIQRAYRPFSHIDL
FT                   RDVKCIYKDSALQITMKLTHITPPPTHQKNYKLNISTEGEIKPPKTLPLETVHGWMYNW
FT                   HYFRKYDLNFDLSKFELPELTDQNKPNLVDDMTPRQVRRFIKESDELSKLD"
FT   misc_feature    443569..443637
FT                   /note="1 probable transmembrane helix predicted for TA16905
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(444826..447021)
FT                   /locus_tag="TA16900"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.cand.31 - score = 36.43"
FT                   /note="SMART 10 transmembrane domains at aa 12-34, 364-386,
FT                   393-415, 420-442, 455-477, 497-519, 526-548, 582-604, 625-
FT                   644 and 654-686"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16900 by TMHMM2.0 at aa 12-34, 364-386, 393-415, 420-442,
FT                   455-477, 497-519, 526-548, 582-604, 625-644 and 654-676"
FT                   /db_xref="EnsemblGenomes-Gn:TA16900"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73071"
FT                   /db_xref="GOA:Q4UIL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL8"
FT                   /protein_id="CAI73071.1"
FT                   /translation="MAGDDPIKIVNYTFAGLAMMLNIRLVYSASPYALMRFKLPENLFS
FT                   VFVRVMASALELWCLPSMVIGNIIDIFDKYISDPHERRRFSDAHKYDVKDSSLGDGLKD
FT                   KAEELQAAAKVLQTKAESVGGLSGLTTPAGQLSNGAGLLATNPGQASEIINNFNQLETQ
FT                   YNGLVGEKAKVKSEFEAVEHIYNRMLNVTKAGKLQNQVGDQVGSSPGEQKIWHHANLLY
FT                   AKANALANASGLNPAQGDDAQKQKLKAELRELATALANAVGADHQAQGSLQKALSDLSS
FT                   ANDSNIVEKAITVINKYKDVTEKYNAVTDKEGKYRSVLVSSADEFTTKYTPVKSQFGQL
FT                   KEKFDAAKCRAITPIFDKEWIRYISIFWSWSNFVTFVILFFVFIPGDEGHVTVFYWVIA
FT                   ASGFVFGINMVMVYAMEYEYFPWYIAGENSFPIITSFMHYVSTLMFGNRRKWNSDYIVV
FT                   LVDMVISLAISLIAASLWTYCYVKPSTHEYFGPSDINPAIVSPVLMVLVGMGLVYTIYP
FT                   AIAPGMIVPFYLIDKIEMVLLILTTFPPLIFATLRKLYGFQDPAQPMCGWSNPTVFWKT
FT                   DADGRFWHAFDILMPLQISLAFIFIYSLHYRDSHISRSIINQPKMSTALSIIFYMCHEI
FT                   MLALGFPGMIGNNGGDQIMLPIQLIGAFLMVLLAFYSIGYITEYKRHDPSQWPTEGMTK
FT                   WNAMCYWLKMASKITNKNFKQLFTNDLWKYLDIFYFN"
FT   misc_feature    complement(join(444994..445062,445090..445149,
FT                   445210..445278,445378..445446,445465..445533,
FT                   445591..445659,445696..445764,445777..445845,
FT                   445864..445932,446920..446988))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16900 by TMHMM2.0 at aa 12-34, 364-386, 393-415, 420-442,
FT                   455-477, 497-519, 526-548, 582-604, 625-644 and 654-676"
FT   CDS_pept        complement(447130..448863)
FT                   /locus_tag="TA16895"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.cand.30 - score = 24.73"
FT                   /note="SMART 11 transmembrane domains at aa 20-39, 221-243,
FT                   253-275, 282-304, 319-341, 353-375, 379-401, 406-428, 453-
FT                   475, 496-515 and 525-547"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16895 by TMHMM2.0 at aa 20-39, 221-243, 253-275, 282-304,
FT                   319-341, 353-375, 379-401, 406-428, 453-475, 496-515 and
FT                   525-547"
FT                   /note="Signal anchor predicted for TA16895 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.022, signal anchor
FT                   probability 0.834) with cleavage site probability 0.006
FT                   between residues 41 and 42"
FT                   /db_xref="EnsemblGenomes-Gn:TA16895"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73072"
FT                   /db_xref="GOA:Q4UIL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL7"
FT                   /protein_id="CAI73072.1"
FT                   /translation="MAKCPYCDRQASLGVDKCGLLITAYILAGLAMMLNIRLAYSSAPY
FT                   ALIRFRLPENLFSVFVRRMASALELWCLPSMLLGNLMDLIQKLGFYPQNLKNAAGGNDS
FT                   DGLRGKAGNLNTQASTLASELNDDHAQALVNKLKEAASNDSGKGLKQLLGDLKSASGTE
FT                   VVEKANAVKDKYEAVEREYYKVKNDDKASKGGNFGQVTTAFEALQKLYTDAVCPEKFYW
FT                   IVVPSIVCQWLNFLTYVILLYVYVFGGDQGHLTTFYFVIAISGVVFGINMTLVYSVDFN
FT                   YIPVYIAGENSFPIVTSFMHYLTTLMFGNRRKWNSDFIVVCVDIGVAIIISFVAAVVWT
FT                   WAYKCSNGQEKKWWHIYAFGFSGGFSSEVISPALMVIVGMGLVYAIYPGIAPGMIVPFY
FT                   LVDKIEMVLLIATFFPPVIVAMLRRTAGFGDPQSPMCGWKKPTVDWMPDKDGRFWHAFD
FT                   LLMVIKITLAVVFIYSLHYRDSSLARSIINQPKMSTALSIIFYMCHEILLAIGFPGVIG
FT                   NNGGDYVLIPQYIGALFMIFLAFYSEGYIIEYKSHDPDHWPTDGMWYLYGYYQLNPDFL
FT                   L"
FT   misc_feature    complement(join(447223..447291,447319..447378,
FT                   447439..447507,447580..447648,447661..447729,
FT                   447739..447807,447841..447909,447952..448020,
FT                   448039..448107,448135..448203,448747..448806))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16895 by TMHMM2.0 at aa 20-39, 221-243, 253-275, 282-304,
FT                   319-341, 353-375, 379-401, 406-428, 453-475, 496-515 and
FT                   525-547"
FT   misc_feature    complement(448741..448863)
FT                   /note="Signal anchor predicted for TA16895 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.022, signal anchor
FT                   probability 0.834) with cleavage site probability 0.006
FT                   between residues 41 and 42"
FT   CDS_pept        complement(join(449015..449283,449314..449490,
FT                   449535..449784,449824..450581,450648..450900,
FT                   450976..451137))
FT                   /locus_tag="TA16890"
FT                   /product="arginyl-tRNA synthetase, putative"
FT                   /note="SMART pfam:tRNA-synt_1d (PF00750) at aa 84-496,
FT                   E()=1.80e-10"
FT                   /db_xref="EnsemblGenomes-Gn:TA16890"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73073"
FT                   /db_xref="GOA:Q4UIL6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL6"
FT                   /protein_id="CAI73073.1"
FT                   /translation="MKMESLIYTLKSPEPSPTFLTLILTKLMKGILHTNILNYNIYNRW
FT                   GNCRFTVLKIKKELSTVGGCKITHDTLNIKLRDQYIIDQLNVMSESDRLNVGKLTDETV
FT                   LVDYFSPNVGKNLHMGHIRSLGLGQAISNLLDFSGSKVIRRNHVGDFGLQSGIIMRYII
FT                   EYDTRAMEALNPATCNRSFMRELFRYQQIGFSPLEYSYEYNTKNLTLSFPLFAYGLVVD
FT                   TIDDYYKLAFEKFSSDQEFARRAKIETYLLQNEKSFANPQWENVNHISLVQYNDILDYY
FT                   YIKGLKNIPESLYKNVTNRLIEELIKEKKVDQNDKEVVYTISKSSKQHNKPDNSDNVEV
FT                   KKEDKTVLRTREGSLTYMATDLGALSHRIGWNKPDRIIYVTENNQKSHFQKLYTIIYVQ
FT                   LYKIAKKLNILKTCKMEHVGFGQIGLEGTGKIRSRTGNTCTIKDITKQVVELVTEKFVK
FT                   RGDYLRLKHPIAARKIGVGSILFSDLSVEPKSGYNFSIERLMNQGYNLLIAILYSYVRS
FT                   KSILERCESLPQIPSNEFRNEYERKLGMLLLGFENMIAASISMREPHRVCKYLTNLSKG
FT                   FNQFYEKTPVIVDDKVNSLSYKLVKMTSKAIEIGLDILNIQTVKQL"
FT   CDS_pept        complement(join(451540..451623,451691..451852,
FT                   451911..452042,452112..452202,452277..452485))
FT                   /locus_tag="TA16885"
FT                   /product="60S ribosomal protein L10e, putative"
FT                   /note="Tap821d03.p1c.cand.28 - score = 20.03"
FT                   /note="SMART pfam:Ribosomal_L10 (PF00466) at aa 17-127,
FT                   E()=3.80e-02"
FT                   /db_xref="EnsemblGenomes-Gn:TA16885"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73074"
FT                   /db_xref="GOA:Q4UIL5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR033867"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL5"
FT                   /protein_id="CAI73074.1"
FT                   /translation="MAISKRRNPLHTSICKKDGKKKIKLVENIRETLENFIKKNDNSTF
FT                   VYLISLNNQRNSPLKTLRSLLLPGRVFYGKNKVMRIAFGTKPEDEIHDNIHKISKNING
FT                   ETAVLITSEDPEVVIKKVKEYKVRDFSKAGNIATDTIVLKVDGKEFDEIPGSMEPQFRQ
FT                   LGMPTALNMGKIILMGDFTLCEKDKPLTPNQTHLLKLFGIRMSLFEANVLGFWNDGHYK
FT                   QLA"
FT   CDS_pept        join(452747..453556,453629..453784,453848..454186)
FT                   /locus_tag="TA16880"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.67 - score = 23.12"
FT                   /note="SMART 1 transmembrane domain at aa 31-53; RING
FT                   (SM00184) at aa 382-418, E()=1.79e-06"
FT                   /note="1 probable transmembrane helix predicted for TA16880
FT                   by TMHMM2.0 at aa 31-53"
FT                   /note="Signal anchor predicted for TA16880 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.903) with cleavage site probability 0.001
FT                   between residues 55 and 56"
FT                   /db_xref="EnsemblGenomes-Gn:TA16880"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73075"
FT                   /db_xref="GOA:Q4UIL4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL4"
FT                   /protein_id="CAI73075.1"
FT                   /translation="MYNFLNEFDWYFYRNLANSRFICGRTGALQSYGSSNLFIVLGLLL
FT                   VFFRLFLLLSEYKSIWHIAKQLQANPKAIHLSGMAEYTSEILNLYFMHFRQILKFKRKF
FT                   KSVPIPRIHMPLSLNSNSVKLISATENSASSPKKSKTEKNTEDEDYSINFSFDCTKTTF
FT                   VSAHWGVPVDIVCSAIVPRIPKKDTFGLSILNDTVLNKAKKMLRRLLIPFYNEQCELLL
FT                   DQPVDVFDSYKVSGDISLLCNEENFCSSDPICFNSGSKIECSIKPWKKFVEVDGKLIPI
FT                   WKCLTSHEELFQNRVPLVIVLYTPRTQEPRVFAEGDVESHQGYAEITIVRFKKPTDLII
FT                   PFVKSPKISPKVVKQVVFCGEYISPQEPRDMFGMGDVKDKECLICIANDMDTVLLPCGH
FT                   GSFCSRCLYSLRNDKCPVCRRNFYSYVKFPLKARA"
FT   misc_feature    452747..452911
FT                   /note="Signal anchor predicted for TA16880 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.903) with cleavage site probability 0.001
FT                   between residues 55 and 56"
FT   misc_feature    452837..452905
FT                   /note="1 probable transmembrane helix predicted for TA16880
FT                   by TMHMM2.0 at aa 31-53"
FT   CDS_pept        454442..455776
FT                   /locus_tag="TA16875"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.C.cand.68 - score = 13.93"
FT                   /note="SMART 11 transmembrane domains at aa 10-32, 52-74,
FT                   89-111, 118-140, 155-173, 180-202, 222-244, 257-279, 328-
FT                   350, 370-392, 396-418"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16875 by TMHMM2.0 at aa 10-32, 52-74, 89-111, 118-140,
FT                   155-173, 180-202, 222-244, 257-279, 328-350, 370-392 and
FT                   396-418"
FT                   /db_xref="EnsemblGenomes-Gn:TA16875"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73076"
FT                   /db_xref="GOA:Q4UIL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL3"
FT                   /protein_id="CAI73076.1"
FT                   /translation="MSEDLKKSAYIFAGLGMMLNIRLAYSSAPYALIRFRLPENLFSVF
FT                   VRRMASALELWCLPGFVIVNLMDQLRIHAYSGKTEKDWGYNWQSIIVQWLNCLTFVILL
FT                   YAYRGGGDTGHLTGYYFVIAVSGFVFGLSNPLVYAVDWQYIPVYMAGENSFPMVTSLIH
FT                   YITTLIFGNRRKWNSDFLIVMIDISVAIIISFVGAILWTVAFYDYTPPPGGTVNPYWQI
FT                   VSPIAMVIVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATAVPPVIVAILREHAKP
FT                   WSPQHYVWHGQNNSKNGFYGWTTYEGLGPTHGAGQTCSDHVDVYGWIWHFFDILIPLKI
FT                   ALAIIFIYSLHYRDSKISRSIVNQPKMSTALSIVFYMCHEILLALGFPGIIGNNGATYV
FT                   VLPAQYVGAFLMVFLAFYSEGYIIEYKSHDPDHWPTDGMWYIYGY"
FT   misc_feature    join(454469..454537,454595..454663,454706..454774,
FT                   454793..454861,454904..454960,454979..455047,
FT                   455105..455173,455210..455278,455423..455491,
FT                   455549..455617,455627..455695)
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16875 by TMHMM2.0 at aa 10-32, 52-74, 89-111, 118-140,
FT                   155-173, 180-202, 222-244, 257-279, 328-350, 370-392 and
FT                   396-418"
FT   CDS_pept        455911..458193
FT                   /locus_tag="TA16870"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.C.cand.69 - score = 37.06"
FT                   /note="SMART 9 transmembrane domains at aa 47-69, 90-112,
FT                   122-144, 151-173, 188-210, 273-295, 604-626, 647-669, 674-
FT                   693"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16870 by TMHMM2.0 at aa 47-69, 90-112, 122-144, 151-173,
FT                   188-210, 273-295, 604-626, 647-669 and 674-693"
FT                   /db_xref="EnsemblGenomes-Gn:TA16870"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73077"
FT                   /db_xref="GOA:Q4UIL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL2"
FT                   /protein_id="CAI73077.1"
FT                   /translation="MGFGDEPVKCAAYTFAGLSMMLNIRLAYSSAPYALIRFKLPENLF
FT                   GVFVRTIAGALELWCLPSMTLGNIMDFVRKQMKFGSSEKNTMDSIVCYSSIVCMWSDFI
FT                   TYVILLFVYLSGGDQGRLTAYYWVISVSGFIFGINMVLLYAMEFQYFPYYLAGENSFPA
FT                   VTSIIHYLATLMFGNRRKYDSDFLIVHIDIWVAILISFTTALLWTYAYYRDKEAMDKFP
FT                   SDPNQRICQILKVEPNSAPATELTYSIGQNFDDSHAGGCGRKKSYGYWLHLVPPSLMVL
FT                   VGMGLIYTIYPAIAPGMTVPFYLIDKVDIVIQILTAVPPVIIKILPLIDPTLNPFVNMG
FT                   TWGHYHKKQCKKGDETKPPYPECNCPAGDPTIYTTAKLKVEESGNNITKAILQLSGNSG
FT                   TSATLEYTPDTRITLRDSGSVTVKFNLEQTNIAITPSSGSTDLRATATLTTTASKSISN
FT                   LTNLKGDTGEDLTLSGQLSSNELTLTKNGEAITTDNNNTLKTGDTIKLEGTLTGTTIEA
FT                   SGTVIITNSDGTPTDQSLTLSGAAVTLKGGLTATGSLNIGGTSTTLNGDVTLAAVKYYE
FT                   KEFHDKHKTTHCCYYGGKVWKWESNPLVWCWNAFDIFIPLQIILEIIFLYSLHHRDSKL
FT                   SRSIINQPKMSTFLTIVYYMCHEFMLALGFSGIGSDDQVLLPMQLIGAFLMVLPAFYSK
FT                   GYVIEYKRHDPNHWPTEGMTSWNAFCYWLKMSSKNTNKLLLDVFTTDLQVFFSFTHLYT
FT                   PLHIYIK"
FT   misc_feature    join(456049..456117,456178..456246,456274..456342,
FT                   456361..456429,456472..456540,456727..456795,
FT                   457720..457788,457849..457917,457930..457989)
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16870 by TMHMM2.0 at aa 47-69, 90-112, 122-144, 151-173,
FT                   188-210, 273-295, 604-626, 647-669 and 674-693"
FT   CDS_pept        complement(join(458241..458321,458360..461607,
FT                   461659..461793,461894..462212))
FT                   /locus_tag="TA16865"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.27 - score = 77.45"
FT                   /db_xref="EnsemblGenomes-Gn:TA16865"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL1"
FT                   /protein_id="CAI73078.1"
FT                   /translation="MGVRTRSYSDSAGQDLKNSNVPQQIVLKRPNLRGNSTNNVRSSDP
FT                   SGFEDDLVENLGKFEILQKKWLKCILSVDLQCQNANIPVNKQMLFLNNAIKYTLKSIPN
FT                   QHRVNFFINFLKNYEKDVQFISRLYVILIRLFFCFKYRFRLSEFPSLGCLSLFNNIFWS
FT                   ICSLGTLFTNFILTLCNGFVSMNDVVMGLVGYKSEIKSDNPLYISDEEILKLFPLFSEF
FT                   HTNKFFCSFHQDFTTFLLKLYCKISVKMDNDGHISDELIWKINEYEINTLTDVNVYIMM
FT                   LDFYSKVSLKTENLKDSSFLNGLVTIYSNLLKQFNTRDKMSNVVARGIIYSFSRFLTYL
FT                   FPKYYSISGVPDSVLILIQSYLIIEQQNGVDNVDETVFESLKSVLKNHEVGREILKNLR
FT                   INFNWYSSNLSFEAELNEYINNIYKSILKSSGIPRTVILYPTTSLTNKIEESYVNYELS
FT                   KEVANKFLNSLFQHIQENNLSISALVNVIPSTGNLHYFIYLDIGLDKSGVDRSSVITCV
FT                   LVSMATLMNDGIFVDGNSDSLVRVIIKLNDNYAQDSSLYKLFLSLLYCEIKDDTALSLE
FT                   YRNYELYLYRTLVVHYLSQLVQSPVRLRDFTFDGKVVEEKMVTVRMFKMLNFRTNYLLM
FT                   DRIVFEKYLTTRYIPVSDAQTMEDEVDSLIFGFLEYDMNNTTQEQNNQLVKSEDFVQNN
FT                   ANFDNVYFFKVILKFITQFRYNSRNTTELVELLLYKYHMKLCSNNYYDVSMTNRIYSNI
FT                   KKLVETNLYGRKVKNSLFVQYFGSNEDSDDLIESNESINGDHSLNHDKLNSTSGSVTST
FT                   DVQLIELLKLNNRYTKRVFYTLTHIVSGHLVAFLPSNYIPTLLCNWASSLPIDTTSAVK
FT                   SEKIAIARFILFLLLSQLLSFEHELSLKMFTRLEPIISAINVIYINLEIIHKGPKPFAF
FT                   CEVISDEDEIYTPERFNFLSQETIELDDSNFYENLVNSYNTLREDSLKKFNERKENIKK
FT                   RNKEQVQLLLQISVLISQIFLNIILKLYNTISDVNNGLITVTGIIYTNSFILHYLQNKF
FT                   ILKFCLDDGVVLSCIGKKRSLYYNSVEFLLLIDNTLSTMIRTCILSTLNLEADTVKSDP
FT                   QNITVKLEDPLNHSIKNNTSKESVDYIYKEKKYSELINKIKIFKESIKSKLTYFNSFQN
FT                   IYNFNIDNIGSTADSMSSGDVGNDTGNNAENEMEDGFEEDLEDFIDFETDSYLSMITYN
FT                   TKKHTEKYKNMSVKKKLKMTILRNEWKSIIKSHLM"
FT   CDS_pept        join(462572..462704,462829..462954,462995..463279,
FT                   463342..463515,463648..463919)
FT                   /locus_tag="TA16860"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 4 transmembrane domains at aa 33-55, 75-97,
FT                   17-139, 274-296"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA16860 by TMHMM2.0 at aa 33-55, 75-97, 117-139 and
FT                   274-296"
FT                   /note="Signal anchor predicted for TA16860 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 1.000) with cleavage site probability 0.000
FT                   between residues 53 and 54"
FT                   /db_xref="EnsemblGenomes-Gn:TA16860"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73079"
FT                   /db_xref="GOA:Q4UIL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIL0"
FT                   /protein_id="CAI73079.1"
FT                   /translation="MHGTVKPKGRFGRIFDSLRFNWTRRRYIWRACFFYKLVSWILMIG
FT                   LLITTVFYYLITKYSFFVNYSCSSRSINMINLFMISISVTTAILLVLSVYLARMCNLFS
FT                   NYTMRQFVTTGRFMHFVGCTVKWLPWVSAVVMWIWLAIQFSSLIWVFVNPKQWCDHRFD
FT                   ESAVNAVRNCRLILNKNTPCQIVFENVTPKEIRNCNHPEYLITRKMVLLALKDPSSKCS
FT                   VEDITVCNAYRDAITKDDFDFDEPGLAGCYGQIPPDMSSFIDEKNSSDLYKYILLFNIF
FT                   WSVMFVLIVCIFYFIKSVTKFDAIIYQPKDPSDNIIIKIIRPFTPWTK"
FT   misc_feature    462572..462730
FT                   /note="Signal anchor predicted for TA16860 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 1.000) with cleavage site probability 0.000
FT                   between residues 53 and 54"
FT   misc_feature    join(462668..462704,462829..462860,462918..462954,
FT                   462995..463026,463084..463152,463749..463817)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA16860 by TMHMM2.0 at aa 33-55, 75-97, 117-139 and
FT                   274-296"
FT   CDS_pept        join(464093..464147,464257..464795,464888..466483)
FT                   /locus_tag="TA16855"
FT                   /product="DEAD-box family helicase, putative"
FT                   /note="Tap821d03.p1c.C.cand.71 - score = 52.16"
FT                   /note="SMART DEXDc (SM00487) at aa 78-262, E()=9.96e-31;
FT                   AAA (SM00382) at aa 2.02e-03; HELICc (SM00490) at aa 310-
FT                   407, E()=1.18e-14; pfam:HA2 (PF04408) at aa 466-560
FT                   E()=1.80e-37"
FT                   /db_xref="EnsemblGenomes-Gn:TA16855"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73080"
FT                   /db_xref="GOA:Q4UIK9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK9"
FT                   /protein_id="CAI73080.1"
FT                   /translation="MDNQVKKRKTRFSDTPNPDSDDSNTVNNNFNNLNVNNEKDSLIPE
FT                   QKHDKSSDLESNVNKWTGLPFSQHYYDVLEGRKKLPAWTARKNFVKLVKRNQVLVLVGE
FT                   TGSGKTTQMTQFALEAGLSGLRPIAITQPRRVAAMSVATRVAEEMDVELGATVGYTIRF
FT                   EDKSSEKTMLRFMTDGMLLKEITTDKMLSHYGMVILDEAHERTIATDVLFGLLKDLIKQ
FT                   RSELKLVIMSATLEAKKFQAYFGGCDILRIPGAMHPVEIYYTAEPERDYFEAAVRTAVN
FT                   IHMQEPEGDILLFLTGEEEIENARKEIETALARRNCELPMTILTLYSSLPPAQQQRVFE
FT                   PVYGRKCVIATNIAETSITIDGIVYVIDPGFSKQKVYNPRGRIDSLLVSPISKASAQQR
FT                   AGRAGRTRPGKCFRLYTESTFSKELVSETYPEILRSNIASVVLSLKKIGIDDLVHFDFM
FT                   DPPAPETMMRALEELNYLGALDDEGELTSVGSLMADFPLEPQLSKVLVHSPEFNSISSL
FT                   TAVVSMLSCGNVFVRPREYAKEADAAKLQYSAQEGDHITLLNLFNQYQAVVNSSSSGST
FT                   SSSVRRYCQENYVNPRSLSSALNIYQQLITILTRMHSVNSVDINKTSEGRDKDVSSVVK
FT                   GLVKGFFQQVAYKSSRGHYLLVKDNQAVALHPSTTLQHTPQWVIYHEFIYTSKNYIRTV
FT                   TEIKGEWLMELAPHYFNPYEMNNQETKNAFLSLKH"
FT   CDS_pept        complement(join(466633..468719,468814..468985))
FT                   /locus_tag="TA16850"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.26 - score = 51.28"
FT                   /note="SMART DnaJ (SM00271) at aa 499-518, E()=3.43e+00"
FT                   /db_xref="EnsemblGenomes-Gn:TA16850"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73081"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK8"
FT                   /protein_id="CAI73081.1"
FT                   /translation="MDSEVFFENRFKKRTLDSPTDNTLDSPITIDTNTDTISNINTTSN
FT                   NILNNTTYTNNTGLNGIETIRVNSVEQEEYYNVEHSTDKLSLTRQFLSSFLVDFDEDEL
FT                   AAKRTVETIYNASRSFSYTYRSLHEAIFAKSTQLTTLLPFVKAISSVADTAILLSTINS
FT                   QNSKTSTNTNKNVNGKGDVVVSGVLMNYELIMLGIFRKFCVKMREFESLEGNRTWEKMS
FT                   ELMESFLKDGILKELRCLFSQVYNIEQMNYGDFKRYLTDFRLYLTHLQDELYPKSGQKR
FT                   KLASVSETFSLQNCIDLINFVGRELDNMRKLLLNIVKSVMNAAVTDSLTTILAKLSNNF
FT                   NSDFNSDFGSENVGSGSQMEDENCILKCVNMLLEEESLFYVVDDQIEQNVKMCVEKYNN
FT                   MYNAYEEEVRRRSDAVSEFEKKKKFKRDSVQYVLDRISETSSPTLSNSFKNPFYTVGIS
FT                   PKLCTKESFRKYAKKLKMLLHPDTEHDPEWKQKAEKAFKEASLALDQCVKQLDTFSASL
FT                   YRVGPVPPYLSHLNIVLPPNSNFYTSGSGNNTGGESSPSYEETKLKEVQLVYFPEFSLR
FT                   CDDQKVGSLSVEVDLTSLVDRKIWQSMGKNRQIIIYVLRPLHYEPYTIQLPNEMISSTH
FT                   NLKLTDRPINKTPILKVDAVQPIRFGTSWKYFVGVKISGDLGSTLVSYKSLFIELPSKG
FT                   RTINHITKLLKTFTNASFIDQSSLQQRLNSVKETNSKSEAEKFLLECTKLAQKWADEN"
FT   CDS_pept        join(469521..469953,470066..470117,470170..470270,
FT                   470373..470463,470524..470851,470911..471046,
FT                   471110..471639)
FT                   /locus_tag="TA16845"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.72 - score = 29.22"
FT                   /note="SMART pfam:ThiF (PF00899) at aa 119-255, E()=3.70e-
FT                   49; pfam:MoeZ_MoeB (PF05237) at aa 294-397, E()=8.10e-13;
FT                   pfam:Rhodanese (PF00581) at aa 437-538, E()=2.10e-02"
FT                   /db_xref="EnsemblGenomes-Gn:TA16845"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73082"
FT                   /db_xref="GOA:Q4UIK7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK7"
FT                   /protein_id="CAI73082.1"
FT                   /translation="MLNFEDWKYLSINVDKYHKSSGCLKYSSDSTNNNNANDHKSDKED
FT                   DFNDYLLNKPKWPPKVNITNNINGVKRVSMCKSVELPYCSCMDSVTSKRYNSQYIALND
FT                   MSSNSHSDYIYRSISSCAVLVIGAGGLGSPLLQYLASSGIGLIGIMDGDVVELSNLHRQ
FT                   VIHDERNIGMNKALSAKNRILSINESVTILDITYDFFLNVKEAHEIIPLYDVIVDCSDN
FT                   PQTKYLINDACLMYNKPFVVASCIKSQGQLMVFLPQTLTNVCEKDSDLNEKNDRMVSKV
FT                   DRDTESGSIGSKLSGPCFRCICPEENNPSISYIKNACSLAGVLSSLPGVLGTIQATEVI
FT                   KICGGLFDRCLSPGRMLIYNGQNPYSPFKTVELSRNRNCRSCGGGEIKLYMAPSEELKF
FT                   NLDRDYLSISPSEFVNLYFNQLGKEFPIRIAVTDTSISVDEAGTEYRIAVIDVRPESHY
FT                   YISHLTGSINWPVNTLINCNETSFSHTLSLLTGNWKDQNVLLLAICRKGNSSRIATEFM
FT                   RKFLSKTVSYGKLGQVLCYSVAGGLQYLIQHFQLQMPHT"
FT   CDS_pept        complement(join(473065..473487,473639..473739,
FT                   473772..473843,473949..474174))
FT                   /locus_tag="TA16840"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.25 - score = 14.28"
FT                   /note="SMART pfam:ATP-bind (PF03029) at aa 5-233,
FT                   E()=1.30e-70"
FT                   /db_xref="EnsemblGenomes-Gn:TA16840"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73083"
FT                   /db_xref="GOA:Q4UIK6"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030231"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK6"
FT                   /protein_id="CAI73083.1"
FT                   /translation="MVWFGQVVIGPPGSGKSTYCAAMQSKLVSKNRKCIVINLDPQVTL
FT                   HELPYQPDINITNLINAEHVSNTLNLGPNASLLYCMEYLLENLDWLLEQISLHKDSYLL
FT                   YDLPGQVELFIHHNALKDIISKLQSSNQRLVQMNLIDSTLCCDPFKYVASLLSSLSSQI
FT                   FIQLPHINILSKLSLLREVEAEMAYRLEYYTEVQDLQSLIISLRYNFKLPNLQKFERFT
FT                   STLCEIIEDFNLVSFHTMDVQDDESIEFILSSADRAIGFIPFNHYDFRFNY"
FT   CDS_pept        complement(join(474348..474541,474613..474747,
FT                   474820..474949,475122..475301))
FT                   /locus_tag="TA16835"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.24 - score = 8.46"
FT                   /db_xref="EnsemblGenomes-Gn:TA16835"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK5"
FT                   /protein_id="CAI73084.1"
FT                   /translation="MELLYNPLKPTDITLGDVHFGYFVPTVICGRTRSFQNDLHRFISN
FT                   YCNHIFQNNFNTFLKSCLDFGLEGIGLEYKNCMFSKILVLSPKENLTDVWQILWGTWSY
FT                   VFKSRVEEESEEYNVLYKVSLIYLMFYLYFSQSDFNNLPIPLSIVNSVIDTFEECLKVA
FT                   ELVLKKYRVTSVLNVLKYLMSQKCITFTLLDGLQFLYQNKFGSPLKPPS"
FT   CDS_pept        join(475591..476590,476656..476972)
FT                   /locus_tag="TA16830"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.73 - score = 16.70"
FT                   /note="SMART 1 transmembrane domain at aa 284-306; 2
FT                   pfam:MtN3_slv (PF03083) domains at aa 158-253, E()=1.80e-
FT                   05; 326-413, E()=1.50e-05"
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA16830 by TMHMM2.0 at aa 158-180, 201-223, 238-272,
FT                   284-306, 311-333, 364-382 and 386-408"
FT                   /note="Signal peptide predicted for TA16830 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.960, signal anchor
FT                   probability 0.000) with cleavage site probability 0.901
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA16830"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73085"
FT                   /db_xref="GOA:Q4UIK4"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK4"
FT                   /protein_id="CAI73085.1"
FT                   /translation="MLILIIILVISKVIIADNVNLTDPKAEKPAQPQQPETKIIKIELN
FT                   DSSSNANTNPSDGKGVQLEEIHDKTQSNTKDATVTPPPNKETIATITLNISNNEPKTIE
FT                   IKNVDAQNTQTIQNQPKQSVPLQQQTVPPDQEQPQVVETLFTKIAKFITTDFRFLVKFG
FT                   AVLSSGLTQMIPLNIILTIRKNNSTRNLKCLNFVTSAVSSLSWSLYGILSKNIILIISN
FT                   FPGSFSSDNYSNKLHSYIYLILLVILSNYIYYGINVKCVGAIINLVGIWVFVKYCSDQN
FT                   EKFILSVSSKISFVLCLILLVLYFILTSTTFLTVVGLIGGTYLVQTICYYLLSSLLAMS
FT                   YLSPLFSFKEILESRNTSTMPTEISLGNFISSFFMFCYGFIIWDMLVIGPSFLGVISGL
FT                   IQLTLLFLFPHSDRIIISEVEILEQPNNFRSMLAMDQEV"
FT   misc_feature    475591..475638
FT                   /note="Signal peptide predicted for TA16830 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.960, signal anchor
FT                   probability 0.000) with cleavage site probability 0.901
FT                   between residues 16 and 17"
FT   misc_feature    join(476062..476130,476191..476259,476302..476406,
FT                   476440..476508,476521..476589,476745..476801,
FT                   476811..476879)
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA16830 by TMHMM2.0 at aa 158-180, 201-223, 238-272,
FT                   284-306, 311-333, 364-382 and 386-408"
FT   CDS_pept        join(477402..477671,477758..478894)
FT                   /locus_tag="TA16825"
FT                   /product="actin, putative"
FT                   /note="SMART ACTIN (SM00268) at aa 2-468, E()=2.35e-19"
FT                   /db_xref="EnsemblGenomes-Gn:TA16825"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73086"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK3"
FT                   /protein_id="CAI73086.1"
FT                   /translation="MEKPLILDFGTVSFRVGRAGDKNPTFFVPPVIGKPLMKDSKGDLC
FT                   DFTGGSGQNPLEYTIFPLNPRDKHDNVIPISAITYGENGFEVNQSLLERLLDGCLGVKG
FT                   MDESLQDTPVIVSEPSLHNPKFRQNFTELLFETFKVENVFLCKRSALSCYASACTSGVV
FT                   VDIGGSCTNIAPVLEGYTLQDHVKEEPTGGTLIDRIFYSYLSSIGITVRPSYEYSKPPK
FT                   SESNTNGVNNGVEVDTTVVKGVVGKKPVKRDDSKVLIRKLPFVHEDYYHWSALYATSVL
FT                   KETCIVLNEEINVNSSGREAYCYALPDGNYLDVENSKRLCGIFCSSIFSKTEYLHNKHS
FT                   VKSSNQDSIDMESVYSRKGLSTLLTDCYGELLDSEVNRVVLDQLVVSGGCTRHPAVVPI
FT                   LERDVEEYLRKKKLESGPRLVAVGGNEQQFSSYIGASILSSLGAFTSFCVNLADVQELG
FT                   LQRALQRRCP"
FT   CDS_pept        complement(479050..480120)
FT                   /locus_tag="TA16820"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.23 - score = 32.11"
FT                   /note="Signal peptide predicted for TA16820 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989, signal anchor
FT                   probability 0.002) with cleavage site probability 0.811
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA16820"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73087"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK2"
FT                   /protein_id="CAI73087.1"
FT                   /translation="MNLIITLFAILIHVSICLDPVDIELLQPLPEEGIVSEEVTFHGIH
FT                   YQIIVPLGQYYFRTISYNNNPIFQEAQRACLKVVIVTSDHIKYIFLRIITEDGFEIIRR
FT                   YSTFGLFCFLERITDCTSSITDLIAIANSWHHSLNNRGFNIPLADVPFEPVGGPDDDQG
FT                   PGGGGPDDDDDDDHGPPGDVADQPPQPPGDDDADSDEHSDNGGDNGEGGAPQDPNQIVQ
FT                   DNNLEAGPQDDIPILIEPDHPGGQDAVQQVVEIGPPSNSPYDYPYFNGFDYLGFDPEGL
FT                   NLGENELDNPALNQPILQDDLEQLLGEAVVEDDFDDPFDVNIIDVNQNNQLVPGDSEQP
FT                   DSEANENGFYDFDVEN"
FT   misc_feature    complement(480070..480120)
FT                   /note="Signal peptide predicted for TA16820 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989, signal anchor
FT                   probability 0.002) with cleavage site probability 0.811
FT                   between residues 17 and 18"
FT   CDS_pept        complement(join(480869..481714,481805..481924,
FT                   481975..482152,482219..482414,482454..482580,
FT                   482706..483026))
FT                   /locus_tag="TA16815"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.22 - score = 43.92"
FT                   /note="SMART pfam:DUF654 (PF04910) at aa 217-595,
FT                   E()=9.90e-04"
FT                   /db_xref="EnsemblGenomes-Gn:TA16815"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73088"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK1"
FT                   /protein_id="CAI73088.1"
FT                   /translation="MSSRQIRRLKEMLNEELEEEIRPRVIFNNKRPKFTFAQLESLCDS
FT                   SSDTTSNDDSSENSDDSSENSDESEYSSDYDRIRESRSVIYLNELSKDDESSKDPSEDN
FT                   QSSDDDSDWDKLLNEVTEVEMEPIDSSETVSNHFLCSPQHFFRISDMGKNKYAKSNGYS
FT                   SRFWLCPTLNIKESKQLRLAASNLFEITCETIDNRDKFTLILSPTYYPKLYYYSHTTRL
FT                   YSNIEFYRYQELDYISSTALDSHDLELFRTLLHSNPYHLGILIRASLINTMMNSHEDTF
FT                   KNLYTASKTLQTILPHRFNLYRTAPFSNLTVPNVYLPCLGDNVVVYRILILYMISLERK
FT                   GQWKTALAICKLLLAMDLPNDSSHALLHVDLYLLNKFSQDSSLILFSQNYSPINPELPP
FT                   LYLFLPNFSLTLSLQVYLNMGLKNNQCNLEEIKNQLPSVLDLGCDLAALARTENPNTPY
FT                   LLLIRSLLQFPLFVVNMSQRVGKSGELRNSAKKEPFSYWSSPKAKDYENVYDQLTRCYV
FT                   YKCGDLWSSNNSTFLAETAKLVVKLYEDEEVRDLINRFQCEYFEFRNGIKIPEEYTNIS
FT                   ITEFDLNNYSLPMLLDFQS"
FT   CDS_pept        complement(join(483189..483561,483692..484545,
FT                   484719..484817))
FT                   /locus_tag="TA16810"
FT                   /product="(RNA) pseudouridylate synthase, putative"
FT                   /EC_number="4.2.1.70"
FT                   /note="Tap821d03.p1c.cand.21 - score = 27.27"
FT                   /note="SMART pfam:PseudoU_synth_2 (PF00849) at aa 144-323,
FT                   E()=3.20e-33"
FT                   /db_xref="EnsemblGenomes-Gn:TA16810"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73089"
FT                   /db_xref="GOA:Q4UIK0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIK0"
FT                   /protein_id="CAI73089.1"
FT                   /translation="MLIKCIIVIDVVLGFIRNPGSYYMKRKLIYSHQEEEPYRFVDGFR
FT                   LVLPYSNVYKTFVKERWMGKPLRKVLKDEFSAFTPDYIDFAINKNNIKIILQNGEELDN
FT                   SSENVLDHILKPNERILHEAIVHEPVALNSKVPVVYEDDQYIVVSKPTSIPVYQTGTYN
FT                   YNSLMEIMKREIPSCRDLKLFTVHRIDRLVSGLVAFAKSSQDASNLSQAIRDNEVKKVY
FT                   IARVKGDFSYLINTSNSDNKESDGDADNSLENVFESIGYMRVISKKEGKYEFVGENDED
FT                   ESYKRSVTRFKLIKYNKDLHESLVLCSPITGRTHQIRAHLKYLGYPISNDPWYNNDELT
FT                   DSSNYFKPIPAIKWSINEDGNWCVPQLNFNDSGTDRVSDEDVKYHIGLNNEVTNGSTDR
FT                   VCSGIFLHSLRFNWLNHFDVIDSLPKWVNDFNIPTDLHIPTL"
FT   CDS_pept        484916..486829
FT                   /locus_tag="TA16805"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.75 - score = 62.54"
FT                   /db_xref="EnsemblGenomes-Gn:TA16805"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73090"
FT                   /db_xref="GOA:Q4UIJ9"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ9"
FT                   /protein_id="CAI73090.1"
FT                   /translation="MSEDCCIFYRFGSEKNIWRELHSQSSSGILISDLKIKIAQESSLT
FT                   REFARKTNLLISLYDDNKPNELFPLDDNIVIHSGSRLIINRVAWTPSKPIVHQAKSYID
FT                   VTVGGKVPGKRKLPISLICQLCHKPLNQPYLVKCSARCGCTGCKNCLEECLGESLPDFN
FT                   STDPYQSDQNIEIKSKVDLPSDDDLGNNVKLEDDKINVKLENYEDDVKLENYEDNIKLE
FT                   IMENVKLENFDELEYNLVANVEDEMCEMYLLEEKKGCPFCGHGFVSACLKNRKLQALLE
FT                   GIDIETFEVPEEIEFYFPTPHSLAFTHQQFPQHFLLEIQSDLYQLVLEKMLIPVFDSSI
FT                   LDSNVVKYHTTNVDNINLENDEKSEIDESSDNNLNAENVNLVKSENFEKSSNSSEVDQV
FT                   VNINIDESVICIILVRPQPDVISLCGIMRLLYEMPDVDFLNKTGSRTSLKFDWIKHNTV
FT                   PINVPATKQPLYGLLGGKKYTNVSLNSEGEVMWRYKTERMVEVGIDPKCYNSILLSLFN
FT                   NLDIEMNLEKSKKNWLQTFFPSPQPLYVTGSGKVVKESDIAEGDEVDKGNPFLGYAGLF
FT                   PFLSRSQFDQVRKTQRRVKEQYLKDLTKQIMVNTHPDKGRLLLEKLNHNIWFSNIEYTT
FT                   ST"
FT   CDS_pept        487076..488194
FT                   /locus_tag="TA16800"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.75 - score = 62.54"
FT                   /note="SMART 1 transmembrane domain at aa 112-134; CPDc
FT                   (SM00577) at aa 183-309, E()=1.05e-21"
FT                   /note="1 probable transmembrane helix predicted for TA16800
FT                   by TMHMM2.0 at aa 112-134"
FT                   /db_xref="EnsemblGenomes-Gn:TA16800"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73091"
FT                   /db_xref="GOA:Q4UIJ8"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027111"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ8"
FT                   /protein_id="CAI73091.1"
FT                   /translation="MKRLILRKIYFYVKSSSFYSSSFVHSQKLFFSQNNTSSTKIVDNN
FT                   ASFHELNSKSQPSNSNNIQNTSNQSPKPEESQNSTESPESRESPKSQESDDPEKDFKTG
FT                   SKLKRFRFLPFGIYGGALLVFSGFALSYYIDRGKDLKGLKFSQVLDDLTQYVYDTIEEF
FT                   FPTDNSPLLPDFKELNYPPNLPTLVLDLDKVIAKMEYDRKLGWRVKKRPYADNFFKELI
FT                   NYYEIVIWSDDAYPVAYDIANHWGLPVIGCIHRDHCKKFKGSYIKDLSRLGRDLDRVVM
FT                   IDHDKTACALQQDNCILIKEFDGDENDEELLLLINLLKTMAINPTDVKAQIRELGGGHD
FT                   YGIGRRFSERFCMKQKIAEKRMNLSKMMGFKH"
FT   misc_feature    487409..487477
FT                   /note="1 probable transmembrane helix predicted for TA16800
FT                   by TMHMM2.0 at aa 112-134"
FT   CDS_pept        complement(488616..490724)
FT                   /locus_tag="TA16795"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.cand.20 - score = 41.34"
FT                   /note="SMART 9 transmembrane domains at aa 346-368, 375-
FT                   397, 402-424, 437-459, 479-501, 508-530, 564-586, 606-628
FT                   and 634-656"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16795 by TMHMM2.0 at aa 346-368, 375-397, 402-424,
FT                   437-459, 479-501, 508-530, 564-586, 606-628 and 634-656"
FT                   /db_xref="EnsemblGenomes-Gn:TA16795"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73092"
FT                   /db_xref="GOA:Q4UIJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ7"
FT                   /protein_id="CAI73092.1"
FT                   /translation="MAGDDPIKIVNYTFAGLSMMLNIRLVYSASPYALLRFKLPENLFS
FT                   VFVRVMASSLELWCLPSMVIGNIMDVVDKYIHEPHEQRQYDDAPKYDVGGDRLRLKAEE
FT                   LEKVAKALQTKATIAGGNLVNVGTKAQALASAAGNLANNSGNADSVIDNYNTLEGEYNK
FT                   LSPANKAEQDKVSKEFNAVKEIYDRMLNVKKAKLLQAQVGEQVGVGVNQKIWHHANELY
FT                   KKANGLASADKLKPELIKLAEALKNAIGESTDVDGLQKALKELKDAGTDPKELITKAKE
FT                   VIQKYNVVKDAYGKVSEKKTEYTGAGANSQYGPVESQFQALEGAYNKGKCKAISLIYDK
FT                   EHIRYQSIFWSWCNFFTFVILFIVFIPGDQGHVTVFYWVIAASGFVFGINMVMVYAMEY
FT                   EYFPWYIAGENSFPIITSFMHYVSTLMFGNRRKWNSDYIVVLVDMVISLAISLTAASLW
FT                   TYCYIKPSTHEYFGPSSINGAIVSPILMVLVGMGLVYAIYPAIAPGMIVPFYLIDKIEM
FT                   VLLILTTFPPLIFATLRKLYGFQDPKQPMCGWSNPTVFWKPDADGRFWHTFDILMPLQI
FT                   SLAFIFIYSLHYRDSHISRAIINQPKMSTFLSIVFYMCHEVMLALGFPGMIGNNGGDMV
FT                   MLPIQLIGAFLMVLLAFYSIGYITEYKRHDPSQWPTEAMTKWNALCYWLKMASKITNKN
FT                   FKQLFTTD"
FT   misc_feature    complement(join(488757..488825,488841..488909,
FT                   488967..489035,489135..489203,489222..489290,
FT                   489348..489416,489453..489521,489534..489602,
FT                   489621..489689))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16795 by TMHMM2.0 at aa 346-368, 375-397, 402-424,
FT                   437-459, 479-501, 508-530, 564-586, 606-628 and 634-656"
FT   CDS_pept        complement(490820..493423)
FT                   /locus_tag="TA16790"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.cand.19 - score = 103.70"
FT                   /note="SMART 10 transmembrane domains at aa 20-39, 505-527,
FT                   534-556, 561-583, 596-618, 654-676, 689-711, 740-762, 783-
FT                   805 and 815-837"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16790 by TMHMM2.0 at aa 20-39, 505-527, 534-556, 561-583,
FT                   596-618, 654-676, 689-711, 740-762, 783-805 and 815-837"
FT                   /db_xref="EnsemblGenomes-Gn:TA16790"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73093"
FT                   /db_xref="GOA:Q4UIJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ6"
FT                   /protein_id="CAI73093.1"
FT                   /translation="MSHKCSAKQAGVGVADCELLIISYIFAGLAMMLNIRLSYSSAPYA
FT                   LIRFKLPENLFSVFVRRIASALELWCLPSMLLGNIIDLIQKLAVNTDGDLKASAGTGPT
FT                   DHEKLRGLAKTLHDKAEELNNAVTGGSEDAAKVLRHKAGTEAQKSDTKYLRKLAKELHE
FT                   KATRLENQAPEGTDNPSLKQKAGSTPDDGLRQLAAELYKATKELSNTGADDQGKAGELA
FT                   TAVGDSETSEGIRAKLKNLATGTGDAEDVTGAYGTVESAFGQVQQQEQQGKYTTGDKQE
FT                   KYQAVKTAWEAFKTLYTTNLKQLANGLKVTVGNESDSDKLQKTLADLGNHQGAEAPTTE
FT                   ATKVKTAYSTSGGDGVKDKFTDLQAKGPSYQAIAAIKPLYEAVVSAMNAFDNVYRPEEL
FT                   LKDEVGDGANENKGLQQKLKELYTDGHDTEKLPGLAKAVRNAYSEGWGPTVKSRFESVM
FT                   AQEKAYAQGNTIKTTEYKGLLEAWTNFNDKYYGVISYYKYYSIVVPSVITQWLNFLTYV
FT                   ILFVVYVAGGDSGHLTIFYLVIAISGFVFGINMTLVYSVDWNYIPIYIAGENCFPIITS
FT                   FIHYITTIMFGNRRKWNSDFIVVCVDIVVAIIISFVAAVIWTAAYLSKPKYASSPETGA
FT                   SWYHHIFTHGFSGGYNPEVISPFLMIVVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLL
FT                   IMTIFPPVIVATLRRSFAFGDPRSPMCQWKEKAGYPWNPSADLGNGSFWHAFDLLMIIK
FT                   IVLAGIFIYSLHYRESNLARSIINQPKMSTFLSITFYMCHECLLALGFPGLVGANNGGD
FT                   YVLIPQYIGALFMIFLAFYSEGYIIEYKSHDPAHWPTEGMWYLYGYYQLNLDFLL"
FT   misc_feature    complement(join(490913..490981,491009..491077,
FT                   491138..491206,491291..491359,491396..491464,
FT                   491570..491638,491675..491743,491756..491824,
FT                   491843..491911,493307..493366))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16790 by TMHMM2.0 at aa 20-39, 505-527, 534-556, 561-583,
FT                   596-618, 654-676, 689-711, 740-762, 783-805 and 815-837"
FT   CDS_pept        complement(join(493630..493703,493733..493825,
FT                   493852..494229,494261..494593,494629..494956,
FT                   494999..495121,495168..495226,495257..495636,
FT                   495699..496072))
FT                   /locus_tag="TA16785"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.19 - score = 103.70"
FT                   /note="SMART pfam:dor1 (PF04124) at aa 3-354, E()=3.30e-
FT                   02; pfam:Vps53_n (PF04100) at aa 14-423, E()=4.50e-13"
FT                   /db_xref="EnsemblGenomes-Gn:TA16785"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73094"
FT                   /db_xref="GOA:Q4UIJ5"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ5"
FT                   /protein_id="CAI73094.1"
FT                   /translation="MESKSYDLNKLLENPVGFLNENFPDEYSFYAIDSLISQLDDEIRA
FT                   HDASLIRLFEDKAVAGDRVHERFENLQLVTNKLEAKISEIKDQSKKGESSLKLLSSDIR
FT                   ALHNAKINICDTIVTLKRILMFSHMLDDLSKHAKERSYAEASAHVVVLKELRNSLNPLK
FT                   KSPSVCKLLSSCDSLLHKLREQIVEDLEHKLRLKMLDAQLVEQQLQLDKLCLCADLLDE
FT                   TIRESISNKYSQHLKNLYENNFYHSFDLKTVDNLNHRFSWFRRTLNEYNEGVGLQIPMN
FT                   WYIYEKSAIAFVQSLKSQLIVNFSYFENFIIEVLNESHQSLSANSLVSCLLRCREFEDE
FT                   LENKFRQNYSKAISENKDKVKAADSVEFPEVLSEVNEEEKVGKQPELGRMLSSCFENYL
FT                   GPWIASEESQLDDLLSRIISDTDSSIMFVFVSARELFSSINARLQVTMTISSEQALYEM
FT                   FLVFRKIIAKYQQHLSGRFALVKRTTDLELLAKITGNTIATADYCLEMIDKLSDEIRDN
FT                   ISHTYSGLITFTNEKEKISAVKSDSFKLLLDFMCTFLPYSTEANLDVSGPSDLLLKNEN
FT                   LIIKRLEVSTKYLPSVYLYHITNKISRNALAHFKDFIFSLNSVTEVLTQQLLLDTFELR
FT                   RFLTDKLKELLVTLPQGMVYSVFSYMESILNEIDKIESMIKVLTTPNNCKESFEGFLTE
FT                   NGGPCTQQELDILLNIKRL"
FT   CDS_pept        join(496302..498231,498291..498742,498822..499127,
FT                   499183..499569)
FT                   /locus_tag="TA16780"
FT                   /product="alanyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.7"
FT                   /note="Tap821d03.p1c.C.cand.76 - score = 78.15"
FT                   /note="SMART pfam:tRNA-synt_2c (PF01411) at aa 81-821,
FT                   E()=1.90e-293"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="1 probable transmembrane helix predicted for TA16780
FT                   by TMHMM2.0 at aa 2-24"
FT                   /note="Signal peptide predicted for TA16780 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.620, signal anchor
FT                   probability 0.295) with cleavage site probability 0.492
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA16780"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73095"
FT                   /db_xref="GOA:Q4UIJ4"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ4"
FT                   /protein_id="CAI73095.1"
FT                   /translation="MYISCIINILILVYMFGCFSLALRPNKSNFLSYKPFTQSLLYINN
FT                   NILSSNLLSNKYFLRSFSNYNNLTKMSTNGQVKGDWVRKQFIDYFVSKNHVHWPSSSVL
FT                   PNNDPTLLFVNAGMNQFKDIIMGKSDENSEFGKLKMVCNSQKCIRAGGKHNDLDDVGQD
FT                   CYHQTYFEMLGNWSFGAYFKEEAISYAWDLLTNVYKLDPNRLYVTYFGGDKSCEVDNET
FT                   REIWLKFMPASRILPFGSKDNFWEMADTGPCGPCTEIHYDHIGGRDASTLVNADDPNVV
FT                   EIWNIVFMQYNRGENGVLERLPKGCVDTGMGLERLCSVLNNTNSNYNTDLLNDIIQYIR
FT                   ELLPGFESYKGGNTPLDVAYRVVSDHVRCLSVAISDKVYPSNEGRGYVLRRILRRAVRY
FT                   CRDYFNTKEPFLYKLVPSVTKLLGNAYPNLLTEQANIESIVLDEEKLFLQTLDKGVEKF
FT                   KKMVSKSGNKVINGPDAFLLYQSYGFPLDLTMLMARELGITVDVDGYYSELKLHQQKSE
FT                   SRVYTDLNSLESRCDKLLKSLSADRINTILKMCNNVYTDDKLKYDWDSSDPVAKVYKAK
FT                   LVSTVTLDSVMSELQCDDDDLVCLVMDRTPFYAEGGGQIYDTGYINDLEVLRVYKMSGL
FT                   VFHFCLSKKSGVLRCGDEFELKVDYERRVRVASNHTSTHILNFVLRDMLDESSYQRGSQ
FT                   LDEEKLKFDYCYNQQLPEDLIRRIEDRMMDFVRSEAPLRTREIEYKNALEIPGIRANFD
FT                   EKYPEVVRVVNVQLGSEDFSGEHTSTEVCGGTHLTNTKTIQDVAVVGEEGISKGVRRLT
FT                   LVTNEQCRKSKADLLHYEKRLEELEKNLKPINFTKDDTREASLNAAENMTRLTALRGEA
FT                   EVHKMLPLLGKRNLMKKFEQLIDQQVSAGKAHQKRLANIAKMKAVEVVEKLQSQKYDEV
FT                   EFTEKTSEHPAVLRASVDDLEGDLKSLNVFVQTISKTFPQIAVLASSVGINAVCCRVNS
FT                   PNASYSALKAANLIATQLNLTNGTGIITNTLFIIL"
FT   misc_feature    496302..496367
FT                   /note="Signal peptide predicted for TA16780 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.620, signal anchor
FT                   probability 0.295) with cleavage site probability 0.492
FT                   between residues 22 and 23"
FT   misc_feature    496305..496373
FT                   /note="1 probable transmembrane helix predicted for TA16780
FT                   by TMHMM2.0 at aa 2-24"
FT   CDS_pept        join(499698..499862,499892..500042,500073..500166,
FT                   500233..500320,500357..500827,500905..501015)
FT                   /locus_tag="TA16775"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART WD40 (SM00320) at aa 222-263, E()=1.92e-01;
FT                   267-309, E()=4.44e+00"
FT                   /db_xref="EnsemblGenomes-Gn:TA16775"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73096"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040323"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ3"
FT                   /protein_id="CAI73096.1"
FT                   /translation="MQILNPSAYQNINKSEENIFYALKKNSRSLVPVPSDNSKKHRFCV
FT                   GTFENSDTNQLEIVSFDEESSTISQETVVNNLLPVNQISDFYSTENETHLLVSFTNLSE
FT                   KGSFLSLLTYKSDNSNSHNFTSIGDKLFKKFKQLSVDPHSTLNSTRFSIITTDSLHIYS
FT                   NYKEELKYSCDREGGNQYSNNYFVGKFDPHNKDLFTVSIDNYFNTIDLRQTQEKSSDSN
FT                   KVCSSTSVGYHSGIILDINYNPNVPNELVTVGEDTILLVWDLRNTLKPVKSFSTGHGHW
FT                   VKKVLHNSFHDHLLLTSGSNGSYLHMINRGKLDNITTKSTSCKDICWSHDDAWIYCSLL
FT                   NNNLRIDTVPRDIKHSLLS"
FT   CDS_pept        join(501040..502171,502213..502472,502528..503046)
FT                   /locus_tag="TA16770"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.77 - score = 65.55"
FT                   /note="or 7, fibronectin/fibrinogen-binding protein,
FT                   putative; but no relevant pfam hit"
FT                   /db_xref="EnsemblGenomes-Gn:TA16770"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73097"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ2"
FT                   /protein_id="CAI73097.1"
FT                   /translation="MYKKVFIVMLIKLINRKSLCFISNKLTTNFRFNGLKIPISTTRNL
FT                   QLKSQVPGQLPQVTTQTLDNHDISQNTSNLPDITKQICDKYEQIRTDKVELLEVDNGVL
FT                   KKNLCLKTYCNLVKYAKELNTVFDKSTFIGCTLLEQEKNKNDSFDYNDGSQMGVDKCIL
FT                   HFRGYERGELLCLCFSPKFFPLIPTPSVPYRSFTERRLEYFEHVLSGLTGLRLSKIRTP
FT                   YHFRNVISMDFADAVDSDKVIYKLIVLSDRTNKLLLVDSSDETVLGSSETLIDPKDNPV
FT                   GDNGEVGRTFSLPVINKKTPRVDESFEEFRLNFKNLNNMTIIKAMLSVYEGIDYTFLTS
FT                   LCSKLSIDPSTLFYRIPDLNLFHSEFINKIRQTIDNSGGYNDMIGMIYNIYGGTSPVYR
FT                   LNRLLEKTTKLSVEFKDKLEKIAKQCADDENYEKLSMVNEKIENITDYQNAINDIKLTN
FT                   DVKKLPNLEEFHDQLLMINDLKSYKILKKKKKVEKVKVLKVTKKTKKVGKILHVPVNDR
FT                   DDSPMMIVGKNAKQNEVVTHDMREKGDLWLHTKDCPGSHVILRNFRNDDHSIQIAADVA
FT                   SFFSKYKQFDNVQVIVAEIDKVKKEKNSQIGAVTVQEFKTIVGSPKRGDHFIQQHKLKS
FT                   A"
FT   CDS_pept        complement(503205..504563)
FT                   /locus_tag="TA16765"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap821d03.p1c.cand.18 - score = 16.91"
FT                   /note="SMART 10 transmembrane domains, at aa 20-42, 118-
FT                   140, 147-169, 173-195, 216-238, 268-290, 303-325, 376-398,
FT                   419-441 and 451-473"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16765 by TMHMM2.0 at aa 85-107, 114-136, 140-162,
FT                   183-205, 235-257, 270-292, 343-365, 386-408 and 418-440"
FT                   /db_xref="EnsemblGenomes-Gn:TA16765"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73098"
FT                   /db_xref="GOA:Q4UIJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ1"
FT                   /protein_id="CAI73098.1"
FT                   /translation="MMLNIRLSYSSAPYSLIRFRLPENLFSVFVRRMASALELWCLPSM
FT                   ALGNILDVGYKTIIYSNTESKFLGNNDDRLSKFRYIICPSIVTQWLNFLTYVLLLVVYL
FT                   MGGDQGHLTTFYFVIAISGVVFGINMTLLYSVDFHYLPVYIVGENSFPALTSLIHYLAT
FT                   LTFGNRRKYNSDFLLVEIDIVVAIIISFVAAMVWSIGYGYFAGQLSNPASPADTDLKHI
FT                   YSFGFIAKFRPEQISPFLMIVVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATIFP
FT                   PVIVATLRRTASKTSIWSHYQSPMCKWGYDETTQEGSAWKWKNTGNTTDESGANRASAS
FT                   FDAFFWHAFDLLMVIKISLAAIFIYSLHYRESNLSRSIINQPKMSTFLSIVFYMCHECL
FT                   LAIGFPGLVGANGGGDYVLIPQYIGALFMIFLAFYSEGYIIEYKSHDPAHWPK"
FT   misc_feature    complement(join(503244..503312,503340..503408,
FT                   503469..503537,503688..503756,503793..503861,
FT                   503949..504017,504078..504146,504156..504224,
FT                   504243..504311))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA16765 by TMHMM2.0 at aa 85-107, 114-136, 140-162,
FT                   183-205, 235-257, 270-292, 343-365, 386-408 and 418-440"
FT   CDS_pept        complement(504832..506976)
FT                   /locus_tag="TA16760"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.17 - score = 37.49"
FT                   /db_xref="EnsemblGenomes-Gn:TA16760"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIJ0"
FT                   /protein_id="CAI73099.1"
FT                   /translation="MDKLLLLLNNNFKNNLKWIDLSKRFYRTKHRKKVSVELNKPSLYD
FT                   PKRTTPSKLLKANLFTPESAGPRELSMLCFWIVNYGYADYSILSRYVQCAIDNIKKLKI
FT                   KSLALIFHSTSKFIYNNTISFIESNQQNIESKESNDETNTGIDEFVQREQLIKKCMKLI
FT                   IDASPILPNLFVNAVPKDLGMISLSIINIYESFLNECDSNVDSGTDELDLKSISLKVNK
FT                   LLHRLSDEIIPKLPFCEIDEFAAFSKSFSKINTDWSRHFMRELSLEISSLLMEKIEDLE
FT                   LLMQNKYIGEDLIEELNRFPKELSTVTCALSRLKINEKRFWERSQTLIFLLIKLKNKDF
FT                   GIKEIDTTTLTLLSTSMCNYSNVSDVVMELLRVCNESHQPSVLVGFNTSVRVLKDDSLA
FT                   SKFLELVDMDQVMELDPKLVSQFILNCCKSTCDRTKIIDKISSIPLDQLHNELLCTVYI
FT                   CNKQLNINPETKVDLCNRIYLNADSLETNLLVTISLSSIQSIDEECVKNLCKKVLDILY
FT                   NRIEEIPSTVIPSLLSLVLNHFPGNLNIIKRFCKKIDTSDFNIDDLSHIFTKIQSMGLN
FT                   INKLFTKNFVKIKEINDVQHDYSFDPVQSDSYDNNLELTPYNESFDIKFTECDEDEIMK
FT                   ISKQTLKKTESVPFLDLDDFKDLKTPNNSPQFNVTKFPSNYDIIDEPDVTDRTLFRGLP
FT                   NANTVDDLKTEWYNFRNNIH"
FT   CDS_pept        join(507421..507684,507749..508868,508904..509024,
FT                   509075..509309)
FT                   /locus_tag="TA16755"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.79 - score = 48.88"
FT                   /db_xref="EnsemblGenomes-Gn:TA16755"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73100"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII9"
FT                   /protein_id="CAI73100.1"
FT                   /translation="METNLSRLECKLKEIILDSREGHSTNYSKSVREDHLHGCAYGKNA
FT                   FTLDDPATGTTIFMPWKLHRPLELLFFKHSNNSTMSHASFKSFVDEFELFPKFQNARKK
FT                   EDILDYILLKCNKNNDFLRTFKNLDIYLLEFEEFLLALFLLAKYRASVLHTNEQFSFND
FT                   LLNSLLSSNLDLNLDALKQDAGNQTDDVVNRQDAGVNATRSVSQNLDGVIYHENGLIVD
FT                   TNIGKVFESPRKLETKEFSDTVKELNNSKNDVDEPRSRVNHSGTVDTDLVRRLLEVLRD
FT                   QNLLHDSRNMQERLEREIKLRDDLESRYIDRLNKVESEKDELNKEYVSYKINFSKLRVD
FT                   FDNLEREYGQYRTEKESDLSKLNSLNRQLTTDLAEANKMLERQKHLRDRSQKTQKLLML
FT                   ETEFEVKLFSIFCVYKEEFPVDGEFVLSEEQLVCFCLDFGLGESSPPANPDDLPKAKQA
FT                   YNQVLEFCHDGKLTYNLFKEFLMCFGQLLKPKLLPEEAFRSIVFNLIFSGTNNYYEDDE
FT                   YHPVFITDDNDPWALDPNDQQVRANKPNASNDINIEGRVWFKNRQEQLKSQLGNDRLTP
FT                   RFE"
FT   CDS_pept        complement(join(509875..510213,510245..510312,
FT                   510364..510461,510490..510562,510593..510635,
FT                   510666..510770,510801..510890))
FT                   /locus_tag="TA16750"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.16 - score = 36.05"
FT                   /note="Signal peptide predicted for TA16750 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.739, signal anchor
FT                   probability 0.018) with cleavage site probability 0.560
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA16750"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73101"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII8"
FT                   /protein_id="CAI73101.1"
FT                   /translation="MLIFRFFINKFVLIYLLNVITHCSPDIAKLEDDQRILIDSLKRSK
FT                   DFKHELDQNFNFLDKNNDKKSLNSFSSTIPVENEANVTMFETNYSPPIIVLLPEDSSSR
FT                   EKWEYAVTLKCLGQKNFDAFTNIHNTRMAKMASISGTTVKEIGEEIKETEQELQKVRKE
FT                   LEEVTEKQKGLGTVGKNDYAKKTRRLHIEHNIKLLKQEIHVMEVKLDRLNNRLKSAILF
FT                   GNKSENTENSENYNENDEQSDEMENEEGGRDNEDENGVEDNDEEYDEEN"
FT   misc_feature    complement(510822..510890)
FT                   /note="Signal peptide predicted for TA16750 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.739, signal anchor
FT                   probability 0.018) with cleavage site probability 0.560
FT                   between residues 23 and 24"
FT   CDS_pept        join(511063..511136,511175..511692,511743..511801)
FT                   /locus_tag="TA16745"
FT                   /product="DNA repair protein (RAD10 homologue), putative"
FT                   /note="Tap821d03.p1c.C.cand.80 - score = 17.34"
FT                   /note="SMART pfam:Rad10 (PF03834) at aa 10-76, E()=4.50e-
FT                   20"
FT                   /db_xref="EnsemblGenomes-Gn:TA16745"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73102"
FT                   /db_xref="GOA:Q4UII7"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII7"
FT                   /protein_id="CAI73102.1"
FT                   /translation="MNNTPINDDNNLIISPRQRKNPILRFIKNVPYIEGDIAPDFIISS
FT                   DIYVLFLSLKYHRVNINYIKNRLESLSQYKIKNLFIICQIDVSDYNQLLSKFLDLQWTI
FT                   VNLLTITFGYGCKILLSWNARESAAIVEILNLNRYRGIESISKKTYMSHRESVTNLLLN
FT                   IRSLNNNDVNFICEKYKTLKEIMHFDPKTVMDIKGLGQKKVEALSAAFTNNFY"
FT   CDS_pept        512534..513265
FT                   /locus_tag="TA16740"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.81 - score = 18.75"
FT                   /db_xref="EnsemblGenomes-Gn:TA16740"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73103"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII6"
FT                   /protein_id="CAI73103.1"
FT                   /translation="MENDLRSKATAIFNNLNRFLNSLNYKEPNNVGSESSSKDNFPDSK
FT                   FSVSDPNNLKNIEKYLSENSDGFSSKFNLLCSFNTIYSDILLEDDPIGIPLKPIYYTNL
FT                   SRLGTEDQVLPSANLDSHAQDDPNADFELISNLSSEAGGDSDEDSFVCSVDSNFVNYTY
FT                   WSVETGENVSSTSKPTYFNAKNCKISLLQEAEAFVAEALWGSDNNLFKITPRHLLLQSA
FT                   QIANRAFFDPDYRKYLQLNYV"
FT   CDS_pept        513907..517137
FT                   /locus_tag="TA16735"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.82 - score = 29.23"
FT                   /note="SMART 11 transmembrane domains at aa 12-31, 41-61,
FT                   68-90, 94-113, 126-148, 158-180, 237-259, 279-301, 308-325,
FT                   340-362 and 764-786"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16735 by TMHMM2.0 at aa 12-31, 41-61, 68-90, 94-113,
FT                   126-148, 158-180, 237-259, 279-301, 308-325, 340-362 and
FT                   764-786"
FT                   /note="Signal anchor predicted for TA16735 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.004, signal anchor
FT                   probability 0.936) with cleavage site probability 0.001
FT                   between residues 37 and 38"
FT                   /db_xref="EnsemblGenomes-Gn:TA16735"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73104"
FT                   /db_xref="GOA:Q4UII5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII5"
FT                   /protein_id="CAI73104.1"
FT                   /translation="MKKRVPDAGDFLESYFLGLSCLVCSEQFYILISQTKASPNFQWYL
FT                   LLSTSFVTLTLVLILYNKTYHDFINLVHYYYLYLPALLICFVWLKVTSVLITTCTTIGI
FT                   GFLTTFLIIEACVHYSSNAKFLLAFVAGLLSARILPSFCWILIAKYDYESQSRSVSLIL
FT                   SIARFSFCLISLCIKFMKGGLSFDQVKSIEFKSDQFSFDLCTKVFTQLYEFYSRRITND
FT                   LFNENGNNKIYLTILNYLMHFSPIFCFFFSIIFFLPLSPVMDAHLNRNSNFIYAPHVIR
FT                   SLSRLEIACHLLGFYIGILFPASYSENLAFCFINIFNISIRFIIEGCFSFFLKNFPNIG
FT                   IYLMVIIYSTLNGYVCSYNLFVIIRNTFHNCKNKEYNEFVCCGDEFLTQCYCRYPAILN
FT                   ERNEYYCSRTDLCTSKLKVNLVKKGSINITVNLTFSIVSFNLNRFSCSKSFTEHNSLEY
FT                   SLSGSNAILLVQKGEKTEINEICSQVKCDGKCCQNPCKTEKCGCLRLCGIYEIETVTTS
FT                   TCDDCQLTVRIEGKNCNQCSDCAGSGSTGTCSCSVTGSNCCCICVKCCRCNSCNPPCNG
FT                   CTKLCCCENCKKLVKSNRTRVFLFFKTFNQKCFIREISPVNTPNFERNRKQLTEFYIDS
FT                   IFILDCCHSDIQVDLHCRFCEDLLRITPVQYPRKWDNPKVIKLCKNIKQCCEKKPEGQC
FT                   CCTNVLLQRVIVGYSSKTEKSEYEKCKCPASLASCSCCLTGKCCCCICAELKITPENSF
FT                   DTTMKPVKIKLISIFWILFFLILIFTYLIMSSVKVKELKYYDFNPVTSYETIKEKIKRN
FT                   KLNSADGVKHRIDGFLMNSGLESKEYDSQLEHMIKLFECTFDPINFTFLRNHLEEVSFK
FT                   LLNDPVFILKTKIEMIKWSCCLGLIYTYVMEMFIRIQIFFVNWEYVWEKEYKYYRMKMS
FT                   NRINQITYESKFGVAGLSEYGIGLKAYMSIAKSRKDTWSSALYNLENYLDLYEGEIEFK
FT                   EKQFPESLDERLQHYIDMWNNRIGHLEEWIDTEIIFFDWTIFLEDFPSIKTWVNMFGKY
FT                   VQGAFDEVVFDEKKFNKGTKIFLIDKIK"
FT   misc_feature    513907..514017
FT                   /note="Signal anchor predicted for TA16735 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.004, signal anchor
FT                   probability 0.936) with cleavage site probability 0.001
FT                   between residues 37 and 38"
FT   misc_feature    join(513940..513999,514027..514089,514108..514176,
FT                   514186..514245,514282..514350,514378..514446,
FT                   514615..514683,514741..514809,514828..514881,
FT                   514924..514992,516196..516264)
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA16735 by TMHMM2.0 at aa 12-31, 41-61, 68-90, 94-113,
FT                   126-148, 158-180, 237-259, 279-301, 308-325, 340-362 and
FT                   764-786"
FT   CDS_pept        join(517305..517667,517734..518348)
FT                   /locus_tag="TA16730"
FT                   /product="phosphoribosyl pyrophosphate synthetase,
FT                   putative"
FT                   /EC_number="2.7.6.1"
FT                   /note="Tap821d03.p1c.C.cand.83 - score = 23.41"
FT                   /note="SMART pfam:Pribosyltran (PF00156) at aa 149-294,
FT                   E()=8.10e-24"
FT                   /db_xref="EnsemblGenomes-Gn:TA16730"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73105"
FT                   /db_xref="GOA:Q4UII4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII4"
FT                   /protein_id="CAI73105.1"
FT                   /translation="MVSYFPSTKSSEEVKTLYFTGSYSKDLAESITSKLVVKLTDFKLS
FT                   RFADGEISLDMGDDLFNSNVVILHSTQPPANDSLMELLLMVSTAKRAGASTITAVVPYL
FT                   CYSRQTDKHTKGSPISSADVALLLQAVGLQRLITLDIHSVVCSGFYNHTLFESHLVHSV
FT                   AVKYFLALNLHNVVVVAPDAGAQKRALNFTQEYNAILKDKPELLATTALVYKTRSEANK
FT                   VDSVYISGSVEGMNVILVDDMIDTAGTIVKAAELLKERGALKVYAFVTHGLFSGPAIER
FT                   INNSHFEKVVVTNSIQQPEAVTNSSKVVVLDTSEFLANLLKNQP"
FT   CDS_pept        complement(join(518495..518637,518688..518775))
FT                   /locus_tag="TA16725"
FT                   /product="U6 snRNA-associated Sm-lke protein, putative"
FT                   /note="Tap821d03.p1c.cand.14 - score = 9.91"
FT                   /note="SMART Sm (SM00651) at aa 8-72, E()=1.37e-09"
FT                   /db_xref="EnsemblGenomes-Gn:TA16725"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73106"
FT                   /db_xref="GOA:Q4UII3"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII3"
FT                   /protein_id="CAI73106.1"
FT                   /translation="MENSSPSAYISSITRKPVLVKLNNGSDFTGTLASLDERMNLAMEN
FT                   TCEYLDGVLVKSYGDAFIRGNNGIFKLYINF"
FT   CDS_pept        complement(join(518832..519062,519105..519230,
FT                   519283..519472,519619..519845))
FT                   /locus_tag="TA16720"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.13 - score = 18.17"
FT                   /note="SMART 1 transmembrane domain, at aa 217-239"
FT                   /note="1 probable transmembrane helix predicted for TA16720
FT                   by TMHMM2.0 at aa 217-239"
FT                   /db_xref="EnsemblGenomes-Gn:TA16720"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73107"
FT                   /db_xref="GOA:Q4UII2"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII2"
FT                   /protein_id="CAI73107.1"
FT                   /translation="MATWFNSFVDNLSAKKPTSEQPKPSQNQPGCHIYAIVVMRHFASK
FT                   EACRLSAEYDFSPLPMYISKISREVTDLVSRTCAQEAFPDQSKGVVMENNMGTFYVKAT
FT                   NCPPPNQLVFIAAVNNECTKYQALQFLHEAIQIYKPAGNVVRDNVGDALRHPELRSLML
FT                   KYKGKRDVLLDAQTKLDETKMIVMDTLDGLINRQGNLDELIAKSHDMTQSTAKLMRLLI
FT                   STQIFIKINIIIYFNFIFDYKTILGMPEGGTVVVV"
FT   misc_feature    complement(518889..518957)
FT                   /note="1 probable transmembrane helix predicted for TA16720
FT                   by TMHMM2.0 at aa 217-239"
FT   CDS_pept        join(520396..520473,520620..520706,520750..520947,
FT                   521124..521480)
FT                   /locus_tag="TA16715"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.84 - score = 13.21"
FT                   /note="SMART pfam:PH (PF00169) at aa 133-233, E()=5.50e-03"
FT                   /db_xref="EnsemblGenomes-Gn:TA16715"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73108"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII1"
FT                   /protein_id="CAI73108.1"
FT                   /translation="MLESILPLKGTSRSTGEPLFPAEIFTNYDSSITGLIKWNLDDCVF
FT                   GFKSNFLIDKVTGQSSVDLPPSKVEHSLQRPTKEKKKEGERKKLRRPTYPPRLAQMFGD
FT                   GTNEEVFEDHSHKEEKIRPSKELRAERVSVFQGNLYQKVKVKSPDKSGKFIVNCSDDGL
FT                   KLEISTPTKSGEEPGKVVKELPVSQVSQVKTTSHNINQLEITVSNVVYTFTFKSREDRE
FT                   RWQNNFDEFRKFSRLIQ"
FT   CDS_pept        complement(join(521572..522666,522732..523574))
FT                   /locus_tag="TA16710"
FT                   /product="TFIIH subunit, Tf2b homologue, putative"
FT                   /note="Tap821d03.p1c.cand.12 - score = 45.77"
FT                   /note="SMART pfam:Tfb2 (PF03849) at aa 27-514, E()=5.80e-
FT                   14"
FT                   /db_xref="EnsemblGenomes-Gn:TA16710"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73109"
FT                   /db_xref="GOA:Q4UII0"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UII0"
FT                   /protein_id="CAI73109.1"
FT                   /translation="MSEVLENDQTEEEESEAQSIIEENFFNYLKELDEQVWERLFRVKA
FT                   CLVALFRSLGELEKLIIFRLLYIDQSISEKPLRLWMRAHSIADLKHSLTLLQSYKIITV
FT                   LENTTNDEKQQYKLNDGFKNGFVTLLSDDSSYKYSYELVKLESILVSSTKTKEPTKNSN
FT                   NSYHDTVTEDHVSKTAEKAVENTTEELTEETPRNKNKSLITLDDLVKHAKLKLDFILLF
FT                   LVSPEARKGTMLVNKILRKIKRLKKQSDETKNDKKIENLEAKFNRLSKNSGVISQDLLQ
FT                   ILRRFGMVDPAKKNYKSSKTVGTKMSRQTLSWLLKDVTSQMTSLLVGHLQNLDNGYLTN
FT                   CKSMNRSSEDSKKSSLELKEASMKTVTESVELLLSLSQASCGDCFSTEGLTKTQIRLLR
FT                   LLNELGIVYYKNPKKFYLYDLSYIVGKTNTNSVLPNSKDLDISIKAGNDSRIIVQSNFK
FT                   VYVYTASPLQISVLSHLCELQARTPNLVVGVLTRESVQSAFKSGITSKEIIRFLSPNGM
FT                   NSSIGSQENTLLNSSFTYSIPENVCRQLKMWESERDRIELCPSIVFKRWDQDFMPDLFQ
FT                   RTVRWAQSKRYELFYTQWPSDPHSPEYHEWISKEKYLACNLEFKEEVINQIRLIRADIS
FT                   AERQAKISSG"
FT   CDS_pept        complement(524200..527136)
FT                   /locus_tag="TA16685"
FT                   /product="polymorphic antigen precursor-like protein,
FT                   putative"
FT                   /note="Tap821d03.p1c.cand.11 - score = 75.80"
FT                   /note="Signal peptide predicted for TA16685 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.755
FT                   between residues 21 and 22"
FT                   /note="GPI-Anchor Signal predicted for TA16685 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA16685"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73110"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH9"
FT                   /protein_id="CAI73110.1"
FT                   /translation="MRLIYFLFFLFGLFSNSFVGADSVLDLDFYDSEKVYHSSSLQNNY
FT                   SVEVFHPNEGKFTDVTALGSSMVRNGDVSKVVCYSVNGLCQLVQLFTDSSDAPSGYFER
FT                   STTYFESVESSKFADDLNNLKLGTYKPKLFFLLNLTNKNNPRGLYSVEENVADGVDTNV
FT                   FTSLFQQNLVSELFCGDDRVFMSLTDHAVKVTASKKGGDFVLLKVDTVNNDVSGTKFYT
FT                   KDNNVWHPVDLPRYNELLRSLHPEPAVEDLTLDVNAPEDGKYHVKREYDRGLTSVTYSP
FT                   LPRFHLVNVRAGDEDLWSGKFGRATEVLSVLLSDQVVSVRVTSLLASYKSFHHFNKVDG
FT                   KFVEATEKEFWDNLEKLRQATEESRAEPEQPTPHTLDLSNPSGDFDVKLSSEQGVTYKR
FT                   FTPKVGVVVSKVVLGTQNLWDPQAGTTLQYVNVYLNKQGLPSAYMLYAVGPGNKKVVDS
FT                   KYDVGNNLWWFLHPSQLKDHLKGLRDAPTLDHSLELNLGPDVVLDHTTVDEFSTLGVGT
FT                   TSYTAEDQYYFSKVTWNGELVFEKTDGTELSPVNVRLFKDAGGDYKLLELGGFLPNGEY
FT                   KTEYFNWDGSKFAALDSKAKFLKAFDALSGSVVSGAWFSPEESVESGEEAGPSVVVYNL
FT                   DTSDFDPQRVSHAAGAENGYYFDSYVPKDNFLFGDVKGPGGFSYLHRGARFVTLAKFYS
FT                   VHGKFLGAVLKTVGSLYRTQELVYYYTFENNKWSYSTDKKHFSEVLASELRYSPERKEE
FT                   HERLLRAEEDFEKTMGKVRAKEEKERKKELEKLEKEVKREEDEAKKRMLDKKTLLYTHM
FT                   VDLDKEEPPELEKVELHTPEELEHMQQPYGEEKFVVESELVYYDFKAPKDNTLVHTKDF
FT                   QSNGLEALDATPVAGKFFHILSLNGRRLWVSTSTRRCTNLQLFFEEGNVVGAVLRVTVS
FT                   RNGKLKAGEDYDYLFVTDGELKTVDVEEFNKLANVRFQSAALAQLSKL"
FT   misc_feature    complement(527074..527136)
FT                   /note="Signal peptide predicted for TA16685 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.755
FT                   between residues 21 and 22"
FT   CDS_pept        complement(join(527838..527949,528033..528045,
FT                   528082..528271,528321..528377,528407..528532,
FT                   528613..528721,528755..528985,529014..529145,
FT                   529181..529236))
FT                   /locus_tag="TA16630"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.10 - score = 33.65"
FT                   /note="SMART WD40 (SM00320) at aa 19-58, E()=7.13e+00; 130-
FT                   169, E()=3.08e+00; 223-261, E()=2.12e+02"
FT                   /db_xref="EnsemblGenomes-Gn:TA16630"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73111"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH8"
FT                   /protein_id="CAI73111.1"
FT                   /translation="MSFEHMNQSIFYDDTVIKSFNVCVAFKDRFSSTNGMDWDKTGEVM
FT                   VNSSFDKTLYIYSVNKSCVTNVLQSKKHGVELVKFTSEGPKHILCSSGKESQNGKFYKI
FT                   HTNYNLYIIIKLCLVSVRLWDIVENRYVKSFSLNTHLSRGVGIVSHPNRNMMMTNCSDG
FT                   TVSVYSLDNTTPIMNYTSPGTSVAAFDYDGLIIGKYNGSGSTSKTFSLYDLNKPQSPFK
FT                   TFDISNVLKRTEEVNSVLFNPNGRLAILGTNFKRLICINTVNGSAIFACCYGDIPASKS
FT                   TESDICYPAISPDGKYLISGCTDNIGPPAFVAFNPRKAMISSACIKVAWWIPNMKTETQ
FT                   E"
FT   CDS_pept        complement(join(529833..530180,530212..530587,
FT                   530625..531232))
FT                   /locus_tag="TA16575"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.9 - score = 31.64"
FT                   /note="SMART 1 transmembrane domain at 417-434; ZnF_NFX
FT                   (SM00438) at aa 104-115, E()=0.00e+00; TSP1 (SM00209) at aa
FT                   200-245, E()=1.82e-07"
FT                   /note="1 probable transmembrane helix predicted for TA16575
FT                   by TMHMM2.0 at aa 417-434"
FT                   /db_xref="EnsemblGenomes-Gn:TA16575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73112"
FT                   /db_xref="GOA:Q4UIH7"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH7"
FT                   /protein_id="CAI73112.1"
FT                   /translation="MDSDVLTYEAEKLKEFSRSKGLLLPNLEEIDPIVDIEDYNLSIID
FT                   ITNKFEGIYTLIQDIRARKFKYDNLTNWNPFQFEYSHGCKPFFTKNIENFGYDPSTSNC
FT                   KCPEKHFPCSLNQALSDISNWSNNILEQDIDKPVEELTIVIDGLKKIDIYGNSIKKGGE
FT                   LSVLNKPKEQDQLNLEDQFCKSSEVILCSSKVLGTQNTQWSDWSGCSSKCGHGTQERFK
FT                   ISYNGNNYKLLKESRACELSKCSNKYINDGVKCALKTTTTQKSKRFTKIGDQSDESYQI
FT                   VKCECNEGERLCSSDEAYKSIDEWISTFRKYCDSELTKDPDSNILQGDIMGNKKEIFGK
FT                   RLKIEFSDGFYFDCSENWGIGKPNDLHIYCKSGSPVLCTKETPIDYPECKIIALDIIKV
FT                   VPVSFAEILPDLTGKNDYFGFILVGLVLIFCIILFKKFTRKHQK"
FT   misc_feature    complement(529863..529916)
FT                   /note="1 probable transmembrane helix predicted for TA16575
FT                   by TMHMM2.0 at aa 417-434"
FT   CDS_pept        join(531525..531642,531768..532296,532379..532473,
FT                   532569..533002,533057..533165,533198..533316,
FT                   533390..533515)
FT                   /locus_tag="TA16570"
FT                   /product="calmodulin-domain protein kinase, putative"
FT                   /note="Tap821d03.p1c.C.cand.85 - score = 41.12"
FT                   /note="SMART S_TKc (SM00220) at aa 54-310, E()=2.37e-107; 4
FT                   EFh (SM00054) domains, at aa 362-390, E()=8.50e-05; 409-
FT                   437, E()=1.18e-03; 445-473, E()=3.30e-02; 478-506,
FT                   E()=5.16e-04"
FT                   /db_xref="EnsemblGenomes-Gn:TA16570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73113"
FT                   /db_xref="GOA:Q4UIH6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH6"
FT                   /protein_id="CAI73113.1"
FT                   /translation="MGCKCSRPRELDSPTLKRQSDSAETTDRMSFDSDIKLKPSMYIGN
FT                   IKDEFKNLFTVCRKLGSGAYGTVFLCKKTNGTKEYAVKVINKLKSPSSHDSSRLLREVK
FT                   YLKELDHPNIAKLYDVYEDSVAYYIVMEPCYGGELFDEIIKRQRINEYESACLIKQVLS
FT                   GVCYLHKNNIVHRDLKPENLLLEKPGSVDRIKIVDFGLSAHFGNNFLKERLGTVYYIAP
FT                   EVLNRNYHEKCDVWSCGIILYILLCGYPPFTSPMDTEIIRLIIAGNYSYPDKEWHDVSD
FT                   EAKNLIDLMLTYNPDKRISAAQALNHPWILKFSKAGKAAPPTKSMSLALKNLKMFTKTQ
FT                   KFEQAVMLLMANKFTSNDEINELSKLFSELDTNGDGTLDRSELIEGYRSIKQNLRDGCS
FT                   RMSDEEIEQEVDEIIKACDLDHSGSIDYSEFITGCIDKLTLLSKERLKLAFSIFDIDGS
FT                   GKISNSELSQILGVSNAPNVFNQILKEIDTNDDGEIDFEEFERMLDKITIE"
FT   CDS_pept        complement(533577..536501)
FT                   /locus_tag="TA16465"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.cand.8 - score = 60.61"
FT                   /db_xref="EnsemblGenomes-Gn:TA16465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73114"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH5"
FT                   /protein_id="CAI73114.1"
FT                   /translation="MLSDQDAFFEAALDAIASDLELMELSINDLNIALGGSPVIIPDSY
FT                   VKTVRSGLLYECFTRSARNSRIYKCYERFKGLELQVDSFFRILKLHLDRGFSFLQRFKP
FT                   ANLSISVKLFCLCYVDVIFDLYYGVVKQVVNLTLHDCVYILKFFSRLDKTLSANRIKHV
FT                   YVRDEIYDLILHSLWFALKDAWWLYLEPKFIKPLFPFISHMRVNKHYEVTIHDLNHVLH
FT                   NIHFVTLISQDIAFQSETPTVVDMPPGTPDQIYTQMPNIQIPNMGSVEHSPDLGDLSIS
FT                   YEDLSESNLHIKYLRTLNTFGIDESKTQQDNTGSVNPEPTEQDNKLESVNQVDTVDEPE
FT                   SLEWLKLDPNRQEKASFDFLPSSNHLDDLEFSKYQIYGDDYSNDFHNDVDNFRRESESD
FT                   SEPSWTQVIYLTLVGFIYIVLFESYLKAVSNSLNTRMSPANYVEFLIKRLQDVIQVTGL
FT                   IVEVDCNFTAWARDKLGDSSDPYLSACFNNYSDDVFSFNNNYTYRYRDIYTDRPRANFD
FT                   FSYNSEHKNDPNTSNPYISFNPRDQMNLYILSLSFDRAQKLQYELIKRVSLVCSAPTLR
FT                   YIDNLYFIDDSNLYREILYNPEKYLISPNGPLSRSCKQLSIRFKRAIFVETYFKIVARY
FT                   INKVTDQESQPSEAIFFDSMSLWDSVLDFFDFSANPQVIEEECLKLVSSLLDRIKFTPQ
FT                   VDLSELESFRKKFTSNFLTASNSPESLLSSYAYKCISFLKSDSSNKFCSNSVQNESDDT
FT                   VTKNELDCSTNDETTIDDICLDKFNVWLDGVRKKRMLVFGNAILFFRDNSLLQPVGFIS
FT                   FDSIYAVLGPRTISQVHPNVHILENNSENDSFSCGTSDTSQSSETSNPLELEEDSDNIL
FT                   NQYSVNGDLDIKEISAENSSNNSAKTSRRSSLCDNMMVWGWQVRLELFDSCVLEDFSNI
FT                   DVVADFEFSSPENRKFWQQLIKDKPGTRPQFISWPYHTFFFDSI"
FT   CDS_pept        complement(join(536910..537156,537280..537355,
FT                   537450..537545,537606..537666))
FT                   /locus_tag="TA16410"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.7 - score = 17.51"
FT                   /db_xref="EnsemblGenomes-Gn:TA16410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73115"
FT                   /db_xref="InterPro:IPR019370"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH4"
FT                   /protein_id="CAI73115.1"
FT                   /translation="MRTNKTSLNKIHELGITIFPEKYGNDQDLEPSEDFYGSDLDDLDG
FT                   DFVNDNYRQGDKSTDAVLCCAMCFTPVCYQCKTVGNSFSSKLALNAYVEDNYSDSVRGN
FT                   DSQDVIDKGDSTKRKLRGSTNNSERTVKCIECNNIIAVLDFSNNYNFKNVIASKP"
FT   CDS_pept        join(538200..538380,538438..538601)
FT                   /locus_tag="TA16405"
FT                   /product="40S ribosomal protein S26e, putative"
FT                   /note="SMART pfam:Ribosomal_S26e (PF01283) at aa 1-114,
FT                   E()=4.40e-48"
FT                   /db_xref="EnsemblGenomes-Gn:TA16405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73116"
FT                   /db_xref="GOA:Q4UIH3"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH3"
FT                   /protein_id="CAI73116.1"
FT                   /translation="MPFKRRNAGRSKHGRGHVNPVRCSNCGRSVPKDKSIKRFNVRNIV
FT                   DASAQRDIREACAYSLFNVPKLYIKQCYCVSCAIHSRVVRVRSAQGRKVRTYVQQRQMQ
FT                   VKLNLPNKDN"
FT   CDS_pept        join(539575..539691,539724..539803,539858..539910,
FT                   539972..540053,540085..540343,540393..540458,
FT                   540521..540577,540620..540679,540760..540822,
FT                   540884..540980,541019..541095)
FT                   /locus_tag="TA16350"
FT                   /product="replication factor C subunit (RPC2 homologue) ,
FT                   putative"
FT                   /note="Tap821d03.p1c.C.cand.86 - score = 30.85"
FT                   /note="SMART AAA (SM00382) at aa 39-175, E()=1.96e-10"
FT                   /db_xref="EnsemblGenomes-Gn:TA16350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73117"
FT                   /db_xref="GOA:Q4UIH2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH2"
FT                   /protein_id="CAI73117.1"
FT                   /translation="MGVTKDVPWVEKYRPKKISDVIFQTQAVSIMEQIIETFNMPHMIF
FT                   HGPPGTGKTSAALAMARQIYGLEGMRERVLELNASDERGIDVVRDRIKTYTRINISNNR
FT                   VNPETNRVMPNYKMIILDEADMITADAQAALRRVIENYSSISRFILICNYLHKIIGPIY
FT                   SRCSVFHFKPIETNSQIDRLKYICNQEGITFDPKFLTTISSGDMRKSITILQVILGSTA
FT                   CLYNEITENAIYSVSGKPPKRVVESIFEVCRRPEGDVESVCKQIVHDGWDISSIFQQIC
FT                   EYVVESDSIGDIEKSKISLELANRDFALLQGGSQYFQLASACFHIKNTITGGTPS"
FT   CDS_pept        complement(join(542043..542108,542140..542239,
FT                   542270..542398,542431..542549,542582..542749,
FT                   542802..542986,543019..543369,543433..543578,
FT                   543620..543727,543782..544095))
FT                   /locus_tag="TA16245"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 1 transmembrane domain at aa 233-255"
FT                   /note="1 probable transmembrane helix predicted for TA16245
FT                   by TMHMM2.0 at aa 233-255"
FT                   /db_xref="EnsemblGenomes-Gn:TA16245"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73118"
FT                   /db_xref="GOA:Q4UIH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH1"
FT                   /protein_id="CAI73118.1"
FT                   /translation="MTPRNILSYKCRNNYLYNFYDNLLNRHGRSFGSIVKYTNCSSSPI
FT                   FNSNSKNDEINCLNKLSLRFYGNVGRDWLPKRNQYTKYRITKPWTSDSVYDDIFLSEPS
FT                   KEDFYPFTKEMPVFLKFLNLLTAAQNRKEVFIDFVKRCENGLVVEKDVYLTKDELLECM
FT                   WANGYSNSEMNAFKFAFPSDYKFHYPELAVLFELNEEDCYKYCVKERASNPEELVELKL
FT                   KKPTNLVSSYGLVFLGCWFALSNAVLGNAWFFAKTLPFGAVFYLLASYFQKWLKEYFWK
FT                   EENALIEKVKQEKEYCEDAIYSQLRKYLEDSKCVDYVESFKSEVVNRMEQYKKALLVRM
FT                   KNEASNLMKERLNNMAHHEASISSSLEKNMVNELVKLFLETFSTSPEMKTDALSSSIME
FT                   LKGEYNKLDDPLFKFFNDNLGQFQAGTRKKRTQTSTNEGGDTFVDRCNRLFQQKEQEFL
FT                   NTFTVTPEEFKEVSSLARLCKSNQGFNLDKLSPDQRTKLDNLYLNLSQKMGYYVPTVPN
FT                   LSVQGLPLTPTTSDESDSFLHKELSEKLDLVRTSRLHDFLGQFV"
FT   misc_feature    complement(543173..543241)
FT                   /note="1 probable transmembrane helix predicted for TA16245
FT                   by TMHMM2.0 at aa 233-255"
FT   CDS_pept        544250..547918
FT                   /locus_tag="TA16240"
FT                   /product="DNA-directed RNA polymerase (mitochondrial
FT                   precursor), putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="SMART pfam:RNA_pol (PF00940) at aa 810-1222,
FT                   E()=2.70e-124"
FT                   /db_xref="EnsemblGenomes-Gn:TA16240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73119"
FT                   /db_xref="GOA:Q4UIH0"
FT                   /db_xref="InterPro:IPR002092"
FT                   /db_xref="InterPro:IPR029262"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIH0"
FT                   /protein_id="CAI73119.1"
FT                   /translation="MVRPIALNTANLNCIIYRNKGTTLNSLNLNKNIHNICNIQSISSL
FT                   NKRNYLKSHSIHSKILKRDISSSQICFKSLDSSTQEPLKKPKSFFSIGSEVSSTETPFI
FT                   LDKITPIHSDESINIPNVDKDKIVEGSKDDSDVLLRNVKSVVFERAEDISKWLRTNKQS
FT                   FLKNIEEQVIHLFRNAEKFSSIHGLLLADVSPDDFKSHVDSVKSISNLFSPQFIRKQKK
FT                   KLYKDNDLPLLCPTQNDKTDITSETSEDVNFESVLSQKRQELIEKLSFSEALETAKVEA
FT                   SNLLDFKHPSELSSLSSTCTRWIQDISQFIKKDREKGGTFVIPLELEEEILATTTVKIV
FT                   LQSMCFPSYTLDSRGNKGGLLKKRIQQTNSNQILISHLAIKLGDEIGKLYNNLILNNKE
FT                   AENVSNLENSGKKANTDSINSIGSLEVSSDEKLEKDCNQEDFIEIKSAGNGAESNDRVV
FT                   VKSSLNAVIEPLNSTNRSQKNWNSSQSAAAGGYLLNALIKSCRIELDLQTALKQYLSNY
FT                   SCYVNQSMDIKTPKLITSNSSQNDSSDDSQESDSQGGGESRVGEISVRDKASVVGGKSG
FT                   LGDDKLRIIMRFLNVIKKSRFNESLVEVEAFRHVLLRQGVKTFGVLEMRESCMLKLRDF
FT                   VAKSLVSLAALPMVCKPKRWINATTGGSILLKHNFIRGSKLNEVKVYDLGNVFDIVNKF
FT                   SQVPWIINRQMLNLIKHICSSQTDMQIKQHLPVNTTTNIMENINTSISNITSLSSNELS
FT                   ELSLFLRRIKIADAFANEKRLYMPLNIDFRGRMYPLSPYLNHMNDDLCRSLLLFSEKRK
FT                   LGNRGLFWLKVHCSNMYGNDKISFEDRVKWVDEHIAIITELVKSPFKDFNQNFWVKADK
FT                   PFQFFASCVELVRAIESNNPDEYMTHLPIQQDGTCNGLQHYAALGLDERGAKYVNLVNS
FT                   EQPQDLYTHILQLIIQKVYNDLNYTNSTVSNNTLVTSGNGKLSNVESNKKYSEICVNNN
FT                   ILCRKVIKQTVMTICYGVTRIGAIDQVESKLKDIKKISYLSPSELRGLAAYLANKILSS
FT                   ISTIFSEAMSIKNWLDEISCVHNKFNIPVTWISPIGLPCEQPYCKSVTKVVRTPLQAIN
FT                   VSKYVSSVDKRRQKLAFPPNFIHSLDASHLMMTATEVFKHTQSFATVHDSYWIHPDKVD
FT                   MMHTHIRNEFFNMHTKPILDDLHKSVLNKLQIDFRPPPKKGNFNLEHVLDSKYFFH"
FT   CDS_pept        complement(549120..549368)
FT                   /locus_tag="TA16135"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA16135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73120"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG9"
FT                   /protein_id="CAI73120.1"
FT                   /translation="MLVPTHWLFKLPIAKDRVRFLRLYCRASFVLGVALAYYSHRPNYK
FT                   ETPAKPSLLYKLRLKTLLARNKISKEDYERYLDFKNL"
FT   CDS_pept        join(550206..550624,550660..550844,550907..552374,
FT                   552406..552562)
FT                   /locus_tag="TA16130"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.88 - score = 47.10"
FT                   /note="SMART RING (SM0184) at aa 685-729"
FT                   /db_xref="EnsemblGenomes-Gn:TA16130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73121"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG8"
FT                   /protein_id="CAI73121.1"
FT                   /translation="MSETSQKITLTGSLRRMFKQSTTALTIRHIKDVRLLCGISELLAT
FT                   GKCRKIYLYETHDPEIVLYVLSAISTVRNVLSRLHIDIWNTDYKKLINLLSESLNAQSE
FT                   TLEHLTIKCRFPNEYLTQAIQILPNKLKVLDLSENRVLICYFRITTKASMVALVSYIET
FT                   SELECVRLVNCNIKPETLGYFVNLMFEIESPFSLRTIEGVDLSECKEIPKNVRLCLKEP
FT                   ACVTRKRQMNYKDYSKISRYDTSVQFIDHLRNAIFMKRLVGLIVRVWWPPTEDDNRTAF
FT                   SGRFWPAKVLMVNPIDLVVVVLYDNDEVDHVPCKFVQPLNPFKYGGGYTDNYSYHLLGS
FT                   THPRTNSKSNEFKTHNEILNFKHKNSYDNSFGETDRESNVDSSDLLKTPETLNTDHYKT
FT                   NINNIVKRSSISGYSVSSVTTRYEEGFLCRNCGYNNNPDYAINHDVNLDSVEKSLGLDD
FT                   KFGGNLLVPGEFCEFRDPLDKFRNDPSDYIAVVRKVNKTEPLYECVCIYLDNNEVITLH
FT                   SNDVRRAVVIPWYNWVSLSFKILTDRRINNDGLTPNRYQLGDPNSGINTLNNNIVNSNN
FT                   IKECINSNFYYLKRLDLAELDEFCPKNPLEMKLVDMNSYLIPITQEVKSHPKLTSNQKC
FT                   YRNHFIVDVSSGKDEETLKIKSLMEYNETLQRELQAERNKNNELQSKFKCILCFETEIN
FT                   CMLDPCSHFSFCHEYVFLFKKFSRCAKNLKNCPVCRQKISKFKILNLT"
FT   CDS_pept        553131..554123
FT                   /locus_tag="TA16125"
FT                   /product="hypothetical protein"
FT                   /note="Tap821d03.p1c.C.cand.89 - score = 20.47"
FT                   /note="SMART 1 transmembrane domain at aa 309-328"
FT                   /note="1 probable transmembrane helix predicted for TA16125
FT                   by TMHMM2.0 at aa 309-328"
FT                   /note="Signal peptide predicted for TA16125 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.688, signal anchor
FT                   probability 0.010) with cleavage site probability 0.371
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA16125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73122"
FT                   /db_xref="GOA:Q4UIG7"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG7"
FT                   /protein_id="CAI73122.1"
FT                   /translation="MYSLLFFYLYYSFIGFSCKLVSSADFTLNLDQKSSNDQLLVNHTY
FT                   HYGIASIEFFTQPGYHAVSVVQGKLPVWTAAHDERVDEAVLYFGTEALSLLYLNVTEGG
FT                   TSMYKYFVKVKGKWAEVLEPVANFFVDIDRTAYTSDELDTFALDIMTKYNRDMLTQHLL
FT                   FPQSYNFVIEPIDYCSLDIQNPSRYSIMKQTMIGAIFSYIFTPKIDFGFSKVTYDGHVL
FT                   WSTDTNRVLCSSVWTYFKGDFDTLILVSLYDFVSKKAAFLHFKKTDSLIVASSERDFQR
FT                   QIVKMTSAEYDEKDIKSYINGYLTERDFAFILSPILAIVVILTALIITH"
FT   misc_feature    553131..553199
FT                   /note="Signal peptide predicted for TA16125 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.688, signal anchor
FT                   probability 0.010) with cleavage site probability 0.371
FT                   between residues 23 and 24"
FT   misc_feature    554055..554114
FT                   /note="1 probable transmembrane helix predicted for TA16125
FT                   by TMHMM2.0 at aa 309-328"
FT   CDS_pept        complement(join(554255..554392,554424..554482,
FT                   554512..554763,554824..554938,554975..555115))
FT                   /locus_tag="TA16120"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.5 - score = 32.12"
FT                   /db_xref="EnsemblGenomes-Gn:TA16120"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73123"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG6"
FT                   /protein_id="CAI73123.1"
FT                   /translation="MTLSEVKNSKIWTVDPVFQNGEFEDSKVESEMESVVESDQIQGST
FT                   SNVIREYTDRIIKSIKESLSFCVNTENIANISLLDLCVQNEQINRIKVDLNKFHENVSL
FT                   SERLVEKYVSTIGWICSSVKWSNGVKLDIEESDEKLNELAKSFSDSHPFDESNLDSDFR
FT                   DIPPTNEPVNDFFSTATRGLSSLVNNMKKNKAKTDLLSSVIMHQNNELEKINSSAQNLR
FT                   DRVSSMNSLLKS"
FT   CDS_pept        join(555228..555332,555420..555666,555727..555830)
FT                   /locus_tag="TA16115"
FT                   /product="mitochondrial membrane protease, subunit 2,
FT                   putative"
FT                   /note="SMART pfam:Peptidase_S26 (PF00461) at aa 1-136,
FT                   E()=1.60e-03"
FT                   /db_xref="EnsemblGenomes-Gn:TA16115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73124"
FT                   /db_xref="GOA:Q4UIG5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR026730"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG5"
FT                   /protein_id="CAI73124.1"
FT                   /translation="MFFGKFKRIKSFSKSLVYTIGTFHILTYYLVDATLTKGPSMSPEI
FT                   SDSGTLVLYMRPYLISKLREGQELYRKNDVVISTSPLNPNKRICKRIVGVPYETIHNIT
FT                   IPQGHFWLQGDNRENSLDSRHYGAISSGLFQGIVFLIASKENGVKLI"
FT   CDS_pept        complement(join(555913..556072,556121..556305,
FT                   556360..556416))
FT                   /locus_tag="TA16110"
FT                   /product="hypothetical protein, conserved"
FT                   /note="SMART 1 transmembrane domain at aa 20-39;
FT                   pfam:DUF174 (PF02617) at aa 59-144, E()=6.00e-05"
FT                   /note="1 probable transmembrane helix predicted for TA16110
FT                   by TMHMM2.0 at aa 20-39"
FT                   /db_xref="EnsemblGenomes-Gn:TA16110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73125"
FT                   /db_xref="GOA:Q4UIG4"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG4"
FT                   /protein_id="CAI73125.2"
FT                   /translation="MPMPRPIRKSESETAKAPKVFMFLKFFITHTLLFVYQMMNRDTVK
FT                   QLKQKTHKKASPEEKEERENEVNSWRVILYNDDIHNFMYVTESISKCVPQLPLAVAHLI
FT                   TLEAHKNGQAEIIRTWKDKAELYCRGNKL"
FT   misc_feature    complement(556246..556305)
FT                   /note="1 probable transmembrane helix predicted for TA16110
FT                   by TMHMM2.0 at aa 20-39"
FT   CDS_pept        556941..557807
FT                   /locus_tag="TA16105"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.C.cand.90 - score = 26.38"
FT                   /db_xref="EnsemblGenomes-Gn:TA16105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73126"
FT                   /db_xref="GOA:Q4UIG3"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG3"
FT                   /protein_id="CAI73126.1"
FT                   /translation="MNKIMNSKENKTNLEAYLSWIDAILNLCNKIDSVCTKLDKKFPSG
FT                   ANSSHLKKYKHSINVYEIIKHYSWQNNIRTKDLINKYKNNSEWKLENIIKNTGKTYNNE
FT                   MVQINCGNKACLGHFGLNGEISGTKLIKRRGEDKVKIEQGFKIDLNSKCGNKRNQDKRY
FT                   ELESEILKNLEVGQKIFITSKSSTKKSVEFTKITQDYDYLLNGKAGENKIKIIKYQELF
FT                   CDVPGVYWDKRSWIASWYQHGKRYYRSFSAKLYGFNRAKYFAIQSRLSNLNCSRKYTPR
FT                   KHSKYIV"
FT   CDS_pept        join(557893..557980,558057..558159,558226..558696,
FT                   558811..558909,558963..559037,559066..559129)
FT                   /locus_tag="TA16100"
FT                   /product="7,8 dihydro-8-oxoguanine DNA glycosylase,
FT                   putative"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /note="SMART ENDO3c (SM00478) at aa 122-295, E()=2.55e-11"
FT                   /note="GPI-Anchor Signal predicted for TA16100 by DGPI
FT                   v2.04 with cleavage site probability 0.5814 near 282"
FT                   /db_xref="EnsemblGenomes-Gn:TA16100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73127"
FT                   /db_xref="GOA:Q4UIG2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG2"
FT                   /protein_id="CAI73127.1"
FT                   /translation="MCSDPGPSTKWFDLRVPLTVLRPELLLTTGQSFTWKCVGNKHWVG
FT                   VLGSSVYEIKQSDDTTLYRTLFGKCSRERLWDYFDLDNEYSVDFTKAPKPVKQIIKRRS
FT                   GVRILQQDPFECLISFICSSNNNISRITRMLNEIKRNFGTFLAKSEVNNETFDFYAFPS
FT                   VDQLRKATPEQLKKLGLGYRSDFIFKTVEILNSRGLNWLYSLRNEDSDTCKSALTSLPG
FT                   VGRKVADCVSLFSLGKRDVVPVDVHIQKIANTFFGVKCGKSLSDSDYERIGTAFRNFAG
FT                   DNAGWAQAVLFIDSVIKS"
FT   misc_feature    558739..558744
FT                   /note="GPI-Anchor Signal predicted for TA16100 by DGPI
FT                   v2.04 with cleavage site probability 0.5814 near 282"
FT   CDS_pept        complement(559382..560890)
FT                   /locus_tag="TA16095"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap821d03.p1c.cand.3 - score = 50.64"
FT                   /note="SMART pfam:Collagen (PF01391) at aa 345-403,
FT                   E()=6.20e-02"
FT                   /note="1 probable transmembrane helix predicted for TA16095
FT                   by TMHMM2.0 at aa 7-26"
FT                   /db_xref="EnsemblGenomes-Gn:TA16095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73128"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG1"
FT                   /protein_id="CAI73128.1"
FT                   /translation="MAMNKCIKLFLILVFVVAVAFGVTFLPFNLSDKFKAVVDKVSSHL
FT                   RGLGGMGSDEKVRLDFSKRDSYTHGNLNVVLDKADNVPKDGYLKFIHKGEKDLPLDVEG
FT                   FTLGDTTLDGVEPGLLDYAAGYFKGESPHLLLVELCLHNKGDGDNGNGEGNKDETNKGE
FT                   TDPNGTEGGKGTGPGDKTEGEKVFYCPGENNKWVKLPDGADLGAKVDEVFATLSANTPP
FT                   TGTPEGGVVTTPVLPATPLPGNQNLDFPKGESPVPAPQNYPLTGPGAPTAAVPLPVGGA
FT                   TTGSQQPGNGAPAGGQLGPVVPGTPDTVGTAGTGGHGTTPQGPVGTPAGGQSGNDGAPG
FT                   TAGTGVPGGAGVSEPGRNGLTGETGAQGGVSSVGQGTHSVPSGLVAGVGGAGGVGVEAG
FT                   AGAVGQGTDSTGEGRGAGGVGVGVGGVAGTGPAPAEPAVPTPKVPEGTQNSETTTGGVQ
FT                   QTASGPAGPNGGTTNQNNGGGVNGQGGSNGGGSSSSSVSTPGNH"
FT   misc_feature    complement(560813..560872)
FT                   /note="1 probable transmembrane helix predicted for TA16095
FT                   by TMHMM2.0 at aa 7-26"
FT   CDS_pept        complement(561370..566721)
FT                   /locus_tag="TA16090"
FT                   /product="glutenin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA16090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73129"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIG0"
FT                   /protein_id="CAI73129.1"
FT                   /translation="MKSLIIYIYIIKVLVYCGRFAIFDVKGIYNTVQYILRKKSDNSLL
FT                   CTILNVKKNNELYGVVSNDEILWIKQSKKEECQDVLVTKHQGKAKLALLQIQHFKSFYT
FT                   VKRLRYFLGIWVPVSKELYNKIDKIISWKFDYKESEISVELTEEFDTAGLMVNNFFINE
FT                   ENKTRLYPRPGFKITLVNYRNNELWSKNDYQEEAIQIEIVKTDSKIQRLYVRYETYYGT
FT                   ADTIYYKCYPELRRVDRKEYFMDDDDDDDDGDDDYLPDGIDRYRRIGTRDVDSSHGTQP
FT                   GGSSQTGTTDQGTEDQDQRASSPVYYGVSELVPLPLGTRPATPLPTPSKLVAPTPIKHF
FT                   PEGIIRCFHVETFSEIGLVPQKTAKQREAAKQVTIRVGGTDDSQGQSEPTHYIPQHTEA
FT                   VSHGTHYTPGQVTRHPTQPILRMPQQTAPRPTGRPRHAPPVPHVPTQPFPTTLIQPPPP
FT                   RPSGITPYNIIQGIGQQRFPTSQTDNRAEQGSRTGSTTSSSTPTNKDNSKKTTDDSDSD
FT                   GSDLFDIQETDVVTEVPESDTRIDEFLNMITKTVTSSTTSVTTTSRQTGQASKAIVAIT
FT                   SSTPQPGTQFGDASGLSLFSSGELTRARESGGSGGMHAISDSTVSSTVSSWDYSNANPF
FT                   QDYIDIGQIPEVVTSDFSQEEIELASRSLTSSIESGRTGSSGDQTPTPGQTFSPAIMGD
FT                   GRTPRYPSAPSVRPQFGVEGGLKNVIVRPSSLTGTQTVRAPVVRAPVFMPRDPETRSEY
FT                   EEPPRKRPNTGQTVQPFPQPQPQPGQFQYQPPQAQQQQGQFGQGQQSQGQFSQGYYQHA
FT                   QQPQHGTGQYGPTQQGPGYYGPTQPFQPQQQQGQTQQTQGYYGPTQQPQQQGQFTQGQY
FT                   QTPQQQPPQNQYPQGQGNQGQGYFLSMLEEQDQFTSGQQQTQPQFPHSQGYYGPTQQPH
FT                   VQPTQQTQGYYQPTQQQQTQPQFGQGFYGPNQQPQGQTSQNQGYFLSMLEDQNEYNLGQ
FT                   QSTQGQFGQGYDGTTQQQTQPGYPPQPQPQPGQFQYQPPQAQQPQGQFGQGQFQPSQTQ
FT                   FSQGYYQPSQQTQQNLGQYGPSQGFQPQQGTGYYGPNQPFQPQQQGQFTQGQPFQGQGD
FT                   QGQGYFLSMLQEQDPYNSGQQSHQGQFGQGNYQTNQPTQPNQGQYSQGYYGPNQPLQPQ
FT                   QSQPGQGYYQPPPPQQQQPQNQYHQGYYGPNQPQQNQAQQGQIPYSQGQPTQQPQGYYG
FT                   PPQQQQTQGYYQPTQQQPTQPQFSQGYYGPNQNQPPQGQFGHGQRQQPQTGYSQGYYQP
FT                   GQNTGTPNTQTQNIGSTQQQGRYGDNSNGEDNQSSDDEDGDNFLVTEQTEKTTGGPDTG
FT                   AGSTPPVQQRPVGSQRPLVRAPIYRPPTTPVGPISQQPPVSGVGGKRRLQTAPTHYIPE
FT                   NARGDRTGLGPENSGRTRPTAHGNNYVPVYKRPRQSQGLDFPEEDPEYEDDNDDAESFI
FT                   LNVNSDVEETEDTERSRDKTAQPRPQVNPEQSSVVRSILRKSLLGQARGTQGDSASKTT
FT                   PAGTRHSGGQSDGSQASGGGSGGADSRRPDSSQSSQFDGGYRSALQHVDSRDVRNDDDP
FT                   NGEFRKEGFPLDVLELDDSTKHYTVLVDKLLKVPVVIIIPADESFVEEITLGSLMIWRS
FT                   ETVKCVRVRLVVSEGNFIAIELTLVTPRRKKFHLFFRYHDGYYKGVARPRFNEAIYEQA
FT                   TKVQNIKRLSKRIDKEIMEEEKAKKDEKGNKKAFSRWESATYRESDETEDETEYENRRW
FT                   DIQEIITRENGNHTNIIRGPKNITQRR"
FT   CDS_pept        complement(join(567702..568904,569055..569105))
FT                   /locus_tag="TA06655"
FT                   /product="phosphoglycerate kinase (PGK1 homologue),
FT                   putative"
FT                   /EC_number="2.7.2.3"
FT                   /note="Tap349e08.q2ks7.cand.137 - score = 49.29"
FT                   /db_xref="EnsemblGenomes-Gn:TA06655"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73130"
FT                   /db_xref="GOA:Q4UIF9"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF9"
FT                   /protein_id="CAI73130.1"
FT                   /translation="MDFLLSSKLGLKDVADKLPGKRVLMRVDYNVPLKSGVVKDLTRVK
FT                   ATIPTIKFLLENDVHSVILMSHCGRPDGRVVDKLSLKQVVGPLSSLLGMEVNFLSDCVG
FT                   PEVEKTCSNLTKGSVVLLENLRFHPEEEGELDGQKLSDEKIQKFRDSLTKLGDVYVNDA
FT                   FGTAHRAHSSIVGVNLPLRVAGFLMKKELDYFSKALENPQRPFLAILGGAKVKDKVKLI
FT                   LALLEKIDVLIIGGGMAYTFKKVLDGMPIGKSLFDSDSVDLVKEIVEKAKEKGVKFLLP
FT                   CDFVVTTMFSNDGPIKLASETEGVPEGWMGLDCGPRSIQKFEESVLTAKTIVWNGPLGV
FT                   FEFPNFSKGSNEVLDFVVKATENGATTIIGGGDTASLAESTGKASKLSHVSTGGGASLE
FT                   LLEGKQLPGVVCLTNKLP"
FT   CDS_pept        complement(join(569316..569684,569803..569833,
FT                   570003..570031))
FT                   /locus_tag="TA06650"
FT                   /product="60S ribosomal protein L35, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA06650"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73131"
FT                   /db_xref="GOA:Q4UIF8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UIF8"
FT                   /protein_id="CAI73131.1"
FT                   /translation="MEIVINNVKNFSKWTLHNFTEKLRVFELRDKSDAELLKLLDDLKQ
FT                   ELATFRVSKVTATGTSKLSKITLVRKAVAKVLTVYNQRKKEEARKKYKKLSKTPLNLRP
FT                   KLTRAKRKGLTTKQLTMKTIKERKRAENLPKRKYALLA"
FT   CDS_pept        complement(join(570184..570561,570617..570772))
FT                   /locus_tag="TA06645"
FT                   /product="RNA binding protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.136 - score = 15.85"
FT                   /db_xref="EnsemblGenomes-Gn:TA06645"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73132"
FT                   /db_xref="GOA:Q4UIF7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF7"
FT                   /protein_id="CAI73132.1"
FT                   /translation="MSELYDRISNERVYWDKKSCSSIEEWKEKIANSSTVYVGNLAFST
FT                   PEERIHEVLQAAGEIDRIVLGLNSIKKSPCGFAFVVYKDVKSAKRAVKMFKGCIIDGRV
FT                   IRVDADPGTSIDDTRRLARGLNGYQWRDAFRKEFDTSRGGQGLGVSHEILNKRMKVPQM
FT                   MSSILAEQSRIVNP"
FT   CDS_pept        complement(571338..572408)
FT                   /locus_tag="TA06640"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.135 - score = 33.79"
FT                   /db_xref="EnsemblGenomes-Gn:TA06640"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73133"
FT                   /db_xref="GOA:Q4UIF6"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037855"
FT                   /db_xref="InterPro:IPR040608"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF6"
FT                   /protein_id="CAI73133.1"
FT                   /translation="MTKLVEETVLKLEDLKVAIGVLRRFYSCTNGLLTTFRLTFNYTNN
FT                   KPKTIFVSSITSVKISNSFFKEYIMLQCGSIRYFISCSDNNKLYSELLRVVKLNETTTV
FT                   LNSPRTVETSVESPDSNTLSVPGISRVLEIQREKIEECEDLCTATTELSALKNKCKLVK
FT                   EVLVKVTKYDQEGFNATIDRVFKSLGVEVFSQSDNQDNSNIPSNSCTNSDSDSDQEVLN
FT                   QLKKILSLLLSKNESILLHEFYVAANRLMLTDLLSPSQLVKYVNRLEKDYLCKLNKVGN
FT                   VYLITKNHEKISEEEFCSDLIGILNSGPTDLIKYSKEANISTTLAQVKLNLAEQIGLVV
FT                   RDETIQLTYYYINSFN"
FT   CDS_pept        complement(join(572442..572627,572681..573007,
FT                   573046..573147))
FT                   /locus_tag="TA06630"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.135 - score = 33.79"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA06630 by TMHMM2.0 at aa 113-135, 148-170 and 180-202"
FT                   /db_xref="EnsemblGenomes-Gn:TA06630"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73134"
FT                   /db_xref="GOA:Q4UIF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF5"
FT                   /protein_id="CAI73134.1"
FT                   /translation="MRSIYDFTGMYFRSFINRKININTKIYDPFFSIKGKIDLCNRNFS
FT                   SGKNFELNNTWKNYRESSRRLLSSSSAPSKYAYDPNSLTTLPRPYESHLKEDVKFRNCL
FT                   GLNPLFTHYVNPVSIVKFTAKYLLSYRFFFIYMARTTFQAARPLLAFCVFGEIMKLVLA
FT                   NLSGGVPAYLFSFVLAFEVFYFFLQLYISYTFLMMFFTVMF"
FT   misc_feature    complement(join(572451..572519,572547..572615,
FT                   572705..572773))
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA06630 by TMHMM2.0 at aa 113-135, 148-170 and 180-202"
FT   CDS_pept        join(573588..574911,574969..576458)
FT                   /locus_tag="TA06625"
FT                   /product="ATP binding protein (maybe ABC transporter),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.1 - score = 60.72"
FT                   /db_xref="EnsemblGenomes-Gn:TA06625"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73135"
FT                   /db_xref="GOA:Q4UIF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF4"
FT                   /protein_id="CAI73135.1"
FT                   /translation="MKLVLHLINCIILYLFLNDYKFGIFCFRSHIAQPSINFTKNYNIS
FT                   DSCDHELNNVIPYSSYRLLLSPSEDVLTETKEWILTKDEDDLASSAHFDVNFNDLYSFK
FT                   GRSKQGVLLEVKDASICLVDRILFDKVSFSVNTGECVGIIGNNGVGKSSMFDSIYERLS
FT                   TNSCTSRKSGLDKPQMSVSMDITFNIKDEETANNISNNKYLYSFVSKLMELENLNESQL
FT                   IKVYNSFEYTESDGVFSGYNLSGVGYMRQNYTLDLNPESTVSELISSVFESYNLCNNVM
FT                   NYIEKNLSFFNSLMLEKSSNGSTGTETANKIAGDILSLYNNERNLITQKFREMKSLIKK
FT                   LVSIFGMESVIGSTVNTLSGGFKMRLYLFILLLHSPSLLLLDEPTNNLDTTTVKFLIDT
FT                   LKYLMKNSNLSVLVVSHDTFLLNSICTSIFQMPGDGTITPFKGNFDEFVQKGTNEKNVR
FT                   NARIERLRKNIAILNRDIQELKANKKGSLNALKVTISQKQEMLNKYQEELDELVGSPIS
FT                   KYTKTYNRVLFNINENARNIKEDSPENTFNAIFQKILRKNPLLNTGQMLNTFGPLFKLI
FT                   NVTLDTHTGKRIFDNLNLTIRPSDRIVLLGENGIGKTTLLKLLFKSQATFKNNPVLAQI
FT                   SSIDKKLLYQSINNDINTVIDKGIDRVMSKMDKSWKLFEQINQVNRDMTNSQDSVYNLE
FT                   DIEYRILVNEPFKFNLVDGLMSVNTAKLSYYSQNCSNILNYDKTVYNLLRDYVGDEVEQ
FT                   NALAEYLGCFHLADYMDSCVSNLSFGERSRLLLSLLLINKAHFLLMDEPTNHLDLFMKK
FT                   LLKLIVNGIYKGGFMIATHDLDFIRDLNTVNSFIYIYSKDKVFRFSDKFGPEYLCFKSQ
FT                   FPDAKSPQVLDFLTQCSGVKKYSEITINTFNEEPEEEKKVLNKKKKIHPPKNPNDRSRI
FT                   KNIKRWN"
FT   CDS_pept        576821..578239
FT                   /locus_tag="TA06620"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.2 - score = 31.23"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="1 probable transmembrane helix predicted for TA06620
FT                   by TMHMM2.0 at aa 5-27"
FT                   /note="Signal peptide predicted for TA06620 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992, signal anchor
FT                   probability 0.001) with cleavage site probability 0.936
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA06620"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73136"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF3"
FT                   /protein_id="CAI73136.1"
FT                   /translation="MNLILLLSLNLLSVHGFFYTLYPLVAIKSNNRVKLYCPWNQHTDA
FT                   NLTCRFNKDVMGYYPLPSTDNTTPLVTSKFLNPSLQTPFTRDYCNSLKDGWSAKKGTDN
FT                   VCKDFAFCFNVADSKCVCSCQSGFFGNPYKACYQHCSTDDDCSSPLAVCKFASNTNEMK
FT                   RCVCKDKYEGNGVMCYKNPCGDDRSSKCGGVENTVCVPTGPGDDDYKCVCPSGYYVNHE
FT                   KTCVPEVTVTKSSVITLVVKNVPDGSRVEAGECLSFTLNDGSKSVFFHKNSGDSVYVKK
FT                   PIKNDGKFSIFFIVTDEVTAFSSVTSSGAGLTKLYSMSSTFIGCKFGHVKVYDPKGREI
FT                   SGYEDLKQSKKLKLAASGGQAAAPTPPGQKGPGAHPRTGGAPRTQAVTVSSELSDPLST
FT                   LELLSAPVAAAVKAKPEVEVHVRELKADELAGGLSSSDVAQRQAALQSGSSSSSGVGSS
FT                   VLQASSTVQTVNEL"
FT   misc_feature    576821..576868
FT                   /note="Signal peptide predicted for TA06620 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992, signal anchor
FT                   probability 0.001) with cleavage site probability 0.936
FT                   between residues 16 and 17"
FT   misc_feature    576833..576901
FT                   /note="1 probable transmembrane helix predicted for TA06620
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        join(578500..578787,578819..581557)
FT                   /locus_tag="TA06615"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.3 - score = 79.68"
FT                   /db_xref="EnsemblGenomes-Gn:TA06615"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73137"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF2"
FT                   /protein_id="CAI73137.1"
FT                   /translation="METHAPFVHVHPYMKKGHSIKVDVLSRQAQVSPIFIKPQILPISD
FT                   RYVRVYDPLINNLESRSDENYIIETKLYDKYKSIFNNISRESLINYSIRKSDEITKDTP
FT                   LSESSSNTCDTTSTNTETTKSDYVESLDNNEFNKILDSNEFISYPWVSVVPHMVKSMFK
FT                   SVINEEVYMSTLSEHPFTDYTYDSIKISKIDVKTPEQISEPDVVRSPNYISESNQMSGL
FT                   SETSRTNGVCEPSKGFLVNEKCVRRLSSALTSFIKELDYWNNLVADSLSRTGSSRLTLS
FT                   EARVFINDYRYITFGLLNSELSNRLENEIKIAEHYSNKVRQKLSSIFDKESEESCSIDL
FT                   SVAENLLKEGSLLTFSTPEFISLSHLFYSVASLRNLLDESILRSDITNSNTLIEECDNS
FT                   VIKIPDLENVKLHLSKIMWLNNAQKYSHKSVNYKLVVELIDNTPEELKSHTLYQNLKNK
FT                   VDMAFKLIEKLKEPKFKYLTSTDELRINNQNKDKNIEKIVDKDKIIDKEKIMEKDSDSE
FT                   DETSDEEEISVENGIEMNKKLKPEELEDIHNNYQEINLIIPSFKNIEPAYFMWKRFQRR
FT                   LRKVEALISSENSANCTIECLVLLQQAETLKEYIDIDNVLEPINSDVENSLKFEKKCRN
FT                   LLNRFNNWSITNDFIKFKTEWNSLNNFRKNATVNKKDLQDLINLVNLYNNRETVESDNQ
FT                   DSKTENIVKDQEDELVLLKPKIKRRKSMKRLEKSQSEKGSDSVDDEDKDKSTLSTNPPE
FT                   ITREKVDFQEIVELFNEFWKLRVKNWQIFRNLEEIHNSCLDLIDKAENIIKDLKQGLRS
FT                   EEVFSSLILITIETLKFGANLHLDKKLLNSVKYCLWIKKLYISLNKLYNFLTSNENDSN
FT                   SELEIKADKVYTNREMNIEADESSSKSDEVSIPSEESNSDSEDVEIEHENNQLKVFVRR
FT                   FKSLGEEFDKDSMEEFVDSTHPISFYINITQEQFNKVNSTINKITHTNDNYEKLLESQK
FT                   IFTLTEEDFIREFTTQQYV"
FT   CDS_pept        join(581604..582847,582879..582960,583015..583105,
FT                   583135..583270,583343..583492,583549..583721,
FT                   583755..583855,583885..583998)
FT                   /locus_tag="TA06610"
FT                   /product="autophagy protein, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.4 - score = 117.01"
FT                   /db_xref="EnsemblGenomes-Gn:TA06610"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73138"
FT                   /db_xref="GOA:Q4UIF1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR006285"
FT                   /db_xref="InterPro:IPR032197"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR042522"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF1"
FT                   /protein_id="CAI73138.1"
FT                   /translation="MDENILIFKPQVYKIDSSFFEELYHIKLKKLKQGLNNLSIKSLVT
FT                   VDGTFLIDKYSFDLNHCRFGERPEQPLAEFVRYTLEKELLDKNSENVYKNDGCTCRFVQ
FT                   GTLVVFDSLLELRKYDKKAFISSHFDLECTTPDKPLISSHIFKKLSSGFEEYYYKVNHF
FT                   FIFCFMDLKSRSGYYYIADPVVTTKSPFAYSYLGVVNNTTYMQSYNNFKLSDLNAILIH
FT                   FKSNTLGDLFFIYSRLHSRVFRTKDFLYDGVNVSLNGEGVPLESVYICSYSCFNGGKDL
FT                   PKFWRNFLLSFCIENRIFGENLNLVIVNSKLFETDEIYSQAFVYCIKTPSEDEFRDLSI
FT                   VYGFRHHISKETLSYEYYYSFMDHVDNEKLNLELITWRILPELNLDKILNLKVCIIGLG
FT                   TLGCSLVRQLLAWGVETFVLVDSGFVTNSTRQSLYTHKYCFNNTPKVDAAEKMIFKIKP
FT                   DCKLTIVNTEIPMIGHSYCENFLNEQLKNTKAIVASSDVIVLATDSKESRWLPSLIASQ
FT                   MNMKGEKCPLVVSAGLGFDSFMIVRHSYKDFKGSCYFCSESQAPRDTITGRPFDETCTV
FT                   VKAGITDICASMVVELIVSLTQHEKMFAADHGDKTCIGKTPHSIRFSLSDYKCSELYAE
FT                   PSEMCICCSENVLNKLKTDEDIIEVFKDPTILMKYSKLESFIDQLSDYKINEEKEEGYV
FT                   VL"
FT   CDS_pept        join(584422..584575,584623..584765,584798..584987,
FT                   585016..585107,585177..585633,585681..585742,
FT                   585775..585870,585924..586105,586228..586385,
FT                   586441..586510,586569..586714,586787..587268)
FT                   /locus_tag="TA06605"
FT                   /product="threonyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.3"
FT                   /note="Tap349e08.q2ks7.C.cand.4 - score = 117.01"
FT                   /db_xref="EnsemblGenomes-Gn:TA06605"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73139"
FT                   /db_xref="GOA:Q4UIF0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIF0"
FT                   /protein_id="CAI73139.1"
FT                   /translation="MGNDPNLSSDNCSEKVVKDHNSFNLQTNPKFIKDRLELFNALYQK
FT                   QQQKLKERENLDISLVLVTDDGEVSVSGKSFLTTPYNVLYSLDKKRAKKAVVAKVLYEN
FT                   RPSEVFADVDEDNSDKSASEWVLWDMHRPFEDSCKVEFLDFNSEQGQHVYWHSSAHILG
FT                   SALETCFGGFLTIGPALSSGFYYDVYLGNNSVKPEDVKPLLSHVEALTNLNSPFERLVC
FT                   TKEEALELMKYNPFKVQLIKNKVPDGENTVCYRCGDFVDLCRGPHIPTTSMVRANSFDV
FT                   TKISSSYWLSNAKSDTLQRVYGISFPEKEQLKMYKNRIEEAKQRDHRTIGTDLKLFYFD
FT                   TVHSPGSCFWLPNGAKIYNRLVEFMRDNYRVRGYQEVITPNIFSCDLWKQSGHYDNYKE
FT                   NMYLFNLEDTEWGMKPMNCPGHCLMFKHLFLSYKQLPLRLADFGVLHRNELTGSLSGLT
FT                   RVRRFQQDDAHIFCTREQIMDEVLNILTFIGKVYSLFDFRYEFKLSTKPAKALGEDELW
FT                   EIAEKSLEEALNKTGTKWTMNPGDGAFYGPKIDVVLFDCLDREHQCGTIQLDFNLPIRF
FT                   NLEYRDKSESSAENVRCGFNRPVIIHRAIFGSIERFVAIVLEQTKGKLPFWLSPNQLLF
FT                   IPITDNHLDYALELYEKFNALGSNTNYIILIMIINGLGYNVDVDKSNNTINKKIKFGQQ
FT                   QRWNYMGIVGDREVETRTVSLRPRDSDEQNVISLDDLVKLFESQQLKYV"
FT   CDS_pept        complement(join(587476..587655,587687..587869,
FT                   587899..588234,588266..588415,588468..588579,
FT                   588648..588808))
FT                   /locus_tag="TA06600"
FT                   /product="transketolase subunit, putative"
FT                   /EC_number="1.2.4.4"
FT                   /note="Tap349e08.q2ks7.cand.134 - score = 34.31"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06600 by TMHMM2.0 at aa 92-114 and 124-143"
FT                   /db_xref="EnsemblGenomes-Gn:TA06600"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73140"
FT                   /db_xref="GOA:Q4UIE9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE9"
FT                   /protein_id="CAI73140.1"
FT                   /translation="MIAFSKNIIGKLLPKNLFSQRLFSTFNPKGPTKEMNMCTAINDAM
FT                   HISMAEDPTTCVFGEDVAFGGVFRCSVGLLDRFGESRVFNTPIAENGIVAFGIGLAALG
FT                   HNAIAEIQFADYIFPAFDQVITIGYISNFNNLYLIIIIVNEAAKFRYRSGGAWDVGKLT
FT                   IRSTWGGVGHGGLYHSQSPESQFAHAAGLKIVVPRGAYQAKGLLLSSIRDPNPVIFFEP
FT                   KMLYRQSVDQVPVEDYQLELSKAEVLKEGKDVTMVGYGTSVGPMMKAAKLAEEEHGLSV
FT                   EVIDLQTVFPWDVETVERSVNKTRKLIVTHEAPKTLGMGSEIAATITERCFHNLEAPVK
FT                   RVCGYDTPFPLVYEKHYLPDQYKLLEAAIQMCK"
FT   misc_feature    complement(join(588229..588234,588266..588319,
FT                   588347..588415))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06600 by TMHMM2.0 at aa 92-114 and 124-143"
FT   CDS_pept        complement(join(589190..589339,589371..589399,
FT                   589451..589481,589512..589572,589607..589695,
FT                   589730..589823,589881..590075,590108..590229))
FT                   /locus_tag="TA06595"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.133 - score = 26.45"
FT                   /note="Signal peptide predicted for TA06595 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.937, signal anchor
FT                   probability 0.000) with cleavage site probability 0.841
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA06595"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73141"
FT                   /db_xref="GOA:Q4UIE8"
FT                   /db_xref="InterPro:IPR033438"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE8"
FT                   /protein_id="CAI73141.1"
FT                   /translation="MTIILLLNLFMIIIYAREDFKHIGSHKFRFNDEILDISRDVNIKK
FT                   AVPIQSRVNNNFENSQKLFKKYSLLKIKKMEQDNTNTQSIGYTTQDYPNPAINPELCLH
FT                   NFFMKSHICDPDGILTEEEQKNLNHKLLDSNLNIFVTISQNIFVETGVSKSDAQISFAN
FT                   EILKKYSESFHSDYNKSILLSYVKEFGNLKIVSGEYMIGKKIKQEFIDTLEQEFQTNQK
FT                   ELYKSFNTVIEKLVQKIIKSDISNSFRILIKNEK"
FT   misc_feature    complement(590182..590229)
FT                   /note="Signal peptide predicted for TA06595 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.937, signal anchor
FT                   probability 0.000) with cleavage site probability 0.841
FT                   between residues 16 and 17"
FT   CDS_pept        complement(join(590280..590470,590506..590577,
FT                   590609..590642,590676..590859,590914..591086,
FT                   591159..591238,591268..591538,591613..592052,
FT                   592134..592197))
FT                   /locus_tag="TA06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA06590"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73142"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE7"
FT                   /protein_id="CAI73142.1"
FT                   /translation="MAKHPSYSFSLDSKTLFSTSEDEQNYDLMSEKLWKDRSFLKCVKS
FT                   LSKYIVIPKSKLENLSRNLVPAELQIQALLEILSNQKLHYNNPLKYDKSSATRSCYLKS
FT                   LGLDLTLELDQLIDESGTSFEHLKVPQYWTYMLPARYIEAKHNLDTDFKTLVSKSFKLL
FT                   HKYWQKSGLISDDGDVTFEVEQKFNTIAKNTIGKNIGCVSTPYLPIGGYSILKRFGTLF
FT                   KRPSPFTVNCDSGTYVCNNLPSFPFLFKVKQTLDKYGVAVVRNVFSKDQIREIKSKLHI
FT                   KSTLKRTQMCQRLNIQEVGTICHIISLGRINCVIRGTSFNEYLSPIQSFWMPFVYYLMK
FT                   RDSLYLLVFSNYEYINCIKWVWVDSMSYVEPWHRENKRSGINIVVPLQDTNKVNGRMQF
FT                   LPGTHNEPSRLNPYTCGPVGVDLNEGDVLIYNSSVLHRNTINESNVCQSMVVFTYDHVD
FT                   TPPPGQGNLLNDQYNLGVVKYFFDNYYGNAIVNLNYLCKNIKFK"
FT   CDS_pept        complement(join(592386..595451,595482..595640))
FT                   /locus_tag="TA06585"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.132 - score = 80.77"
FT                   /db_xref="EnsemblGenomes-Gn:TA06585"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73143"
FT                   /db_xref="GOA:Q4UIE6"
FT                   /db_xref="InterPro:IPR029240"
FT                   /db_xref="InterPro:IPR039920"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE6"
FT                   /protein_id="CAI73143.1"
FT                   /translation="MSNLDADLDDIVRSYLSTHDIYKQNSYRNSILLSANRSGTTNFIK
FT                   ILNNIYEEGDDPVDRKNVLNLLYEVVSRTEQLFDTKAVLELLLKFLKLTICVQLSLSTM
FT                   RAMIERHSNSEPTFYENVQEFHEVVSHKKISEYPQKCRMDYLYISDYLVDLFISKKIDK
FT                   INLKLICDEVSGERDPRNILVMFNLISKLASVAGTDEDFEYISRTISVYYPIQFEPPEN
FT                   DTIKITPLQLKKSLLSCFMSSHKLGPYSMEILMDSLYSEFSLSLNYTSVISDTLYFLTA
FT                   CKPVYQDCFNNFVGQLIQIMKIELLDNKLLEPTGPSDIPSELYECEELDQLNLSKVKEI
FT                   GSKYYRTWNFVDEKVKLFGEIMRLFVETIHEANDLIDEFLKLIAGNLYSNNSVGYLVDI
FT                   MCENPKVHNKVIEFIIVPVLKNINGAETCDVNDVLNILVMFIMPKILINCESQISNSKL
FT                   IESLLCLVDPEIKSKDKLDYELDTQRNVQYLKLLALSSCIIDDKIVEKLVPFLLDKIFP
FT                   SQYNIDLTDQEFDKSPTKDEELYFLECLICLYKCHNKKNVKILRSLNSICSKVTESYDF
FT                   HKSLSRMSYINRNGRQINILNKMCGLFKSVLEQTGEDSLDQVSQDSLEQVSHSLENTSD
FT                   NLLFQLVVKILIILFKSLKCLIGFKMVLDSVNEEDVSDMFISYSSLIPCAFENGCRELV
FT                   LKLYTKEQLLKDLKNLILLYKDSFYNDEKNIIRVIFLTSSVPRIIKYLNEAVESDFKFL
FT                   NTDFTFLNTDFRFLNVYLNKYKEDLKIQLNCGNELFSSGLELMNLESDLICGGYFKDFE
FT                   KLRSFSYFNGSLLVKYGLNRYKFDLADLISKIKLLENYRVKNLEYEDLFLLIVPISINR
FT                   VKPIIKYQLIDIRKTYQDEVSGSDEKLLEFLKNKIKEDTNLVPNYQENLSDISKIELYI
FT                   VLISIMLNKGENIEVESINMIIEGINEILSMFKEIKSNNGEQNSLEWELTREYVHWCFD
FT                   KYLMCLQQLLYGVVSRDSVKERHEYFGQDFDNVLEELINVYEINQVPFSRILTILITNS
FT                   VMKISGLEIYTKQKVRTLDNIINLVN"
FT   CDS_pept        join(596091..596460,596490..596590)
FT                   /locus_tag="TA06575"
FT                   /product="mitochondrial import inner membrane translocase
FT                   Tim17 subunit, putative"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA06575 by TMHMM2.0 at aa 20-37, 61-83, 90-107 and 117-139"
FT                   /db_xref="EnsemblGenomes-Gn:TA06575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73144"
FT                   /db_xref="GOA:Q4UIE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE5"
FT                   /protein_id="CAI73144.1"
FT                   /translation="MQGRDISRQPCPDRIVEDMGGAFGMGSVGGFLWHFIAGAKNSPRG
FT                   LILKNALYTASSKSPVLGGNFAIWGGTFSTFDCTFQALRNKEDHWNAIFSGFVTGGVLA
FT                   LRGGLKNASRNAFIGGVLLSIIETVSIVVNKRIAVTPRQHFQRQMEYEKQLK"
FT   misc_feature    join(596148..596201,596271..596339,596358..596411,
FT                   596439..596460,596490..596536)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA06575 by TMHMM2.0 at aa 20-37, 61-83, 90-107 and 117-139"
FT   CDS_pept        complement(join(596766..597028,597060..597171,
FT                   597269..597444,597521..597781,597811..598186))
FT                   /locus_tag="TA06570"
FT                   /product="mitochondrial inner membrane subunit, putative"
FT                   /note="Tap349e08.q2ks7.cand.131 - score = 30.33"
FT                   /db_xref="EnsemblGenomes-Gn:TA06570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73145"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE4"
FT                   /protein_id="CAI73145.1"
FT                   /translation="MFRRLFNPRFSNNILTRYRNNTFGSFNSSEFAKPSNPVNSSVCLS
FT                   SRFFSSDSFMQTVLKQVKKDLEKDKSLQEAMEKLESESQISEKISRISEYFEKTRDFSK
FT                   DCINKISETKNSKIVRNCLDSAKSIAVGFDRVSSYLYDEKGHAKRIRTKMKLNKRKPES
FT                   SKPENESVVTEPNDSGNDTPDNSLVLAKESVWDRFGSKIRDMPFLYEFFENPIISKLFG
FT                   DTSLASALREMKRLDPSFNLPDLVELVEHVIAPHVVESYLKGDGEALKLHCGEVAFNIL
FT                   NTSIKERNLQKLVLDPSILILKNVELKGGMKVKEGDPWLIFNFTTQQINCLRDTKGKVC
FT                   AGNCDVIYYVLGQIDDIREVVYSIAISRHPNPFENLEYPYMVIQYIYTKQITILM"
FT   CDS_pept        complement(598565..598942)
FT                   /locus_tag="TA06565"
FT                   /product="small ribonucleoprotein D1, putative"
FT                   /note="Tap349e08.q2ks7.cand.130 - score = 11.30"
FT                   /db_xref="EnsemblGenomes-Gn:TA06565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73146"
FT                   /db_xref="GOA:Q4UIE3"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027141"
FT                   /db_xref="InterPro:IPR034102"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE3"
FT                   /protein_id="CAI73146.1"
FT                   /translation="MKLVRFLMKLANESVTVELKNGTVLTGTVIGIDISMNTHLKNVKV
FT                   VNKGSDGKEGTNVVVLDHLTVRGNNIRYFILSDSIPLDTLLIDDTPVQKPSKTKFSSIR
FT                   GRGRGRGGPPRGRGRFGGQRK"
FT   CDS_pept        join(599409..599647,599754..600228)
FT                   /locus_tag="TA06560"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.6 - score = 14.52"
FT                   /note="Signal peptide predicted for TA06560 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.716, signal anchor
FT                   probability 0.000) with cleavage site probability 0.404
FT                   between residues 18 and 19"
FT                   /db_xref="EnsemblGenomes-Gn:TA06560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73147"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE2"
FT                   /protein_id="CAI73147.1"
FT                   /translation="MKIVIFIGIFLEVLTINGFITRTKLPKFNTNLYMIWAYPLFDDSP
FT                   KRGPRRKIHQAFERGPVRANVTLNYEYANRLAQNTYHVPGQGELPYRTEEGLGDTEDIH
FT                   TSPETACGGIDIDPAEFDKIKTVYKVFNDRNCGVLRIIGAKLGHFSFLYYGPIRHKYGI
FT                   KCYLRYLINRVYPGSKVTILTQESHDRHRLQEGVNPGLFGKQQRLMITGRDYCESFKDG
FT                   LPNENALPPKVDMII"
FT   misc_feature    599409..599462
FT                   /note="Signal peptide predicted for TA06560 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.716, signal anchor
FT                   probability 0.000) with cleavage site probability 0.404
FT                   between residues 18 and 19"
FT   CDS_pept        complement(join(600383..600838,600942..601250))
FT                   /locus_tag="TA06555"
FT                   /product="co-chaperone (GrpE homologue), putative"
FT                   /note="Tap349e08.q2ks7.cand.129 - score = 41.34"
FT                   /db_xref="EnsemblGenomes-Gn:TA06555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73148"
FT                   /db_xref="GOA:Q4UIE1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE1"
FT                   /protein_id="CAI73148.1"
FT                   /translation="MKSSLISPVCVNILKNIKYPPFRKNIRYYTTTLMTKYARFHEFQT
FT                   FRNPNLRLYSTVEDSKSSEQKSTKDSNEEPDLDEENGREETNLSPEELLNQENELLKQK
FT                   LSTLETKLKELELKYKMSLSNCDNLCKIHKKELENTKVYAVTEFAKGLLEVADTFELAL
FT                   KHLGESDPKKSTEDFVDGIKMTEAMLHQTFEKFGIKKYESMMEDFDPQIHEAMFEVKDN
FT                   DSHNKVVQVVKNGYTISGRVLRPAKVGVSKRQ"
FT   CDS_pept        complement(join(601435..601579,601647..601714,
FT                   601745..601818,601868..602005,602035..602213,
FT                   602372..602476,602667..602677))
FT                   /locus_tag="TA06550"
FT                   /product="ribosome biogenesis regulatory protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.129 - score = 41.34"
FT                   /db_xref="EnsemblGenomes-Gn:TA06550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73149"
FT                   /db_xref="GOA:Q4UIE0"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIE0"
FT                   /protein_id="CAI73149.1"
FT                   /translation="MAYRESSDIQKVDNLDYCLKNLIAIDATPTSTDLLYDENLLKLSC
FT                   ENAQLLVNKIFGLERTITSDGVFADLPSNDEIVMPRVFPLPKPREKTRWEKFAEMKGIK
FT                   KRKRSRKVFDPTVNDWVPRWGYKSIKKNKVNRPPIMEVKPGDDDNVLDVESAKRSLVKM
FT                   KQKMRELRNKMEQNSPKDSKSQLKKTLQRVKESTKGCGKHGKVKGKTKVSIKRKPVIQS
FT                   LKSEKDSYLSSIKKLNL"
FT   CDS_pept        603131..605125
FT                   /locus_tag="TA06545"
FT                   /product="polyadenylate (poly(A)) binding protein,
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.7 - score = 62.20"
FT                   /db_xref="EnsemblGenomes-Gn:TA06545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73150"
FT                   /db_xref="GOA:Q4UID9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036053"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID9"
FT                   /protein_id="CAI73150.1"
FT                   /translation="MASTVKSVPSENLMMMPMRDTQVFSSASLYVGDLKPDVTEAVLYE
FT                   VFNTVGPVASIRVCRDSVTRKSLGYAYVNYYSTQDAEAALESLNYIEIKGHPTRIMWSN
FT                   RDPSLRRSGAGNIFVKNLDKSIDTKSLYDTFSHFGPILSCKVAVDASGASKRYGFVHYE
FT                   NEESAREAIEKVNGMLIGGKRVEVAPFLRKQDREGEEVFTNLYVRNFPADWNEEALRQF
FT                   LEKYGEITSMMLKEDSKGRRFAFVNYKEPEVAKEVVNTLNDLKLDESSEPLLVCPHQDK
FT                   AKRQNLLRAQFNNSSMGQEDKRVTSNLYIKNLDDSFDDESLGELFKPFGTITSSKVMLD
FT                   ANNHSRGFGFVCFTNPQEATKAIAAMHLKLVKGKPLYVGLAEKRDQRMMRMQQRRSFEP
FT                   HSRDVLFSELPSQSLYYPRPFPAPSFPNSVAGPNKKFPPNFTTNNPQANNYPPNYNANF
FT                   PPVNSYANYPVRNVAAKAPSAGNARNMSPMSSANIPSNIPHYPSVVPPSMAHVVASGNM
FT                   GVHGNLTHHVVPPNMPHVLPGNMGVPTNMVPGAVGIRRDNNNPKSHQHQMPPVSAFKFT
FT                   PQARNREMPMHPQYVVNGNVQVDDVAMQKQMIGERLFPIIARDNPDLAGKITGMMLEID
FT                   NHELLQLLEDNDQLKAKIDEAIKVLKQAS"
FT   CDS_pept        join(605787..606411,606471..606937)
FT                   /locus_tag="TA06540"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.8 - score = 32.47"
FT                   /db_xref="EnsemblGenomes-Gn:TA06540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73151"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID8"
FT                   /protein_id="CAI73151.1"
FT                   /translation="MPSCVCLRSPNKYVSNPKSPSDLRATTTTNTADDQSLVTDSDVFD
FT                   HQALLNQEGSTTYDEESYANTSPSNSSDETYYMKNKSNDQESTNSDQQYENLGKEKPED
FT                   LRKTVEKWNNLLKLFDENPDVQEVQNNLNMVVSMSEDEESDKTEMKKQIEETIKRLTSS
FT                   LTEVRSFSSSQMPDKELVLQPYIGNDDETHFKCFLRNVKSHMGEAEVELDVNESSTQLI
FT                   LQLFDSLGLLSGNGLKEERPGLLSRMSSSIKSSTVFKNLFDPLDLTRSKMDLTTYLHQL
FT                   SNEIDRDDLASVSTLSDLEPNEPQNSISNCLLNTSLALDGALCDLVREHNRDIPNFCNE
FT                   QLKKQATLRNKYGDMSDLPLFIS"
FT   CDS_pept        join(607542..607562,607614..607718)
FT                   /locus_tag="TA06535"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.9 - score = 8.39"
FT                   /db_xref="EnsemblGenomes-Gn:TA06535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73152"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID7"
FT                   /protein_id="CAI73152.1"
FT                   /translation="MAKISDLALDENKIDRNFRVVKSLCEGPYGNTDLICDNEGN"
FT   CDS_pept        join(607974..608115,608157..608302,608333..608464,
FT                   608506..608625,608656..608775)
FT                   /locus_tag="TA06530"
FT                   /product="protein kinase, putative"
FT                   /EC_number="2.7.1.37"
FT                   /note="Tap349e08.q2ks7.C.cand.10 - score = 20.45"
FT                   /db_xref="EnsemblGenomes-Gn:TA06530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73153"
FT                   /db_xref="GOA:Q4UID6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID6"
FT                   /protein_id="CAI73153.1"
FT                   /translation="MLGGDLHKYIGYRRKMNKPIREERILIWLVQLLSALKFLHKRYTL
FT                   HRDLKTLNILIDSNKNLKICDFGVSKSLNRTCDNASTLIGTPYYFSPELVNGLNYGFPS
FT                   DIWALGCILYELCTFRTPFHDAKGIVELTRLINERKVPDLPPRYSRELNALYRSMMFHD
FT                   LRYRLTAVELLSTDLLQKVVKNMIRDVKMKNRNTNEDTIYELERYIVSKSIKTATK"
FT   CDS_pept        join(609175..609490,609559..609659,609689..609835,
FT                   609865..610020,610047..610146,610222..610509,
FT                   610570..610691)
FT                   /locus_tag="TA06525"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /EC_number="2.7.1.82"
FT                   /note="Tap349e08.q2ks7.C.cand.11 - score = 32.51"
FT                   /db_xref="EnsemblGenomes-Gn:TA06525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73154"
FT                   /db_xref="GOA:Q4UID5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID5"
FT                   /protein_id="CAI73154.1"
FT                   /translation="MRPNSSRTPSIKSIRGYPEDLYTDESEEDETDSISMSAEDCIDYC
FT                   IKLVPNQLGLQPYVNKNSNSPKDHNIYNNLTVERLGEGITNSLYKVTNILNKKTVVVRV
FT                   FGASSSKMVDRNREHYIHELLSKFQIGKSIYCYFKGGLIEEWIEGRNLTEYDLYNSNYM
FT                   VQIAQNLKKLHSISMDGEMSKLIHGGDGKPKSELWPTVWKYHRLAKKYMKKMNKSITGV
FT                   DLRAIENVLLNFNLFPNFKIPILEEICNSKNSPLVLCHADLLAGNIILKPDDHVRFIDF
FT                   EYCCCMERAFDISNHLNEYMGNNINRDLFPNEDMRRDFIREYLKYDIIEWRPSLEDFCG
FT                   QIHVLHSEDCVDEMVSEIEPFFLASHLLWGLWGALQSCLSNLDFDFEDYSRQRLDIFMK
FT                   DPFWEKHLKK"
FT   CDS_pept        complement(join(610779..610878,610909..611003,
FT                   611045..611124,611229..612328,612415..612455,
FT                   612499..612642,612709..612774))
FT                   /locus_tag="TA06520"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.128 - score = 61.23"
FT                   /db_xref="EnsemblGenomes-Gn:TA06520"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73155"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID4"
FT                   /protein_id="CAI73155.1"
FT                   /translation="MTSTVYRGELLLTQEESNDFNRTLENACLKIYGLQTPFIPWRMSP
FT                   IDQPIRAHTPSSISLATVLRELDATIDPAEIIKQPLNRRSSFKLEPTPSPRPTAPPSPK
FT                   KPEVKPEVKKRPNFVLDEKIEYDVDSDFYKLLNPPEDKLQELPEWARKIHKILREVCYQ
FT                   PYAKPFLKYFKKKTPDEVNITENPQPDPKPKKPEKADDLDFDDLSDDLHDILMDIDNDA
FT                   NNPVKDGQEDKMELDSDLVTPKHVDNYVKIDTIFSVENTTDSFNTEDLNTLNHTTNDQN
FT                   NKPVNKDFMEHDTQPNNEFTNTQPNSESVNTQNHEPVTVVDVEGEPKEWNIENILESLL
FT                   MNEFENSSKVFSLVYMFLVRQFKVIPPGTLDWMCAQDMSNKLDQLRIQEGLLDSEKLHS
FT                   FPDETVDQPIPQPVPEPPLEVKKPRTSMEDFEHEISLINKSDDYNSTISLPEVKIITDE
FT                   ERMEFYNNVMELDQEYQLELFTVFEHAAVWKIVGNGEIELDDRNTDPKIYRGMIKWVKE
FT                   KKKVATTLQEPEMDLSKMTSEIAV"
FT   CDS_pept        complement(join(613074..613348,613414..613624))
FT                   /locus_tag="TA06515"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.127 - score = 30.60"
FT                   /db_xref="EnsemblGenomes-Gn:TA06515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73156"
FT                   /db_xref="GOA:Q4UID3"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034104"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID3"
FT                   /protein_id="CAI73156.1"
FT                   /translation="MSQESELDPTPHWICSLEDELGSLIWVTLRDDTFYVGLFKSFDQF
FT                   GNIVITDAVKKIVLNDKKSFSDIYCGYTVIRGESISYFCALDVILYLNLFNYEKLVDKS
FT                   LVKKLYSIAKVRGVHSSMKFDVVLNYIPIEEALKLEKMENDAKGYTKLSIDDIVANE"
FT   CDS_pept        complement(613796..614731)
FT                   /locus_tag="TA06510"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.127 - score = 30.60"
FT                   /note="1 probable transmembrane helix predicted for TA06510
FT                   by TMHMM2.0 at aa 288-310"
FT                   /note="Signal peptide predicted for TA06510 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990, signal anchor
FT                   probability 0.000) with cleavage site probability 0.701
FT                   between residues 19 and 20"
FT                   /note="GPI-Anchor Signal predicted for TA06510 by DGPI
FT                   v2.04 with cleavage site probability 0.348 near 286"
FT                   /db_xref="EnsemblGenomes-Gn:TA06510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73157"
FT                   /db_xref="GOA:Q4UID2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID2"
FT                   /protein_id="CAI73157.1"
FT                   /translation="MNYILFFLLLRCIISSSQSDIEEDLRRSISRTNYEIRRYMTDCFH
FT                   DCDEHISELNDYIQKIEAARFKDNSEKHSTKFQNDYTDFQSEFKQLKTTYESYRMDESD
FT                   TDFKNKFTKALSSFDKIFTKASSTFSNSFRKVNNSLTKLDETKMTYMGAEVYKKSEKSV
FT                   LVTKHRIRGIDEMVKLVELRGDECGPLSNREAFHKEAIDKLKANLEESINLLYDFPLTV
FT                   VNEEQLRKVDEIEERIKELFHNGIKIMEEFDENLRKMYESKGVKYNKDYKKLIKFFEKI
FT                   PYRLSSFVTPNTLGSMIIVSFLLMNVFYLN"
FT   misc_feature    complement(613802..613870)
FT                   /note="1 probable transmembrane helix predicted for TA06510
FT                   by TMHMM2.0 at aa 288-310"
FT   misc_feature    complement(613844..613849)
FT                   /note="GPI-Anchor Signal predicted for TA06510 by DGPI
FT                   v2.04 with cleavage site probability 0.348 near 286"
FT   misc_feature    complement(614675..614731)
FT                   /note="Signal peptide predicted for TA06510 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990, signal anchor
FT                   probability 0.000) with cleavage site probability 0.701
FT                   between residues 19 and 20"
FT   CDS_pept        complement(join(614938..616281,616333..616764))
FT                   /locus_tag="TA06505"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73158"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID1"
FT                   /protein_id="CAI73158.1"
FT                   /translation="MAGSRQQPRRIRCFSFRRRQNIFDYVNDPSRNSQADHTTPSCDAS
FT                   LKTAKHSKDDEVKSDTTDDVDDSKFEKTKYERHNLPSSSYTPQKDKILLKKSSTKSKLN
FT                   TPRSPIRENSLQSKPSDDHVSNEPNYLGYGMVDLPMDSRRMSRSNNVGISKGSTFQSVQ
FT                   QDESEDRDIIRSGRKFIIGGKQTDGKPSIERCIWELVEKRGWGMMNSSWSMMGPRVFNQ
FT                   VVEYLTGMEISLCRQVSKGWYKNVTDVMVSRSEVIVDAFKNTYRDMLTYDRSYILFQPV
FT                   LTAIKAMRIDVIIRAKVEPQCTMHKNSFGYTYSYHSMTNMSKPGKDTTPNGNESIKSRD
FT                   GKDMFGLFNRKSSKNMKNLNSGSKNMAGSGKKSIFINKFIFEVLKKNSSRSITFTRDLS
FT                   SMHSEDINLATTASISQVCEGDYIEVPITLINAIGATDVESIKFLPLVKDVITNTPSQL
FT                   DLLHREWYTVEPNSKYLEQLFPQNINSYSIIHPHKLLPQLVHQVTQVAGIDVITSKSSY
FT                   IASNLGTKYIFMWMNKSNSCSGVVVESCNIIGHTVEVVAKNEPIICMIQRIGLQHDRIC
FT                   YVQLRPVSFQTHSLH"
FT   CDS_pept        join(617939..618752,618794..619159,619195..619307,
FT                   619364..619703,619754..619822,619885..620651)
FT                   /locus_tag="TA06500"
FT                   /product="transitional endoplasmic reticulum ATPase (CDC48
FT                   homologue), putative"
FT                   /note="Tap349e08.q2ks7.C.cand.12 - score = 91.68"
FT                   /db_xref="EnsemblGenomes-Gn:TA06500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73159"
FT                   /db_xref="GOA:Q4UID0"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UID0"
FT                   /protein_id="CAI73159.1"
FT                   /translation="MTQNFNSDNKNNPKNNTNETNQNAVPEEDLEQKERKYLNRLLVED
FT                   ALNDDNSVVALNPKRIDELGLFRGDTILLRGKKRRSTVCIVLADNDLDETKARMNKIVR
FT                   KNLRVMLGDFVRVSPCPDVPYGKKIQVLPIDDTVEGLSKESLFNVYLKPYFLESYRPVK
FT                   KGDLFLVRGAFKAVEFKVVEVDPGEYCIVAPDTIIFHEGDPIKREDEEKLDDVGYDDIG
FT                   GCRRQMAQIREMIELPLRHPGLFKTLGVKPPRGVLLYGPPGTILSFLYYRSGKTLIARA
FT                   VANETGAFFFLINGPEVMSKMAGEAESNLRRAFAEAEKNAPSIIFIDEIDSIAPKREKT
FT                   NGEVERRVVSQLLTLMDGLKGRGQVVVIAATNRQNSIDPALRRFGRFDKEIDIGVPDDQ
FT                   GRLEILKIHTRNMKLDPQVKLEELAANSHGFVGADLAQLCTESALSCIREKMGVIDLED
FT                   DTIDSSILDSLAVTQEHFNNAMNTCNPSSLRETVVEIPNVKWEDIGGLEQVKASLREMI
FT                   LYPIEHPEKFEKFGMSPSRGVLFYGPPGCGKTLLAKAVASECSANFISVKGPELLTMWF
FT                   GESEANVREVFDKARTSAPCVLFFDELDSIGTSRGNNVGDAGGAGDRVMNQLLTEIDGV
FT                   GAKKNIFFIGATNRPNLLDEALLRPGRLDQLIYIPLPDLPARVSILNAILKKSPVADNV
FT                   PISYLAQKTNGFSGADLAEMCQIAARAAIRDAIKHEEMMNNTTDQNNNAMPNGTEFKYE
FT                   ITRKHFQEGLANARHSVTSSDITKYDAFRTKFDPLYKNRNAATPNDIDFDWPENDEVIM
FT                   DPIEEDDLYS"
FT   CDS_pept        complement(620731..621666)
FT                   /locus_tag="TA06495"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06495"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73160"
FT                   /db_xref="InterPro:IPR012942"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC9"
FT                   /protein_id="CAI73160.1"
FT                   /translation="MSNDWIEVLGNRKLKPRKNQRNRNKYYTYTHLPDKSKICFNFEKI
FT                   KVHVHNVYNNCKPFLSHLLNCLKNNIHSKNVYIYALGCGTIENSSLVLSKSCIFQWVVC
FT                   RILLNFLNVRKVFIFDPQMTDNDYQVWDLLLNHNFELENPEFAHQYHDNNMVSCELTST
FT                   DCFDLNDEMSHVILWMPHCEKFLYSAVLDGILSNKSPLKVSKSLSKTYKKDLESKCPDK
FT                   SFDFSQLSNDSSDNSSDSDDRLVDEDSSNFLESFCLENTTLVGNSLSDCSFEDFRYKAE
FT                   FTSSETQLLPFETHHQSFNDTFVTIFTRIS"
FT   CDS_pept        complement(join(621724..621810,621877..622031,
FT                   622088..622220,622280..622472,622558..622709,
FT                   622740..623211,623242..623729,623783..624255,
FT                   624294..625179))
FT                   /locus_tag="TA06490"
FT                   /product="SWI/SNF family trascriptional activator protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA06490"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73161"
FT                   /db_xref="GOA:Q4UIC8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036306"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC8"
FT                   /protein_id="CAI73161.1"
FT                   /translation="MPGEGQTNSTQNLHTAEESFSTLTQPKSPVKVKNDTPHPIVNGNP
FT                   QNFLEYSEHNKNDHEASFRKYDTNSTDNHIKPEEVKTINNINHSHVPHQPNEQTLINND
FT                   EQNELNNEEQAQVQDYLYYNPANTTLLHKILNEGGCIDEILAMSRTGVNVKFKKSEIKK
FT                   IVEAVDQPKILVGQSKPYQIEGLKWLVGLYVKGLNGILADEMGLGKTFQTISFLAYLKE
FT                   TFGVHGPHMVLAPKSTIGNWISEINRFCPSLRVLKFIGNKEERTQLIAYELDPEKYDIF
FT                   VTSYETCCKAKGPLGRLNWKYLIIDEAHRIKNEESKLSEVVRLFRTEYRLLITGTPLQN
FT                   NLKELWALLNFLFPVVFSSSEEFETVFDLVGPKELTQEEREERNLQIVARLHGILRPFM
FT                   LRRSKKDVLSDMPQKNELLLMVPLSAMQKQLYRDLLRKNVPELGVDDNTKSGIHVQLLN
FT                   LAMQLRKACNHPYLFEGYEDRNEDPFGEHVVQNSGKLSLVDKLIPRLLGNSSRILIFSQ
FT                   MARMLDILEDYCRMRNYLYFRIDGNTSSEDRDYQISSFNQPDSMVNIFLLSTRAGGLGI
FT                   NLATADVVILYDSDWNPQVDLQAIDRAHRIGQLKPVYVYRLVHQYTIEEKIIERATMKL
FT                   QLDTAVIQHGRLAQKELLQMVQYGAGHIFKAGDEAITDEDLDVILSKGQERANLMNQKL
FT                   ISNTKKHLLDFSTSTTSNIYGYLDDDENEEDKEAWSKLEALKVQSEALIERESRRKLRI
FT                   AKEQMELYTSNKSDKPLLLPEYQFFDNVSLLALNKKEIEIGLTEEEQQQKDELLSKGFS
FT                   NWSRKDFNNFIKANVMYSRYDINSIASFIDGKTYQEVEQYSKTFWQKYNTLPDWAKYIK
FT                   KIEQGEENLLKIHQLHQTIVEKQKQLKNPWVGTEVLFSAHRGKSTFSEDEDRFLMNIIS
FT                   LFGYEKWSVLVELIRLDPKFQFNLFFRSRNAIDISKRADYIIKHISKEVSLHLEATKVG
FT                   SGERPSKRGRKDHSTPVSTPVNN"
FT   CDS_pept        complement(join(625462..625933,625962..626342,
FT                   626351..626432,626478..626560,626591..626766,
FT                   626796..626883,626957..627021,627052..627147,
FT                   627179..627331))
FT                   /locus_tag="TA06485"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73162"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC7"
FT                   /protein_id="CAI73162.1"
FT                   /translation="MRGFNRIFSIGSIINYQRRFLTELPYNIDNKNLYCNSFASCEDVT
FT                   KYIEFLSIGESNEVDKISDSTHLFNERAHKMYPYQIIRVLNSYARLKFSNENILKSVLT
FT                   RCEEMCDQASPKRALELITLYRNVNLSHEQVLSPLTKSLINHMNNYSYELYTLGLNASY
FT                   LNITDQIFIESLKTQILLTSKELNPLNSIKNLESFSRFRVESDELFDSVWNFVKDKVLF
FT                   FSSWRQLQEYINKNLNYSRRLLEFHIDLLSSELEKSNMNSEEISTILTIKSSKGYFIHI
FT                   IFKLRIVHHQCVEAIINSIEMKVNDPNYIKDDIYYHIFKLSQILSFDETDSLFKSSHIC
FT                   EFWKLILDKIFTNITGFLSPTKAIQLLYTISILKRNNVIDKNYDEILKYIKPIWQKLNL
FT                   RDQELLYDSLVSMYWSNESKGEEDIFVKRIIEEKMPTILPLMYGNMKNVKLGIKGGKNV
FT                   IYKADMDKKLVPQKCVNEFYVLNVVNEGVKVVKSPETLMELEVMEKIHNDVESYTNRVE
FT                   IKIPNEKLKMSLKC"
FT   CDS_pept        complement(join(627446..627593,627627..627724,
FT                   627756..628379,628410..628637))
FT                   /locus_tag="TA06480"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.122 - score = 39.27"
FT                   /db_xref="EnsemblGenomes-Gn:TA06480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73163"
FT                   /db_xref="GOA:Q4UIC6"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC6"
FT                   /protein_id="CAI73163.1"
FT                   /translation="MLCSLILELNERFLNDQFIDLCFVYSNNSFESRFDKLRDDCRDLI
FT                   IDTHSFNVLNSDKHLYYYTISHHNLTKFLKSAEEFLNSLKKINFVGNKNHLTNISNEFK
FT                   DKINCLDQKFVYNNLKLVNNLLKFSFSIPEHRVDSANCEFEPLICNNIDESYVLAVVES
FT                   GLSMFFVPYERDSAVKFLGYSTIGLVTIMSLFYLFVNNFSPFLSEYDKYKNCSFNDIIS
FT                   LAMKGNNSKTDILVSDIYNCHSSVINLPADLQASSFGKLQTPPLNELLNDVNSGDEALK
FT                   SGIVKIEDFSKSLISLFTENIVQQCIPRAMIDNSKTILIVGSVFKNQHLCSLVLDKVRI
FT                   YSKDVRVLFSTVNSLQTIVSGLSFC"
FT   CDS_pept        628985..631951
FT                   /locus_tag="TA06470"
FT                   /product="chaperone protein (HSP90 homologue), putative"
FT                   /note="Tap349e08.q2ks7.C.cand.13 - score = 106.32"
FT                   /note="Signal peptide predicted for TA06470 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.926, signal anchor
FT                   probability 0.000) with cleavage site probability 0.761
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73164"
FT                   /db_xref="GOA:Q4UIC5"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC5"
FT                   /protein_id="CAI73164.1"
FT                   /translation="MKVSLLLLIKLFFILQLNKGYYFVSCNESDELEVVEDTVNVDEDV
FT                   TEEQTPSELSEEELLDRSEDSSVLTSEKLFKDSTKSEKYEYQAEVTRLLDIIVNSLYSS
FT                   KDIFLRELVSNSADALEKYKITALQKNYRDKDDVELFVRIRSYPKKRLLTIWDNGVGMT
FT                   KTELMNNLGTIAKSGTANFLDSLSKAGSDPNLIGQFGVGFYSAFLVADTVLVQSKNYDD
FT                   KQYVWRSSAANNYELYEDTDNSLGDHGTLITLELREDSTEYLKTDVLENLVKKYSQFVR
FT                   YPIQLYKKLKDKQEVGWVKVNETQQIWTRNKNTITEEEYNQFYKTISGKNDEPLTHVHF
FT                   TAEGDVDFKALLYIPSSPPGMYFSTESVGHNVKLYSRRVLVSQEMKDFIPRYLFSIYGV
FT                   VDSDSFPLNVSREYLQQSKLVKLIGKKVVRTVLDTLYDVMKKSQEDVKETEAELEKVKA
FT                   VKEEKEWNSYKKDWKKRNEVEYKEFEESAKKESDKEAKDKKSSWSSDLEKRKKKLEKKL
FT                   KDVDKYTKFYNGFKGSLKVGCYDDDQNRKKIARLLRYKTLFSEKELTFDEYVEKMPEEQ
FT                   TEIYYVTSENYDDLKQLPHIQGLKKRKYDVLYLHDTMDEGCLTKLEEHKGKKFKNVQKA
FT                   DLNLKLTDEEQKEEERKESKYKPLLLYLKDLLPETSGVKLSRRLVEDPCTVVASEWSMS
FT                   SHMEKLMKSYAVHRDDSFDMFNKLNSKVLELNPDHPIMVKLLYLYTQTQKLDKVEKKDE
FT                   QKDKSVEKEEESKEDESKDKNEETKDETKSKEDESKDKETESKDEKELEEKRKELTEKK
FT                   KKYMKRLDRLFKLLYNAAKLKSGFVLEEPQLVVNYLYEKLNRSLGDFVEKDFEFTKNLT
FT                   LDDFEVEKEEVKEPDGVENLEEQKKMDDEDVFKLDEVEYPGKEDEKTPEERKKQLEEAS
FT                   VDLKEILQGRGPEGFDLTGGTVGDTGGEPMFDQFKSTGVDVDKLKSKEEDYDWSNDEL"
FT   misc_feature    628985..629044
FT                   /note="Signal peptide predicted for TA06470 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.926, signal anchor
FT                   probability 0.000) with cleavage site probability 0.761
FT                   between residues 20 and 21"
FT   CDS_pept        632202..635900
FT                   /locus_tag="TA06465"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.14 - score = 77.44"
FT                   /db_xref="EnsemblGenomes-Gn:TA06465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73165"
FT                   /db_xref="InterPro:IPR024420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC4"
FT                   /protein_id="CAI73165.1"
FT                   /translation="MDKNQILDDLISLYTGPLIVVRPFPKATEKILKCAGCSPLEIVQN
FT                   IIKRHPKSSAFAFEDFNEVETLKQNDLVQSLMDSLKKNDREVGKKLENTLGDKNEKYSK
FT                   WFRDWCITLAKILRIKASERFEAPLERNGVFIFVDNEDDFNQLEEVMEKYRDFPVTIIY
FT                   FSQGDSTEFSQVISKYNAQYLILQTFEDFNDYSNLFEFVSKFIDSCYQNLESNVINLNS
FT                   AFKGIKLSSKIIKSPEPQRNLPNLYMLMCDELGTRNETTINNVSKSTLEHEIHALSHLF
FT                   YGIHLYNCKFKSQNSQEKYNTSEDSDKSVEVPNIISHFDKAISIYNKQECQWESFFTNT
FT                   LSVLLGEYEEFNKLLSNNYILQPSTQNEFARSAIFIELSSNLCVKQKKKIFQLVMAGRL
FT                   FSQAGLENLSKRCYLSCLDEYEDWYITHEHLYGLLAAFDDNFLVNCLNILSNAYENKYI
FT                   SYSSQEELHSSSDSEQSGEVDLASWKQASGNQIYYLKILMKIQSFSMKTKYLKNTPISA
FT                   PFLNYPTIYYSHDLKLPQVDYKTPFLVRVPIVYLRNNGVNGTNLKLSTTYVDDLYEKLL
FT                   DNSFTDPLWQKCMKFYNIKDHTKKTFLPPTDRSNGSDYMINTKLKLSLQLLNPLNIPIY
FT                   CHNFKILVQEVDSTNQKKNDPVQQFENKVEENEQKVSDLKWVDCEILAKDNEEGFKLGE
FT                   FEKKSLILSFTASNTGSFKIVGLCWNLFGEVVFWSPVYTVGRKRVKEVCKKISLTEFIN
FT                   QREVDKSLYFNVFKDMPRFIYYFRKVSDLTLLSNTVFYKKSDVETSDYDNLLRKYIEMY
FT                   KDDTVNMKSSEVVENENLCLFDCFNGESSLIEISLQNVKETPIKSLVLRFKVFGAFSIP
FT                   PYPVSYKLTTPNISITRSTDPYDLESVFSSKEILESVTTVKHKYDPDRLTKIINSSWSV
FT                   INLPNFKVKEISLTEKMYEVCMQFNDDSINLQKKTLSVYLFFQPLMVMDGISLINGSIS
FT                   VSPKQGLDLVVPFKLFFRCLKGPTFNAHFNYKDVIMIKATNNSKEEIVQLKFSVNDEPV
FT                   KSTNSELCPIPPKNTMNFAIPVENTLRYLSDPNNLLALDTSDRMRFSVFWATPLRFGLF
FT                   NGNVEFLEYKVLVSLTVSKTELKLSDEPVIVNLVLTVHNISSESLDSMSVYPLIKHQED
FT                   SLISFIGVTKNRVDSINPGSFKSIEFTIIIPVPGIYNFSPQNFKLVGPLEQDVIYQDNI
FT                   NTIIVYD"
FT   CDS_pept        complement(join(636050..636407,636438..637219,
FT                   637259..637393,637450..637552,637583..638081,
FT                   638137..638473))
FT                   /locus_tag="TA06460"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.121 - score = 63.47"
FT                   /db_xref="EnsemblGenomes-Gn:TA06460"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73166"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC3"
FT                   /protein_id="CAI73166.1"
FT                   /translation="MFDLKKSEEILRRRAIFYCLNNYKTIRTHYNDLSELKNYVPKTKL
FT                   TDFFIKDENFDYSDLLNQISNSLISLDVKTDTKTHEDTKDQPIWSNYDLLSLIKIHKFK
FT                   NVKEKLYTCNINVQNNVKFDFSEYEDGYYDLVYERPDNNTSEVFKPMDSYDLSVENYWK
FT                   NFKNVPKDEITVFRDIKEEDLPEKTTRNEPETTVRNYNLLNLLPGNNSISNLANENYFD
FT                   DYYNFNNMKKISVNIGTERQLRQIYIKPRNKDKELKFGLLTKGNNKDLILKRNENNMNE
FT                   YLVVFDEDSMKVYESETLEGQVSSEKHLQKSCIRKFFASEIVRENLRNKLILKLKRHQN
FT                   ARVFTAKDMKKNADQINKSISSVTLGCFWCDWNFYGGGIVPEVHNEELSTNPTEYLLSL
FT                   EKNDLYLLTTSFIESLQVRGRNLETFEDIFSVISEIVKSYRTLVMGNFNEDYFEIMKKS
FT                   FLELKTKSTPSDIALLTPDLSELSVSSASSIDRDSVDVDSELNSQREQVLPTFNKYAKT
FT                   VEELTNLRQLVSFLLTDYNDVGSFVKEPFVDLSTIPKIKNVSKTVINCSKSITKRSKNP
FT                   NLKETEIVLSALKILDLLIFLLQKSSKSFNSPRDFHSFITNSKYEVESYFSSIMFNYFY
FT                   ERSNDSYSIKVLGSKRLMCYVIWLCIYLSPKYTFDFSFLLNYDLTNVSNSILFNSCVDL
FT                   TSISPAGRTNKNLYKINTPLFSGSKKMNLTSLVTNKTKRFKLR"
FT   CDS_pept        complement(638630..640627)
FT                   /locus_tag="TA06455"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.120 - score = 57.45"
FT                   /db_xref="EnsemblGenomes-Gn:TA06455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73167"
FT                   /db_xref="GOA:Q4UIC2"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC2"
FT                   /protein_id="CAI73167.1"
FT                   /translation="MNQRGLKKNLNHHRDTDPNVNNNHSFDLKRKKQKFTNSTKQRNHI
FT                   NNNDFSIELKCEVEEQDCDSLHLDSEIEINSNVKESKGQLKSKSQLNKLEDKLKFNGKL
FT                   RLEDKLKLEEKLKLKCKNSSKEVKINDIDTKGDLNNCLNGKDSFENACNHSPTRDSQEK
FT                   IPVDLFSVPHDKTILNSFERKLKSLNVPITKDNEHTNTNNIHNDVDTTNNVHNVDTTNN
FT                   LNDVDIEKNGDNVNNHVVDENVEIKPRKRGRKPKIKRNISKYKLNDVKKIVSDTNGTKP
FT                   NEDEQLEENLSNPNESIEYKNQKIKNEMDNHRKKRTYKKRPKLGEAINLFNKVTRRSES
FT                   IYEMQLRMAIEMSMKDCKSYEFQEDYKPLDIEKVEDTEGNDDKDSEYEESKPKKKKKIV
FT                   KKVKNGNLKVSKKRSKKSESTEVSTPKSENNVTSVSSIEYLNTDSLDSRFENSDSNCLN
FT                   DSQDDKDIDKTVVPSESVQVKESDETVSQAKMTAFEEYLSMCERFYCGKSLDDDIAQVV
FT                   YETDVKNTVKPEIKKNSHSQTKKYKDSDSSSSSSTNGFNNSEEQLNDSKGWKEKPQDDR
FT                   ILSFNCSRLDLIYRVSFNILKSSLRQPEVIDLWGPKEVVLFELGLFKYGKEFHEIQKDI
FT                   PNKSVKEIVDMYYLWKKSNRYKLWKANRYY"
FT   CDS_pept        641220..641903
FT                   /locus_tag="TA06450"
FT                   /product="ATP synthase delta chain, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="Tap349e08.q2ks7.C.cand.15 - score = 14.18"
FT                   /db_xref="EnsemblGenomes-Gn:TA06450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73168"
FT                   /db_xref="GOA:Q4UIC1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC1"
FT                   /protein_id="CAI73168.1"
FT                   /translation="MIKFINISHKLICSPFPKILNLVSRSSFSTNQVKNNTTRKLLEGC
FT                   GIMGSYANALFLTTQKAGNLNEVMNDLRFISNSLLTCEDFRTFMTTPGLRTSQKMKFLK
FT                   EDFGTLTRSPLQAQTLNCLELLFDQKRSTEVLTLAKHFETLFLSANNQLKCLVQSADKL
FT                   TDDMKARIVDALRHRLGNSCEPVVEYKLNPSILGGLLVNVGDKVVDTSVSSKLERIQSH
FT                   LLSRY"
FT   CDS_pept        complement(join(641932..642144,642199..642351))
FT                   /locus_tag="TA06445"
FT                   /product="vesicular cargo protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.119 - score = 13.51"
FT                   /db_xref="EnsemblGenomes-Gn:TA06445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73169"
FT                   /db_xref="InterPro:IPR008907"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIC0"
FT                   /protein_id="CAI73169.1"
FT                   /translation="MEISKVFDNYKDQNNVLKGRMFIKMFKDANLISSSSETNNLDLIF
FT                   TKYKSKFSGINYDQFLKSLKDVSKVLNMEPSELELKLKRTNGPIYKGTETQPVRLYDDK
FT                   SLYTGVHLHGGPRIIDK"
FT   CDS_pept        join(642610..642675,642733..642803,642867..642978,
FT                   643052..643156,643190..643279,643351..643473)
FT                   /locus_tag="TA06440"
FT                   /product="prefoldin subunit 3, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.16 - score = 14.80"
FT                   /db_xref="EnsemblGenomes-Gn:TA06440"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73170"
FT                   /db_xref="GOA:Q4UIB9"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016655"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB9"
FT                   /protein_id="CAI73170.1"
FT                   /translation="MNYSDFISNDASNSNVPEAKYIDNIEKFVGDRNSAELTQVAKELL
FT                   AKYRFMEKNSMSKIGLIKDKLPELKDAINTLEKLKKKKESGDKSDIITYFKISDTLYSE
FT                   ARIPYTESAFLWLGANTMVEYPIDDAIKLLTDQHDGIELLIDSINLELDWIKRQITCTE
FT                   ITVARLHNYTVMKNAANQPKSENVK"
FT   CDS_pept        join(644591..644789,644822..644985)
FT                   /locus_tag="TA06435"
FT                   /product="actin depolymerizing factor, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.17 - score = 18.43"
FT                   /db_xref="EnsemblGenomes-Gn:TA06435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73171"
FT                   /db_xref="GOA:Q4UIB8"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB8"
FT                   /protein_id="CAI73171.1"
FT                   /translation="MESGIKVSEETVAKFNQMKLKKVKTRYMVLKVKGNFVDVENDGEG
FT                   DVEELLTVLPNDECTFVVYDKGQNLVLFMFAPSGATTQSRTVYSTTKQTVENALPGVRL
FT                   HRNLVEDHDEVRDALK"
FT   CDS_pept        complement(join(645111..645422,645452..645988,
FT                   646087..646272,646332..646470,646519..646669,
FT                   646749..646871,646906..647058,647147..647330))
FT                   /locus_tag="TA06430"
FT                   /product="hypothetical protein, conserved"
FT                   /note="1 probable transmembrane helix predicted for TA06430
FT                   by TMHMM2.0 at aa 574-592"
FT                   /db_xref="EnsemblGenomes-Gn:TA06430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73172"
FT                   /db_xref="GOA:Q4UIB7"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR032682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB7"
FT                   /protein_id="CAI73172.1"
FT                   /translation="MLDYTSPRNSTPLSCDSAYTQAEAVKSDYGRHQSFTWHNAVGKNN
FT                   ELVSVFKISLKTKDYEIVTPYDVDLAKHHAKHIKTVRHPFILKVLDSYESDSAICIITE
FT                   RCYPFKSKYLASDPTLGISQVCSALNFLHKKCKLVYSMVNPYGIGVKEDGSWCLYNFEL
FT                   VSDIDKTLSQHQNVVKNHISFNDGWRPTIQNLNLNSVHFDNWQLAVFICWVYALISDNE
FT                   ERCNIKRYGFDFNSFRLIVPKVLHQFLNELLGDGEVDLDMVLKTNPYFKDNITFNTITF
FT                   ISELHIKTQFEIEEFFTKLPENINKIPVLIRCKQLLPEILKSINLCKNFLPMILDCVIM
FT                   ICKSIVLQDFRKHVYPSILDLFKDNDKSIRFCLLKRINELDELLDENQVSQDMFEYFYV
FT                   GFTDPSPQIRGETIKSLSYLIRKINSKQKVSCTYSLLKCVSDSEPTIRANSIICFAKII
FT                   PFIEPELVSKVLPQVWRNGLHDTFLKSKIASLESISASHIFLTPEDKAHSLIPLVSETL
FT                   LDPDVQVRRLSFDTISKLLDSLKPFAIPGNFIPNQFLQKVLRNQLVKRVGKFNLSNYIY
FT                   ISVYILVDFYIYYSILTH"
FT   misc_feature    complement(645120..645176)
FT                   /note="1 probable transmembrane helix predicted for TA06430
FT                   by TMHMM2.0 at aa 574-592"
FT   CDS_pept        join(648068..648229,648288..648485)
FT                   /locus_tag="TA06425"
FT                   /product="60S ribosomal protein L31, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.18 - score = 11.09"
FT                   /db_xref="EnsemblGenomes-Gn:TA06425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73173"
FT                   /db_xref="GOA:Q4UIB6"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB6"
FT                   /protein_id="CAI73173.1"
FT                   /translation="MIFLDKHKRKTLAPLTRDYTIHLHKMVHRVTFKRKAPTAVKKIKE
FT                   FASRAMKTKDVRLDTRLNEFLWSNGIKNLPRRVRVRVSRRRNDDEDAKEPMYTLVQHIP
FT                   VDDFSGLQTEVVANE"
FT   CDS_pept        complement(join(648630..648891,648930..649040,
FT                   649072..649118,649159..649312,649369..649539,
FT                   649568..649602,649636..649825,649855..649940,
FT                   649971..650113,650154..650193,650235..650363))
FT                   /locus_tag="TA06415"
FT                   /product="DEAD-box family (RNA) helicase, putative"
FT                   /EC_number="3.6.1.3"
FT                   /note="Tap349e08.q2ks7.cand.117 - score = 38.99"
FT                   /db_xref="EnsemblGenomes-Gn:TA06415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73174"
FT                   /db_xref="GOA:Q4UIB5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB5"
FT                   /protein_id="CAI73174.1"
FT                   /translation="MLFYIITVIYGSISVYSYIISDSRIKYGNIPNYTRLESDEIIQNL
FT                   NPTILSNLEKIGIQSLNQLQYECIPKILDDYIKNVCILSQTGTGKTLSYLVPIVQMILN
FT                   SEEESTCVVIVPNSILMYQVYDVLNNLTSGLNIKVKTVDDVEKGKVPNIVISSPLKLLN
FT                   KFKTYSLNYNFDAFKTVKYLVLDEVDQLFVHKQIIIEILKRTKNRCKTILSSSTLPDYG
FT                   TKSDSNTVSKLFKNCSYIKSQDLHKIPSKVSLEFINYKDEDDRGMLILYRFNKVVEYLY
FT                   SNNDRMIIYCNSSVNCEKLYNKLSNLGKNVHILNKNIDLMEQLLILTSLDKKMIILSTD
FT                   HSSRGVDFKNIKTVIHYDFPTNVVNFIHRTGRVGRHGNEGNCLAFWSESDEFLKNHIEN
FT                   NLNSFVDCFIIFFRLSKVFSRKRGLRKKFKKAQKLLEPTLSQEISSESQEYSTESV"
FT   CDS_pept        complement(join(650371..650508,650587..650788,
FT                   650821..650946,651155..651232,651264..651449,
FT                   651538..651608,651651..651770,651820..652502,
FT                   652546..652617,652647..652741,652809..653007,
FT                   653082..653262,653348..653407,653439..654946,
FT                   654977..655014,655046..655518))
FT                   /locus_tag="TA06410"
FT                   /product="P-type ATPase, putative"
FT                   /EC_number="3.6.3.-"
FT                   /note="Tap349e08.q2ks7.cand.116 - score = 129.56"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06410 by TMHMM2.0 at aa 143-165, 205-227, 242-259,
FT                   655-674, 684-706, 1171-1193, 1208-1227, 1234-1256,
FT                   1266-1285, 1292-1311 and 1365-1387"
FT                   /db_xref="EnsemblGenomes-Gn:TA06410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73175"
FT                   /db_xref="GOA:Q4UIB4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB4"
FT                   /protein_id="CAI73175.1"
FT                   /translation="MLIYKIFVLYFVTIAESSDISNNITTRKSSKSKPLKILEKNNINP
FT                   LKINNKYRYGLNSTDLESFIAESEHEPDSSVWYKVYNNEKGDENKESNEPSEEKVREED
FT                   KKTPLITPDDENGKEPVNYNFDRWCKQDKLLITVSELKLIHSGFLIIVLLLTIWHLICV
FT                   STNYNKYEGYYDSRQFDPSNTNSIIQEGYSFTMPGSMIIKCILVYTFLCQLMVISLVCN
FT                   ELCIPMVSSVEYWDSRAKPFLFSWLVGFFTLLISFLVRNTRVGKHLFVIRVPLETCTIV
FT                   KIRDLNKSSTEHDILNSMLDLVRNAITKIKLFFNIPDSIFKIPFEKYKVAKNCYVPVVT
FT                   AESERFFYYHYVKYTYNNEESCFLDSSNRLNSYLMSTNLVQLMDNGGLTESESARRSED
FT                   IGPNEIPIEKLDFWTLLYREVSDPVFFMQLYLTTKSIYWRSYITAPIWGTTTLYTIYKK
FT                   VKIIYDQQNDLYNLTTSSNQKYVTVLRENVTKNVMTRDLAVGDIVRVENDWEVPSDMIM
FT                   LRGDAIVDESSITGESIPLKKRKLDLEKYSNYNLNMNIYDFIHTPTSGNTLSRHSSGNN
FT                   IDKVMYKRDKTNTLPSPSNSINENLLKSGTKVISVLGNQETSVSAVAVVIATGVYTTKG
FT                   KQIKGVLFPNQFRLKYDTQLPLVFLLTFIYALFCSYYQIRFLGWNMISIFYSIGTLSQV
FT                   VPVWTSTIISISQSRACQRLSKSENIYCIAPSRIAVCGKLRVMCFDKTGTLTNNKLIFN
FT                   GSKYFSEDTLMVLSPQKILENLNTNFQEDLFKILNTKEYVISLAVATCHSVWPSSTSEK
FT                   FGNHVDKSMFECTGCVVDQYIDKTGKNRRYIKSSQNEKLVIEVINSFDFDYQKKLSSVV
FT                   ISIEVEGETRRIVFVKGAFENLSVCCNNELENLSVLSNNESSNGSYVLGLAYKVLEENS
FT                   DYTDRNLMESNLQMISLLIFNNQVRPESKEVIQTLNEAMVRTVILTGDNIPASKYVARK
FT                   CNMIQTQNSTIVEELDSQNNTNELVDERVCPVAIMNNNKIEWKYPFREDDEEKLFFSEE
FT                   FSDISMTGDVFDYIENNWNEILARYRRFSTNESINQTKFEHFLMKIRIFARLNPNQKVR
FT                   VINSFKRLGIITGMCGDGTNDCLALQASHAGISLTKGVSSMVSPFSSMTNKLESVIYLL
FT                   REGRGSLVTCLACFKFMLLFGLMIAFVKVTLFRLCRGVMPEWGYLFIENAIMLLLSYTM
FT                   ALSRPSEKLRIRSPTSSLLGPLTLLSVGIISDNFEAPTVCFWLCYQVVNTALVFSFGGV
FT                   FRESIHRNIGFSTVWLFINSFLTYLTLSKPTKLTCLFRINCTDEVSRATKIPILELLTT
FT                   SASGLPFHGEHSHNVLPNNFKMAFLALNFINCVINCLIAKSFFSNSFLKRVRSSIGYKC
FT                   SADRIKI"
FT   misc_feature    complement(join(650440..650508,650746..650788,
FT                   650821..650837,650856..650915,650943..650946,
FT                   651155..651219,651269..651328,651371..651439,
FT                   653224..653262,653348..653377,653405..653407,
FT                   653439..653495,654681..654734,654777..654845,
FT                   654993..655014,655046..655092))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06410 by TMHMM2.0 at aa 143-165, 205-227, 242-259,
FT                   655-674, 684-706, 1171-1193, 1208-1227, 1234-1256,
FT                   1266-1285, 1292-1311 and 1365-1387"
FT   CDS_pept        complement(join(655724..655796,655828..656816,
FT                   656847..657068,657098..657283))
FT                   /locus_tag="TA06405"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.116 - score = 129.56"
FT                   /db_xref="EnsemblGenomes-Gn:TA06405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73176"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB3"
FT                   /protein_id="CAI73176.1"
FT                   /translation="MNYYNNCNGTTLIKRIHFSTLSPSKIIQDAHQSCFKDIEKSIKED
FT                   SFSAYANELKNCILSKQEAASALKICLDLNFFEPNLFRDLIKLLEDEYFKPVLLEDSND
FT                   KHELYNITKSNPSNTFNFINSLSVKDKSMIIIWTCKVNSNVKKFKRNFTVKRSEKIDPE
FT                   KKELYITKRTGMVLDPIPIRAKMSFIPPGKKLSNMLSMQLRDHVPNADLMELCYISHIF
FT                   STPLPLSGQLNEDTIELIAENFCKFDYLELSKSMFSLSSFCRYAKNRFLEVSSFMDPNI
FT                   NRRPTRGKVLEKIDYRKLSNKFVRKMLESVENYINSTDLEDDYIGYLMVNSDITVHLHI
FT                   LNNLANSDIPISINVWENLVIKLEKLMDYVKNFDVKEIGLYCDSVLSVKYTTENTIEVS
FT                   RKMFKNFTVACEYNKEDYYLISQILKYILKNRLIGDSSDLLSDSSELIRCICTLTLNNM
FT                   ERIEPSVRVPLVKYLYTFSSLLNDNEKEELM"
FT   CDS_pept        join(657485..659407,659439..659987,660034..660831)
FT                   /locus_tag="TA06400"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.19 - score = 49.38"
FT                   /db_xref="EnsemblGenomes-Gn:TA06400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73177"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB2"
FT                   /protein_id="CAI73177.1"
FT                   /translation="MSQESEYVINLLKGSVSTIESVRNEASVRIIELESNISFLSTLLD
FT                   IATTRNDDFSKLSFIILKNSFCKILSRLKTNDPNANVDYPLLLSEIKLKLLQTINFVYE
FT                   AHSVIIPKEFCLLIRSVFRSEFPLNSPELYDFFILRLKSIENTIDVRAFNLIFLLHHVF
FT                   KERISMRLFKDRNVTNQIAEQFFPYLSKIWSNQFFNKWKKLELNPDTFNSEFDPVQLKF
FT                   NLYLDSIILNFYSHCFRNVYKNQELLQLLSNLFLKFKIISKVSQNSNVNSENIKILVKN
FT                   VLRILKGFTLLVEKVPYDFVFLDFSTVLNQVFDFLIHSGIGFERVETESIRFMTTIFSS
FT                   SSMNHDKYSTIYFENLEPIPVVQSSVSPINSPKNNYKLDINNVPYYKSFEELVNLNPSL
FT                   KQIELEDLMERQLTFYFYKVLNSRGGFLKFLDLLRTKYLLLDEKSVELWNEEEFPTTSP
FT                   TLNLVPELISCMNIKLVGVFNFTFNSLLNFKLNNLHNLSNLNDVKFFEYDTFLQIYTLC
FT                   FKDFYNFHTYKHYILLLETFGENINVLENEKSNVLFKFSKLLVFRISRIVNLWCKKPLI
FT                   TQETKAKILSFLIKCISSQNLQLKAQNLVPLYNLYNNSKDENIWPLIFKNHPTSPIINN
FT                   LLLISTTSVPVIRIRSLELACNLSLEYDESNLEGVLELYTKLESPEICEAILKTILYFI
FT                   GSLDWVKCYTDFDTLNYNFITFVIKIIINTVVVGKQGNFAVEYDVSGLQIVSVTKYSVI
FT                   DELFLSVWLGFLRILPLDIGKLECLSQIFTLFGPFLEYICNSETLEDTLFNKLAIEILI
FT                   EYISLLNTIQYKEYTVGQEIKNCYSSFNLTKLYKLTNMNSFDNSIGTVLLNLMIAVVST
FT                   FGVKENMTEYYGILNMFFNSLESILPADSINNQFMALGVDQKWTKFQPMKIKKESLVPV
FT                   GRLLPLINKIILSNKILESYFRSRSIVNFESWINDRILTMIIMTNLYRNQPFAQIGLIL
FT                   LTCSVISTFPQLIYPFIKFSGSSLNSLDKTVNLQDSSFVMCFLLKVLSSVCDDYRGKHL
FT                   TISQEKVENYQIPPSNRFELVKNKALVNTNSQILFQGSFLF"
FT   CDS_pept        join(661311..661716,661803..665287)
FT                   /locus_tag="TA06395"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.20 - score = 81.34"
FT                   /db_xref="EnsemblGenomes-Gn:TA06395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73178"
FT                   /db_xref="GOA:Q4UIB1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040251"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB1"
FT                   /protein_id="CAI73178.1"
FT                   /translation="MKGFGVFSPCSATSRYVLAASGLHESSCNSTPREGTQPLSLNLLD
FT                   FKVTENSETSSDFFSNTFENNFNQYAPDTPFSFNNTNFGGANYGGTNFGGNNFDDYVTS
FT                   RSTPGIAEFSLLHSIPVDLNAHLTTMKWIKLGVPYTDEKTLVVVGSSSGDLVFYDAKAL
FT                   TENKTLVSTFNTNVCSVPIKCLGYCGKNMLGVAGVDGQVSVVDLGDASNYAVVDVSYGK
FT                   WKVGQVTSLSWNYRLPHILASAGAALTPSDTSGVVVWDLKVRKPASTFRDPMGRVNPVA
FT                   LDWVPDQATQLVVAYADDNAPSVQLWDLRNPSGPLFELKSHGDVKSHSELNAQESKAHT
FT                   RGLTDVKFSPHDPNVLLTSSKDDTTKCWHLTPERTFTLLSTFQTEALSHHSRVDWHPNV
FT                   PGLFLSQSNDGQLNVHHLYSGTVEGSYVPVWTRKRGGIASGFAGQVTSWNNVELKNFTL
FT                   TSQLDGDSLKLLDGVLEVMRMLNDESMFTEFCESKVNSSTSEYEKLTWSVLKCQYKGQL
FT                   KDLLSTLGYSNFEPVTNLSPDSVTGNVGGNMNLPAQSIGTLATQSIGSLGAFFTNRTNS
FT                   LSEVTSQDDKEAEDFFNSLTLKSNLLDPNSNLLDTQNNLMNTNNNLLDLNAGSSVTGVS
FT                   SVRSLSGLDWCSDMKLKNKLVNADFKEAAKRCLDLNKVVEGLLLAYVGGQEVFLELVEK
FT                   VVESKKDPFLNLLHLLMQGDVETVLLNSNLNDWKETLCIIYTYGGDLTLFRTLTHKFAK
FT                   RLYEQGYYQEATISYILACDYYQVANLWKLQQSLSNSGRLQGLGDKNNLGTTRLEDRIE
FT                   MMLKLSVLSFSMWSNSGAGYQNESFDTVLMELSEVFIDAGMLDKALETLNVTGASNSEQ
FT                   IRQMKSKVENQLTTQYTGQSVVQPTAQYVTQATPQYAGQSLLQQTPQYGTQSMVQQQAQ
FT                   YATQPATQYTPQTMVHPVQPVVQGVGTGLNTRPAVSVSQTMASTTTRTVPLTALQPTTH
FT                   RTTQQTYPAQSTGYPSTTYQGSTSVSGMSQSFTTASSLTNSTAVSSVSTGFLTSQLPSN
FT                   ASNLSSYNSLPHSTNLTTTQANLNPVPAHLNTVPTNLNPVPSHLNTSLSTKASNAATMS
FT                   QTSRPGYNKTNASHPVNPLTSRPQTHTMGASGQSYSVGSSAPGAVAGAVKPGMPVPWPN
FT                   PTATQQLSSKTVATQESNKLIIASTQNVPKGEMMPKADLDMVISTLNVMTGRLGETKMD
FT                   LDTKKNVNDLINMLKQGSLNAEANSLLATLCRAVSQDDNFNSNLILNNIISKLWNNQNK
FT                   SWIMCLKRLVPK"
FT   CDS_pept        complement(665367..666578)
FT                   /locus_tag="TA06390"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.115 - score = 32.19"
FT                   /db_xref="EnsemblGenomes-Gn:TA06390"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73179"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIB0"
FT                   /protein_id="CAI73179.1"
FT                   /translation="MGFKRMKSNSSNSGNGPIKIDKLFPEKNAEKKLLPLPSGKVKPGR
FT                   HKKKRRCLKGSRKTIRRDVTVVFDELMKEIEPTEEYTSSDSLEFPPDWDMPQSLELGTE
FT                   DYNHSLSLTSKKELKEIYEAIDELNRLCIEPIKVKLKRDYIKIKKSNDDPNNSLNDKVN
FT                   VGEDLRYSADINIVLSSRKKNETTENPEETGTNDFSLTVEPASDNSISEECCGKNSCVT
FT                   NNSDLQISHFSSDSVRTLDNSENNDLSNKEPVSDEDVSNNPDTAEDHCYNSSSTGNWGV
FT                   ELDDNNNPIYSRTLFYRFYEPFTEYDYNFNSSTQHSFNPPYTKCSSPSKLGFDSVESLN
FT                   NSLNAPCEIIIKPPVSIGRSISFRSNVCKSVLSKDRFISGTVFQINWFNPRRKKSRSFL
FT                   TCCT"
FT   CDS_pept        complement(666874..667278)
FT                   /locus_tag="TA06385"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.115 - score = 32.19"
FT                   /db_xref="EnsemblGenomes-Gn:TA06385"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73180"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA9"
FT                   /protein_id="CAI73180.1"
FT                   /translation="MSAEIDFDNLDSIFTFKSKKYNKPSEKNKFGQRVCFLLKSAQFFS
FT                   TSNPNLSRFYIKELVEVCEKHLIRLSPKVKRKFCKGCYTYFVQGLNSHTTEPPDPVNNS
FT                   DTNRSKTVKGNLAFLTCLMCTRTRAYPYKT"
FT   CDS_pept        complement(join(668513..668956,669033..669383))
FT                   /locus_tag="TA06380"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.114 - score = 24.35"
FT                   /note="Signal peptide predicted for TA06380 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996, signal anchor
FT                   probability 0.002) with cleavage site probability 0.433
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA06380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA8"
FT                   /protein_id="CAI73181.1"
FT                   /translation="MMLASKVLYLTFLLFNVLGGCTPFDDYQTQTAAILELLGKKEANR
FT                   SLIKVVSDCLGKTFNINGKSQDFLRCVNDSLHTDELTNSDDIRFILGNYVVRSSILLYK
FT                   CYAKKNDIIYCLKVFGDCLPLLMRNLFGFSDYTRRCRRLVHMPHYDKDDGYLQDEDDDY
FT                   DKEYDPYDDYDDYEDFDDEDLGDYDYDADEEDDGAFSDFPSEKTQHEDDSNTTVQSDIT
FT                   HHGVTHDDTTENIFSRDSLDKDGDTSDSVLVLDTDSEIFQDE"
FT   misc_feature    complement(669315..669383)
FT                   /note="Signal peptide predicted for TA06380 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996, signal anchor
FT                   probability 0.002) with cleavage site probability 0.433
FT                   between residues 23 and 24"
FT   CDS_pept        complement(669780..670232)
FT                   /locus_tag="TA06375"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.113 - score = 63.43"
FT                   /note="1 probable transmembrane helix predicted for TA06375
FT                   by TMHMM2.0 at aa 4-26"
FT                   /note="Signal peptide predicted for TA06375 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.972, signal anchor
FT                   probability 0.019) with cleavage site probability 0.830
FT                   between residues 22 and 23"
FT                   /note="GPI-Anchor Signal predicted for TA06375 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA06375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73182"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA7"
FT                   /protein_id="CAI73182.1"
FT                   /translation="MYGIRVVWGISLLFCCIMPVFSIPGSPKRGLMSKKQIMLMLDESI
FT                   RKMIDQPTSEESDKKSLAKYIFLTKSLSVCMSRGKISKSELVSCINSSFTDLEIVPPPQ
FT                   LIHCIGDYLICTGKIFLKRIRKNPEDDHFLSVFSLNISLDILYNLL"
FT   misc_feature    complement(670155..670223)
FT                   /note="1 probable transmembrane helix predicted for TA06375
FT                   by TMHMM2.0 at aa 4-26"
FT   misc_feature    complement(670167..670232)
FT                   /note="Signal peptide predicted for TA06375 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.972, signal anchor
FT                   probability 0.019) with cleavage site probability 0.830
FT                   between residues 22 and 23"
FT   CDS_pept        complement(670430..673390)
FT                   /locus_tag="TA06370"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.113 - score = 63.43"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06370 by TMHMM2.0 at aa 13-35, 576-598, 605-627, 642-659,
FT                   668-690, 710-732, 745-767, 815-837, 858-880 and 890-912"
FT                   /db_xref="EnsemblGenomes-Gn:TA06370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73183"
FT                   /db_xref="GOA:Q4UIA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA6"
FT                   /protein_id="CAI73183.1"
FT                   /translation="MPTTNYKEDPENQALQIVAYMFAGLAMMLNIRLSYSAAPYALLRF
FT                   KLPENLFSVFVRTTSSALELWCIPSMLIGNIMEQFYNHTQDTSSYHYVGLKNYASEIEK
FT                   KAGKLKTIAGAQSTSELASTENTDLQQSSNYPQTKLEGKANLLKGAAQLLHKVAKALEE
FT                   AVQNDGTLNPLKDGAGKLKDAAKTTGSGGLFEKAEALAGVTTSENASSQADKVIKAFDK
FT                   VETQYTELINTANTSGLTNDSKVIEVVKSYHEVKTIYYQMIITFRIKQKAEAFHSAAEE
FT                   LQTQAGKAQPSTNPKLKALNTHASAEMGDLVAKANQLKTEAEKLHNATDANIVTKYLAV
FT                   VQKYNELEKKPAFKAALEDPSSKSTVEKATKEFSVLKKSFENVLMLRVQELSEKSGDLK
FT                   NAASALSSDSLLGLTEEAGKLRDAAMSSTGTEGLKQKATALVTAIKGASGGNNAEATKV
FT                   ITAFEDVTAKYQALTGHANYNTNKGNAKVIAVDDAYKDLQKVYDSILNLAKLAKKTSEL
FT                   NSAASDPTKVIENFNAVVTAYNALDRERKSQVQKQFEALQTEYSEAIYKYKFHIITVPS
FT                   MITNWLNFLTFVILLIIFVTGGDQGHVTGYYVIMAISGFVFGINMVLVYAVDYRYLPFY
FT                   MAGENSFPMVTSMILYFATSIFGNRRKYNSDYVVVVIDVSIAILIALVAASLWTVAFYK
FT                   YRTPKYGDLTPDPLNLVSPVAMVIVGMGLVYSIYPGIAPGMIVPFYLIDKIEMVLLVAT
FT                   AFPPVIIAILRLKAPNWSPSTKFVWHGFGKPNTGMGGWKRYASDHNWAAGTDCAKDNKD
FT                   VHGWIWHFFDILIPLQISLAVIFIYSIHYRDSNISRSIVNQPKMSTFLTIVFYMCHEIL
FT                   LALGFPGMVGNGGAGGQVLLPVQYVGALLMVFLAFYSIGYITEYKRHDPSKWPTEGMTK
FT                   WNAMCYWLKMASKITNKNFKQLFTTDLRRDLVLSDKETKFIIHVNINSIYTSIIIL"
FT   misc_feature    complement(join(670655..670723,670751..670819,
FT                   670880..670948,671090..671158,671195..671263,
FT                   671321..671389,671414..671467,671510..671578,
FT                   671597..671665,673286..673354))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06370 by TMHMM2.0 at aa 13-35, 576-598, 605-627, 642-659,
FT                   668-690, 710-732, 745-767, 815-837, 858-880 and 890-912"
FT   CDS_pept        complement(673518..675194)
FT                   /locus_tag="TA06360"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.112 - score = 22.78"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06360 by TMHMM2.0 at aa 20-39, 112-134, 144-166, 171-193,
FT                   208-230, 344-366, 376-393, 420-442, 462-484, 491-513 and
FT                   528-550"
FT                   /note="Signal anchor predicted for TA06360 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.010, signal anchor
FT                   probability 0.618) with cleavage site probability 0.002
FT                   between residues 41 and 42"
FT                   /db_xref="EnsemblGenomes-Gn:TA06360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73184"
FT                   /db_xref="GOA:Q4UIA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA5"
FT                   /protein_id="CAI73184.1"
FT                   /translation="MYKCPSRCQPAEDVRGNCPLLQVAYILAGLAMMLNIRLSYSSAPY
FT                   ALIRFRLPENLFSVFVRRMASSLELWCLPGFIIVDIMDLAVKLTIKGIGSTGDNSLKSK
FT                   QLKFNSIILLSIVAQWLNFITYVILFFVYLAGGDHGRLTTFYWTIAVSGFVFGISNPLV
FT                   YAVDYNHVPIYIVGENCFPALTSFMHYITSLMFGNRRKYDSDFLIVGIDIIVAILISFV
FT                   AAIVWTVAYGFCTDADPMCEITYTTEGANYTIKFKYKGTETEKTGKLTTNTLTGTQIGT
FT                   TPTKWQYTVKDTTSNIRYTFTHTNGTINAGDAITEQPVTIQYGHVFAEGFSGTNANPYM
FT                   IAPLLIVLVGMGIVYAIYPGIAPGMIVPFYLIDKIEMVLLIATIFPPVIVAILRRTAGW
FT                   KDPRSPLCEWSPDNSGGDGSFWHIFDLVVPIMIILAYIFIYSLHYRDSSLSRSIVNQPK
FT                   MSTALSITFYMCHEISLAVGFAGMIGNAAEWTVLAQMIGAFLMVFLALYSEGYIIEYKS
FT                   HDPAHWPTERMWYLYGYYQLNHDFFIMIKFNVCSDGYCDFK"
FT   misc_feature    complement(join(673545..673613,673656..673724,
FT                   673743..673811,673869..673937,674016..674069,
FT                   674097..674165,674505..674573,674616..674684,
FT                   674697..674765,674793..674861,675078..675137))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06360 by TMHMM2.0 at aa 20-39, 112-134, 144-166, 171-193,
FT                   208-230, 344-366, 376-393, 420-442, 462-484, 491-513 and
FT                   528-550"
FT   misc_feature    complement(675072..675194)
FT                   /note="Signal anchor predicted for TA06360 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.010, signal anchor
FT                   probability 0.618) with cleavage site probability 0.002
FT                   between residues 41 and 42"
FT   CDS_pept        complement(675572..675949)
FT                   /locus_tag="TA06355"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.112 - score = 22.78"
FT                   /note="Signal peptide predicted for TA06355 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979, signal anchor
FT                   probability 0.000) with cleavage site probability 0.797
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73185"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA4"
FT                   /protein_id="CAI73185.1"
FT                   /translation="MKVWVKFVVLVFLRLVPVYCNFSQVKLTLHRMFKNKDFGESLDQL
FT                   VNNYKYTTESIENSFRRCLENEMDDNKIMACFISGLYRERVLEQHKLLLCIAEYAKNAA
FT                   MNCIIACLNNYTPECFKVTYF"
FT   misc_feature    complement(675890..675949)
FT                   /note="Signal peptide predicted for TA06355 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979, signal anchor
FT                   probability 0.000) with cleavage site probability 0.797
FT                   between residues 20 and 21"
FT   CDS_pept        complement(join(676046..676486,676579..676791,
FT                   676832..677506,677580..677707,677745..677918,
FT                   677973..678263,678333..678438))
FT                   /locus_tag="TA06350"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.111 - score = 76.94"
FT                   /db_xref="EnsemblGenomes-Gn:TA06350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73186"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA3"
FT                   /protein_id="CAI73186.1"
FT                   /translation="MNVPLPNPINLIKKLIRLVKTGDSHNDSILTRIFNDHSTPDVPVV
FT                   LRVESYDGTDVYLFDGSEVYRGVLSDNHIKAVFESKQVRPGSKLLLQGVIFNEINGEFV
FT                   LLLNFNSISLATRRSIGVQPKYTNVIIKDLVVGGGRVSRVEVVVLKYLPLVYKIWYKCP
FT                   ETMEKKCLTLSENEYLQITQNPESEILGTIESISTVYTMYVVDALVLNENAPLDRHKFL
FT                   LKSFLTITLNNVDDSISYVLRPLTRFVLTNTMITYHANIDFFYDNQLDFEPVKLSSTPH
FT                   SKLDVLESNVKFPESLVNKSEMLKNILDKHPCLSVPESISEDEYYERIKIKPEKTRLFL
FT                   GQICDLNGVVLHVEELEESPKYCYFRVYMSTTMLNIACIKVSYKNVQDQKSQFSITPDI
FT                   KSLHKRLNDAVMTVTSSGSGPDSSAKGTHPTIFYTLSNLQYVGLDEEYSIYNFHMNSDQ
FT                   ISLRECCVLKKLQECLVNSGVILKESGFQIWLPGYKSLGSTHVENACKIFIKGTLFNIV
FT                   EVYRLVQFECVYLIINEMFYFTLLLVVSSTVFASDRDTKLEANPYSKVKIKDKKQLLKK
FT                   ISEIFNTAATEDIAIFSRDLLKRKFGKDELLEYSYGNLERSPFVGILPRCVCNYLTCNL
FT                   PICAALCFNNDIHSNKIFDCLSCFGECIPMFLRCITGDQH"
FT   CDS_pept        complement(678652..679560)
FT                   /locus_tag="TA06345"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.111 - score = 76.94"
FT                   /db_xref="EnsemblGenomes-Gn:TA06345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73187"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA2"
FT                   /protein_id="CAI73187.1"
FT                   /translation="MESSFNSFQYTSSGFKRPNLTPDNNDVSEESLENKPKRTFGFFSA
FT                   SKLDANNPNNEDSSFLKNYKPDENLLKSHWLFSDESPVNQVSNTNSFTHLNNAFNSYNQ
FT                   SSIATTRATSIETPTGFKLASGKQCDYYNADKNEEFRKLLGLDDEDVTIESLKASVPRF
FT                   TNANNMIQNSNQNLNVNVNLKPEQTFRQNTSVYEDSNSDSNSNAETISDIPSQDSGKLS
FT                   YTDFWNHQCTFTQYYSSNMSLEVISDLWSKYGNPLLVNYANAERYNYLLFTHQNDYVSV
FT                   GGLNEIVSCFKKIVSKSNLNM"
FT   CDS_pept        complement(join(679820..680198,680228..680295,
FT                   680328..680429))
FT                   /locus_tag="TA06340"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73188"
FT                   /db_xref="GOA:Q4UIA1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR040383"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA1"
FT                   /protein_id="CAI73188.1"
FT                   /translation="MLDYRPEVFTTNEFRLTGSLFCNCGVPFTNRYRNVPCYHVFCQKC
FT                   INNLESQNKCKMCDSIVEKVEELHPNEDLFLCTVQRCNQAFLNFPSLKAHAKLSHSVSV
FT                   DSVDDFYEKFGDVEYSIPKTQLITKDKQGFKIVTRKNVESSDSPTRCGNRDSIAKKAEK
FT                   SPKRNNKSNLKEDDFESLM"
FT   CDS_pept        join(680551..680647,680726..681169,681239..681513)
FT                   /locus_tag="TA06335"
FT                   /product="proteasome subunit beta 7, putative"
FT                   /EC_number="3.4.25.1"
FT                   /note="Tap349e08.q2ks7.C.cand.22 - score = 20.78"
FT                   /db_xref="EnsemblGenomes-Gn:TA06335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73189"
FT                   /db_xref="GOA:Q4UIA0"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035216"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UIA0"
FT                   /protein_id="CAI73189.1"
FT                   /translation="MNYDYLNTYMSQKGGWDFSNYSRNSRIQNSISGHNYLKTGTTICG
FT                   VMGRDSVVLAADTRATQGIIVADKNCSKLHKISDNIYCAGAGVAADLEHTTLWLANNIE
FT                   LHRLNTKKAPRVQMCISMLVHELFKYQGYKQCALILGGFDYTGPHLFSVSPHGSSDSLP
FT                   FCTMGSGSLNAMTVLEQNYFDGMSVEEATELAVKAISAGITNDLGSGGNVDVVVMDKNG
FT                   SKHSRTFKKVCSRTYAAPDNKLTAGTTEYLREHIEHIKKHIIVDQIDVD"
FT   CDS_pept        681731..684061
FT                   /locus_tag="TA06330"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.23 - score = 62.22"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06330 by TMHMM2.0 at aa 20-42, 375-397, 404-426, 436-458,
FT                   471-493, 525-547, 560-578, 625-647, 667-689 and 693-715"
FT                   /db_xref="EnsemblGenomes-Gn:TA06330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73190"
FT                   /db_xref="GOA:Q4UI99"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI99"
FT                   /protein_id="CAI73190.1"
FT                   /translation="MANQCPSGCGKAGIGNDKCGLLISSYVLAGLAMMLNIRLSYSSAP
FT                   YALIRFMLPENLFSVFVRRIASALELWCLPSMLVGNIIDLLLKGIGADEAFRSKAGTGT
FT                   GDTGKLRELALALHNEASSLNTEVNNVAGDDAAKVLKAKAGENDSIPGTLRYLAKELHE
FT                   KAKALASAASGDSGAASALATAVGSTEGTSGDSLRKALKALAEDPGTALTTKATAVKNA
FT                   YENSAGAGVKPRFTALQLKETTYNANPTTKPLYEAVVDAMTAFENVYKPEELLRDAVGN
FT                   GAGESTGLQKALKDLYDGSILNIKDLNSKAKAVKNQYGSDWSGLKQKYKLVVKQETAYT
FT                   AGETIKTQYETLVDAWNKFNNAYNTAISIAKFGVIIVPSIICQWLNFLTYVVLLIVYVA
FT                   GGEQGYLTEFYGTIAVSGFVFGINMTLVYAADWNYTPVYIVGENCFPILTSFIHYITTL
FT                   MFGNRRKWNSDYLIVCVDIVVAIIISFAAAVVWTAAYGYCDNGDTESVDYGHVFVEGFD
FT                   TSTVHWQIISPTLMVIVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATFFPPVIVA
FT                   LLNRGELGNPAKARSPKSCPDTGGGLGGWRTYTPQYCGDDVKTEVNNSFWHAFDILLVI
FT                   KISLAVIFIYSLHYRDSSLSRSIINQPKMSTALSIIFYMCHEILLALGFAGVIANNGGT
FT                   YVVLPAQYIGALFMIFLAFYSEGYIIEYKSHDPSSWPTEGMTKWNAFCYWCKKASKITN
FT                   QNPTSWFRLISERFTWLPYTRLY"
FT   misc_feature    join(681788..681856,682853..682921,682940..683008,
FT                   683036..683104,683141..683209,683303..683371,
FT                   683408..683464,683603..683671,683729..683797,
FT                   683807..683875)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06330 by TMHMM2.0 at aa 20-42, 375-397, 404-426, 436-458,
FT                   471-493, 525-547, 560-578, 625-647, 667-689 and 693-715"
FT   CDS_pept        join(684172..684454,684544..685058)
FT                   /locus_tag="TA06325"
FT                   /product="exosome complex exonuclease (Rrp46 homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.23 - score = 62.22"
FT                   /db_xref="EnsemblGenomes-Gn:TA06325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73191"
FT                   /db_xref="GOA:Q4UI98"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI98"
FT                   /protein_id="CAI73191.1"
FT                   /translation="MCDSTVYIMINFKRVDDRTNYSLRPVSFKLNPLKTGPSCKISVGN
FT                   FRDDNGNLTGIGGRTTVIAILMFSSETKSKNAPGSFHNPHMEVFVRPASGTIKSSLRCI
FT                   ESILLKIMQRLVKVDRLGKVTLSLRLQIMEDSGGLLSVCINTLILCLYLSGIEMINVPY
FT                   SVSVGIVRSGSDSMGENLVILDPTDYEIATYCSTSLTILCDPETGNYYIYLSSLGEVSL
FT                   MTIDSGSGLYGNSLTLIKSLAKKAAVKYMEEVEKLKNQSSKSL"
FT   CDS_pept        join(685501..686124,686249..687013,687125..687220,
FT                   687247..687540)
FT                   /locus_tag="TA06320"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Signal peptide predicted for TA06320 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.891, signal anchor
FT                   probability 0.002) with cleavage site probability 0.546
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA06320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73192"
FT                   /db_xref="InterPro:IPR010884"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI97"
FT                   /protein_id="CAI73192.1"
FT                   /translation="MKLTKVLYSIIFSLVIINNQFCIAADDEEQENEHGPDGGEPGVGG
FT                   AGQEQGPEQGQGDRPGQGQEKGPEVPTRVGCNFIDRDDIGIPPFSRTKKEGEACTLTLD
FT                   PRGDMFLYACDGQSDPANFPFSAKSDGEVIDFLGLFNSSNTINISNRFLNNPYVYFIIT
FT                   GEYNTPFQVSCDCIKADGTRETMIVKSGFKASGIVGLLFVLAAVVGSRGSSVGGFAKRF
FT                   RKRLKVDLESHDNTNSNKIESSSDFTQDSIKKQEIKLEDSTPVKLEPYSTSIDSKSDLK
FT                   SEVLNKEKIKTEILNKDKFKTATSIKEKLKRDIISVFKLSCGPSNYKIDVDYFEEKFVL
FT                   RTADTILLLCQKLNLSLPTLLTALVYLQLYRNSSKTWITSNKSDSGKTTLSRRVVSKSD
FT                   EQFLTASACVLLSWKYKEDEIGLIKSTRKLFDISTTVYKVIVSQNSRFTSIPSVSSWML
FT                   QDDGEEMKNLKSQILDRENQLLHSLDYFIGPIPLPDLLVGPYVRLFLVSVSNEFTELQD
FT                   FAKKLQEVVLLLVIDIYKTQMCVNYTPDELVAISIIKACCLLSFADEKYDIFKFNFESG
FT                   DFNKKSRGNRILHNIS"
FT   misc_feature    685501..685572
FT                   /note="Signal peptide predicted for TA06320 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.891, signal anchor
FT                   probability 0.002) with cleavage site probability 0.546
FT                   between residues 24 and 25"
FT   CDS_pept        complement(687879..690413)
FT                   /locus_tag="TA06315"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.110 - score = 43.55"
FT                   /note="1 probable transmembrane helix predicted for TA06315
FT                   by TMHMM2.0 at aa 52-74"
FT                   /db_xref="EnsemblGenomes-Gn:TA06315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73193"
FT                   /db_xref="GOA:Q4UI96"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI96"
FT                   /protein_id="CAI73193.1"
FT                   /translation="MNNYSVIKYCSLYESDSRVTFCEPSGRTVVFEKNNLKVSVHDYST
FT                   DDTESKFLFNCYGILGSITFMNLKYLIVVTRATLCGRLFLEHDVYSINSKKLIPLFYPV
FT                   NLSSREREFLRLFNDFDTSSNFYFSYTYNLANTLQLNLSYKSLLSEKTKLISGENDWMA
FT                   FDPALVDQKYCYNFNHKIDLCSIDEHCFGLSLLVIHGYFSESMLSLSGRNVTYTLISRR
FT                   SRFYSGTRYRKRGITGSGQVANDVETEQTLHDWSMTRSVSSFVLVRGSIPTFWSQDPSE
FT                   SFLKKPPIIYPQNDPTNSSVRSHFMELLSCYGGPLVVLDLLSDNPTTEEGQLSDRYRRI
FT                   IEELNTELPSFLKIIYYSKNIKSLLEKGVAKQMVKDVVETVVNTLKLTYLSSFNSNSLN
FT                   YTNLINPQTYSNDMIIQKGVIRISCLDCLDRTSAFSKHLSLRMLKYQLELIGIRVNYEL
FT                   STYFTNYSPIQNLSFNENYVQNLHQNRGSLSNSSASFSSNSMSSRSSSSLDLKFIRDGI
FT                   SSIGDVVVVDKDEGIIVSDYFGFNNVKGLMFEIVKDRYEEMCDVLSMQYAGSKALRKYE
FT                   GHISAINISRELFTNVRRRYRNYFEDTRIQEQTNAFLWSEFISYYSQVCPNIEQYDLDD
FT                   IIHFKPINMQFNTIDSFVLALVVFNKRISKLSNHNTLCATNVLDEDLNYLIYTRFFDLV
FT                   SENTSAITKELDSTQDNSDHICDYSLDGTLMSERTDVLNKVMFNYLTLDYQLQDGYTFL
FT                   SKYKPAGKIIPLDNCPSLDYSSDILITPFVSPIIPEHPVEEVEQVQDLNLQDNSSDFIN
FT                   FLAPLAHYDPSHWTLNIKSNINSLSNFINVTI"
FT   misc_feature    complement(690192..690260)
FT                   /note="1 probable transmembrane helix predicted for TA06315
FT                   by TMHMM2.0 at aa 52-74"
FT   CDS_pept        join(691084..691466,691502..691625,691656..692843,
FT                   692873..693043,693099..693776,693807..693971,
FT                   694002..694130)
FT                   /locus_tag="TA06305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA06305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73194"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI95"
FT                   /protein_id="CAI73194.1"
FT                   /translation="MTVGVTKRVKPIPPDRGSFPLDHEGLCKEDSKKYLDCIRVNKGNS
FT                   ANCTKLASVYLKCRIDNGLLAEEPLTNFGFRAKDISGDSPNRVVDTETELKPRYERKEN
FT                   KGFIAGTSVVDGYINDQSILSKLLSSHYCDRLSHLIYRIHSSLDYKLKFILSTKLFNFK
FT                   EQLESEEVCRQIITALDPEFIYILLRSSTIFKIIGLELSNMLLHSRDSAKHMRKIVAYI
FT                   SNIISENLRRKEFKWDSSTRAISEEIGESETVWIRLIYESLSCLLKLSEHLSSDFVFKY
FT                   SNTVNVNEMEESIEYLIHDMFDISLTNKDDKKQYSVQIREGAKEFDCVLCDLLSKKEFK
FT                   EEHSRLMELYKDLNSLAEAHLQELDLADSEVPVTECLDSTRTKLFKVLDGLLDSLLEDL
FT                   KEKQEGVLLNLSCIELLVKLIPQDNKLSVFEKCIKSNNFDVLKLLIHYLNDSSCESEVD
FT                   GENKKSFEMNLLVSKRCLDILDTKITRENMSYLLNFLVICIQKKVIGLNKETCGGFLKL
FT                   AKRCEVEIHLTLDEVLRIENSLVSSSPFEALEGVMTSISEFIEPFEKMEEFFSVFHRTI
FT                   QLLFDFFDQLNSSKYRNSSSTESCKHYSVRLLGCWMTLEPTHYKNQYLSKLSKIIECIS
FT                   EFDFIWLLPSFNYIDASDIYSVDGLANVLIKLIFGLLKFDEKSGTCKRSIKMLCELVTR
FT                   IHLDPLVDYELFLKRINCKLLSEYGTELCEIRQEIKIPDCILESGKFSPSNPVEFLAPI
FT                   TVNLENSDSYRLLSKSLMNLLYNLCKNCGDECIKGFFGGNHDLNKFIKALLDDQEFSDE
FT                   FELIFLATLACGSCIVRVTENTGLKHLGSSLLILVMELVIFFFVHTSPRVPGDYLEDLE
FT                   KISHYMSLCRVSLLLMNNYRNFSSLFQYSIKKIQLRIPKPVKEDFEASIEEGIVSEEDL
FT                   SICELMSSYVSNILS"
FT   CDS_pept        join(694247..694452,694514..694745,694787..695461)
FT                   /locus_tag="TA06300"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.27 - score = 33.49"
FT                   /db_xref="EnsemblGenomes-Gn:TA06300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73195"
FT                   /db_xref="GOA:Q4UI94"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR040194"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI94"
FT                   /protein_id="CAI73195.1"
FT                   /translation="MTEERSSEKDSHKNGILNYNKLLSGFVVKITNIPGQIDENSLKSV
FT                   MSHFGNVEMCKLVFGEKISDPATAWIQYKSESELNNALKADGKLECGGCKLKITRWDGE
FT                   IPSEKREQKRKLTESSTCQDSCWFCLANDECETHMISYVSKHCYVAVAKGALSDMHSLV
FT                   VPIYHYANLGSAPLDVQMDIKKVIESLFDIAISKGKGAIAFERYVPMTMKVAMHTQVQV
FT                   LEVPSHRALQCFNFVDRSQIFSDATRVTFESEDIGFHGITSRVNNKTQYLYLQAVGKPE
FT                   NSDEISFAKCLWVFDRPNFRKIPTHFGREIALSVLSHRELEKINSLNKYVSETNMKPGI
FT                   AAIDWHNCVATKEEETESSKRMSKMILGVE"
FT   CDS_pept        join(695600..697213,697241..697324,697354..697719)
FT                   /locus_tag="TA06295"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.28 - score = 52.28"
FT                   /db_xref="EnsemblGenomes-Gn:TA06295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73196"
FT                   /db_xref="InterPro:IPR005343"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI93"
FT                   /protein_id="CAI73196.1"
FT                   /translation="MKRDRKKINKNKSEDENEADFIESESESELHSEDSEVEFVDEESD
FT                   SEQSQYDSEDDETNNVDAESEDSEPDFDEDTNLPVLTSKLSQKLLDKASSHSYNSIKKL
FT                   LSVFSSVVGSVGSNKINLASDTKNHKLDVDKSKMKFKYLKNENKRILKGTANRFSEPSK
FT                   VSKKDYVVKDWDVYKIFVSSTCDVMTEYLKDREVTGKKEEVTSSAPLVRKFLSTSLVQL
FT                   AFILDDFELTRSCLVSLSSTHVVKWICVFKNLNNQFVKIVSSLMCAHPQKHTRIDCFCF
FT                   LSEYLNCVKDHKLMRVQLSFKSYLVNYAKLSESESKSASNTIVDLLLKRCYSSHVKSVM
FT                   NGITLKNYGLFKVSKNCISELYLNAPFDNLYMFSFKTITNLAYNVRREWNNTGKEKKPK
FT                   KKETNSKEDKTKKPLNVNTTILSVCSWGFIESVNIWINVLSRSDNKMKTLIYPLVTVIN
FT                   SAIKIKISNKRQIPFVLHLLISLNKLLDGTHKFIPIMSLLYHVLDNIKNIKQTVPSEYF
FT                   KNTLVTSNINNPNKLVKPFKLLKSKGSLEKSEDIMVKLRLSGKSVNSPQIYKVLYKYVE
FT                   LILIDHLGILSLNPSFPEYTNCICYHLKRYIKSPEVLNDFRNTVNSLLKVLNETNVVVT
FT                   KLREGMDDAALEGFNVFEPEKIPMYKYRQDFLVKFQQVNKDKFVSSLQINDL"
FT   CDS_pept        complement(join(697809..698057,698088..698254,
FT                   698287..698433,698497..698559,698594..698656,
FT                   698687..698944,698974..699081,699117..699240,
FT                   699272..699352,699391..699552,699582..699638,
FT                   699669..699939,699982..700129,700159..700689,
FT                   700726..701140,701172..701246,701276..701511,
FT                   701590..701701))
FT                   /locus_tag="TA06290"
FT                   /product="DNA polymerase delta catalytic subunit (Pold1
FT                   homologue), putative"
FT                   /EC_number="2.7.7.7"
FT                   /note="Tap349e08.q2ks7.cand.107 - score = 100.86"
FT                   /db_xref="EnsemblGenomes-Gn:TA06290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73197"
FT                   /db_xref="GOA:Q4UI92"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI92"
FT                   /protein_id="CAI73197.1"
FT                   /translation="MSSNDLNWHNTMYSNFYGTQNDYGKIFSKLRRPTFDFVFFLTDAD
FT                   YTFKVVKCTSDGTLSETGDHHTEVPVVRLYGVTKEQQSVLVCVDDFQPYFYIEKPPELL
FT                   EENFEDLKQLFNKHLSEQNQFKKSLRHVLDIQKTRLTSLMMYDENGEKDFLRIVVSSPR
FT                   MVSNLRSYIESGVELEVDGDSFTIPLYRQTYEANLPYVLRFLLDNNVICGSWLMIPQNC
FT                   YTLNNPKNFMQLVSTCNIEVNCGYSDIITLPLENEYETIGPIKILSFDIECIKLNGTGF
FT                   PNASNDPVIQISSVIHTHGNDVNNTKNFVFTLKECDSLANCTILSFDNEEQLLLAWNDF
FT                   VIFVDPDFLTGYNIILFDLPYLLTRSSVLNIEARFKKLTRIKSVNCNFKDSISNNNILG
FT                   LYENKEINIEGRILFDVYDLVRRDYKLKSYSLNYVSFEFLKQQKEDVHYSTILKLFNGN
FT                   NNDRRRIASYCLKDSILPLLLINKLLLLYNYIEMSRVTTTPIKLLITRGQQIRVTMQIY
FT                   KQCKKMNYVIPVITGGGKNSSNENSYEGATVLEPLKGYHKNPISVLDFQSLYPSIMIAH
FT                   NICYSTLLNYNNINNYRPEDVVRVPGYNDICFISVNKRKGILPIIVENLINERKKAKKM
FT                   MNECKDEMLKKVYDGRQLALKITTNSVYGYTGATSGGFLPCIDVATAITSFGRNMIVNT
FT                   KNLIEEHFTVKNGFKFDSKVIYGDTDSVMINFGTDDIQEAIDLGKNAADLITSKSVKPI
FT                   TLLFEKVYKPLLLLSKKRYAGLYYVNSEKYEKIDCKGIEVLVFVTILFQSVRRDFCLLI
FT                   QQMLEQILYLLLVKLDLDGAIEFVKKKVSELLKNEIDVSLLVITKSLGKVDYEQRLPHV
FT                   ELAKKLRKRDPGKAPGVGDRISYIIVKGTKGEPLFDRAEEPLYVTENNLPIDTSYYLDS
FT                   LKNVLLRIFEVVMTNPNSLFNGEHTRVININSSTKGLMNKFLTKIRRCLSCNIVLSNST
FT                   ESTEMFCSNCNTSKKQQILLDKLTACRIKEDLYHKLWTHCQRFASIIYYNLLIRCQGNL
FT                   HNAVMCDNRDCPIFYRRVKVSKDLTQLQSTLSTLQLQYTN"
FT   CDS_pept        join(702099..702257,702297..702518,702557..702708,
FT                   702741..703014)
FT                   /locus_tag="TA06285"
FT                   /product="exosome ribonuclease PH (Rrp42 homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.29 - score = 22.35"
FT                   /db_xref="EnsemblGenomes-Gn:TA06285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73198"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI91"
FT                   /protein_id="CAI73198.1"
FT                   /translation="MDFVKSAISSNLRLDGRKFEQLYSLNIIPNISSIAHGSSQVTFGD
FT                   NIVQTTVNFSIVSPEDSTPDEGIIDLTITGTNIFENSELSQRNYEILCNILYDLEFQHA
FT                   FLDLKSLCILPGQLCWNIRIHSTVVKRGGCVIDALSIGVLSSLMCSDVPDVEVMFRDEL
FT                   ESYQRSNLQLKLSLDKNKIISQLVERFPLITSVGKVSKNYLWGMTREEELCSDGTMSVA
FT                   VDKTGKCLSVKANGSCFELNCIQNLINTSTEITLDNFNKLNQFISS"
FT   CDS_pept        complement(703049..705658)
FT                   /locus_tag="TA06280"
FT                   /product="hypothetical protein"
FT                   /note="Signal peptide predicted for TA06280 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.983, signal anchor
FT                   probability 0.000) with cleavage site probability 0.784
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73199"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI90"
FT                   /protein_id="CAI73199.1"
FT                   /translation="MFNLLIRSLIVLLLVKSCFTIRFNNYRINSLFINNFNKESCLLND
FT                   LSFEEYDKSSRFINKLKESSSKGNDNSGDVEDSNTHQGDNESNKSPEANLELTISKRIL
FT                   NSILSLTSSFYEPDFYDIIPILYNIKDEVINMKEYMGKTQVKTSQRKHPVKVYHKHKDK
FT                   TYKINEKMYNKINGMFMNDSSGEVESLVLSIPSSIMNRLYQSSNYEQKPEDTMPIQLVT
FT                   LTSGFLTRLYEISIFPYFSKMFQNCFNTTLDNTYGFMYRIIKYNSAEETYIKSDYETGK
FT                   EKIPGFFLTLELEKTLTEEFEKILRKIRIKTVKELDLNVFTKDSLRNISVLIKCIKDLV
FT                   FFNSSLKLLEQLIGRKPTDNEIIFSFFRKSQTHPIKNNETVSEGSEPTVNHPPDFNAKK
FT                   LVQIINDSEYEIEHRLDFYFTPFIEAIINIYKRRINPNFFKVMISCFKDALDAVTTRLY
FT                   EISPKRINDYGTNFILDIFLFTYNQVKLSALRQNLPEHLPIGTLRLAKKGLKLYEYLEP
FT                   IQGNMIYRHKKKAITKEELESLYKDEVDDDQKDEDKNDEKRHQNPYSQKFDIDDKKFNE
FT                   FLRKIIEIEDHFNKRGGDKSCNDYMRRQQQDEHLKNSVAKFLNVTPDRLSEAIDAYYSK
FT                   EVGPTDRIPRYLRSRLSPTGRPGKSPVRYYGELEPYEVYDRLESVEYFRDMIYRRTLRK
FT                   LAMEALDDRVARILFMAQNSLFCEVHPDYEEVIADLKIPKRTADFIAFAATVMCKQYEV
FT                   WRIKLNLPPYVNEFRINPSVLMLATLDPNNLPHHISTTMYNRVKGSYSSALREEPTQIR
FT                   GAAAKNKRDRFNRMRLIKPNMSDMTESFMNYKANYKEYEQILLRSPIYYLQYSGIMN"
FT   misc_feature    complement(705599..705658)
FT                   /note="Signal peptide predicted for TA06280 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.983, signal anchor
FT                   probability 0.000) with cleavage site probability 0.784
FT                   between residues 20 and 21"
FT   CDS_pept        complement(join(705896..705998,706030..706115,
FT                   706171..706254))
FT                   /locus_tag="TA06275"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73200"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI89"
FT                   /protein_id="CAI73200.1"
FT                   /translation="MLYRNYNLTFKRFVYWPPQFNNKSTILNLPSGKKCFVFMGKRDCD
FT                   GKLEPVLCFIDKLGNKLMWLNREEVHQFDKLINRIESYFDLFKDK"
FT   CDS_pept        join(706352..706453,706549..706695,706727..706834,
FT                   706867..706976,707008..707185,707240..707309,
FT                   707340..707656,707687..707849,707881..708167)
FT                   /locus_tag="TA06270"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.30 - score = 44.77"
FT                   /db_xref="EnsemblGenomes-Gn:TA06270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73201"
FT                   /db_xref="GOA:Q4UI88"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="InterPro:IPR032324"
FT                   /db_xref="InterPro:IPR038239"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI88"
FT                   /protein_id="CAI73201.1"
FT                   /translation="MMQPIRTYNLPPFSELRIITNDHFNSIPLKPSITLIKKNDNESAE
FT                   IFGKELVPGVEVALNEGERIAIYTWSGCTLQIKGSILQEYESYDINIMKEYLNIINLLN
FT                   IKRQLSTINNTFGPRILVTGSPSSGKSSFCTILCNYALRFSWKPLFIDADPRSSCDKSS
FT                   LKLYPGTVGCVLYDNMDIATNPLLYYYGYSYYQDNEFLYLHVIIRSSQLDCLLMKLLNV
FT                   NIELMLYNNDNVIKSSGIVINAPYECNKDMIVKLCKIYKVSVIVVIDSPSIHQELIKHY
FT                   KNEKNNIDINIAKLAYNNIIINDNETKSDNPEPVKRSDASENSANNSDEMLILSSSKLE
FT                   GVISVDNNRLKYINNMNWNKYFEINNLGRNHIIKVNSSTITFIYIDIIEPLTKDALPTN
FT                   EEYVMKHKEMYCNAYTDDLLLLNNLIVAVPATDDIKLIPYTNILSFFHIRSIESTASED
FT                   NTFTISLCCQTYYSPSSLPKYLLLPRDFKTLKYNP"
FT   CDS_pept        708388..710247
FT                   /locus_tag="TA06265"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.31 - score = 66.00"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06265 by TMHMM2.0 at aa 22-44, 144-166, 176-198, 205-227,
FT                   242-264, 392-414, 429-451, 501-523, 543-565 and 578-596"
FT                   /db_xref="EnsemblGenomes-Gn:TA06265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73202"
FT                   /db_xref="GOA:Q4UI87"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI87"
FT                   /protein_id="CAI73202.1"
FT                   /translation="MAECPYCGSANKQAGGGTEDCPYLMAAYVFAGLAMMLNIRLSYSS
FT                   APYALIRFRLPENLFSVFVRRMASALELWCLPSMLLGNIMEYGLKGYYQIKNYESDFAN
FT                   GFNLKVPSTINITDSTPKTITIKNLPHVNNTFTPRLEKFYWIVVPSIITQWLNFLTYVI
FT                   LLFVYISGGDQGHLTVFYFVIAISGFVFGINMVLLYAVDWNYIPVYMVGENSFPIVTSS
FT                   IHYMTTLIFGNRRKWNSDFIIVWIDIWVAIVISLVAAFLWTLAYGYYRNTQKEAITGYP
FT                   ASTSTTITYGTSSECTKHTATPVGKATITDPTDGKSPTLTLNVSDTATNLAAIQETQCN
FT                   VDVDTTKKTLTIKYGDECITITVGSITKAKGPVLYGHILTEKFDMSTVRGAIISPTLMV
FT                   IVGMGLVYAIYPGIAPGMIVPFYLVDKIEMVLLIATFFPPVIVALLNRGSFNESTKPYS
FT                   PKNIYQFHKPEDTENGFGGWRPYKKHVKGSANCESESTIDNWFWHFFDLLIVIKISLAA
FT                   IFIYSLHYRESAISRSIINQPKMSTILSIIFYMCHEFLLALGFPGVIGNNGSTYVMLPA
FT                   QYVGALFMIFLAFYSEGYIIEYKSHDPTHWPTESMNRWNVVCI"
FT   misc_feature    join(708451..708519,708817..708885,708913..708981,
FT                   709000..709068,709111..709179,709561..709629,
FT                   709672..709740,709888..709956,710014..710082,
FT                   710119..710175)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06265 by TMHMM2.0 at aa 22-44, 144-166, 176-198, 205-227,
FT                   242-264, 392-414, 429-451, 501-523, 543-565 and 578-596"
FT   CDS_pept        710444..713464
FT                   /locus_tag="TA06260"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.31 - score = 66.00"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06260 by TMHMM2.0 at aa 20-42, 54-76, 98-120, 127-149,
FT                   164-181, 190-212, 274-296, 309-326, 868-890, 911-933 and
FT                   938-960"
FT                   /db_xref="EnsemblGenomes-Gn:TA06260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73203"
FT                   /db_xref="GOA:Q4UI86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI86"
FT                   /protein_id="CAI73203.1"
FT                   /translation="MTTDNKPPFGEHPLKISAFTFAGLAMMLNIRLVYSAAPYALLRFK
FT                   LPENLFSVFVRIMAGSLELWCLPSMTIANVMDYFRRRLLSDDNWKDWYYHYQSIFWSWA
FT                   NFLTFVILWISFIIGGEAGNVTAFYWVVAASGFVFGINMVMVYAMEFQYLPWYMIGENS
FT                   FPMVTSLMHYVGTLFFGNRRKWNSDYIIVTIDIVISLAISLVAAVLWTWAYWDAKNDGY
FT                   PPSDPNQRVCKTFSVSGTTDLTYSLNPNYADSHADGTDNCGYKKSYAYWLHFIPPSLMV
FT                   LIGMGLVYCIYPGIAPGMIVPFYLIDKIEMVLLIATAFPPVIIGIMKQYKINPYIPMGN
FT                   WGTYHKKACKGGSNLESGGGTTEQCKCPNGSSSSSSSAILRLHNTTIKASDGLIAIATI
FT                   KVTNSTGGGTPYTGLINTINNGTLSKTGDLKINTKLQVGEILTLSGRGTANGGNEINIK
FT                   GTIIVTSPGSLGQTITLDGLLAGTLTLSDALAGSINVTKETTGDSLNANTPSALGGITV
FT                   NIGGSGVTGNATITITATKDRDDLTSISEQVNIRDIKLTKADGGALRINTTALKPNDTL
FT                   NLIGTATATRFTNIKVSGMITITSGNGTLGNTITFTDDVTSSGALTLADDPDGESVKVQ
FT                   TGGTLTLQANILTVLQNTNFSLISPGSDKRVLTYEPRLVTESRITIGIKTSTIGKVTLS
FT                   GLSLIPVCITSTNNFSATADLSLTHNQSASTDLKTTGGLTINSTSLSGATVTITKDEKD
FT                   KVASLSNGDLQTSTNLVPGDTLTLTITKSSTETKLEGKITVTSPGNLNGNLTLKGGLTG
FT                   TIRDLSVRGGTLTASNVNITNLKYDPEEFHVNHESTHCCFWGGKVFKWSDTNPKNVPWH
FT                   IPVILGPFQICLAVVLVYSLHYTDSNISRSIVNQPKMSTALSIIFYMCHEIQLALGFPG
FT                   IASDPNILLPMQLIGAFLMVLLAFYSVGYITEYKRNDPLNWPTDGMTTWNSLCYWLKMA
FT                   SKITNKNFKQLFTTETS"
FT   misc_feature    join(710501..710569,710603..710671,710735..710803,
FT                   710822..710890,710933..710986,711011..711079,
FT                   711263..711331,711368..711421,713045..713113,
FT                   713174..713242,713255..713323)
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06260 by TMHMM2.0 at aa 20-42, 54-76, 98-120, 127-149,
FT                   164-181, 190-212, 274-296, 309-326, 868-890, 911-933 and
FT                   938-960"
FT   CDS_pept        complement(713912..714649)
FT                   /locus_tag="TA06245"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.103 - score = 11.20"
FT                   /db_xref="EnsemblGenomes-Gn:TA06245"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73204"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI85"
FT                   /protein_id="CAI73204.1"
FT                   /translation="MSQFLPVSKGFNPRKSHPFSSNRFKRRCPSQYFYIPIECPLGRNC
FT                   EDGLCALSHSKLEVIFHPVLHRTKRCGMAVLNICVFSQRCAFFHNSRERISSHLVWLNW
FT                   HWNWSLWDSDPKSFSQRFNLDIDISNKFFIMLQNRIQLHYILNKQENSQNNQLNHEGSD
FT                   TYYPTYVKEAIAYNAGDDAKMMNLEKRLDAILELCTTPETTASSLTPKIKQYLELTPYN
FT                   NEMQNSNHNDFEFYNDNLNQLIK"
FT   CDS_pept        join(716747..716775,716823..716921,716953..717049)
FT                   /locus_tag="TA06240"
FT                   /product="protein-transport (SEC61 homologue), beta
FT                   subunit, putative"
FT                   /note="1 probable transmembrane helix predicted for TA06240
FT                   by TMHMM2.0 at aa 47-66"
FT                   /note="Signal anchor predicted for TA06240 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.898) with cleavage site probability 0.000
FT                   between residues -1 and 0"
FT                   /db_xref="EnsemblGenomes-Gn:TA06240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73205"
FT                   /db_xref="GOA:Q4UI84"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI84"
FT                   /protein_id="CAI73205.1"
FT                   /translation="MVGGQRVSTRRRNNNESSGPRSNLPPNSGFQKYYGLTTTGLEMDQ
FT                   QSVLLLALIYMGVVVVMHIVSRINLVYKG"
FT   misc_feature    716963..717022
FT                   /note="1 probable transmembrane helix predicted for TA06240
FT                   by TMHMM2.0 at aa 47-66"
FT   CDS_pept        join(717320..717451,717560..717668,717698..717906,
FT                   717969..718272,718306..718415,718450..718565,
FT                   718625..718733,718768..718980,719021..719113)
FT                   /locus_tag="TA06235"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73206"
FT                   /db_xref="GOA:Q4UI83"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI83"
FT                   /protein_id="CAI73206.1"
FT                   /translation="MYNFPIQFFQNLRIRTLKVNNFNFFDRFILFTRRLISSQTSPTHT
FT                   SNIPSVPSIHDPEVVRRPGEIIDVATLTRNYWSFPAVGFNSVLELPVYVFEYYDRKDVK
FT                   EAIRYLRVPNDIFGLPIRPDILHRCYQFYRRAKAGYSEDMQLYKWEWPGSTKKWRKQQK
FT                   SGKARIGWKKSPGKYVGVFAHPLRPKDNRTKIQRRSKLVFLIRFLALYTGLKIMLSAKF
FT                   AQSQIQVVDSFLMASHKTKYAVQNLRRILGDRCNSALLVFEGLSDSNENFRWSTANIPS
FT                   VRRETVEGVNVYNLLKYRQLVITQSALRKLIYYIENYPKKCDWIPKYATPNNTPAPIPQ
FT                   KVKGWNSTWIENKLKARLSPESKEKWMEQVKNWKWSSDTKGALKVPRDDPLKCFRLIDL
FT                   PISDSSEIKKRFQYLYDVTFDPPEEVELDSYEPMEDEAESLVQFTNEYIEQDLKTLQEL
FT                   KTFKLK"
FT   CDS_pept        complement(join(719507..719692,719724..719954))
FT                   /locus_tag="TA06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA06230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73207"
FT                   /db_xref="GOA:Q4UI82"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI82"
FT                   /protein_id="CAI73207.1"
FT                   /translation="MDDFNYGFPPPPSFYTNYSLKCTDPDDSLESKLNSIKDEIKEAEG
FT                   LVFDYKKLKCFQGPLPPFPPNESWYSFGNSEKFHEEEHTLDSETLIRPEPGVVDLREHF
FT                   RVLYGDFTNSLFTYLDLVKNVRLLIDIRNYLKIS"
FT   CDS_pept        complement(720296..720859)
FT                   /locus_tag="TA06225"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.101 - score = 8.92"
FT                   /db_xref="EnsemblGenomes-Gn:TA06225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73208"
FT                   /db_xref="GOA:Q4UI81"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI81"
FT                   /protein_id="CAI73208.1"
FT                   /translation="MTASIPISSSFDPDRNEPFKCHKFKRRCPINYFYIPIECPHMLKC
FT                   LDGRCPLSHSTYEVIFHPILHKTKRCTLAFKNKCKLEKKCAFYHGENDRLSSYLSWLVW
FT                   EKHWGMNSENVIPILQKFGLSSRLISKFVLMINIRSSQKSVLSLNSDVTDYIKVLEDEL
FT                   NDLISTCKSTLDNQNNHSYESIVI"
FT   CDS_pept        complement(721785..722321)
FT                   /locus_tag="TA06220"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.100 - score = 9.64"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA06220 by TMHMM2.0 at aa 7-26, 31-53 and 116-138"
FT                   /note="Signal peptide predicted for TA06220 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.655, signal anchor
FT                   probability 0.233) with cleavage site probability 0.142
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06220"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73209"
FT                   /db_xref="GOA:Q4UI80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI80"
FT                   /protein_id="CAI73209.1"
FT                   /translation="MEKESKLVPFLFLLSFNALQFSTYVLKLPPLFLLSKGFLGLVFLG
FT                   GFLRLVRGDRSSKLRERFHTDLFTSDTVDRVVKFLSRKVNLVFVQTKSVVLWDDPVKSL
FT                   YSLVVLYLLSELLKVVPSVLVVFVLVWVFFLYFYMNEFLRKNVYTHFEPYVKEFVNFMY
FT                   KMYNSVPRLNENKLL"
FT   misc_feature    complement(join(721908..721976,722163..722231,
FT                   722244..722303))
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA06220 by TMHMM2.0 at aa 7-26, 31-53 and 116-138"
FT   misc_feature    complement(722262..722321)
FT                   /note="Signal peptide predicted for TA06220 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.655, signal anchor
FT                   probability 0.233) with cleavage site probability 0.142
FT                   between residues 20 and 21"
FT   CDS_pept        complement(join(722896..723573,723667..723705))
FT                   /locus_tag="TA06215"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73210"
FT                   /db_xref="GOA:Q4UI79"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI79"
FT                   /protein_id="CAI73210.1"
FT                   /translation="MISKHLTIFLILPDSKLKKSTKNKSNQVKSTKKTRSKKIIKVYDP
FT                   KPKIKKGLKSYAFVNLRRIPVPPNRMTPLQNNWENIVRTVVERLELQIRMCTKTKCVEV
FT                   RPSREGMDLSLLQKAQDYIRAFMLGFELKDAEAILRLEDIFIESFEINDVKRLHGDHLS
FT                   RCIGRISGKDGRTKHAIENMTKTRVILANNKIHIMGSFNSIKLARHSICSLILGSQPGK
FT                   VYNNLCNSAKRLRERI"
FT   CDS_pept        join(724024..724466,724537..724678)
FT                   /locus_tag="TA06210"
FT                   /product="cytochrome C1 heme lyase, putative"
FT                   /EC_number="4.4.1.-"
FT                   /note="Tap349e08.q2ks7.C.cand.33 - score = 11.22"
FT                   /db_xref="EnsemblGenomes-Gn:TA06210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73211"
FT                   /db_xref="GOA:Q4UI78"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI78"
FT                   /protein_id="CAI73211.1"
FT                   /translation="MSCPSSNDTGSYCSSKNHIGPRISPDPVALSKLCSKRSKSSIPSR
FT                   DSLWSYPSQQQFYKSTLNKGHNVDSNLIPTIVEIHNLVNEKAWERVMEYESVHKETCKN
FT                   PVLVHFVGNKDKHTFKSILNYISGYKLPFDRHDWTVDRCGNRRRYILEFYEGSTDDPNK
FT                   LGVHIDVRPDLSFNGICDRLRFWVHKSFSGI"
FT   CDS_pept        complement(725444..725923)
FT                   /locus_tag="TA06205"
FT                   /product="eukaryotic translation initiation factor (eIF5A
FT                   homologue), putative"
FT                   /note="Tap349e08.q2ks7.cand.98 - score = 15.65"
FT                   /db_xref="EnsemblGenomes-Gn:TA06205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73212"
FT                   /db_xref="GOA:Q4UI77"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI77"
FT                   /protein_id="CAI73212.1"
FT                   /translation="MYEEDFEGGDAGASHTVPVQAGAIKKNSFVMIKGHPCKVVEYSTS
FT                   KTGKHGHAKANITGIDIFTGKKYEDICPTSHNMDVPHVKRTEIQLIGIEDDGFVTLLNQ
FT                   DGSCKTDLQLTKDSEGNYDEVAKQIQTLYESGKEVLVTVLSACGQEKIVGCKELT"
FT   CDS_pept        complement(join(726320..728187,728218..728342,
FT                   728499..729412))
FT                   /locus_tag="TA06200"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.97 - score = 56.90"
FT                   /db_xref="EnsemblGenomes-Gn:TA06200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73213"
FT                   /db_xref="GOA:Q4UI76"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI76"
FT                   /protein_id="CAI73213.1"
FT                   /translation="MSTDVDKPSENSLKLNTKDVSIEDSSTIFEKLDKLFTTFKNKKYY
FT                   RKYKPKSQLITIPKFYYKFKNCYKSIDFNDIPYSPSTSRLEYNFLDIFFNLVRKGFGIS
FT                   QIVGSSGSGKTSICLRIAENFPGIALYLDTGGSIDPITSPHTHKFIPLRLYTCEELLLF
FT                   LNHFESSLSEDKELSERLKIKARSVEMLIVDSLWIIDQLDKFQQQIFLYNLSSVLKRIS
FT                   FNYDICIIVCINSTVKSNTLKPIVKSELKGLIKETVSSFQTTKQPRNIYVKWNCNCNAQ
FT                   FLLSYKTLNFRPSNLSIEDSEYPLKLNEIYTYHPSDELPWRPPEVDQFRNFLISSKTRS
FT                   TRDSSTGYINLCIIRGQTGSGKMTTIRKLCNDLRIRLIEYDPFNVVPNTQVEFDYTIDS
FT                   VIRFLQSSLSRRCLRTTAPEKITTNEKILVGSRKIKRIKSEVSKYDGSGAGGLTGTMNS
FT                   GGPEEGQLVLISDLPRGILNCKYSNLYPLQSLLREVVISDTMYPLVIVTSNSNEDYLIL
FT                   RRIMPPNYLKKSRCLLINIKEVTRAKMTSLLNVTKKNKLLNYLMDSSGGDIRYVINNMR
FT                   FYQCDPNLDIDFECDSKEETIKDYILERNNLNNFDLLGKILYNKRIPAVLKVKNETPEE
FT                   ELTGDFKFLECFSLSRPINIQSSQSYETINMTSTPVKRKECSPRNSQSAVSRINSSRER
FT                   QNPDSIPVIVKMFGLVSEFDFTRPVSYTRWPVLTPEPDVIRFRQTSDKMIPKLTRPVLY
FT                   YSPEKMVDSIKSDSNYFANSIFDNYSDLYGHIDDCASMLKHFVIADVYQSNPKNINDSD
FT                   VSRIFLAICIRAAADSNIYGFESHKQKFHTFITHKSKSEYIRAMFQDLRSESIGGDGSK
FT                   LYSKDVLFTEIIPALSVATVSQNESSEDVTQTLSIDEDYNINDVMDKVEKILEGRQETV
FT                   HKLKTLEQETIFTPKFNEILQEITNHYYSWDKHSQESI"
FT   CDS_pept        complement(join(730218..730374,730433..730794))
FT                   /locus_tag="TA06195"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.96 - score = 29.40"
FT                   /note="1 probable transmembrane helix predicted for TA06195
FT                   by TMHMM2.0 at aa 38-60"
FT                   /note="GPI-Anchor Signal predicted for TA06195 by DGPI
FT                   v2.04 with cleavage site probability 0.3306 near 140"
FT                   /db_xref="EnsemblGenomes-Gn:TA06195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73214"
FT                   /db_xref="GOA:Q4UI75"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI75"
FT                   /protein_id="CAI73214.1"
FT                   /translation="MSIVLIIASGGIDPKSILSCFESDLSSEFIASFELVPFSFVLFEF
FT                   FSLVTSCLLTVNSFFRFLKTFTNESSPFLTNFGTSVLANFILEFISEMSVPDPPSDSES
FT                   SEKYLFNKINPCISHLQENCYHELTVDLLVSITLVNSLNNCREMNLKLIFKVCNMKVYK
FT                   VLGILNFEF"
FT   misc_feature    complement(730372..730377)
FT                   /note="GPI-Anchor Signal predicted for TA06195 by DGPI
FT                   v2.04 with cleavage site probability 0.3306 near 140"
FT   misc_feature    complement(730615..730683)
FT                   /note="1 probable transmembrane helix predicted for TA06195
FT                   by TMHMM2.0 at aa 38-60"
FT   CDS_pept        complement(join(730903..730992,731024..731125,
FT                   731169..731624,731653..731748))
FT                   /locus_tag="TA06185"
FT                   /product="casein kinase II, beta subunit, putative"
FT                   /note="Tap349e08.q2ks7.cand.96 - score = 29.40"
FT                   /db_xref="EnsemblGenomes-Gn:TA06185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73216"
FT                   /db_xref="GOA:Q4UI73"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI73"
FT                   /protein_id="CAI73216.1"
FT                   /translation="MFGTNILGQNNKDEDYVMSENRTDTSDDQNSEMTWIEWYCSLKGN
FT                   QYYIQVDESFIRDEFNLVGMCIQIYKFSGLQYQVSYYNTALQLILDNYENDFYDDDDYE
FT                   SLSEKGKQHQINTSAQLLYGLIHSRFIMTSKGMHLMMQKYKDKVFGFCPNFSCENASVL
FT                   PIGLVDAPAHHTAKIFCPSCNETYHPPKSSRLGLIDGAYYGTTFAHLFLMVNESVIPRG
FT                   PSYYYVPKIYGYRISPYVKKNSKYS"
FT   CDS_pept        732154..733701
FT                   /locus_tag="TA06180"
FT                   /product="protein kinase, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.35 - score = 35.23"
FT                   /db_xref="EnsemblGenomes-Gn:TA06180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73217"
FT                   /db_xref="GOA:Q4UI72"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI72"
FT                   /protein_id="CAI73217.1"
FT                   /translation="MSTEESYFSSESDPDSEEDIADSEENTSGILFFKRSPNDESRLAR
FT                   NSIIYKRNSLEKGLTKDKRVTVQQVLDKRTYIRLKRLHGRGIFDFIYGVISTGKEANVY
FT                   EAEGTLLSTKHRIAIKVYKTSILIFKDRSRYIEGEFRFRRSYVGTKNPRKMVSQWAEKE
FT                   FRNLRRISLSGIYCPCPIALKDHILVMELIHDSNGRIGTKLKDLGQLPVSEWLLIYSQV
FT                   ISIMRILYQESKLIHADFSSYNLLYSESRVVVIDVSQAVENDHPNSMYFLKRDCENITT
FT                   FFTTVSFDNPNEEDSDFSIDCDHSDSVLQNSFNILTSFQLFNFITMELDLGNELRVESL
FT                   DENVDEYVNKMVYTSKNAKVDHLREVIMKKRLLYNAFYNHVYNLLLIKDPIIFIKEPFE
FT                   SVNFISNQASWSSLNHLNLSSLTVDILDRLERENNLPEPNKTNYGNEDSLFEDNLDSNS
FT                   SSDQDVESPEDNVKFNGKIPEGIDPKEWKRMVKQMNRERREHKIPKHIKKSFKNKHS"
FT   CDS_pept        complement(733820..734731)
FT                   /locus_tag="TA06175"
FT                   /product="RNA-binding (SR) protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.95 - score = 27.48"
FT                   /db_xref="EnsemblGenomes-Gn:TA06175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73218"
FT                   /db_xref="GOA:Q4UI71"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR037366"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI71"
FT                   /protein_id="CAI73218.1"
FT                   /translation="MVENTESSDTKNFYNVSPLLTESDYESLKIFAGGLTRSTTPEDLK
FT                   EYFSKYGEVTHTEIVRDKNTGRSRGFGFVTFADRDSVNTVLRKVHKIDGVEADVKLAVR
FT                   KEKSKILAPQYDQTKRIFVGGVSEKITESYFRDYFARYGPITSYNYLVDRATNRPRGYG
FT                   FVIYENMEDAEKSIGMHLSLGRNCEAKFAEPKYPEKEETMISDFDYSAYYYAQANLLYS
FT                   QYLSQLYNGQTNPESSSTDENSTNRSRESSPHRRRERSSDRKRSRRSRTRSRSRTRSRS
FT                   RSRSRHRSRSSSRSYSRRKHRR"
FT   CDS_pept        join(735356..735423,735474..735593,735630..735691,
FT                   735746..735819,735859..735972,736004..736195)
FT                   /locus_tag="TA06170"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.36 - score = 24.30"
FT                   /db_xref="EnsemblGenomes-Gn:TA06170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73219"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI70"
FT                   /protein_id="CAI73219.1"
FT                   /translation="MANSQRMSLVDLRSLIENHNQIKIGNDLEHSKLSNSIVGNRDLSQ
FT                   ITTQDTTTALFINDNDKKDESINPNTRLNDFNYLPLVNFPKFTKDSLNDKKESYGIELP
FT                   KVSKKDKKKIISKEGDVDKRNVKLKDKCVENQSSDIAESENRELKELDNLELNMRIKGC
FT                   LGILKTEILTSILKNEFNEEDVNIIEDSNINERKIIIDKILSHLIG"
FT   CDS_pept        join(736613..736661,736738..736960,736989..737116,
FT                   737179..737252,737283..737351,737419..737508)
FT                   /locus_tag="TA06165"
FT                   /product="Rab GTPAse, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="Tap349e08.q2ks7.C.cand.37 - score = 50.06"
FT                   /db_xref="EnsemblGenomes-Gn:TA06165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73220"
FT                   /db_xref="GOA:Q4UI69"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI69"
FT                   /protein_id="CAI73220.1"
FT                   /translation="MSYYKYLFKYIIIGDTGVGKSCLLLRFTDKRFKPDHDLTIGVEFG
FT                   TRFITVQGEQIKLQIWDTAGQESFRSITRSYYRGAAGALLVFDISRRSTFEHLTKWLEE
FT                   VRDHGSPTMSIILIGNKTDVASREVEYHEGKQFADQNDLIYMETSAKGDYNVEAAFLTT
FT                   AELIYENVKNGLFDIESGVQGVKRGPMGVSSRSMFILIIKIQLLRYW"
FT   CDS_pept        join(737768..737887,738089..738163,738417..738452,
FT                   738497..738644,738688..738791,738830..738961,
FT                   738991..739146,739177..739988,740019..740220)
FT                   /locus_tag="TA06160"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.37 - score = 50.06"
FT                   /db_xref="EnsemblGenomes-Gn:TA06160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73221"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI68"
FT                   /protein_id="CAI73221.1"
FT                   /translation="MSYYKSSKQLSQSKVSDINRFGSDDTFVVDLESKVDSLKNSKVFN
FT                   SASLSLNTTLLNMSKIARGYNDNIIIIELIYIRIQISKFQNGSKLIQIDSRCIYRKVLW
FT                   FTTFHSYEKYELRERMKRPFYKENDRVEQISHYANKLARNLNFNTTEWDSILLKSKERH
FT                   LEFKPIDIALLLNSLSRGRIYDKELFELLIPQIIKKISFFTSVHLSMVLSAYSKGKMLT
FT                   PDLYNILKFEISSRIYEFRTSIEMCMVLNAISKFGDNDKIFLSKISNHILKSFRYFNFS
FT                   PQELSVIINSLVTLGYYHEQLFNIFSSQLMINNGNIGNLVNNLNACNIFELLRVLNGFM
FT                   IFENNYKDIQNQCKHEIVSRVRFSAPNDLTNSLYALGTIKSTLNNSNISVNQEIIEEIV
FT                   MSIKNRSLNTLQNFKMECVSNLLVSFSKWSFELGQQELLNIIEHMFTIRMELNIVDLSN
FT                   TLVAITKLFCASSCINDFNDIKSVGENNQILLVIQKLMRKWSNEIIALLEQEKNELNTI
FT                   IKIIDCYNKFGVYEDKLYSKIKSIIALNHLGELNKNNAYSLYEIFNKHRGMCRINSNKF
FT                   SEYTKYDDFMEILTQSIS"
FT   CDS_pept        join(740511..740612,740672..740947,740979..741086,
FT                   741121..741233,741309..741400,741493..741614)
FT                   /locus_tag="TA06155"
FT                   /product="20S proteasome beta 5 subunit, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.38 - score = 46.79"
FT                   /db_xref="EnsemblGenomes-Gn:TA06155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73222"
FT                   /db_xref="GOA:Q4UI67"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI67"
FT                   /protein_id="CAI73222.1"
FT                   /translation="MEENDLKRYDDVVIQSGNATDILRNGFKIFPIKEVNMLNTYMTQE
FT                   ARNVKNFKKGTTTLGFIFDQGVILAVDSRASMGPIVSTQNVSKVIEINSYLLGTMAGGA
FT                   ADCSYWERHLAKLCRLHELRNQCRISVGAASQILANIFYYFKGYGLSAGTMIAGYDLNG
FT                   PGLYYVSSEGERVKGKLFSVGSGSLFAYGVIDQGYRSNMTLEEAVELGTRAIYQAGHRD
FT                   GFSGGFVNLYHVHKDGWTKIVDRRDINELHYLYADKKGNKRHIRSIYL"
FT   CDS_pept        join(741764..742059,742116..742218,742255..742413,
FT                   742447..742525,742561..742700,742740..742856)
FT                   /locus_tag="TA06150"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.38 - score = 46.79"
FT                   /note="GPI-Anchor Signal predicted for TA06150 by DGPI
FT                   v2.04 with cleavage site probability 0.172 near 270"
FT                   /db_xref="EnsemblGenomes-Gn:TA06150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73223"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI66"
FT                   /protein_id="CAI73223.1"
FT                   /translation="MYIGPILIINLMPIWLISSKCTYISLESSLAFAPPRPFLRKIKVR
FT                   NRISRDERKRRSAFSKQLHNELRMKYWQRLKPCVNDVLVFENPGSEIYDIDPKRGFIVQ
FT                   EVIPRMVEVTESLKPLSLKKETSDEFDRNAGLRFLSNIAGVTTVFVNEFDKRREFTALR
FT                   DMGPSELLPRLETDIAYISSLLNVDPPPLSESCQDYIHFLISLAESSPIRFLSHCYVFF
FT                   KDWSVSKTTLLTNFRAHLRLVNKMKSAFFDPDCRNLEYVLNMLACGWSRSQKDEFLNEM
FT                   PVAYKCLSDSLLVPFL"
FT   misc_feature    742571..742576
FT                   /note="GPI-Anchor Signal predicted for TA06150 by DGPI
FT                   v2.04 with cleavage site probability 0.172 near 270"
FT   CDS_pept        complement(742943..745537)
FT                   /locus_tag="TA06135"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.94 - score = 77.27"
FT                   /db_xref="EnsemblGenomes-Gn:TA06135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73224"
FT                   /db_xref="GOA:Q4UI65"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI65"
FT                   /protein_id="CAI73224.1"
FT                   /translation="MTSESNEDTRNGDLNNRQKDDDGFQKVLTPFEKRVLKKKNPDLKQ
FT                   VSLADCNTLQNSIITRLKKRGLDLTNDPDHTTLESSSLELEEVQEIIADLDEAINGVLY
FT                   QAEKPDQNLSLTELENKIKVAKNTLSQMKTKKKGTFSKEELDNATKETDVYVTYLQNQI
FT                   TLTKDYQKLKNAQVSLLKLKTFLKDYINLKTRIRNSSTKIEKNKVATPTSEPKVLGTTK
FT                   RSIDYVYDFIKEMKERNGRTLDVNDLTSRDFKVEDGTKFQPPYNYLQKLKQKFEVFIDK
FT                   TGTKPLILSIYGCKADVDRCMDFLSNLDLSRQNKVPMSFTKYRLLLEAEDKYNVLLNYN
FT                   SRTMELIGKNSDVKAFLEYMESITKENREKEKQLNNDTVKTNDVTYVTGDNDKLYDYYV
FT                   LRALSGKFRPNVRELETEFGVGIKFDLTPRNGLAKVSFVPLLNNAVDGCIKTFTNYVDQ
FT                   YGYKELGKLSNEEISFLSDNDVQKKRYRSQYTTLVKVADKFYVVGLKKYLNFGFNRAQN
FT                   LLESRQQPPYKFKLTNAQYNQVNPHLNSLQDQKGVYITTMGHSNSKEREKEFNDLDDHK
FT                   NGSEKDITLLVYGNAVQQKECVAALNEMIKYFVTIDLPLSGVEYNLLLEEKNRLNEYEN
FT                   KYKLKLSLTKNTLTLSGPKIQVEAVLEDLKTLFSKVVYFTLDDPSMPEIINQGMVYSVM
FT                   AVPQKFIGKIIGKGGSTLKNILLQTSLNNLIVTKSSHFNHESSNSIENLHLNHENPNSN
FT                   HAKLLPNNIRDHKEKKTKAKQKDKEVDVLFMIGSGLSVHTTVSLIKHVLDSDEDVVFTK
FT                   PDSRNLYDEYTSKHSFMRRTISNYSSSTSSSTNYKTDVKLDINDMDNFPSLY"
FT   CDS_pept        complement(join(746467..746727,746757..746900,
FT                   746936..746998,747028..747132,747163..747348,
FT                   747414..747641))
FT                   /locus_tag="TA06130"
FT                   /product="DNA repair protein (RAD23 homologue), putative"
FT                   /note="Tap349e08.q2ks7.cand.93 - score = 74.21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73225"
FT                   /db_xref="GOA:Q4UI64"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004806"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015360"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036353"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI64"
FT                   /protein_id="CAI73225.1"
FT                   /translation="MNLKVKTLKNVQVDVDVPDTASVEDLMNKVAESFPNMQADSLKLI
FT                   HAGKILKKELLLKDYSDIKDGDKVIVISSKTSDPSKNQDPNSQPSSTTTPTSKPPQPPT
FT                   QDDTPNQPSSGNVVSEQTYENVSSKFVMGSELEQSINRICEMGFERPLVERAMAAAFNN
FT                   PDRAVEFLSTGNIPASNMPNINAQNLATAEHGDPAGDDVLQMLQSHPMFEQLIQAVRSD
FT                   PNLLQQMLENLGQTNPELLQAIIQRQDEFVELLSSSARAAATADQYSTTENNPNIITLT
FT                   PVEMESIQRLEGLGFSRPAVIEAYLACDKNEELAANYLLENFNDFQE"
FT   CDS_pept        complement(join(747872..748080,748111..748229,
FT                   748263..748358,748397..748517,748549..748582,
FT                   748627..748688,748719..749023,749055..749251))
FT                   /locus_tag="TA06125"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.93 - score = 74.21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73226"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI63"
FT                   /protein_id="CAI73226.1"
FT                   /translation="MNISHILLNNARIKHSARFLKPPGFFKRAEMREKPHRKTGPFENP
FT                   VRRFVRLREKARLFSQLPAPRHVPLPKPILPTLLKPLEYVPKVSPEVLERRLEFLLGDK
FT                   AKQQQLHAKIRPGLTPYQAELYMWERQMRDLRRIYRAQYIQKLNDVTEEERLRQYNLYV
FT                   KETKEKFAKREEIRRSIHEEKKRRAILRDTMAIEKKVTQSLELGRLSSKKIKNIYWLNK
FT                   LQGAMNYDEDKNNVNIEDINVAKLASDLGHPAADSKKIRQKILSGNLFFRNILKESFEL
FT                   MPEDMFRYEVMDEETLTPEERAKITYGVLTDDEKLELLDKKINILNEKIDQDSKLKGKS
FT                   KDNLYIQLRDHLEAAKLAYLVCIKNINGIICENIRILYLL"
FT   CDS_pept        complement(join(749379..749512,749580..750167,
FT                   750198..750323,750362..750395,750452..750504,
FT                   750537..750702,750739..750786))
FT                   /locus_tag="TA06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA06120"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73227"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI62"
FT                   /protein_id="CAI73227.1"
FT                   /translation="MSLSNPDLDKKILEIKKKICKPNCKKCKRALHESIEIKSKIFNLS
FT                   NKRQLDSENEPYKYYDVIEYTSDSLPNKYRKITSDNGTITKISIDIFKQRLPKEQEPYK
FT                   PPKKKKSDRSYSKKTDETKKCYKRTSDDSKTTDEHPDEELTLDKKYQDFVKKIDLATIK
FT                   HIITSDSEERKTDDPLKTVELHFSIPTTQETVKPPEKTITHQPPGSVDILAPKIPEPVQ
FT                   NEIEKPQEKVSETDLTIEQTDKPTGLFGIESKQSVDDRSPFDILHKINVPIPKGNPLFA
FT                   PTQQESNIFTPKTDVTNFVFGQSQASIRKPDEQPNIFTNQQQQIQQNQLMNQQLVIPEA
FT                   EEVGEEGEEDNSLFKHNVFYHSFINLSIFCTFHSTILYTSGF"
FT   CDS_pept        join(751162..751716,751746..751988)
FT                   /locus_tag="TA06115"
FT                   /product="hypothetical protein"
FT                   /note="Signal peptide predicted for TA06115 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978, signal anchor
FT                   probability 0.004) with cleavage site probability 0.885
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA06115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73228"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI61"
FT                   /protein_id="CAI73228.1"
FT                   /translation="MKLNSIAIVFLFSCFLNFFKNVSALRRSSPDVSLDDSFLQVKSAS
FT                   AQDKQDVTQGSNPRVQVPSVDPEGLKKMVAAAVLSNQNQPLQNGALNPEDYNQTAAVNS
FT                   LNKAVNVMASPVNGVNPMAAVGAMNSLNGMTGVTDNFNQTAPVNYQDNNQTQETSLDHL
FT                   NLLLDPSLAKISEADRHIKECMERSVHSLKKVLEGLTNLATLAKNRENEPFSVLGDDYT
FT                   MRNVLDLMNKELRQVESLQKVVLQFNAFALSTFTKNEDDNKKS"
FT   misc_feature    751162..751233
FT                   /note="Signal peptide predicted for TA06115 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978, signal anchor
FT                   probability 0.004) with cleavage site probability 0.885
FT                   between residues 24 and 25"
FT   CDS_pept        complement(752116..752631)
FT                   /locus_tag="TA06110"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.91 - score = 13.53"
FT                   /db_xref="EnsemblGenomes-Gn:TA06110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73229"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI60"
FT                   /protein_id="CAI73229.1"
FT                   /translation="MRNSTSRYLLDDLYDDLLIPETRISPIPTNSNMMPITISVLNGVK
FT                   NSNLVYSSIRRMKNGSFTWRNEEGKISANSFSQSRAITTTKPLIALTNHTGISHYLDRL
FT                   CDNVESLFHKKAFIHQFKDLIEEDEIRLNMMKLRETSDMYKVQDELISAQVQEEMGVND
FT                   ETETQQEQ"
FT   CDS_pept        complement(753012..758462)
FT                   /locus_tag="TA06105"
FT                   /product="SNF2-family protein
FT                   (chromodomain-helicase-DNA-binding protein 1 homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.cand.90 - score = 153.22"
FT                   /db_xref="EnsemblGenomes-Gn:TA06105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73230"
FT                   /db_xref="GOA:Q4UI59"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI59"
FT                   /protein_id="CAI73230.1"
FT                   /translation="MNTLEQITEPAQTPETTPDVAEQQLQQNKIQNQLQPNQLQNQLHQ
FT                   VGSNTQMAQQVQSHPMQNTQMNQPQHVQPNQMGQQVGPSQQGQNPQMGQNQHMGANQQM
FT                   MMRMGNGVMNPNMYYYQMQMYQNQQGQKGMPMNMQMGMSRFMPQYNAYLNRVQPMQQMA
FT                   PTHPMMQQQMGHNQQVQSAMMMQQQQQQQQQGETKTEETGETKQQPMSNMPPNMYPNMM
FT                   GNPMNPVGMPMMHPGGMGGMYYGPRLLVNNAIDSIPSLRLANSQFQNVTQVLDALATQS
FT                   KKRRAPRASREPREDSDFKNVLQDYFSASDNSDDEFLVSRSLRLNDGSSSIRRSNRTRT
FT                   KTAKYDEYNETESDTQEDYIANYQPTTVNNINPTGVKSNRGRKKGVSYKKPTPAKPVNP
FT                   YSRSNYLQFDESSDESPQFSGHDYDPNSIESSGLSLRHRKHKVNYAELEYSEEEEVVEG
FT                   EEEEKKSSGGIDRVINHRQREDGEWEYLIKWQGFAHIHNTWDVYENLKEYNGIRRLDNY
FT                   IKRFKNLEERQKYMTLDEIEQENIALGLQKQIDEDSLIAERIVTHYKDENGVMVYLVKW
FT                   RSCPYDQCTEEDEETLVEHGFQDLIDAYKIREDRILGEAARKIPWNTHSISLTKFEPYY
FT                   ETPKYLSNPTYLEDLGYTSRLYYTILAARANRLKTDGVNEAGEVKADAVKPQDSVKGEV
FT                   TNLVKEQEPMVNNETDVKINGVKEEKNEQEDVKMDLDQETNSTTSAQSFPNSVKSEPNA
FT                   QQSVNTGSTENSVNSAQQGDAGVKKYHLRDNVPNSIYKVSEPRKLRDYQLTGLNWMVNR
FT                   MKRGLSVLLADEMGLGKTVQTISLVGHFMYKEFLIGPYLIIVPQSTIDNWMREFEAWLP
FT                   QANAVCYYGNATAREMIRQRELTRIFVPGKGERYKCDVCITTPSIINSPADLDFLRRIS
FT                   WQLMVVDEAHQLKNKNSKRFVELMQFMADYKLLLSGTPLHNNLEELWTLLHFINPQIYP
FT                   YYEDFRRRYSEIENPAAIGENKQKQLLSLQHELHEFVLRRVKKDVEKSLPNKVERILRV
FT                   ELSPMQIEWYKNILARNYEELARNSGGSRSSLQNICMELKKVCNHPFLCYEPEDRQVWL
FT                   QGLIYGSGKICLLDKLLQRLKEKGHRVLIFSQMVRMLNIISEYLTLRGFKHQRLDGTMG
FT                   KEVRKKAMDHFNDPQSDDFCFLLSTKAGGLGINLTSADTVIIYDSDWNPQNDLQAEARA
FT                   HRIGQTKTVQIYRLVTKDSIEQTILERAKTKMVLDALVVQGLNKRGDAVMFNDDGKSGF
FT                   SREELAKILKFGASKLWATANPQTNKTSSTDEKLDIDLDKVLQEAELTKENDSDLAADL
FT                   LSSYTNITEFRYEPPEGQLEATGENDKEFWEATIPLEERVKLKKKKQEELLVMGPRRTR
FT                   AKDTGTIETDDYSDDEADADFQPRKTTKELLQSQEGIKGKRGQRRSRKAVLTIKDKMKI
FT                   HRSLSKFGVPELRLKDIHADTKLNKVDPRVILNECQNMIDTCKSKLKSNADDEDRRSRR
FT                   SQLIVEMGEIKVNAQDFLDKMKLLESLEQFGRKLAGSSWNMAPNDEFEIPQQVLDQMNE
FT                   GKETWTSDDIVNLLKLINKLGFGYWSQMCADKELCVGVLQDIKHDKLKNRAMKLLKIVN
FT                   TYIDPSSVITLSDEKRLSTVRETPVKVKKKESVTSDKENDLTPSEGPNDKVRDDLSDIY
FT                   TLDPSDASKDVIDVANLLSTGKLTSRDHYASAVKHVLKSCRDVLRTTKRLRNPSLDFTE
FT                   NLKSEEFQTQVRDTVKMVKNALDSNLNVCPDEVVANKLRTACWKFVSKIIQSDQFHLES
FT                   Y"
FT   CDS_pept        join(760064..760168,760228..760469,760601..761279)
FT                   /locus_tag="TA06100"
FT                   /product="splicing factor (SR protein), putative"
FT                   /note="Tap349e08.q2ks7.C.cand.40 - score = 73.91"
FT                   /db_xref="EnsemblGenomes-Gn:TA06100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73231"
FT                   /db_xref="GOA:Q4UI58"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI58"
FT                   /protein_id="CAI73231.1"
FT                   /translation="MVYKGGKANRSPSCVFVGNLPDRVDERDIHDLFDKFGEIKDVDIK
FT                   HGKTSNYTSYAFIEFASVRSAEDAVDSRDGYEYDRYRLRVEFAGEKKPRRYPSYDRPRD
FT                   RDRSNRYPPPTRTDYRLVISNLPHGCRWQHLKDHMRKAGPVGYVNIVHGKGFVDYMHKS
FT                   DMKYAIRKLDGSELTTPDDSCRIRVKKDEFRRSRSRHRSYDRRSRSVSDRRSRSVRSGS
FT                   PYERRSRSISGKRSRSERSRSPYDRRSRTVSDRRSRSVRSVSDRSRSPYAKRQKSRDRS
FT                   GSERSRTRSRSASERRSYERSRSDERLKLNSELEPMKHTYDRDAETETAAETYRESPLK
FT                   V"
FT   CDS_pept        761465..764143
FT                   /locus_tag="TA06095"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.40 - score = 73.91"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06095 by TMHMM2.0 at aa 12-34, 519-541, 548-570, 575-597,
FT                   610-632, 668-690, 703-725, 749-771, 792-814, 824-846 and
FT                   867-889"
FT                   /db_xref="EnsemblGenomes-Gn:TA06095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73232"
FT                   /db_xref="GOA:Q4UI57"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI57"
FT                   /protein_id="CAI73232.1"
FT                   /translation="MFHICIANQAAVGVSDCPLLMAAYILAGLAMMLNIRLSYSSAPYA
FT                   LIRFKLPENLFSVFVRRMASALELWCLPSMLLGNIMDLIQKLAIDTDPELRIAAGASSP
FT                   DGLVQMATQLHDRANELDQAVKNVGNDEGAKVLKYKAGTEAQNDDPKHLRKLAKDLHNA
FT                   ATQLESVAPGDSTSDNDALKLKAGTSEDDGLRKLAKTLYEAAKALVDTRPSDNNAAQQL
FT                   ADAVGQDENTTDKLRQALQQLAGADGDLIAKAGAVRDAYDKSGGDGVKPKFTAVQGQEG
FT                   KYDGDKQPLYEAVKKAWEAFNDLYTANLKKLANDLKDAIGTTGQPSKLQQTLSELGNDT
FT                   GDDPSTKANAVKTAYEGSTDNGVKPKFDALKAKEFAYQAIAAIKSLYENVVKAMTAFDN
FT                   VYKPEELLKDAVGNSDQAPIPPGSDPKTLREALHELGSAGTSDPTLHAKAKAVKDKYSE
FT                   GWSDTIKQKFHLVQAQANAYEQGNTIKTEKYKNLLDAWTAFNDKYYKVISSPKYNTIII
FT                   PSIITQWLNFLTYVILLIVYVVGGDQGHLTVFYFVIAISGVVFGINMTLVYSVDFNYIP
FT                   VYIVGENCFPIVTSFIHYITTLMFGNRRKWNSDFIVVYVDIVVAIIISLVAAVVWTYSY
FT                   VCKIKYGSATDKDASGWHHIFSHGFSGEFNPEVISPFLMIVVGMGLVYAIYPGIAPGMI
FT                   VPFYLIDKIEMVLLIATFFPPVIVAALRRSFAYGDPRSPMCKWDSAGFLGFMGSGLHWH
FT                   AFDLLMVIKISLAVIFIYSLHYRESNISRSIINQPKMSTFLSITFYMCHECLLALGFPG
FT                   LVGANGGGDYVLIPQYIGALFMIFLAFYSEGYIIEYKSHDPQHWPTEGMTKWNAFCYWY
FT                   YLVIISSYGYVFHHGFYYDKV"
FT   misc_feature    join(761498..761566,763019..763087,763106..763174,
FT                   763187..763255,763292..763360,763466..763534,
FT                   763571..763639,763709..763777,763838..763906,
FT                   763934..764002,764063..764131)
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06095 by TMHMM2.0 at aa 12-34, 519-541, 548-570, 575-597,
FT                   610-632, 668-690, 703-725, 749-771, 792-814, 824-846 and
FT                   867-889"
FT   CDS_pept        764308..765825
FT                   /locus_tag="TA06090"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.41 - score = 22.08"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06090 by TMHMM2.0 at aa 15-32, 101-123, 133-155, 195-217,
FT                   237-259, 272-290, 341-363, 384-406 and 416-438"
FT                   /db_xref="EnsemblGenomes-Gn:TA06090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73233"
FT                   /db_xref="GOA:Q4UI56"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI56"
FT                   /protein_id="CAI73233.1"
FT                   /translation="MTYTEEDEGDLQTAAYMFAGLAMMLNIRLSYSAAPYALLRFKLPE
FT                   NLFSVFVRTTSSALELWCIPSMAIGNIMEQVYNYNYMEEDKKKSNATEVKKYGWIVVPS
FT                   IVTNWLNFLTFVILLIFFVTGGDNGHVTGYYWIMAISGFVFGINMVLVYAVDYRYLAFY
FT                   MAGENSFPMVTSAILYFATSIFGNRRKYNSDYLVVLIDISIAILIAFVASVLWTLAFYF
FT                   YKTPLGGAGDPDWTVASPIAMVIVGMGLVYSIYPGIAPGMIVPFYLIDKIEMVLLVATA
FT                   VPPIIIAFLRKYKPNWSPQTQFLLYNYRFGGWTEYNDHKEKEQGDPSKGYVKDNDALVH
FT                   AWIWHFFDILIPLQICLAIIFIYSLHYRDSHISRSIINQPKMSTFLTIIFYMCHEILLA
FT                   LGFPGMVGNNGAGGKVLLPVQYVGALLMVFLAFYSIGYITEYKRHDPSQWPTEGMTKWN
FT                   ALCYWLKMASKITNKNFKQLFTTDLRRDLNVSKNNMVNTIVYYTLLN"
FT   misc_feature    join(764350..764403,764608..764676,764704..764772,
FT                   764890..764958,765016..765084,765121..765177,
FT                   765328..765396,765457..765525,765553..765621)
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06090 by TMHMM2.0 at aa 15-32, 101-123, 133-155, 195-217,
FT                   237-259, 272-290, 341-363, 384-406 and 416-438"
FT   CDS_pept        complement(join(765919..766013,766042..766111,
FT                   766144..766231,766281..766315,766372..766398,
FT                   766432..766612,766662..766778,766811..766890,
FT                   766943..767018,767073..767347))
FT                   /locus_tag="TA06080"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.89 - score = 34.64"
FT                   /db_xref="EnsemblGenomes-Gn:TA06080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73234"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI55"
FT                   /protein_id="CAI73234.1"
FT                   /translation="MDSEESEVTNLESNPKTPTNYVDKRFSKRRPQSLRSETNSKLLQL
FT                   GKTLLSYNTEDTNKYAIEIATIFLSSIPPEAHIPDDLLNYIISIFHIYFKNESVDKLFN
FT                   KFLTISATSSPQLRPLILEHLVRLLALKRDYSGIVNEVTRRCNEWNLEIHEIAKHYKWV
FT                   VKHIDILTNFDQEDAPPDFIVELEDVLVTYLEYERLPNKNLLSLYTRICGSKSLDLINR
FT                   YITVFPRIYFLRFCRLKLLLNDSNSDKLLIEEDLINFVELSGYSSLSVEFLNIYNRFVS
FT                   TDKLIPLLFNTAVTVPHINRNWDILYKIIKSRRDKDTVMDTIKRSSLVSIFNSPSNKFS
FT                   YLKYFDR"
FT   CDS_pept        join(767625..767788,767882..768033,768094..768219,
FT                   768256..768557,768637..768936)
FT                   /locus_tag="TA06075"
FT                   /product="protein disulfide isomerase (thioredoxin),
FT                   putative"
FT                   /note="Signal peptide predicted for TA06075 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998, signal anchor
FT                   probability 0.000) with cleavage site probability 0.607
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73235"
FT                   /db_xref="GOA:Q4UI54"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI54"
FT                   /protein_id="CAI73235.1"
FT                   /translation="MSRLFLRLLFCVVLFKFAYTTSYYKDSKVLEVKEDDFDNKVKSFK
FT                   VTLVKFYNESCKKCVEFSEVYKNLANIFHDLVQVLAVNDESLSKKYKVKSFPSLKLFLG
FT                   NGKESEPDVVDLDEDKDLDDLVSFTLKTLKKHVKQRASKFLPKDSKKVVQLTSSNFDSL
FT                   VLDDTYSQWYFYSILMFIIIRLVKFYAPWCGHCKNLEPEWMSLPKKSKGVKVGRVDCTV
FT                   HQSLCSQFNVMVFYYSLFSLSYINYYGYPTILLFNKGEKSPKTAMNYEGHRTSADILAF
FT                   AKKNDKALSPPTHATSVSDLKEKCSGPLCLLFFFNTSTKEENLKTLKSFASKHSAPFAL
FT                   AYSMGLL"
FT   misc_feature    767625..767684
FT                   /note="Signal peptide predicted for TA06075 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998, signal anchor
FT                   probability 0.000) with cleavage site probability 0.607
FT                   between residues 20 and 21"
FT   CDS_pept        769457..771247
FT                   /locus_tag="TA06070"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.43 - score = 25.57"
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA06070 by TMHMM2.0 at aa 20-42, 71-93, 113-135, 147-169,
FT                   174-196, 209-231, 339-361, 374-393, 443-465, 484-506,
FT                   516-538 and 573-595"
FT                   /note="GPI-Anchor Signal predicted for TA06070 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA06070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73236"
FT                   /db_xref="GOA:Q4UI53"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI53"
FT                   /protein_id="CAI73236.1"
FT                   /translation="MKNTCPYNCKAAEDDFGNCPLLMAAYILAGLAMMLNIRLSYSSAP
FT                   YALIRFQLPENLFSVFVRRMASALELWCLPAFLIADIMELAVKLIIYQLKDSGYGDNSL
FT                   ASKTLKFYAIIVPSIVAQWLNFLTYVILLFVYLAGGDSGRLTTFYWTIAASGFVFGISN
FT                   VFVFAANFNYIPIYIAGENCFPALTSFIHYLATLMFGNRRKYDSDFLIVFIDILVAIII
FT                   SLVAAIVWTWAYGICQDAVTECKITKDSAGGNKLTIEYKDAKESDPPKVKEADYTNPPT
FT                   PPAGTNYNYTVKHTATKNITYTFKLTEQLAGTKDANVTIEYGHIHASGFSGTGAKESLI
FT                   SPLLIVLVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATIFPPVIIALLQKFKPNW
FT                   SPKTNYVWHGDEDPKTGLQGWRKYASTHVGGPGDCGSESKDIHAWIWHFFDLVVPIMII
FT                   LAYLFIYSLHYRDSNISHAIVNQPKMSTALTIIFYMCHEISLAVGFAGMVGNGAEYTVL
FT                   AQMVGAFLMVFLALYSEGYLIEYKRHDPAHCPTEGMTKWNAFCYWTKKTSKITNHILRY
FT                   LHEMICLDLPVSITYIVYIM"
FT   misc_feature    join(769514..769582,769667..769735,769793..769861,
FT                   769895..769963,769976..770044,770081..770149,
FT                   770471..770539,770576..770635,770783..770851,
FT                   770906..770974,771002..771070,771173..771241)
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA06070 by TMHMM2.0 at aa 20-42, 71-93, 113-135, 147-169,
FT                   174-196, 209-231, 339-361, 374-393, 443-465, 484-506,
FT                   516-538 and 573-595"
FT   CDS_pept        complement(771274..772836)
FT                   /locus_tag="TA06065"
FT                   /product="GMP synthase, putative"
FT                   /EC_number="6.3.5.2"
FT                   /note="Tap349e08.q2ks7.cand.88 - score = 37.95"
FT                   /note="Signal peptide predicted for TA06065 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.745, signal anchor
FT                   probability 0.012) with cleavage site probability 0.582
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA06065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73237"
FT                   /db_xref="GOA:Q4UI52"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI52"
FT                   /protein_id="CAI73237.1"
FT                   /translation="MKESKGWVLVLDFGCTFSSTLVRAVRELGVRCELESLEKFKGLDK
FT                   KDLPSGVFLVGGNESVFDQDVLSVEKSLLDTLKGHKVPVLSLSFGMMSVAKSFGAKLRK
FT                   TDNKDYVVTKCTLKNSELFDSVPNSLTVYLNTLDMVESVPSGFEVIAKHSEVPVGLYNS
FT                   DYNLFCLYFHPESVDTEKGNTILHNFLYKVCKCDRTWTLSEYLERELKNIEEQCGSDKY
FT                   VVAALSGGVDSTVSAKMVQSVIGDRFHGVMVDTGLMRHNEIAECEKRVRKEVPGIKLTV
FT                   RYSQNVFFKELAGVVDPEMKRKIIGRVYIEEFEKAIKELGFNEKNCLLLQGTIYPDIIE
FT                   SELNRRSKLPVKSHHNVGGLPERMKFELIEPVRYLFKEEVRELGRLLKLSEETFKRQPF
FT                   PGPGLGVRVLGALTPENVQKVRMADKIVREEVEKSKADVSQYFCIYLPNLKSTGLVKGQ
FT                   RVYGTTVVVRCVKTKDYVTAKWVHFDHEVLDRISQRITSEVPGVNRVLLDITNKEPATI
FT                   EWE"
FT   misc_feature    complement(772765..772836)
FT                   /note="Signal peptide predicted for TA06065 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.745, signal anchor
FT                   probability 0.012) with cleavage site probability 0.582
FT                   between residues 24 and 25"
FT   CDS_pept        complement(join(773270..773958,774082..774376))
FT                   /locus_tag="TA06060"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.87 - score = 26.10"
FT                   /db_xref="EnsemblGenomes-Gn:TA06060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73238"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI51"
FT                   /protein_id="CAI73238.1"
FT                   /translation="MEGTMDVSLIERLFHKKKFDYLEKRGIIRKGSCNLNKSNNESSIK
FT                   SNISDFVPPETPPTFFAIDIDDTFYHPDEKIFSKNVEAFKKVKSLGFSPFFCTGRPLFT
FT                   LKYSFGEKFFEDTGYSGFPGIYLNGAVVYDSEGKLISLKHFPEFFLDEILDFIVHSGLE
FT                   KDFLFYDPEGHYCLKEVNDQIVHMLRTIRLPDPTITTVEELSKKKIVSIVSTSRTIIPD
FT                   NARLGVHFWLRNMSFPDLIELCPLGITKADAIVKLMEHENARPESCAFIGDGENDVEIM
FT                   QLVDMSFAVANSSNFVKKHAKWILHLNYYEAAFSYVMNLVYNINLI"
FT   CDS_pept        complement(join(774862..774962,775058..775327,
FT                   775370..775592))
FT                   /locus_tag="TA06055"
FT                   /product="ubiquinol-cytochrome C reductase complex, 14 kDa
FT                   subunit homologue, putative"
FT                   /note="Tap349e08.q2ks7.cand.86 - score = 22.39"
FT                   /db_xref="EnsemblGenomes-Gn:TA06055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73239"
FT                   /db_xref="GOA:Q4UI50"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="InterPro:IPR036544"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI50"
FT                   /protein_id="CAI73239.1"
FT                   /translation="MNLNRELGKVVAKFSAATKSRSLAPSPRYQRLLKGPGLLQKVYRK
FT                   FIAPWYFRAISGPFERWHHACLTRYLREHGLLYDDLMSEREPLVERALSILTPDLATAR
FT                   FRRIAKGMQISMLRLYPPLEEQNYDPFIPYLAPFIEEAKFQLQEEEELLGYHPVDRRLF
FT                   CGGTTGFGDLEPGMHFLVSFPCVYGGGMGNMKKK"
FT   CDS_pept        complement(join(775866..775915,776034..776085,
FT                   776116..776190,776261..776403,776502..776748))
FT                   /locus_tag="TA06050"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.86 - score = 22.39"
FT                   /note="1 probable transmembrane helix predicted for TA06050
FT                   by TMHMM2.0 at aa 26-48"
FT                   /note="Signal anchor predicted for TA06050 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.856) with cleavage site probability 0.001
FT                   between residues 40 and 41"
FT                   /db_xref="EnsemblGenomes-Gn:TA06050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73240"
FT                   /db_xref="GOA:Q4UI49"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI49"
FT                   /protein_id="CAI73240.1"
FT                   /translation="MSIEYVKRLFHQIKLSHYHNNKSDRLFYFLLFYFLGVISNKPLHL
FT                   FYSYLKLLFYTFVFKILKVRSSEDFNGEYKLVLCVRTDLSMGKGKIAAQCGHASIGAYA
FT                   DSVKNNNPYVYKWFNDGQKKVVLKINDYDEMREIKKQAKLKGVYTHVTVDAGRTQIPSG
FT                   SCTVIALGPGPEPILDKITGHLKLL"
FT   misc_feature    complement(776605..776673)
FT                   /note="1 probable transmembrane helix predicted for TA06050
FT                   by TMHMM2.0 at aa 26-48"
FT   misc_feature    complement(776629..776748)
FT                   /note="Signal anchor predicted for TA06050 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.856) with cleavage site probability 0.001
FT                   between residues 40 and 41"
FT   CDS_pept        join(776896..777355,777397..777689)
FT                   /locus_tag="TA06045"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.44 - score = 20.15"
FT                   /note="transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA06045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73241"
FT                   /db_xref="GOA:Q4UI48"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR034004"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI48"
FT                   /protein_id="CAI73241.1"
FT                   /translation="MDELYESCERGEEIFISPLDPLVSQEMANINVNEASDMVNYLYSE
FT                   SQIQFKGKYITDFKFKLSSTNFNDTDTTCSDDQGVELGYDYLVSMGCRNCGSFVDFNNT
FT                   HMFFGFEDSTEDQPKHRPNKFLRCENCNSIISPIFTKNQSDSFYNITNRDEQEDDKVYL
FT                   YGMRSAYVFDDNEKQWWKDSVYGSYSSNKLLQAKTANKSGKQTVKYNCEKCGHDTHLYS
FT                   TFQARSADEGMSIMYECIKCKNRVVIST"
FT   CDS_pept        join(778263..778340,778374..778429,778496..778621,
FT                   778654..778696,778760..778870,778920..779099)
FT                   /locus_tag="TA06040"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73242"
FT                   /db_xref="GOA:Q4UI47"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="InterPro:IPR040309"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI47"
FT                   /protein_id="CAI73242.1"
FT                   /translation="MKEDKSLVIDGQTEVDDLAFVTHFATNEYTKINELKTFKNNVPKS
FT                   SKPLELDLSQLNVENEDSDFSDSDIESESLKDVLSPAQFGRTKSSHDFKDPLDNLRIID
FT                   TVDLPEKVAEQLPITKIGTCKSSFDDILIIHSTPGSGVLDLGSIICKVDRTILGTVNDT
FT                   FGPTDHPYYMVILTNKSLSIQPVMFLIVLTVDLG"
FT   CDS_pept        779425..780441
FT                   /locus_tag="TA06035"
FT                   /product="RNA binding protein, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.46 - score = 23.89"
FT                   /db_xref="EnsemblGenomes-Gn:TA06035"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73243"
FT                   /db_xref="GOA:Q4UI46"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR040052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI46"
FT                   /protein_id="CAI73243.1"
FT                   /translation="MANSGDVDSTGEGVSKSTASWLTHRLYIAPNTVKRHKVTQNTNNF
FT                   VNKTNTVGYRVGNNVNYNFNDEYDPRYPNEYEKVTKLLSIKSHTKVPQPIQLTPNTLTQ
FT                   TPLSGIILLHHLLTVGDEMLKLRLEAMEKSEVYTETPSTQSLPVTSQPKKPEQPVALKM
FT                   MEKMGWKGQGLGKNEQGMVTPLVAKSIGKKSAIIINAPNKPVSVSIPNTNVSKGLNTME
FT                   KVEDEVNIDEKDLSRICIIIFKGNSKVDLDELEEILTEFGTIIDIKLLSEKMCDRLLQD
FT                   QRYSEVVWKFRQDSSIVVCEYETEEQSKRLFLEYNNKLLMESSVSILFLSPALYTQL"
FT   CDS_pept        join(780767..780918,780949..780962,781059..781436,
FT                   781513..781784)
FT                   /locus_tag="TA06030"
FT                   /product="hypothetical protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06030 by TMHMM2.0 at aa 7-29 and 33-52"
FT                   /note="Signal peptide predicted for TA06030 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.667, signal anchor
FT                   probability 0.278) with cleavage site probability 0.334
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA06030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73244"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI45"
FT                   /protein_id="CAI73244.1"
FT                   /translation="MAIMSRIPIFLVFYIIAFFNIKLTHQVEGGNSFLIIPTLTIFYFT
FT                   NNYNVYCQKARFFVDGRNPLDLVKCPANSTLYYLQAYAVCKTDVNNINDQTKVWFVPEH
FT                   GNADKRAGQDTVENCKASQNSLIKAYYDYCESVFNENKKCTLAINKENSDSDRFRTEDG
FT                   LDCANQGKSIFNGVLFCIQTDGSAVKENEEVTLVGFKGVPLEPACPEDRKIQTLTAFTY
FT                   GPKLTNKGFVDSFLGEARNKCDGNEHCSLDFEDTGRFFRYRIYTYKCVQ"
FT   misc_feature    780767..780838
FT                   /note="Signal peptide predicted for TA06030 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.667, signal anchor
FT                   probability 0.278) with cleavage site probability 0.334
FT                   between residues 24 and 25"
FT   misc_feature    join(780785..780853,780863..780918,780949..780952)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06030 by TMHMM2.0 at aa 7-29 and 33-52"
FT   CDS_pept        782217..784463
FT                   /locus_tag="TA06025"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.48 - score = 35.22"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06025 by TMHMM2.0 at aa 377-399, 411-433, 437-459,
FT                   480-502, 536-558, 565-582, 618-640, 660-682 and 692-714"
FT                   /db_xref="EnsemblGenomes-Gn:TA06025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73245"
FT                   /db_xref="GOA:Q4UI44"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI44"
FT                   /protein_id="CAI73245.1"
FT                   /translation="MPCPAGCSTEASQNYSGDSCKLLMSAYILAGLAMMLNIRLSYSSA
FT                   PYALIRFKLPENLFSVFVRRMASALELWCLPSMLLGNIIDLLQKLIIYPKILQNEAGSG
FT                   ESDRGKLREQANQLHQKANTLNTAVTADGDTAAARVLKAKAGDQNDEGKLRKLAENLHD
FT                   KAIQLAQAVGSSSPVDGGAAKTLASAVGNKDEAGTGSPKDLRQALHQLSIALPAASDLP
FT                   NKAQAVREKYTLVKLAFNKVVGKKSTYKDKGHEPLYQAVESAWDAFNNVYNPEEPLKDV
FT                   VGASDTEGSPGSPANLREALNQLGSATILQLHRRAEEVKKKFEGWGAVKSKFGLVQAQV
FT                   AAYNADSSFKDTNYNPVEQAFNEFNKLYRKAIYSPKFYSIIVPSIMCQWLNFLTYVILL
FT                   IVYLMGGEQGHLTTFYFVIAISGVVFGINMTLVYSVDFYYIPVYIAGENSFPIVTSFIH
FT                   YLSTLMFGNRRKWNSDFLLVKIDIWVAIIISFVAAIVWTVGYVCEFSGEYHDMKHIHAH
FT                   GFGGEPNGYQISPFLMIVVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATIFPPVI
FT                   IAILRIKAKSWSPQHNTGTFHKWKLYEYTEFGKPNDKITVHAYLWHFFDLLMVIKITLA
FT                   AIFIYSLHYRESHISRSIINQPKMSTFLSITFYMCHEILLAVGFSGFIGNDGGDWILIP
FT                   QYIGALFMIFLAFYSEGYIIEYKSHDPAHWPTEGMTKWNAFCYWCKRAIKIKIT"
FT   misc_feature    join(783345..783413,783447..783515,783525..783593,
FT                   783654..783722,783822..783890,783909..783962,
FT                   784068..784136,784194..784262,784290..784358)
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06025 by TMHMM2.0 at aa 377-399, 411-433, 437-459,
FT                   480-502, 536-558, 565-582, 618-640, 660-682 and 692-714"
FT   CDS_pept        complement(join(784939..785062,785095..785410,
FT                   785441..785601,785658..785872))
FT                   /locus_tag="TA06020"
FT                   /product="hypothetical protein, conserved"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06020 by TMHMM2.0 at aa 109-131 and 169-191"
FT                   /db_xref="EnsemblGenomes-Gn:TA06020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73246"
FT                   /db_xref="GOA:Q4UI43"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI43"
FT                   /protein_id="CAI73246.1"
FT                   /translation="MIRNIFYNICFNRRFELALFKKINYAPILRNLHNEQGFVYSRSFS
FT                   TANTPNNSDNETITISYGPKDTLLMLGYNIKENDLKDHIKMLEESLKLKLMSLDFYSPD
FT                   IANSYSGIIIILCSTVLGCYCSFIFILELGMVQHQSLEYINKAKENYIKSYEIWKKIKG
FT                   QNSREVANVLCLLGSNLILQIFVYLPYTHQYTDLYIARSIFRFIGVVLRDLGEIELSKS
FT                   TLLESLSIDRQLNTPESNLCSVYSLNNLANISHLQQNYKEVLHSEPLIV"
FT   misc_feature    complement(join(785214..785282,785394..785410,
FT                   785441..785492))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06020 by TMHMM2.0 at aa 109-131 and 169-191"
FT   CDS_pept        join(786250..786397,786454..786674,786746..786832,
FT                   786895..787010,787250..787337,787385..787471,
FT                   787562..787819)
FT                   /locus_tag="TA06015"
FT                   /product="eukaryotic translation initiation factor 2 alpha
FT                   subunit, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.49 - score = 30.68"
FT                   /db_xref="EnsemblGenomes-Gn:TA06015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73247"
FT                   /db_xref="GOA:Q4UI42"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI42"
FT                   /protein_id="CAI73247.1"
FT                   /translation="MPPVSKLNLGDCRFYEQKYPEPEDLVMVKVNRIEAQGVYVSLLEY
FT                   DDREGLILLNELSKRRYRSINKLVKIGRHEVVLVLRVDPLKGYIDLSKRRVTPEDIIKC
FT                   EERFSKSKKVHQTVRHIAQKHGISVEELNRECIWPLYKSYPHALDALKEAAANKDNVFK
FT                   NISISQEVIDSLLQDIQLRLVPQALKLKCSIDVWCFGPEGINAVKMSLGKAKLLDPQIS
FT                   IRLIAPPQYEILTSCFDKEAGLALMNQTLEVIEKNIKSFIGGDFKQKCDVVVIGDDEKH
FT                   LEDLLELHETTDEEDEGDEEEEEEEDEGMGRVDESMLPPNLSNEMEEEEESDE"
FT   CDS_pept        join(788101..788178,788271..788423,788493..788646,
FT                   788701..789100,789153..789253,789316..789443,
FT                   789512..789656,789731..789836,789900..790122)
FT                   /locus_tag="TA06010"
FT                   /product="signal recognition particle 54kDa protein 2,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA06010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73248"
FT                   /db_xref="GOA:Q4UI41"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR006325"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI41"
FT                   /protein_id="CAI73248.1"
FT                   /translation="MVLAELSNQITQAFRKLHSTTVISEAVIEEVIGDIVRALLMADVN
FT                   VKLVHKLKENVKRLNKNNSDMIGANKRRYLQKIVVDELVNMLTTEKKPFEPKKGRCNVI
FT                   MFVGLQGAGKTTSCTKFAYHYQRKGWRTALICADTFRAGAFDQLKQNAAKVKISFYGSY
FT                   SEANPAKVAADGVARFKEEKYDMIIVDTSGRHKQEDALFDEMKLIYDAVQPDEVVFVMD
FT                   SHIGQACYDQASAFNKAVDVGSVIITKLDGHAKGGGALSAVSATNSPIIFIGTGEHFDD
FT                   FEPFDPKSFISRLLGFGDINGLINTLKDVINLEDKPDLLDRIASAKFTIRDMYDQFQNL
FT                   LKMAPIGKVMSMLPGIPPELLQAGREQEGVDRIKRFMIIMDSMTDEELDCEKPLNGTRI
FT                   MRIAKGSGSSPHEINFLIDQHKTLQKMVGSMGKMGLNKDNAMQNIMRNPNQLLNKMQSM
FT                   IDPRLLNQMGGAGNIMKLMKEFSQNDDLQSLMKQMKR"
FT   CDS_pept        790347..792200
FT                   /locus_tag="TA06005"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.52 - score = 26.67"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06005 by TMHMM2.0 at aa 236-258, 270-292, 296-318,
FT                   339-361, 388-410, 423-445, 465-487, 507-529, 539-561 and
FT                   592-614"
FT                   /db_xref="EnsemblGenomes-Gn:TA06005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73249"
FT                   /db_xref="GOA:Q4UI40"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI40"
FT                   /protein_id="CAI73249.1"
FT                   /translation="MPECPGPNCKEHAGEFGADSCGILNSAYVLAGLAMMLNIRLSYSS
FT                   APYALIRFKLPENLFSVFVRRMASALELWCLPSMLLGNIMDLIQKGLYNNFFLTKTLHV
FT                   LKDKAGGQNNQGLRGKAGELYTKAEALKTAVGAGEGSSEAQELMNAVGQDENSGIRQAL
FT                   AALATAGGATDLPTKANTVRTEYSTVSGKFGLVQNLKDSAYKDKGEAYGNVESAWNDFN
FT                   KLYKDAISPDKYYITVIPSIICQWLNFLTYVILLVVYVMGGDQGHLTLFYFVIAISGVV
FT                   FGINMTLVYAVDWQYTTVYIAGENCFPALTSFIHYITTLMFGNRRKWNSDFIVVCVDIV
FT                   VAIVISFAAAVMWTLGYVAYVEGPSGKGYSYGHIHAEGFGGGSIKPHVVSPFLMIVVGM
FT                   GLVYAIYPGIAPGMIVPFYLIDKIEMVLLVATIFPPMIVVILQITDKQSTGTKHSPKFW
FT                   QGWGEHSLYYWHLVDLLIVIKITLASMFIYSLHYKESSLSRSIINQPKMSTFLSITFYM
FT                   CHEFLLAIGFAGQISNGPEYVLIPQYIGALFMIFLAFYSEGYIIEYKSHDPAHWPTEGM
FT                   TWWNAFCYWCKRASKITNLNLISLFRNYLLRGFVFFLIFSI"
FT   misc_feature    join(791052..791120,791154..791222,791232..791300,
FT                   791361..791429,791508..791576,791613..791681,
FT                   791739..791807,791865..791933,791961..792029,
FT                   792120..792188)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06005 by TMHMM2.0 at aa 236-258, 270-292, 296-318,
FT                   339-361, 388-410, 423-445, 465-487, 507-529, 539-561 and
FT                   592-614"
FT   CDS_pept        complement(792229..793248)
FT                   /locus_tag="TA06000"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.84 - score = 25.81"
FT                   /db_xref="EnsemblGenomes-Gn:TA06000"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73250"
FT                   /db_xref="GOA:Q4UI39"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI39"
FT                   /protein_id="CAI73250.1"
FT                   /translation="MGIPIMICSIEDMDGDDYSWLDNDEAKSYLRELFNRGEDPRTDYN
FT                   VLCSSINDIYLSILRIREEMTNSYNVLLTCVDLLKKYVNTNCDNSEDEMALESSTSTTF
FT                   RGNQLDEVSEGLNDSLGEDPQYSFPLASCVKCSCLIKIVVNHAVAGLYIGKNGAHLKSL
FT                   QSKYQFKLTQSGRGAKGDFTGVGYPCHRTNTTLLFQGNLVDILQGLRPLYKIIQSDILA
FT                   LDEKSMAFLSGRTLKVKFELNLVVPADRKRILLQDTGRRCMQLRNASGVEIIAGKQNFE
FT                   VGNIKESIVTLFGFEENVERAMEWLGIFLQESPAITSGDYYFMDYPKYTTAIPETNRS"
FT   CDS_pept        join(794019..794199,794268..794602,794666..794736,
FT                   794788..794867,794898..794972,795026..795141,
FT                   795182..795262)
FT                   /locus_tag="TA05995"
FT                   /product="DNA repair protein (RAD2 nuclease homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.53 - score = 25.19"
FT                   /db_xref="EnsemblGenomes-Gn:TA05995"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73251"
FT                   /db_xref="GOA:Q4UI38"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI38"
FT                   /protein_id="CAI73251.1"
FT                   /translation="MGINGLIVYLNKKVPEVIRPLGSLDSLGGKRLFIDCSMILRRSLH
FT                   ASIRTVLERLKFSHSGGNEPFVNVKLLRDDIMKYSVNPLLVLNKSLKEVDVKGGIDSTF
FT                   VVGPLENNETNSKVKDALYTNILDVKDKELLRRIREYLKGSTIYTFYPLLSHTDINDIA
FT                   NTLMNNYAKKCVEFCDSGEDFVLSDDTNAIAYGAPNVIRDYLGSKEPSVINHMEMLNAL
FT                   KMTRDQFIDFCILLGYKANVRIPEIGPERTYNIIKRYKSLEKFLESDLYQQLFKTKKAT
FT                   DLLLKYGMELGEFTNKFFNPEFRQELIKNVN"
FT   CDS_pept        complement(join(795299..795916,795978..796088))
FT                   /locus_tag="TA05990"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.83 - score = 15.82"
FT                   /db_xref="EnsemblGenomes-Gn:TA05990"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73252"
FT                   /db_xref="GOA:Q4UI37"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI37"
FT                   /protein_id="CAI73252.1"
FT                   /translation="MLFIGVKRILNINITKFYCLNNFSSLKNINQYSTTKKYLKDDEIL
FT                   VEKVRVLKDKKFMGDYSIHEAKLLAKKFNSNLILFKPNSIPPICVIQNYSDFIKSLENS
FT                   STTGVVNESKEDDKGVYAFDPSLKGKTIQISENCAIPDLNRKLSSIRKFITSGHKVDII
FT                   LQTTNKSRKLTKNKQNTNNIENNIIEEKDSKLHKEEEGVLIQRIDYIYSRLNDIAKPFT
FT                   VKNKLNLNSRQIILKFYPKQ"
FT   CDS_pept        complement(796174..798279)
FT                   /locus_tag="TA05985"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.82 - score = 36.75"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA05985 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.918, signal anchor
FT                   probability 0.000) with cleavage site probability 0.588
FT                   between residues 21 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:TA05985"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73253"
FT                   /db_xref="GOA:Q4UI36"
FT                   /db_xref="InterPro:IPR003690"
FT                   /db_xref="InterPro:IPR038538"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI36"
FT                   /protein_id="CAI73253.1"
FT                   /translation="MLLCYNSLLFLLAFRISFINSISHNYKLLYINYPNILSNFNPNKS
FT                   DLTCNIFFGNKGISLDTDEYKTQHHINEYFKKLPYKTENIVNPDQPPGSSSREDLKGHN
FT                   IPIANNVLTDVLPLAPLSEDEPLEEIVEDNDLTRPPSNKEDWNLKRISHGRYFWHKFFA
FT                   KPSEQTLKALRWFKQEHDQTRCNRILERTYTQLPKIMPQKGPDGKILPLTRSEKLMNRH
FT                   SLKVNKKIIGYDNSGEASNLLILLNYPTEKLVGLVEKLRMPGVLNLENYELLRLLNYSM
FT                   AYLAKTNNFTNVIQFLLTLGKFNDNLKLPKDETDSEDNNKPEPIILPDNSIAYITMAKG
FT                   NIYKGKIKRVFMRYKPMVYSIIGRLKNDPFNKKFLLPRKARPEPIREFYPTYNTDSALT
FT                   KFLEEALELEIKCSEEEYDHDKTMDRSFSDQFDGNSDYTTKKSINKFDRPTTINFSKEL
FT                   KEYLIKGISELSPSSIKEMLKFNKNLGILKTATLINRIMKLHTEIGMSYNEIIRVCIYS
FT                   PGILSNGSYKQRCLKIYDIDESFTHEVVNKLVRSFPKLLSYNIDRNVKPKTLYLLRVMG
FT                   KSVSDLLDFPKYLSFSLYDRIIPRHFSIMNKFYNGEFLSVYQFLFQTGFYPSYGQPVTH
FT                   PKIPNTLPENHDKFMSFYMELNRDLSLKDMLTTSEEDFCRIYNLTYRNMVEGKKYALKI
FT                   PLPTNVQ"
FT   misc_feature    complement(798217..798279)
FT                   /note="Signal peptide predicted for TA05985 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.918, signal anchor
FT                   probability 0.000) with cleavage site probability 0.588
FT                   between residues 21 and 22"
FT   CDS_pept        join(798410..799120,799150..799236,799271..799408,
FT                   799440..799534,799593..799683,799757..799957,
FT                   799987..800231,800269..800407,800537..800752,
FT                   800783..800842,801045..802334)
FT                   /locus_tag="TA05975"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.54 - score = 67.16"
FT                   /db_xref="EnsemblGenomes-Gn:TA05975"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73254"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI35"
FT                   /protein_id="CAI73254.1"
FT                   /translation="MEIPPFIRITPNILTKFRYNNGVFYNVWNNNDKLDPILINNTKTN
FT                   LNENTKLTNYNLNELVDSISHYLNKSNVSLHGLLDYNLNRLEKLNYESNKIVNKLAKIL
FT                   NYRILSISDKLNTNQLSKLIFSLTQSTEQFSDLTLKLFELFLEKSNFNVVSTHNNDVYD
FT                   YFLVLSSFLIFKSKFSNETIENKLIDKINLINFNYLNLSNDVLLQFLQTLAFLNGEKIH
FT                   QNVLEQIFYKLDVEKMAFNEMCTLVHTYSLLQTNITFDAQNIMENVLERINKNVMEVYK
FT                   NDVELSIECLPKLFHYFYITNDLDNHLMSLLVEIIVKRDITFQFSNYFYRVTFPISLSN
FT                   LITYDEVGKWMLDQLINNYDNYVNQLSNFLFILMRVASSARIEPNKALNGEKGTMVESL
FT                   YEEALMYLNEKVYLPTNRSKLLYLFDKIMEFIQSADSDQFIQILHVLSHKLVKINTGMK
FT                   LKLMNECKERVNSTSVGGISHVLEFITWVYSNKNPDCITILEAYQQRILSDISTYNTGD
FT                   RNFITTSELYNDSYLSSVKILSNILYIFDWASLYSSDLSNEVSSLINNNTHMLVEGDVS
FT                   DICHIIHYISRSNEQQNEIFYIVLFDKMKNDSEVEPTDLVLLLESFIANSLHLRYKELL
FT                   DEVEKRVKEIRGEQRVVKLLVDCLNKINMDLVYSLDVTGESFSEPLDLDSETQDDEPSI
FT                   NVKEFSDSKLNVVDEETKVIRIDLATHIRDLSSVNQSSCPELYELYRKITMDIRKFIYN
FT                   SIISEDFCVNFSISHGDSDNKVEGTGKGVLKSDNSNLVVNMEDVTPEQPNSDLKSAMSI
FT                   DGLNEVMSIEMMKSFSSSNSIQSITSSSSLSSIKNDHLDDIDEISPSTNLDCIVLELSP
FT                   NKLNRTVTEMAHVQMRRFFSSYPKSFKIATGNVGADVYAMGKRYYITSDSQASDFNIDS
FT                   SQPSHSLFLAHLYRRQRSICYYCGFTRCARSASSKNMCEYQKCIKCVAYHKWSRNSCKA
FT                   NGKLLEHYLSQNDWQIRRSNYWASVPKHIRQMLRCFYCNNEGDANFKCQGLSCPEGNAT
FT                   LRIRCLELMGANELNSERRRIPHNFPHLKRINFVFDKDFKLK"
FT   CDS_pept        complement(802428..805352)
FT                   /locus_tag="TA05970"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.81 - score = 58.72"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA05970 by TMHMM2.0 at aa 20-42, 587-609, 616-638, 643-665,
FT                   678-700, 720-742, 755-774, 820-842, 863-885 and 895-917"
FT                   /db_xref="EnsemblGenomes-Gn:TA05970"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73255"
FT                   /db_xref="GOA:Q4UI34"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI34"
FT                   /protein_id="CAI73255.1"
FT                   /translation="MADPSPTTNYHQSEEATLNIFAYMFAGLAMMLNIRLSYSAAPYAL
FT                   LRFKLPENLFSVFVRTTSSALELWCLPSMLLGNIMEQVYNHTQEIQRVHATGINNYEVK
FT                   TKAGKLKTNAGGQSKSELASTKNTDLDKSNNAQNKLEAKANELAQKALELHNGANTLEG
FT                   AASSSPLLPLKGDAKQLKTAAKKGSTGLYEKAEALAARAGQGGGATARGHAHRVIGAFD
FT                   NVEKLYDKLMGKANESKLTNHPNVTAVIKAYLDAKNTYYQMLITYRIQQKAIKFHEAAE
FT                   ALQNEAAGASAKEQPDNTLLKALHTHANAELDDLVKKAEALKGINADTIDATIVTNYLA
FT                   VDEAYGTLMEKVKEQKAEEVPQVKGVKEKFISLEKSYVNVLRLRVQELAKKSEELKEKA
FT                   NELKTRVDELRQQATLLANAASQDGSDGLQQKALLLVQAIKTDGGDDGSKATDVIKRFE
FT                   TVTKAYNEISKQPKYQQLLDKANEQEAKGTSLPDDEEQNVKDVYDAYKDLKAVYDEILK
FT                   FTKIKYYSGELYTAVDRNASDAIINFNAVVTVYKLLGETEYIVKTDFENLQEEYSNAIY
FT                   FYKKCIITIPSMFTNWLNFLTFVILFIVYVTGGDQGSVTGYYWIMAASGFVFGINMVLV
FT                   YAVDYRYLPYYIAGENSFPIVTSAILYFATSIFGNRRKYNSDYLVVLIDISISIFIALV
FT                   ASVLWTVAFHKYRAPKASPDTPNWPVISPVLLVIVGMGLVYSIYPGIAPGMIVPFYLID
FT                   KIEMVLLILTTFPPLIFAFTTKYAPSWSPKTEFLLHSYLFKFGGWTKYNADKPDSGWPP
FT                   QEGAVVYGWIWHFFDILAPLQIILAVIFVYSIHYRDSSISRSIVNQPKMSTFLTIIFYM
FT                   CHEIMLATGFPGLVCNGGVTHVLLPTQWIGALLMVLLAFYSIGYITEYKRHDPSEWPTD
FT                   GMTKWNALCYWLKMASKITNKNFKQLFTTDLGRNLLIFIFYKVI"
FT   misc_feature    complement(join(802602..802670,802698..802766,
FT                   802827..802895,803031..803090,803127..803195,
FT                   803253..803321,803358..803426,803439..803507,
FT                   803526..803594,805227..805295))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA05970 by TMHMM2.0 at aa 20-42, 587-609, 616-638, 643-665,
FT                   678-700, 720-742, 755-774, 820-842, 863-885 and 895-917"
FT   CDS_pept        complement(805475..807289)
FT                   /locus_tag="TA05965"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.80 - score = 27.22"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA05965 by TMHMM2.0 at aa 19-41, 222-244, 251-273, 283-305,
FT                   317-339, 373-395, 408-430, 462-484, 504-526, 536-558 and
FT                   579-601"
FT                   /note="Signal anchor predicted for TA05965 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.161, signal anchor
FT                   probability 0.704) with cleavage site probability 0.058
FT                   between residues 31 and 32"
FT                   /db_xref="EnsemblGenomes-Gn:TA05965"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73256"
FT                   /db_xref="GOA:Q4UI33"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI33"
FT                   /protein_id="CAI73256.1"
FT                   /translation="MAKCPSCTGPAGIGQDSCGLLIAAYVLAGLAMMLNIRLSYSSAPY
FT                   ALIRFRLPENLFSVFVRRMASALELWCLPSMLLGNIMDLFQKGCYNNVVLPIAVQVLKS
FT                   KASGLSGLAGTLSTKAGVLHGVLGSAEVDAKAKATALQQAASKPNDPKGLEQLLDELSG
FT                   INGDAQKVLAKYKEVVDAYNDVASDAEAKKKDSQLQAVTSAFNALHMIKTLDKFHLITV
FT                   PSIICQWLNFLTYVLLLVVYLMGGDQGHLTVFYFVIAISGVVFGINMTLVYSADWNYTP
FT                   VYIVGENCFPIITSFIHYLATLLFGNRRKWNSDFLIVNIDIWVAIIISFVAAVVWTIAY
FT                   GHCDSGNTDGTTVEYGHIFAEGFDTDSKVWCEIISPTLMVIVGMGLVYSIYPGIAPGMI
FT                   VPFYLVDKIEMVLLIATFFPPVIVALLQRFPSTKKYSPKATYVYPDGMGGWRPYQSDGT
FT                   VHNWFWHLFDILIVIKILLAAIFIYSLHYRDSAISRSIINQPKMSTALSIIFYMCHEIL
FT                   LALGFAGVIGNNGGTYVLLPAQYVGALFMIFLAFYSEGYIIEYKSHDPGHWPTEGMTKW
FT                   NEICYWYYFKIISLGGWYSPHGFYYDKV"
FT   misc_feature    complement(join(805487..805555,805616..805684,
FT                   805712..805780,805838..805906,806000..806068,
FT                   806105..806173,806273..806341,806375..806443,
FT                   806471..806539,806558..806626,807167..807235))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA05965 by TMHMM2.0 at aa 19-41, 222-244, 251-273, 283-305,
FT                   317-339, 373-395, 408-430, 462-484, 504-526, 536-558 and
FT                   579-601"
FT   misc_feature    complement(807197..807289)
FT                   /note="Signal anchor predicted for TA05965 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.161, signal anchor
FT                   probability 0.704) with cleavage site probability 0.058
FT                   between residues 31 and 32"
FT   CDS_pept        complement(807545..809257)
FT                   /locus_tag="TA05960"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.79 - score = 24.56"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA05960 by TMHMM2.0 at aa 20-42, 115-137, 152-171, 178-200,
FT                   220-242, 349-371, 381-398, 464-486, 506-528 and 535-557"
FT                   /db_xref="EnsemblGenomes-Gn:TA05960"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73257"
FT                   /db_xref="GOA:Q4UI32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI32"
FT                   /protein_id="CAI73257.1"
FT                   /translation="MARCPDGCKPAEAFGARGKCQLLQSAYILAGLAMMLNIRLAYSSA
FT                   PYALIRFKLPENLFSVFVRRMASALELWCLPGFIIADIIELAVKLVIKFGNDLGLSGYG
FT                   DYTHKSRELKFYAVICLSIIAQWLNFLTYVILLFVYLMGGDSGRLTTFYWTIAVSGFVF
FT                   GISNPLVFAADYNYIPIYIVGENCFPALTSFIHYLSTLMFGNRRKYDSDFLLVYIDISV
FT                   AILISFVAASVWTIAYGIWIVTNTAPIKTITVTDAGKKKLTIEYEDGNKDENATYTETP
FT                   STGPPYKYTVTHPKTNITYTFTLSEQLNTGTPYSKKDAATELITVTYGHIFAEGFSDTN
FT                   AKPSMVSPFLIVLVGMGLVYAIYPGIAPGMIVPFYLVDKIEMVLLIATIFPPVIVALLQ
FT                   KDHPNWSPKTKYVWHGFGNANTGFGGWLPYPATHIKDQEQSTAQKKEVCDPAAEKASNN
FT                   TVYAWIWHFFDLVILIMIILAYLFIYSLHYRDSNISRAIVNQPKMSTALTIIFYMCHET
FT                   SLAVGFAGMVGNAAEYTVIAQMIGAFLMVFLALYSEGYIIEYKSHDPAHWPTE"
FT   misc_feature    complement(join(807587..807655,807674..807742,
FT                   807800..807868,808064..808117,808145..808213,
FT                   808532..808600,808658..808726,808745..808804,
FT                   808847..808915,809132..809200))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA05960 by TMHMM2.0 at aa 20-42, 115-137, 152-171, 178-200,
FT                   220-242, 349-371, 381-398, 464-486, 506-528 and 535-557"
FT   CDS_pept        complement(join(809491..809659,809732..809838,
FT                   809869..809934,809966..810185,810226..810288,
FT                   810346..810389))
FT                   /locus_tag="TA05955"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.78 - score = 24.24"
FT                   /note="1 probable transmembrane helix predicted for TA05955
FT                   by TMHMM2.0 at aa 199-221"
FT                   /db_xref="EnsemblGenomes-Gn:TA05955"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73258"
FT                   /db_xref="GOA:Q4UI31"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI31"
FT                   /protein_id="CAI73258.1"
FT                   /translation="MIEGLDKDPYDEAENKVRKSIRKAILLQSQLYDNTGSLKNDNNEA
FT                   VRSGDELASVCSSIENDIGELQKVILAIQQNPNKYKISQTLIDSRQQTINEFKSKLNGI
FT                   VQHTNEMKFAQTNYASDYSNVQLQHQQDVLNQQNYHLNELHGSAQTLHTQAIQFNQEVK
FT                   SQNILLRDVEEQMTESQLHINTLTRKLSRFLDTDNPSIIRLILTLSIIATILVIVLIVF
FT                   "
FT   misc_feature    complement(809497..809565)
FT                   /note="1 probable transmembrane helix predicted for TA05955
FT                   by TMHMM2.0 at aa 199-221"
FT   CDS_pept        complement(join(810519..810960,811029..811224,
FT                   811319..811772,811849..811925,812008..812121,
FT                   812187..812220))
FT                   /locus_tag="TA05950"
FT                   /product="26S proteasome subunit 4, putative"
FT                   /note="Tap349e08.q2ks7.cand.77 - score = 45.27"
FT                   /db_xref="EnsemblGenomes-Gn:TA05950"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73259"
FT                   /db_xref="GOA:Q4UI30"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI30"
FT                   /protein_id="CAI73259.1"
FT                   /translation="MGNTQGTGNSPDDKKDKNDGRQSRSDQPVTFGKRKRKMLRQLAPV
FT                   RIPTVTPNSKCRLRLLKLERIKDYLLLEEEYITNKSLHKPLKTKNQDDLIKLDDIRGSP
FT                   MSVGTLEEIIDENHAIVTSSIGPEYYVNILSFVDKELLEPGCSVLLHNKTNSIVGILLD
FT                   DVDPLVSVMKVEKAPLESYDDIGGLEEQIQEIKEAVELPLTRPELYDDIGIKPPKGVIL
FT                   YGPPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGEGPKLVREMFKVAEDNAPSIIF
FT                   IDEIDAIGTKRYDATSGGEKEIQRTMLELLNQLDGFDSQSDVKVIMATNKIESLDPALI
FT                   RPGRIDRKIQLPNPDSKTKRKIFEIHTSKMTMSKDVDLDEFVVNKDDLSGADIKAMCTE
FT                   AGLLALRERRMQITQADLMKAKEKVLFQKKGNVPDVLYC"
FT   CDS_pept        complement(join(812451..812690,812720..812958,
FT                   813071..813341))
FT                   /locus_tag="TA05945"
FT                   /product="ubiquitin-conjugating enzyme E2 (RUB1 homologue),
FT                   putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="Tap349e08.q2ks7.cand.76 - score = 29.99"
FT                   /db_xref="EnsemblGenomes-Gn:TA05945"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73260"
FT                   /db_xref="GOA:Q4UI29"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI29"
FT                   /protein_id="CAI73260.1"
FT                   /translation="MYKGVYLKDHVADKAHKTCLSQTASELSVDSWALRIKYCKDTLEN
FT                   IKAEAQKSHVSGINGRSGRVLSEEQEKNFHDAISNNSKLIHQLTRELSELRMYEGVEIR
FT                   FPDINNIMNMEILIKPKEGIYKDMKITFSFHIPNQYPNDRPKIYCTSKVTQLHSYIIWS
FT                   HYINKSIIIHPNILGTNADKCKGAVCLNILREDWLPIYTIDTAIIGLVNLLIEPQFENP
FT                   LDKFAANLLQKDPMHLRSINLSLNYTT"
FT   CDS_pept        complement(join(813495..813605,813640..813685,
FT                   813731..814055,814103..814145))
FT                   /locus_tag="TA05940"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.76 - score = 29.99"
FT                   /db_xref="EnsemblGenomes-Gn:TA05940"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI28"
FT                   /protein_id="CAI73261.1"
FT                   /translation="MLDHLNNSLTPNLHGEITLDKVAHVKDETVRFLEKRSFDLVSFTY
FT                   SYEPERAPEINKMLEDDLDNLLLNSHRQLAYHRLYGDNKTNVAQYNSNLRRLEILAKEV
FT                   ESCYDRFQAVKKNNPDPTKVAIIHIFGVDDLEKRVQQSLNQLEILKKTFDNLQENCKSL
FT                   LENSLHLRRMV"
FT   CDS_pept        join(814746..814799,814828..814955,815005..815050,
FT                   815080..815161,815225..815319,815370..815525,
FT                   815559..815704,815750..815864,815917..816100,
FT                   816144..816226,816256..816382,816409..816563,
FT                   816619..816767,816900..817055,817114..817297)
FT                   /locus_tag="TA05935"
FT                   /product="5'-3' exoribonuclease (XRN2, DHM1 homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.55 - score = 43.26"
FT                   /db_xref="EnsemblGenomes-Gn:TA05935"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73262"
FT                   /db_xref="GOA:Q4UI27"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR027073"
FT                   /db_xref="InterPro:IPR041412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI27"
FT                   /protein_id="CAI73262.1"
FT                   /translation="MKMKCEGILDGAFSECFFLSLFPLEISCVNFSNKKFSHNFINQTI
FT                   IPNKHPPILYNPITNHEEDGKEIGYKVDKFKLEGVPRLYGWMMENFSRVRIPLDDSEIS
FT                   KGVDYFYVDMNAVIHSATHGNIFPILMMEDQQRMRRIVAALLNTFNLVKPKKMMYIGVD
FT                   GVCPSAKINQQRTRRFRLYKSSNSDNEYYKVEDGKMKYKVNKLKIGAYDNVSFNPSYIS
FT                   PGTQFMSMMDSEIRNWIALQNYEGTWNDCYIVYNGTDVPGEGEHKIYDTIRKMLELDPD
FT                   VRNSTHLVYGLDADLVMLSLITKLPKMYILREEYSYTPHILSKEKPDPYYSKKTGLLHI
FT                   HGKDFIDLKSNNYEVLSMNLLRKTMYSRCMSISGSVKNDLNRFLFIPNAKNRLTDDFSL
FT                   LSFMAGRNDFLPHLPSVELCNSSFNDLINMYYKMLPKLRGFLTLNYKINMSRLQLLMKE
FT                   LCKKEFDYFKMKSVSEKISDYSDPKKYAKYYYENKCDIDFNNKKAIRKMCYKYHYAPLV
FT                   SDLAKISGTTIKFYKGEPITPLEHLLAITPPNNSQLLPPVYRSLSGPDGSLCQYFPEDF
FT                   EICQDGKDNEWEHVVKLPFLDTKHLCQVARSVNDELKYNNLYK"
FT   CDS_pept        join(817494..817593,817624..817739,818022..818318,
FT                   818393..818526,818556..818709,818757..818864,
FT                   818897..818943,818974..819790,819832..819988,
FT                   820020..820076,820142..820899,820978..821078,
FT                   821109..821193,821226..821309,821339..821388,
FT                   821442..821541)
FT                   /locus_tag="TA05930"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.56 - score = 85.88"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA05930 by TMHMM2.0 at aa 599-621 and 634-656"
FT                   /db_xref="EnsemblGenomes-Gn:TA05930"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73263"
FT                   /db_xref="GOA:Q4UI26"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI26"
FT                   /protein_id="CAI73263.1"
FT                   /translation="MCHDNSLVYNDLVRKGLIVKDGMNYGATFSIYEDDPEQFHGHGLV
FT                   FLKHSNEELKISSIIRWNRISTFANKKNLTGWNIRFSNQPGKGESYYSEEQIPTERSEH
FT                   SLLKVPSGLHCGPAGRRTLIKWLEGNGDLKQKYCVLDNYKLSRGINNANPGVMACRLWQ
FT                   ESQGLPDEVSKAIVGLLKLQGIPTNITYRVLFENYLSKQLSSLMKRHSDSQEKLSMLAE
FT                   KMISMFQVTQIQPLIVDVLDLLVEIPQSAMAKILEDTYSSHHFYKISTLNIKRKIWSAS
FT                   PEKLNETIIPLILKALFLLRLGIFDDQMGNLSSNENLNEYNMLIGQMLQLIGDPQAECS
FT                   RIVYCQTVTILKLLFIKSSLQYKTNTIKHTNVVNANDSRNKSGTNKNVEDRMVKVSKTA
FT                   ECSLTFQSERFSEVKNKNLDLHYTKVLPQDLCDLYTKYANKTIGLSYSYITHSTNNKIN
FT                   YDLEEIVESNRSLNDTFHSTDTAKSEYRTKSMNETTDSVKIENILENVISSDIDNDLLY
FT                   PDRGEHYYSLIRYSLAMKCQEMYKITNANMKLIEPNFNLLQLINKVHNSVDNNLPTDEL
FT                   ISMINKNNTYNITVKDDMELFNISFILCNPLLYNKVVSYFVYYLFNMDMMLLTSKVEIG
FT                   YWIALISLGLSCTYIGIVKFILESQLNNVMKINDDDLDLKKSVSYLKQYIKVCKPVSLK
FT                   KLLKYIYPIEKDSRLFILKVPPFFSNFLTSNLTSQNSSDNKSDNSIHEDSVKNPFRRLG
FT                   EFRIEFDDKEGSAYKIFEGDPDTSFHSLLILYLPKLDSKSVNEFKGSSRSFLNLFRNDQ
FT                   AENSPKDTPSRTPLRFTDEENKNIILKILEQFDHQKFDSYSHIGNLLSLTNRHYSSVKS
FT                   AQTTIGQINLALLNIFLEKLSTLPYTMLNTLSSTSNITKLLFKMVSIELIKTSLKNVDG
FT                   LNQNSEGLKKFISSDRFKREAVVNFKTPTDYLYLKLLATIMFSDTVKPKDPVFKFAENV
FT                   SNYSICTSFILLYYYKKYGKDKSTEQTLERLSKNCHKILYDKENKNNPSYPYRKWSYLF
FT                   QEINKD"
FT   misc_feature    join(819853..819921,819958..819988,820020..820057)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA05930 by TMHMM2.0 at aa 599-621 and 634-656"
FT   CDS_pept        join(821598..821733,821771..822153)
FT                   /locus_tag="TA05920"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.57 - score = 53.10"
FT                   /db_xref="EnsemblGenomes-Gn:TA05920"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73264"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI25"
FT                   /protein_id="CAI73264.1"
FT                   /translation="MSVFNSEVFQGKFWSFFKRNENPENELKNLSKYEKILDSEKQTLE
FT                   GNIRQSLNKSALKAFQFSESYAECYDQCASNALRTTLKSTTLESLLPDEVKSGTSKDLL
FT                   TVQDNPAEKSLKELAGQVLDQNLFEPPKPNPEFFVKQKLDKPLRETVRDSELKCETHCA
FT                   KKFYNTFFE"
FT   CDS_pept        join(822241..824002,824080..824279,824331..824516)
FT                   /locus_tag="TA05915"
FT                   /product="oxidoreductase, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.57 - score = 53.10"
FT                   /db_xref="EnsemblGenomes-Gn:TA05915"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73265"
FT                   /db_xref="GOA:Q4UI24"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI24"
FT                   /protein_id="CAI73265.1"
FT                   /translation="MSRCCIVYGSETGNTEVASFSTYLYFRRNGVPVEIHLADFVAPKF
FT                   LSSFEYVLFFVPTCAFGEFPHNFESFINSLINIEGKLDSAKRNVRENKGYLEKLKYTIF
FT                   GLGDSRYPLYNFAARRLQSLLKSLGAAEFFPLAFGDEQHPLGYSGELIPWRNDLLNYFT
FT                   ENMVVNNFSEEDCFEKYNLPFTITFSESISQSTSLSHTIAGADLATNNTLNDYNIVDIN
FT                   CLDTKNKSSNNVDSLSINPKIALGDNKSDYKTGRVVCNKIITSESHFSNVRTIVIETES
FT                   PVYKTGDVFCCLPTDNTVGNMLKTINLNPNMILKISYNPNFNSSKFTIQTVLSVHNEHK
FT                   LRIVSKIFGNPIRIIPENSGFGSGSISSRKIEFDKFITMEELFSKYLCLRNICTPFQMH
FT                   FMSMYTNNKLHKEKLQEMAGDTIEGCLEYYRYCWLEKRSFYDVLYDFPSVKLPLEILIN
FT                   ICNPYYSRLYSISSSEVDFVNKFLYTIPRYPKSFNYFSLKQFLDHKYNRSNRIELCVGS
FT                   VKYVTPYKRRLEGLNSAYFSNLMAEDKVDFLIYKPLFSKLISNVEVPVLFIATGTGITV
FT                   IKPFIQFRAFKLKEIWKNYGYVTNVKDLAFIGFRRPNQDHLYTDFHMYRSWCRFIFVYS
FT                   RASKTKFYVQDSIRLNSSIVYPVLRDGLVLIGGKSHPMPSQVLEALSFVLEKEAGFGSD
FT                   AAKRFIDDSIKENKIIIDSWG"
FT   CDS_pept        complement(824654..827860)
FT                   /locus_tag="TA05910"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA05910"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73266"
FT                   /db_xref="GOA:Q4UI23"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI23"
FT                   /protein_id="CAI73266.1"
FT                   /translation="MDKNRRFNSQKSTRGRNGRFSQGHPREKGNNDVKYKNKILSRELK
FT                   EITLDVFFNSRLSQDLNLPRQQVDQLLDFKPSHHFNSYLNCCICYENTLICAVGKCDHI
FT                   TCLLCSLKLSFFYNTTTNQTDNTTNSVSNTTNNGRNTANSSRNGSNGSLRGTYECPYCK
FT                   QQNDFIYFCVNPFYVHLAKNNKFYSSNETPALTKAELTEFIYILTKSRRLPEQCSNSST
FT                   INIMQLYKIFLNTIKNTVDMLSFNGLSTSLYGLGVSGSRPDLPDLISKISDNFTFHDDF
FT                   VILSDQRMFFESAGIYYLYKVILSPLCWFPECKEQWYLDNVTKSNLVEALKGLSRHKYA
FT                   SYKVLNKHIKASHTMVFCDICLSYFANKKFVCEFTLYNTAKIGDHVKYGDVNSYPPINP
FT                   HVCCPACKTYHWDMTAFKQHAKDEHFICELCDSYDDSYCVFSDYNSLFNHFKTYHYPCE
FT                   EEECMFIVFSDDIQLQLHYLYKHPGVARVTKGNKKPIHINNRANTATNRSSSCAYYAMD
FT                   DNLTYDTWDGSINICDKHDNSLENVDTIRVNEVKSDPLDGLEDTKLYSYISPLDGDVDL
FT                   KEDRKRLDKFLKGLKGSRHLPVSSEYINNFDVTKSSHVFNDLETVLTHFRRLDIKLFDI
FT                   TSYLTELLSGCYISIINSFTKHYNNIINNSDLSDGTVLFNLVKSYLLKFVLFFYTIHIN
FT                   RPRSDSDKLSVKIDVLKLREHNPDVKLGANGILFLIAALNFSNISNRIIVKASLSSIIE
FT                   DMKTIYKESPSPMSLSEAFNLNNSLNSSSGGGNISSNALNPNADINEYIAKKPRSNNIV
FT                   KIPRKDYIVTLKGKKMKNKPQVVHEEPVDTTTSIEEPIVVEPDNPTPINISDGLIHLEA
FT                   LEADNETLFMNHVGSCNFYGLMCDMIGSLLISNMKRYKAKSFDYSLRETTKLKILAIAL
FT                   SQKRSLTNLGEFISMKKLESLQSLEPEFHRLVKECKKSDLPTIAKVWNKKCTNILKNTQ
FT                   VEHLEILHFYLKGNSDTCMPLCNDTEFPSLTKNKNSPEFTGTRNYASAAGVVNKPKFMN
FT                   DLEFPTLKQTAHLHKKNIRK"
FT   CDS_pept        complement(join(827989..828400,828466..828607,
FT                   828675..828768,828840..829395,829480..831161,
FT                   831193..831342))
FT                   /locus_tag="TA05905"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.75 - score = 145.41"
FT                   /db_xref="EnsemblGenomes-Gn:TA05905"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73267"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027711"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI22"
FT                   /protein_id="CAI73267.1"
FT                   /translation="MENCVIKNSKRPYHSTMGPLLEDFNTLSKRRKKLFDNINTQIDTL
FT                   IKLLQDTDDKLNSNHLNHLNNHNLNGLSHHCDQVNNKSNELNGLNHTNDTHTTNGVDSE
FT                   VHNHVNDYTKGNEHNGINETKEVVLTDRSSGTDDETVTLTERSDIKSENPPENNKEQNS
FT                   SGKFEPSDSKIAAKYDSSDTGNETSSTDFNNEQSLCECKKQLIRDLASTVKSYDIYRKI
FT                   NRSLKVFNVQFNDMGRSLLGNCSKDSHELLSPVKLDERLVCRMIGMHLLHYGLFDVYEQ
FT                   LKLESERLWGANHIGTIGSVMVTAYRTLHGLLDQIRNGDIDPVLEWTKLQYDSSNLHIQ
FT                   RFNEIMINLYKIRFLSFLYNFKPSLNGCKEQNNTNGNPDSDIIQQVKNSGITSLWKIHN
FT                   DEIGKLVTQLILGENKPTESEFDELKNKTIKMFTKLFCESGILIKKPPNYDKRPLLSQV
FT                   VDEQFSYNTETKTEELPEEESPKLEDCLKINDNTTLLFAYRPILNDQANRSCRVKYNSW
FT                   LLALGTELETTVTKPAPEFYKTPLRRDWLNLSEKIRPKQPKMAYRYLNSKSLENGRRIN
FT                   FIRNKLCNNSTLDQSPSMSKSVLITTLCDPETFCRQNLSISDNMLNNIPYYVENQLTED
FT                   ETSSLGMYTDPGDWTSSRIDRTTTVLIATGSEESEEGILGLSNMGRLIENYSSSVSSEE
FT                   SSQRTTPTFSLTVFAGPSIFRDSRLSSQLMEADIISQRLLNVSPGSRIRIRVPTLTEEE
FT                   LRSPPMRETLISPYEPPAAEPPAVVEEEEQASTTIERSSITLRDILRMIMRGLRVETQS
FT                   TVVRFRGSRQQQNLEDSRTSPNDSDSPKDKVTTHKRLIRPKSSTKSESQVDSDYIKVHL
FT                   PYESPLSVVTCAGHVTFPYLLDVLKVLFKERCEVSSKVGMWLKSNQQLPVESDLGPAFH
FT                   FHSYLTCAVSKDQTSNENLPIMLSCGHVICKICHDRLSGKRRKRLFKCPMCPTMVEPNQ
FT                   VNSIKNNKFSDNGTLPRLELQP"
FT   CDS_pept        join(831798..833927,833960..841681)
FT                   /locus_tag="TA05900"
FT                   /product="dynein heavy chain, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.58 - score = 152.53"
FT                   /db_xref="EnsemblGenomes-Gn:TA05900"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73268"
FT                   /db_xref="GOA:Q4UI21"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR024743"
FT                   /db_xref="InterPro:IPR026983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035699"
FT                   /db_xref="InterPro:IPR041658"
FT                   /db_xref="InterPro:IPR042219"
FT                   /db_xref="InterPro:IPR042228"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI21"
FT                   /protein_id="CAI73268.1"
FT                   /translation="MIPHGSTFRNFCAKVLIGIPDCVDFISSICALYFNISDVNINDIL
FT                   NSFYFDIVSNFINQKDPEIPLTIYFKDDLSCENGVDFSNKIVVSYGKREDVADLVNFIL
FT                   FYKLSSSNKFTKGFILLPLVSTSEFPLNLTILSHLKSLLTFYSASNTHIIDGNTVENKQ
FT                   ISEKLRQILFLTEDLEKEFVTDDPKFPFCKSLIQYIDPDTKTLKVYEIKINDEFVLEDI
FT                   KSDVREWSTEIFQIIKRYLSMFSEDEEYDTSDISDYISEKSSISSGSYETTSSSFDTSD
FT                   TSSDTSDTSSDTSDSSDTSVIDNSLLTLKTSKIQRLTTGLVNDIYGYVHEICSNSIELF
FT                   EEIEFWNNYQIEINELRKKMESPNFVNTLLLLEYNGISVENIYSFKESKGLVSKIVEEV
FT                   KEINSFMAELKADNFINCEKLSDFPLLIEKVFTTLRKYKHLRYMKSDRLLLLINSIILN
FT                   SIYSVSRIISIELNQTMEENHKVLMKSIRIVYDLKNRTVDLVKYFEKNNQLLTLNNNMI
FT                   IILDLYRDILQSVCKIHEKFVTLNSDMSTVISELSEYLEDNSELDNCPKIITELNEINS
FT                   SVSESNRLFVESVISGYSNLNEGMENVLKLDDVIFETKYKVENYKNEFLKCVNSYLYTL
FT                   DLFEAFPVIEMINSLDESECKSMLVFNVDVYIDQITDEYDKIIRDIDDNDYEAVLIPFQ
FT                   YDNIPYKDMVIQERIMNLVHIVDVLNTISSKSILKTTKNNLNELLKNPKLNFRRIDFNY
FT                   SDEHISLSSNNEYREKYLPYMTHLDRYHKLLKNHIFTSTNTILDEILIIRQLDVEVYDK
FT                   NIYDDIILIEKIYKEYMYFVQESSELSDKLLHIIGDKSYLNHINISTLVRVYKLKRKEI
FT                   QSFLEFEKNNYKIRSYFTKLKQDSDDVTIEYKHISIEFCEIYGLNQIYIYSIDNIDYII
FT                   DYINDNITKLLVIKSSKCDLKILNNCDLWICAIEKSKSFVENFKMFNDKFQKLLNIVSC
FT                   KFMDFKDHGNIICSLKEDIDKLSEVNKLSNIEQEHLLLFQSMIKRVDDIEKVAKKRLND
FT                   IRYKCPRLYFINDADLVELVGGGDMDLFLSRIFPGIARVITNENIVSGIESSQGEIIIF
FT                   DSKIDYCSGDNIKFINELDSIIKCTIKRLFTLGLEELKVCYSHFNFDDSFFSKWISKYP
FT                   TQILILTLCICWTESVECCNSFTKILNFLSKIINFIISNTIDVFDNLKYYQLFLLLNYQ
FT                   INKTREIEMGDKSKLGWLKCVRYYHDNDDVIIKIMYKEYKYSFNYLFNCQKMITTKVTE
FT                   HFYSIASMTLSCNLLPSAQGPAGTGKTETIKSLSYIAGSNVMVFNLSELYEVEDMEKIL
FT                   SGLYQLGFWGIFDEFNRLSECVLSSVTEKLSNKNITLLDRNIQVNGNSAIFITMNPGYS
FT                   GRSELPLNCLNLCQQFFMEKIDLHSILNINLKIFSFKFCSKLSDRIIFLLNSLDLVFTS
FT                   AKFDFGLRFVKNLLNIIKNLIITSIEWTDEYDIFLQSLNRLLLPRLTNEEKELYKHFIK
FT                   NNAELKYSNDELEFVELIKLSNVDDIILNKSLEIYQMSKISSLVILYGESGTGKSLSFD
FT                   KFIECIEKTKEVEVVKFDPNSLDTCELYGYMDVDDWVEGLIPKILKSNPDKDMYIVFDG
FT                   DLKQEWVENLNSLLDDNRILTLSNGDRISLRNNVKIFLETDSLKDITPATVSRSTIVFF
FT                   DCKIGTNSLIGSDTQLDSLGNESESFIIKCNDSCESKLLKRIEWHCVINTIYLSQGLGS
FT                   RDIINYLYSLLGENIQENAIGDGSKRTTILVKDIHILNDTSKWSSLCSIFRQMIKYKFF
FT                   YRYFPEESEWIKVHLDGIVFVFCSTYECGNKCRLLSMLKEVVLTNSSIEFDEFSQLKTF
FT                   INHKYGRQMSHYDLTAIKLLLSKKHGGWLILKHLQSRFNDNSLQLMEQVKCICKVDINP
FT                   ETINNSVITCKSVEDTYNFIYFTLLYNKSFLYISGPSVSGKSFLSRIASTNLGFEFIEA
FT                   HDMSKDDIVSIIISCGLNNKKCVIFINIDILVDMKLYFIVKNMISKEYSVVLYDALIRD
FT                   VYDKNSVSIPYDDFINEFKMKINDNIRFILTGNNIENSLMNRLIKYNMPCISYDEYVLM
FT                   SHGMIEDSKELIPDIYNVCKEYVGDGFINYIFILKMTKHWYQISFEINVKLLKHLNRGI
FT                   DKIKLFKNNVDKMESSLNQTRCKLDQMNIESETKIKMLEIKRKDCEEKKKLAMELASGL
FT                   KERKSILDHKKQMIKSQINNIDPLIKKAKEDVENINKRSLEELKSMNNPPFIVKYTIET
FT                   VSMILKNGRKIQWDDAKKLLKSSDFITKIILYDIENMQENVYNMLKERLEISEWDVNRI
FT                   FKASKAAGPLAKWANSILICYEIYKQVIPLKNEIIQIEEEYIRNENILAEQNMLISQSQ
FT                   NEIEQNQLDYEKNIQVSSKIQNEIEINQNELMVSKKVIDDLTNELVRWNKRVSHIENHN
FT                   KYLLCNSTIEAIMPIYVSLDYNTRTTFIQKCIETLKKKFENYSFDIKSIFNIEKYIIEM
FT                   YKRLRHFVVLDSSESEYTSLIQEPYTQVSCCDVNFIKVLNSVKSLSGSLLVKDIHCCDV
FT                   NIKLKILNEFKEKVDVETDFTMYIISTNEYFGMNKCVDKCIIESIYNRAIVLNMKLNSE
FT                   CFLEYTKNKIIDVLEPEIYSLYINSNKNIDELNFRINDNETRLLDKLVDSDVFDPDFVK
FT                   FIDEYKQVNEQLDSSLNDLKKSYEIYEQAIDSKLPLIELLYYIYKEVEELGNLNKLYCF
FT                   DYNALFYFTKVLYNRDNYITDIIILTYNWISEGILETDGIIWGTKMLRILSKYNNELKE
FT                   INDSSNNTSNSIQLLINNYLKSQDYNDIILDYYDTIVLLTDGFEDPVYISESISNKREK
FT                   SLDAYAVGSLSEMTRVTNSMLKSLNMGNYIILKNIHLSKTWINKIETDFLNKYKSSKIF
FT                   LTCDMNVELSKNMLLSCHKILSELTELKSLISHLFNIFANNSYLKCSRFILLKCVVIHS
FT                   IIILRQVYIPFGWSKKYNFNTNDLKIILTFLSESLNKSDLDQVKTSCLINDIIKEVYTA
FT                   KITCEIDLKLLDDIIQVSDQRVQESDDIGTWIENNSLDDGFAFIGFTKYTQNEILNSKT
FT                   YNNKSCIEYDGEYKTELNTDCKVFQNFIKDEIAEATVKKSVNPLEHTKELENITRFING
FT                   ENMGTINLNNIILANRLINLVKFCIPNNIDPEEMELTLTIDNLGELLGNWFKVRVKLWN
FT                   GEYDPDDNLILSGTDCGREHELFFCWARKVENTSEHNALRTLIPLYKSNGFV"
FT   CDS_pept        complement(join(841791..841939,841971..842061))
FT                   /locus_tag="TA05895"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.74 - score = 9.81"
FT                   /db_xref="EnsemblGenomes-Gn:TA05895"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73269"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI20"
FT                   /protein_id="CAI73269.1"
FT                   /translation="MVFLSRRFGHIYRTVLLDGSPANRTAKWTLALLMTGIWIYKSEKK
FT                   HPRKRGIFFRDNKAEPFHEYEIEEWNSKFKRDTA"
FT   CDS_pept        join(842277..842351,842384..843398,843711..843760,
FT                   843807..843981,844048..844129,844159..844243,
FT                   844275..844349,844378..844443,844472..844924,
FT                   844953..845011,845041..845185)
FT                   /locus_tag="TA05890"
FT                   /product="adapter-related protein, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.59 - score = 71.63"
FT                   /db_xref="EnsemblGenomes-Gn:TA05890"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73270"
FT                   /db_xref="GOA:Q4UI19"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI19"
FT                   /protein_id="CAI73270.1"
FT                   /translation="MVFPGLDKIPMPPRSKTTYFSNHKKGEVGELRLLLRRMLLDSKSP
FT                   STTEKIVSQIIEPNVDHFKVQNEQKRRNVLKKLIGCMTLGIDLSSLYTDVVMVSQTDDP
FT                   VQKKMIYLYLSNYSMDNPDLAVLAINTLLKDADSPDPVIRSLALRNLSSFGTNLSNEYA
FT                   TMSVLKKMFDPSDSVKRTAIIGSIRIFKSNCSTYGKDLKSTCDLLEDLKTALRSKNVHV
FT                   MVDAMCAVSEIAEYDKKIPLTTPSVIYLTNWYANMKQLIFSLKDMNEWEQCYILELLWT
FT                   YTPSDKDEMFDLMNLLDDKLKHNSSAIFLATAKCFLVWTKNDLFLQLEVVKRLQDPFLS
FT                   LINRTRSEISYVLLANILSLIVNGIIALKIPSQLSFLMEKISDIYKFNLPHLNSSVLHV
FT                   IRALFSVYPERAPELLEIVKEPSEYITDPEAKSHHISILGDYGYDLEHTPYTLEDYIDD
FT                   PDRTEDMTLELLPASVKVFLKRPAEMHKALSRLFESVLESSDYNLAMSGSFYYNLLYSG
FT                   VEEAEKILFEDENDRVEYDKDFLLAQDYYFVPDPEWREHFNTVYVLSNCSDFYNSNNPI
FT                   FFPFEHKDVKTDIFREESLRKVVENYSSGSIEPGSEYERVGQNPESANTETLLFEELEN
FT                   EVRYFNLVVPETISEEDFQTAWLECEHSYSTEMELYPNDLNVEDFEGLFAKLNIMTLAS
FT                   SDKDSYSKMYMYTQDEQGAKYYIEVIIKGGQIKVTIKVKETNSSESALQSLSEILCDFI
FT                   SRWLTR"
FT   CDS_pept        complement(845202..846281)
FT                   /locus_tag="TA05885"
FT                   /product="ribosomal RNA methyltransferase (FtsJ homologue),
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="Tap349e08.q2ks7.cand.73 - score = 23.86"
FT                   /db_xref="EnsemblGenomes-Gn:TA05885"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73271"
FT                   /db_xref="GOA:Q4UI18"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR028590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI18"
FT                   /protein_id="CAI73271.1"
FT                   /translation="MAHTTKENRDIYYRKAKEEGFRARSAYKLLQIFESFHILYPKLDE
FT                   ESALSILLNSSCSYCEHNINKNDYIDKIVISERTKENLCSTGPGSDSESDDYSELGLVD
FT                   YVKIKRNCLELGRIKNVVDLCSAPGSWSQLLSKMVHEDYETLKNACKKLQTQQEVCKNL
FT                   VEYVNIKPVIVAIDIQQMAPIEGVRFLKGDITDPEILKEVLQLFIENVSRNINQAYGGE
FT                   YDEKLRRNAQLITCDGAPDISGLHETDSFLQSYLIKSALSVCFSLLDPDGCFICKTFFS
FT                   SENTPIFTQVSSFFDYCTIFKPSASRSSSFEHFIVAVGYKPFGHILNTPKSQEIDDERE
FT                   IDSELKEIIKAAGKAISWD"
FT   CDS_pept        complement(join(846472..846543,846558..846632,
FT                   846664..846758,846789..847076,847111..847211,
FT                   847244..847302,847334..847570))
FT                   /locus_tag="TA05880"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.71 - score = 25.48"
FT                   /db_xref="EnsemblGenomes-Gn:TA05880"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73272"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR026532"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI17"
FT                   /protein_id="CAI73272.1"
FT                   /translation="MSTDVSKLNEESHENENSENVVDNVDKDPYKLKNAEYIKPSSKYK
FT                   NKQKILVFGNKRISQLGRNLLKDLIALLPHHKPESKWDSKSGYKEINELCELNSCTGAL
FT                   YLESRKNEMIMWMAKTPKGPTLKSRVTNIHTLKDSTFTGNCLARSRPLLTFDKSFSDEP
FT                   YLKLIQKLFSQILGTPNNHPKSMPFHDHCLSFFFVDNRIHLRHYQISPKNEFSMNSVDN
FT                   QVLDEIGPQFVLEPILILDGSFSGITLWRNSKYISPLMVKRYERQLKMNRRRIPRKKKV
FT                   ILVLEDNVQLPEDELSISNVFSIPDRK"
FT   CDS_pept        complement(join(847676..847796,847827..847960,
FT                   847992..848720,848752..849094,849165..849376))
FT                   /locus_tag="TA05875"
FT                   /product="nonsense-mediated mRNA decay protein (NMD3
FT                   homologue), putative"
FT                   /note="Tap349e08.q2ks7.cand.70 - score = 42.45"
FT                   /db_xref="EnsemblGenomes-Gn:TA05875"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73273"
FT                   /db_xref="GOA:Q4UI16"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI16"
FT                   /protein_id="CAI73273.1"
FT                   /translation="MPDWLFTSPTKLDSIYPPMQCFLCGEFVSAPTSSRMCSTCLTKSV
FT                   DLSENVSTHCTILQCTTCTRFYHDRWLNCELESKELLSICLKKIKGIDLMKIVDAHFKW
FT                   TEPHSKKLKVNVTVQKEVENNCVVEQSLSIDFTIASAQCASCKQMYTPHTWKALVQIRQ
FT                   KTKDKKHILLLEQIILKHNAHENVLNILSRRNGFDLHFSSRNDAQKFADFVSDKIVSQI
FT                   KNSKKLVTQDVNNNKYNYKYTLHVSLVPICTDDLVFLSPKVSSIYGGISPFLLCINLTS
FT                   TISLMDPFTLRKLEVSSDKYWRNPFVSCKKWRFNLFLVFNKFNLCEFIVLNIEKDYTRK
FT                   SKDQQYELVDVEIMPSNSSKIIYTKSHLGKILTVGGTYLGYDIKRINMNGLSEQETDIS
FT                   NRIPFDVILVRKAKKYSSKHNWVLKRMFRRKNNQKDKDNDMEEDIDEDELLDFKEEIVN
FT                   RKEFQKDIDFYRNPRAKPHKEFDITPSSDMSDEFAMNNLSVQLKDLSIHDDEYF"
FT   CDS_pept        join(850109..850162,850195..850268,850427..850598,
FT                   850629..850734,850764..850915,850947..851135,
FT                   851165..851218,851248..851358,851389..851481,
FT                   851514..851576,851608..851661)
FT                   /locus_tag="TA05865"
FT                   /product="RNA binding protein, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.60 - score = 49.20"
FT                   /db_xref="EnsemblGenomes-Gn:TA05865"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73274"
FT                   /db_xref="GOA:Q4UI15"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034392"
FT                   /db_xref="InterPro:IPR034393"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI15"
FT                   /protein_id="CAI73274.1"
FT                   /translation="MSDSTKSDNIPPPTNAPKWYVQAGENDIRGPCDTESLKSLLKSLE
FT                   SEDKENLEQLEENTYIKGAVLTEEEEAKKRKREKKKLYLKRKKQRMESGEIAGSLKSHT
FT                   VYVSGLPKDTTISEVAEVFKKAGLIKIDPHTTLPKIKLYTDEKGELKSDGTVTFVNKES
FT                   IDLAIRYLDNYHFRDNCVIHVEQAKFEPRSTQIKPIPPSIKSELRKKYLAAKYEEKRLQ
FT                   GWSDTLDDGTGRRIVISKPMFSMEDAMKYEAGDEFYEELKEEILSEIKKYVEVEKVTPI
FT                   ARHPQGVVCIKFKNSSDAEVFISKFNGRMFDGRELEVYFFDGKTDLQAQTIPSNKIKKP
FT                   VVETKLKEDEDDDVKCDWVEEQSSDEEFEIRTE"
FT   CDS_pept        complement(join(851783..852178,852208..852261,
FT                   852323..852482,852517..852944))
FT                   /locus_tag="TA05860"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.68 - score = 143.15"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA05860 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.923, signal anchor
FT                   probability 0.069) with cleavage site probability 0.589
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA05860"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73275"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI14"
FT                   /protein_id="CAI73275.1"
FT                   /translation="MFESLLYIIFSLIFVLPILCRVTSPTKLSFVSHLSNNWHNKQHLN
FT                   NQKRYLKNPEYIVPGTFEEWKKDMSRTVGVWSIYYPYDLFKAKHFMPGADIRPNLLFLD
FT                   IAGRVRGPGEYGSPEGCYLLDSKEYHHMEDSNNVLHSRKCVMVMYGSIRYSNLRMILAG
FT                   RMFYAGGLVLKGLDPLLNSTSAIFLGHTFLESYKNEYYMDFISKLKRKISFIDRQGNEI
FT                   DPANWEYQKLDGYGSDFRWMHGNEKWKLLGPFTSYKSYGVNYDNGAENSFFSQYADEAI
FT                   YNVFDPLEHFCRKFTSREYLEEEVHTIVRSVLKGSDKMTKIKVEDENYLNNLEEEVIKK
FT                   HYCWF"
FT   misc_feature    complement(852885..852944)
FT                   /note="Signal peptide predicted for TA05860 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.923, signal anchor
FT                   probability 0.069) with cleavage site probability 0.589
FT                   between residues 20 and 21"
FT   CDS_pept        complement(join(853239..853487,853519..853630,
FT                   853663..854032,854063..854230,854260..854365,
FT                   854395..854491,854524..854618,854650..855027,
FT                   855080..855999,856034..856717,856824..856899))
FT                   /locus_tag="TA05855"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.68 - score = 143.15"
FT                   /note="1 probable transmembrane helix predicted for TA05855
FT                   by TMHMM2.0 at aa 210-232"
FT                   /db_xref="EnsemblGenomes-Gn:TA05855"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73276"
FT                   /db_xref="GOA:Q4UI13"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI13"
FT                   /protein_id="CAI73276.1"
FT                   /translation="MNLQNCQSYTNVIYKESTGFTHYSKQNQFRGIIAEAFEHLKGLNH
FT                   LNICKYVNMLRLEGNTYLLFSEGYSLTLSQIFQTQCEEYIKSNFYTIVNQMLFGLQYLH
FT                   SSGFYHGRFSLDCVSISDEGLAKISGYGTNYFNKIVNYMIKNSYKESKESYEDKEVYKN
FT                   YIMNPFNNDEKNDFIDYVISSEYLTNLLPYMPPELIFFNGSEPKGHLFWFNVDIWSLGI
FT                   CILFIMSYVVSSSDLYNGSYPNGIDDKNDKIGNCHSEGNKGISKTEGYFEKLKNMFNSY
FT                   ESKSVFVESFFFVTYLLILINKFESQEPISALGLDIVKILNEKFKLFIKENEPLGDIGV
FT                   VSEIFNKVNNKCGDLDIKEEVEEEIDQDKIGSQSESLVEESLMVSIEILTGREVLRNLI
FT                   SFNKKSTWGNSNCDSFLRDLNYLLTLVNDCLLITNSKRPQVIELITKNNILKMPQRITN
FT                   DCLVKYSWFTYKEKTEDIESISDFSVPYSVELLKESQLNLSESGFFLSQVGLENVLYYW
FT                   TLLGNDPGNTIPFEYKNKINVVYEENSSKETNSKQDCKTKVISNLEYFRRYKIGKVFLG
FT                   ELINHVKLANLFPMVIEHQLRPTCVYARQHCFIYQLLRIRRFKRLLNNPVENKRQIFAE
FT                   AMIDIPPLLRKQIWCNLLDIVYRPSTKECPISSKYKFESMPPDIEQNLNFYNNDLLCST
FT                   NNLNQLLSSVEDLKRKIIHQQVPNSIYSFAIPLLLLYHNSKVYATVLNKMFSKYLKEFY
FT                   SPTGSFVNNYLSEFSTILNFFDPEVSYHLRTIGAYSDSYALPWFMSLFSENTTVDQLYL
FT                   IWDSILVHPKQYIKFLAVMIVHNIRERILGITDASVAISFISCVVDSLNVPMLMYLTTH
FT                   MFNTWIEVINPKTLTNKYNMLNNQESLNQSEGTGFKSDSDTFTLDKNTLVFLSGEYPFE
FT                   RCFKLSIDTFSNIFNNCIIIDLRSIESYNLGHIPNSVHVNKVFSALSETDKKIGSISIP
FT                   IFNTENNTDSDFNGVGGQTQVISSLIGLRNTSKSPWLHINTPESNKVVLAAGDGYDNDN
FT                   EMLSLQRLIFEFRVQHVCYYRINTEEWPKVFTLSKI"
FT   misc_feature    complement(856098..856166)
FT                   /note="1 probable transmembrane helix predicted for TA05855
FT                   by TMHMM2.0 at aa 210-232"
FT   CDS_pept        complement(857097..858257)
FT                   /locus_tag="TA05850"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.68 - score = 143.15"
FT                   /db_xref="EnsemblGenomes-Gn:TA05850"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73277"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI12"
FT                   /protein_id="CAI73277.1"
FT                   /translation="MANASLLNDSSLKTRPVSRLLSLAKKRHEKYSFETEAETSKSDVK
FT                   FSDKVTSTQSQFTFENEPLLESKADVKSSDKLVEKEGSQVYENVPNSTSADFKSYDSVV
FT                   ERPGDYLFENAPKVSSKADFKCGDAVSETSGEYLFENQPQLSTANVRSSDRLYETVENL
FT                   VFENQPQLSKAHVRSSDQLEEKKESQVFENVPEESTANVRSSEQLEEKKESQVFENVPE
FT                   VSRANARSSDQVEEKGESQVFENQPELSKAHARSSEQLEEKTQSQVFENVPEESTANAR
FT                   SSDQLNGSKESQVFENVPDEVSKADVTSYDPSPDLSKSQTVFECQRSTVSTADFSAFKP
FT                   VEPKSQCVTTFEAQTSQHSNADVVYNKFDTPMKELSETMSKCRLDE"
FT   CDS_pept        join(858963..859412,859443..859884,859915..860027,
FT                   860056..860306,860336..860660,860694..860794,
FT                   860824..861127)
FT                   /locus_tag="TA05845"
FT                   /product="DEAD-box family helicase, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.61 - score = 59.45"
FT                   /db_xref="EnsemblGenomes-Gn:TA05845"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73278"
FT                   /db_xref="GOA:Q4UI11"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI11"
FT                   /protein_id="CAI73278.1"
FT                   /translation="MILLNGRSSRFKLHKLRILSYKFHSLTNDIKNHSNHIEHFLNDNN
FT                   VENGDSDDESSSYDHTSADSSTFVSDFSEFSGILNKRLLKSLENNGFVRITHIQRSSIP
FT                   KVLNGSTTLIRSPSGTGKTLTFIVPALQRLIDPPDNMKITRKDGTKVLIITPTRELSFQ
FT                   ISKVAENLSKPFPWIVVSCIKGGESRKSEKARIRKGITVVIGTPGRVLDHIESTSSFKL
FT                   DNLEMLVLDEADRLLDMGFESKIRTIHSYLLDSKKSNRENSGIQIVLTSATITERVRNL
FT                   VETCFDSKPQIIGLNEESSEIPTKLRLEYVLVDCNNKFMCLISLLLKFVKNREKIIVFV
FT                   SNCDTVNYFYMLLKSLTWPTLNKSDKKETNPLRNFDKSILSSENQHLLSNGFDINKNSK
FT                   NNIFKVPIFKLHGDMESSERFPYMEQFINSECSILISTDVASRGLNFSKVDRVIQYDPP
FT                   QQLDEFIHRSGRTARIGDSGTSILVLIRHEVEFVKLLNKRGMKLDELSENSVWNEIKLL
FT                   NCPKYLKKFKGDLVGFMRNRICIDVKEDDGLLDLGKKAFMSSIRSYKTYSKELRKVFNF
FT                   RNLHLGHYATSLCLNMKPTELMNRNRKDYNDQNVLKDPRNSTKRKNKSKTHSDRPVKQP
FT                   KITLSEESNKAAELALKYLKEHKMIL"
FT   CDS_pept        complement(861192..862082)
FT                   /locus_tag="TA05840"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA05840"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73279"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI10"
FT                   /protein_id="CAI73279.1"
FT                   /translation="MTRQELDASALRNVTDKLSFDEIDAIIENLSTGNLSSFLNNDKLN
FT                   EALEKDAYIINNVFTQTGITKSCEHGAKISSIIKHKAAKLNEATALELLDCIIGIYLEN
FT                   FSKPSIEHTLTMSSQDYPSNPLDFVLLSKHFESGVLAFSSLSWDNLPLSDLIVNESLSQ
FT                   QRQKRSVTSSVPQYNELDTLVDYDDKLETKERVEKIKELLRRQTSRRAVRFWEFVLDRD
FT                   PQNGFNNTCFNLYSLTFLATNGEVEIFKGSDGEIMIKVFCGLKLFFRLGIGVVAPKSTF
FT                   SPLLLVGLISSGLIC"
FT   CDS_pept        complement(join(862184..864617,864646..864991,
FT                   865024..865429))
FT                   /locus_tag="TA05835"
FT                   /product="phosphatidylinositol 4-kinase, putative"
FT                   /EC_number="2.7.1.67"
FT                   /note="Tap349e08.q2ks7.cand.66 - score = 100.80"
FT                   /db_xref="EnsemblGenomes-Gn:TA05835"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73280"
FT                   /db_xref="GOA:Q4UI09"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI09"
FT                   /protein_id="CAI73280.1"
FT                   /translation="MEEEENKDINPTDSPDVNPESLSTANSSDPEHKDDYLEQPALKEE
FT                   ISEDVEEENVKKLDSLSFHTAISLEVHEIDHNFYNKESELNHMNSDESKQHEESVEPDE
FT                   KVTEPNNQLNHNQMEVDDSLLNDFERSLHLKDVTKTNDSRTKSLSQRTESSKSKHSSKS
FT                   HESTERSKRKSSRRSQQFGTSENPLDITEITVDCGSLLELYQNDYFDAFMHMYHLYHKK
FT                   EPGVHEYLVNMLYTKRTDEEISYYLPQLCQLSISKYGKSSLHRFLLDKASVSMHFALQL
FT                   SWFYQAAIDDHIPSILNTNNLFLECDRLTQKMTQDTEMAVVNSKLITPVSFSRPSSEMS
FT                   ISENTTFPCLLDRRLLLESFSRRTQQKSDLYNLFTNVNSLLGAKIPTSLVHNTFMLSTP
FT                   TSKVKLVGVHPKLGNAIVLETHPILDYTQDLHLELQKLMMKQRRLNYFNTLNNFVELCM
FT                   QNSSLLTTESKRDARDPLLRVFASALNEWMLLRRCIVAAYEESFAYTGLSLPFDFINKP
FT                   QNNYSNKLNGYSTVHNNDQALLQILRILENETKIFFSRKRAPFVFYVEMGNLDEDIELI
FT                   SYNTNKDRETGMKDLYVFDAIVQDLLNYELLTPEQVEAIKNPLECIRYALDMLPQESLD
FT                   RYNILSEEKMNTDSSDNYSAKTQTSDDSFAVSRHSSYSNTDENMVTELDSLSETESKSN
FT                   ENTEYSRVDPDSQENSPNIVNSPQVGDTNTPNQNVEESSPTSNRDVSPVDKEESDPTKE
FT                   TPRDGETKTLNVKNLSPQEVRKIVFAETFDQKKEKIRRKSPYGNLKSWDLHAFVIKGND
FT                   DLRQEKMANQVLESFRRIFEKANLPLWLRPIEILVTGSNSGIMEFLHDTYSVDVIKRKF
FT                   NAESLAPVFEKLFYSNIYEARKNFIESHAAYSIVSYLLQVKDRHNGNILLDPYGHVIHI
FT                   DYGFCLSNFPGKLISFETSPFKLTKEYLDVIEGGNPDNFVYFKTLITKGLLEVRKHVDE
FT                   VVLLVEMMTTANKMPCFLAGTSYTIEMFKERFMLNQSEEACIRKITEIIDASVNSFSTV
FT                   QYDTYQRLTNGIL"
FT   CDS_pept        join(865881..866013,866045..866126,866164..866199,
FT                   866234..866287,866317..866383,866415..866495)
FT                   /locus_tag="TA05830"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.62 - score = 16.00"
FT                   /db_xref="EnsemblGenomes-Gn:TA05830"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73281"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI08"
FT                   /protein_id="CAI73281.1"
FT                   /translation="MDFPSNSFSLSHRNFSDSNNSQEYFIRNQNFIRNNLSDSFLSRNK
FT                   SPFSIHHKTFNTDPVDSLNFGRMVPTRTDGFRSMHGLIEMNNLMHDFLNKSLNMNGCLS
FT                   MEEELSLIENINNQQKALMNVSENLSFLELLDETNNSFKEKMKIYK"
FT   CDS_pept        complement(join(866563..866695,866727..866768,
FT                   866798..866917,866951..867099,867133..867345,
FT                   867375..867437,867483..867593,867623..867682,
FT                   867711..867782,867812..868356,868389..868653))
FT                   /locus_tag="TA05825"
FT                   /product="asparaginyl-tRNA synthetase
FT                   (chloroplast/mitochondrial precursor), putative"
FT                   /note="Tap349e08.q2ks7.cand.65 - score = 53.35"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA05825 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.802, signal anchor
FT                   probability 0.002) with cleavage site probability 0.480
FT                   between residues 26 and 27"
FT                   /db_xref="EnsemblGenomes-Gn:TA05825"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73282"
FT                   /db_xref="GOA:Q4UI07"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI07"
FT                   /protein_id="CAI73282.1"
FT                   /translation="MFILIIFCKIFVNLLVFIQPFSSASGFRPKFHNNLNTSFILCNFR
FT                   ENNSINDNFKQGVSHSFSIQDHASFQCNNVSELDSVDNDCTSTDCKTVNPLEKNSVTIS
FT                   ELIQCLNMCKESNTPIGVPFTVNTRGYVQEIRRINSQNLYFIDINDGSTLANLQIVVNK
FT                   ANNFKELELLKNGDHIYAAGTIDKRRGVPSERSLSDFDLYINHDNPEHKLKIHKYSENE
FT                   LENPVIPNIEYSDEYLRKYTHFRFRNKQFRSIIGIRSAIKSYIHEFFQSKNFTEVDTPC
FT                   LTHMNCENLVPLTLKTASDGTNLDTLGSENTEKNIPVNLSSTGQMELEFACYGLGKVWK
FT                   IGPSFRAERSDTIRHANEFWMIEAELPDASLKGMINLIQEMVRGCATYILQKHGDYVNY
FT                   LNNFNDKYKDFLVHLVFLRYLIDFQSKANIKLITYDQAVNILNETDSGSDKQDKVFEWG
FT                   KRLSEPQERRLLKHFDKDIIAITNFPESITPFYMKRTDGSVNSRITVENFDILAPFGYE
FT                   IAGGSIREHEYEVLKRKMDERKVSGEEYEKYINLRKNIYLPHGGFGVGFDRLVMLMTMK
FT                   ENIKDVTPFPVTKV"
FT   misc_feature    complement(868576..868653)
FT                   /note="Signal peptide predicted for TA05825 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.802, signal anchor
FT                   probability 0.002) with cleavage site probability 0.480
FT                   between residues 26 and 27"
FT   CDS_pept        complement(868951..870183)
FT                   /locus_tag="TA05820"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.64 - score = 15.14"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA05820 by TMHMM2.0 at aa 13-35, 45-67, 100-122, 132-151,
FT                   206-223, 228-247, 289-311, 361-383 and 390-409"
FT                   /note="Signal anchor predicted for TA05820 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.016, signal anchor
FT                   probability 0.976) with cleavage site probability 0.008
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA05820"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73283"
FT                   /db_xref="GOA:Q4UI06"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI06"
FT                   /protein_id="CAI73283.1"
FT                   /translation="MEFDCNSLYSFIIVCAVSSLSVAIGIGGGILYVPILGVLYHDVAL
FT                   GVYLSKISILITSFLGTTYHICNDVYILVKQRRINKPDEESHSDLTLKTPETPRVYFVL
FT                   ALSLLPSCIVGTNLGTRLHFYAKKYLKILLTSVVLLSILLTFIKLYLMYKSSKTKLNLK
FT                   LESKNFENIVVESSNGEGVNKGIISTILGAYDKSSLHTVKMRSISFALIAFCIILYYIC
FT                   VRFEDSFTPIPILVLLFFIGLYFSIRLRMSFRLFKENDETNEGDGDEEMKEKEKKETKF
FT                   SKFLEQGIHIIFLNTLVAIFSGLMSGTIGIGSGIFLIPLLQYLNVPPISCSATSNLLTM
FT                   SMSIATLSRFSFKIDLPGKMFIPPICGSLLGTSLSLFIIRSLIKDKITGLFINLTLLTY
FT                   CILSIIVSWAI"
FT   misc_feature    complement(join(868957..869016,869035..869103,
FT                   869251..869319,869443..869502,869515..869568,
FT                   869731..869790,869818..869886,869983..870051,
FT                   870079..870147))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA05820 by TMHMM2.0 at aa 13-35, 45-67, 100-122, 132-151,
FT                   206-223, 228-247, 289-311, 361-383 and 390-409"
FT   misc_feature    complement(870115..870183)
FT                   /note="Signal anchor predicted for TA05820 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.016, signal anchor
FT                   probability 0.976) with cleavage site probability 0.008
FT                   between residues 23 and 24"
FT   CDS_pept        complement(join(870415..870556,870587..870652,
FT                   870698..870819,870857..871171))
FT                   /locus_tag="TA05810"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.63 - score = 18.47"
FT                   /db_xref="EnsemblGenomes-Gn:TA05810"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73284"
FT                   /db_xref="InterPro:IPR042530"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI05"
FT                   /protein_id="CAI73284.1"
FT                   /translation="MGVVVVFLILTKEVFKSNGLEHIKTYISGIMERFKVSNQNIKFVL
FT                   VKHGTKDLFMTDQGNVQRSSNSTYKNNDHQSLISIINELETYLLIYHNVDTIETDDDGD
FT                   LANIVAVSAKSLRTSYSRRNLTKFKLKNNQIAKDEPEMMKKIWLSQLLQVPNIGKDEAI
FT                   ELIKKYAKPYEVIESLKISEDNFYNVLKNIEIPGKKRKTLGKITSKRFLTF"
FT   CDS_pept        join(871951..871999,872036..872074,872106..872195,
FT                   872230..872346,872378..872561,872591..872837,
FT                   872871..873215,873266..873358,873400..873479,
FT                   873529..873629,873660..873872,873904..874187)
FT                   /locus_tag="TA05805"
FT                   /product="cyclophilin peptidyl-prolyl cis-trans isomerase
FT                   protein, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="Tap349e08.q2ks7.C.cand.64 - score = 72.48"
FT                   /db_xref="EnsemblGenomes-Gn:TA05805"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73285"
FT                   /db_xref="GOA:Q4UI04"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI04"
FT                   /protein_id="CAI73285.1"
FT                   /translation="MTNPEEDPESSSDDEYGPVPIPEPKKKKKVEFDDSFYLNHFPFAN
FT                   FYSRSYTHRTFVKHVVASQTTRYIATGSDDGCIKFWYYDTDGVQFVKHLTAHTSSIIQM
FT                   RSSLDGLHLGCISYDKTYKHIDFQSFDLVNIIKLEFVPISLEFITSETSPHPVVALLNS
FT                   KQEVHIFKPTLQSTEVQKFEIGTKSPHIMLYNPKAGVCLMANSLGDVDLYEVETFKFPK
FT                   YKEEFKVRMKSDTDLYEIRKYNTHVVSMCLSPNFNLVAMYCHDGMIRIFRFSTMKLFRV
FT                   YDETVTMYSVAQTDPNQSILHFDPSDFLRRQANENEIKKTGKDEGEYMNLLFDSSSNYL
FT                   IYPCMLGVKIVNIVTNKLVRVIGKSEPSLRYMKISLLQHVLDKVCSKSKRYKVSIDSNE
FT                   DVLPPVLITTAFQKSKIYIFKDKDPDDEEMETRDVYSDQPTEAEKGEKTVVDKGGKLAK
FT                   EAIIHTNKGDIQVKLFLDECKKTVENFTVHALNGYYNGCTFHRVIKNFMIQGGDPTGDG
FT                   TGGESIWGSEFEDEIHPSLKHDRPFTLSMANSGPNTNGSQFFITTVPCPWLDGKHTVFG
FT                   RVTSGMEIVQSIEKVGINKITFNFIHKDQPHTNIGSY"
FT   CDS_pept        join(875077..875971,876049..876584)
FT                   /locus_tag="TA05800"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.65 - score = 43.61"
FT                   /db_xref="EnsemblGenomes-Gn:TA05800"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73286"
FT                   /db_xref="GOA:Q4UI03"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI03"
FT                   /protein_id="CAI73286.1"
FT                   /translation="MPILSEEDLERFRTKVCTLASSMKCDFGVERCNYSHNLYWARRCP
FT                   FYLRDSSILRYIPQCCPDVELGEGTTVIRNSCPRGNNCSFAHSYEEIHYHPLVYKTEVC
FT                   KDYRLGKCKTYYCHLVHGLAEYRVPKQYVLPKKVGLDIPEFAHVRMVDNIKSITSGNVS
FT                   VGCFQKDKGNKSAEKSLSKLESKGKNKGIKEPNVDLSDSGNIKSWSSIKWKNKSTDKDN
FT                   IVANNSDLVNGSISKDGNGKRDGKNSITNNFGNTNEGVEGETFKTIGSIENGNQNSEND
FT                   PIYEWYKLISMPKVDYTDDNMSERNCSILKLYDKHIGNNLNEFNNLTIYNNGLNPYNDN
FT                   YDNDLNAYGQENNINYENDKRNESLVTRNVNMWNDSNIARIIEANDNAIGTVSSIMGDS
FT                   YQSYEDVFQSSDLASSINSINQDDIYSNVFNQCEVIKKNCRESIQNKTKWSNVVDECTK
FT                   LLNLVIDANQPPQEQKEE"
FT   CDS_pept        join(876925..876997,877053..877123,877161..877229,
FT                   877260..878105)
FT                   /locus_tag="TA05795"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.66 - score = 42.92"
FT                   /db_xref="EnsemblGenomes-Gn:TA05795"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73287"
FT                   /db_xref="GOA:Q4UI02"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039971"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI02"
FT                   /protein_id="CAI73287.1"
FT                   /translation="MFNKRNLSALKNRKPEELDDNEESELKLNPSGNVKLFKKRTISKI
FT                   CVTGNQTNPNEKKDLIPSDSNIVDLLSSDEPINRATSTYEIDTDRSMDHRSILERNLEI
FT                   GNKILSGELEPNIYRGKGAYKPVINVKKDSIAASKYTGLYGPVRASATNVRTTLRIDYQ
FT                   PDICKDYKETGYCGFGDTCKFLHDRSDYKSGWQLEKEWEEEQAKKRLKMQKKLDKWHKK
FT                   MQSNSKGGDNDEEEEESEDLEDSDSSCSDSDDSESSESCCEEVDEKVKKLFKFKAKGLK
FT                   IPFCCLSCKKLWKTDMNPVVTSCGHYFCERCIIEAYSTDMKCPKCKVAQDGIMNKASAV
FT                   EKLLESMNTIET"
FT   CDS_pept        join(879701..879849,879884..880385,880416..880541,
FT                   880575..880802)
FT                   /locus_tag="TA05790"
FT                   /product="ADP-ribosylation factor GTPase-activating
FT                   protein, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.67 - score = 38.92"
FT                   /db_xref="EnsemblGenomes-Gn:TA05790"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73288"
FT                   /db_xref="GOA:Q4UI01"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI01"
FT                   /protein_id="CAI73288.1"
FT                   /translation="MAEGKEIIHLHELLAIESNNVCFDCGSVGPTWASLSHGSFICLTC
FT                   SGIHRGFGLQISFVKSITMDSWTSRQLLYMKNGGNANLKAFFDEYKIMDLPITSRYKTE
FT                   GAAYYRRRLRAIVDGTPVPPVLDPVIALQPESQMSDYYTNTSTESESNTSESKKHYSKK
FT                   KLPYSSNLIHSDVFNSLGTTLGSFVQTACANAERAVSDIQSSQVFDNAKGVFETGKVWF
FT                   KDKSKKLASQVQDPEWWEDKEAKAKVGAQKFANQLSHAASNASEWFQRIVTGIPPSPNS
FT                   PHAAFDDHNYGASSGPHNNPVGVSGGASLWNSQPRDFDESDPLMSHFKKPSLK"
FT   CDS_pept        join(881234..881533,881564..881699,881729..883707,
FT                   883751..886637,886692..886779,886809..887155,
FT                   887221..887483)
FT                   /locus_tag="TA05785"
FT                   /product="DNA-directed RNA polymerase I, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.68 - score = 154.07"
FT                   /db_xref="EnsemblGenomes-Gn:TA05785"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73289"
FT                   /db_xref="GOA:Q4UI00"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UI00"
FT                   /protein_id="CAI73289.1"
FT                   /translation="MKNYDSTVSTEVNGLSLLFLSSAEIKSLSCSEIKNAGRIDHESAG
FT                   KSCIYDPSMGSTEIYRLCSTCNEMTNCDGHLGHISFSIPLFHPMMINTLCKLLKTVCFY
FT                   CGRFKFKSNTWFDFLLLFETAQRGDLEDLIILDQILTLESDDHEIKDVNPAQQLRDKII
FT                   TEITERFNRKRNLLMTEIKEKKSEFLDYFTEMDHDSNMWNEIRNRFFNKTSQKFFCNEC
FT                   SQKGKIMIKPSSDLSYIEVSWPQNHDRPNLIKSFKRFIEEDYGGDVNYNTSETVNSKNF
FT                   EEEKMIELTNKVNEDIISCSLKSLNQTGKSVNTVHLQSFHLYPYLDHLFRVYSRLLNHV
FT                   FPQSIVLGHKIFFMDCMGVSANRFRPPLVTTDKQIVLHSRSTALLDIVMANEFVKLFLQ
FT                   FKYDEANYNDNGSDVSEQLNGGNQEVKSKTLKLSLVEYLSKMNYKIDEKQLEQFESYLK
FT                   DYKDLNEAIRDQILNLQKKLSSYMDNGNPRPGVKQTMEHKTGTVRQNMLGKRVNYSART
FT                   VIAPDCFIDTNQMGMPLKFALELTVPEYVTKYNVNFLRKLVINGPKVYPGAKMLRDTNG
FT                   KIYNLSALSYNERVAKAKLLLVGLSEGNATKIVYRHILDGDVVLMNRQPTLHKPGIMAH
FT                   FVKILTNQKIFRLNYVNCSTYNADFDGDEMNLHLPQDYLSQSEAQLIANADCQFVVPKN
FT                   GQPIRGLIQDHCQGGALLTSRDTFFTKSEFFNLVYLSFNSFVSTNSLMYLSNQDLHFVE
FT                   EDIKLDVQLHQLVKRLKVLSDPFSRKITNRNIKIYLDQPAILYPKQLYTGKQVITCVLK
FT                   TLIDNISVGLGDTDNNKYNGINLQSKSQTPGDAWGGSYDGDKEESTIIIRNSELLQGVL
FT                   DKSQFGASSYGLTHLIYELLGPRVCGMLLNSFSYLFTSFLQMRGATCSPKDFFLTETAE
FT                   SERNKILKRIKYAGIHLQELFISLSRNTNNIPPNTNGHDNGNYNENKKLLNELVSDFKL
FT                   FYDNVKNYMSEMKFEDLDDLGSFRSFVKALLNVFSSISNSNNRNVNEAIRKYMCKLIER
FT                   CSKVTRLRNLLLQYLLRLPPDSNLKLVQLKFPNWLAQYSDLDKTEPKQNPIENFMENYA
FT                   ELSNSLNKNGLKNGNNGASYKLGDSYTTCMKFYKMVCNSPRENHLLSTFDRFFQNNIVS
FT                   VSSSINELVDSTVVKFPKNGFATMVSTGAKGSKVNFAMISCALSQQTLEGKRVPVMPSV
FT                   RTLPCFAFGDFGSRAGGFISDRFLTGLRPQEYFFHCMSGREGLVDTCVKTAKSGYLQRC
FT                   VLKAMEDIIVCYDSTVRDSNSNIIQFKYGEDGIDVCKSSYLSQLHDLQVNEIYQWSNDP
FT                   KNLKSSDSDSMDLDEQEGDLDNGSRFYLRNSKTGVYNKNRETDSNFKAYFERCKCDPGE
FT                   AVGCIAGQSIGEPATQMTLNTFHLAGHGAANVTLGIPRLVEILQNTSHCSTPYFSVPIL
FT                   GKNEDEIAENAENAINALRKIYLSDIVQSVGMETNVYVNKNSEKEWEYSATIQFDDFNL
FT                   FRKVIGHFDTSDIIKVCSHSLIKSFMKRVLGQMIVTMDINVPFELSDKTDQLEEFWNMF
FT                   VMEKQIVKRDKLSTRIRKMILSSGSSSDIPKGVGGQDITDTVFPSLEDSVCDSHGGDED
FT                   EDSEGGTESSVEESEVDEEVGEEEDEGHGEEELQEEEQEKEDDLDEEEEGEEEFEVLDA
FT                   SQSSSATVEDIPMDLDKETGDPNLMNLDEQDDTLSGVDDFNSPTLSPTRMRNESSGIKE
FT                   GKQKIFTINRKVFHFAKSLEYSEETSTMVLKFGWPVIKCPYFLDLLPLLKQEISQLVLR
FT                   DSYGIRQSRIVFQTVDDKEEYTLHCDGTNLKRLFMLRENIVDFNRIKMNDVATVFKYYG
FT                   IEAARSCIVSELQKVFSVYGIKVDYRHLTLIADFMTQKGDVRTFTRYGMARHTSPLLQM
FT                   SFESTMKFLMDASERGAYDNLKSPAGGLMTGKPVHVGSSLCRLMHVVDLKNTNSKKLVQ
FT                   FEDQYQF"
FT   CDS_pept        complement(887562..889784)
FT                   /locus_tag="TA05780"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.62 - score = 41.69"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA05780 by TMHMM2.0 at aa 375-397, 404-426, 441-458,
FT                   467-489, 509-531, 544-566, 595-617, 638-660 and 670-692"
FT                   /db_xref="EnsemblGenomes-Gn:TA05780"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73290"
FT                   /db_xref="GOA:Q4UHZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ9"
FT                   /protein_id="CAI73290.1"
FT                   /translation="MSEGADPNPTKNYSQSDGFGVGTTQIAAYMFAGLAMMLNIRLSYS
FT                   AAPFALLRFKLPENLFSVFVRTTSSALELWCIPSMLIGNIMEQVYNKTQNTTGPHATSL
FT                   KEAAGTSSGDEGKLWKLAKELNENANSLEGAAPEGTTDDEALKQKAGANDQVPGTLRYL
FT                   AKTLYNAAKALATAVTEASGTDNQASENLANAIGDKDEAPSGGKLTNLRQALAQLASRG
FT                   QASDVTSQYSTVEGRFQAVQRQDTSGQYTGAAKAKYQEVKAAWNAFDKVYKANLKNFAQ
FT                   DLKNAVGEESGPGLQGALKNLNSDGSTDNALEVIKKFNNVADKYNKVKELGDTYKAIGA
FT                   TQSPYNNVETKFTDLQKKYSEAIYKYKFYFLTIPSMITNWLNFLTFVILFIIYVTGGDQ
FT                   GHVTGYYWIMAISGFVFGINMVLVYAVDYRYLPFYMAGENSFPMVTSLILYFATSIFGN
FT                   RRKYNSDYLVVVIDVSIAIVIAFVASVLWTWAFYNYRTTMYDDQTPNPWPLISPVAMVI
FT                   VGMGLVYSIYPGIAPGMIVPFYLIDKIEMVLLVATAFPPVIIAILRKYAENWSPQTKFV
FT                   FPGFGGWTKYTDGSTTVHAYIWHLFDILIPLKISLAIIFIYSLHYRDSSISRAIVNQPK
FT                   MSTALTITFYMCHEILLALGFPGMVGNGGAGGAVLLPTQYAGALLMVFLAFYSIGYITE
FT                   YKKHDPSRWPTDGMTKLNALCYWLKMASKITNKNFKQLFTTDLNIY"
FT   misc_feature    complement(join(887709..887777,887805..887873,
FT                   887934..888002,888087..888155,888192..888260,
FT                   888318..888386,888411..888464,888507..888575,
FT                   888594..888662))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA05780 by TMHMM2.0 at aa 375-397, 404-426, 441-458,
FT                   467-489, 509-531, 544-566, 595-617, 638-660 and 670-692"
FT   CDS_pept        complement(889907..891889)
FT                   /locus_tag="TA05775"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.61 - score = 24.15"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA05775 by TMHMM2.0 at aa 20-42, 153-175, 185-207, 214-236,
FT                   251-273, 411-433, 448-467, 523-545, 565-587, 594-613 and
FT                   633-652"
FT                   /note="Signal anchor predicted for TA05775 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.040, signal anchor
FT                   probability 0.680) with cleavage site probability 0.015
FT                   between residues 32 and 33"
FT                   /db_xref="EnsemblGenomes-Gn:TA05775"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73291"
FT                   /db_xref="GOA:Q4UHZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ8"
FT                   /protein_id="CAI73291.1"
FT                   /translation="MSTCPHCTNGQAGVGQDQCTLLIVAYVLAGLAMMLNIRLSYSSAP
FT                   YALIRFKLPENLFSVFVRRMASALELWCLPSMLLGNIMDYGLKGYYYGRYTQDFGNNGN
FT                   LKPNEQGTSTIKITIKPKSCTNKLEITFGKDILPNINDTFTPRREKFIWIIIPSIISQW
FT                   LNFLTYVILLIVYVTGGDHGHLTLFYFVIAISGVVFGINMVLVYAVDWNYIPVYIVGEN
FT                   SFPIVTSFMHYITTLIFGNRRKWNSDFLIVYIDIGVAIIISLVTAVVWTAAYGYYRDTK
FT                   KQNATYHNAPEVVVDATYPEGTTPVTEDINPNDINSITVNKDGKPTIYNKETSGTTGPI
FT                   AIKKDRDPTTTTYTNRGDTAPANGAKPNSIILSYKQGDTVGTITISPGTATVHYGHIFT
FT                   ETFDMSSVRWEIISPTLMVIVGMGLVYSIYPGIAPGMIVPFYLIDKIEMVLLIATFFPP
FT                   VIVAILQRVPETKNYSPKATYVFHGVNNSNNGMGGWRKYASKHEGEPKGSASECDTSDT
FT                   KDVENWFWHIFDILIVIKISLAIIFIYSLHYRNSNLSRSIVNQPKMSTALSIVFYMCHE
FT                   FLLALGFPGIIGNNGSTYVVLPAQYVGALFMIFLAFYSEGYIIEYKSYDPAHWPTDGMW
FT                   YLSAIIFYHIICLLFLPNDFYYDKV"
FT   misc_feature    complement(join(889934..889993,890051..890110,
FT                   890129..890197,890255..890323,890489..890548,
FT                   890591..890659,891071..891139,891182..891250,
FT                   891269..891337,891365..891433,891764..891832))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA05775 by TMHMM2.0 at aa 20-42, 153-175, 185-207, 214-236,
FT                   251-273, 411-433, 448-467, 523-545, 565-587, 594-613 and
FT                   633-652"
FT   misc_feature    complement(891794..891889)
FT                   /note="Signal anchor predicted for TA05775 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.040, signal anchor
FT                   probability 0.680) with cleavage site probability 0.015
FT                   between residues 32 and 33"
FT   CDS_pept        complement(892105..894243)
FT                   /locus_tag="TA05770"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.60 - score = 31.38"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA05770 by TMHMM2.0 at aa 10-28, 83-105, 115-137, 144-166,
FT                   181-203, 278-300, 595-617, 638-660 and 665-687"
FT                   /db_xref="EnsemblGenomes-Gn:TA05770"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73292"
FT                   /db_xref="GOA:Q4UHZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ7"
FT                   /protein_id="CAI73292.1"
FT                   /translation="MEEDKTLKTAAFIFAGFSMMLNIRLCYSSAPYALIRFKLPEDLFS
FT                   IFVRRMSSSLELWCLPSIVIGNIMDQLMKRVGVDKKKIITWPSIACMWIDFLTYVILLI
FT                   VYLMGGEQGHLTAHYWIIAFSGFNFGIEMVLVYAQDDDGTITWYMVGENSFPLFTSLVH
FT                   YFTTLMFGNRRKWNSDYIVVFVDIIAAIMISFTAALLWTIKFYGADSQKCTRLTLDAKT
FT                   SGNELSYCSGYTSCSNYDNAAGGHKHKPGLPTHTHHGANSGCEYDINRWHNFSPVLMVL
FT                   VGMGLVYMIYPAIAPGMIVPFYLVDKIDMILLIATAVPPVIVAILKSKYYGPFVFLGNW
FT                   GGSHNAFGTVLSPAVSKATLNLRYENSHTLTLKNSGGNAVQEAKVNVRNQKDTITQIKT
FT                   QSQAIKINLTLKLAEVTLTQTLPGGTRNKLKATGTITTTKEVTKGSLHTDHTLNFTSID
FT                   LNQRLPAGPAGTVIIGHGTIDHKELNLISSAAGAGEDGKPTKLTLKLSPGTTSDANINE
FT                   QLTLNNTDKNTLTLTGGITGTLKYTSDNSGTLTASINSVTYNLNDFHYTSATDHSGTHP
FT                   NYCCIGGNLATWQDDSSGMPAWHLCDVFVILMIILAIIFVYSLHYRDSAISRSIINQPK
FT                   MSTALSIIFYMCHEISLAVGFPGIASDDNIILPIQLVGAFLMVLLAPYSEGYLIEYKRH
FT                   DPADWPTEGMTKWNAFCY"
FT   misc_feature    complement(join(892183..892251,892264..892332,
FT                   892393..892461,893344..893412,893635..893703,
FT                   893746..893814,893833..893901,893929..893997,
FT                   894160..894216))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA05770 by TMHMM2.0 at aa 10-28, 83-105, 115-137, 144-166,
FT                   181-203, 278-300, 595-617, 638-660 and 665-687"
FT   CDS_pept        complement(894500..897832)
FT                   /locus_tag="TA05765"
FT                   /product="ubiquitination-mediated degradation component,
FT                   putative"
FT                   /note="Tap349e08.q2ks7.cand.59 - score = 71.88"
FT                   /db_xref="EnsemblGenomes-Gn:TA05765"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73293"
FT                   /db_xref="GOA:Q4UHZ6"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ6"
FT                   /protein_id="CAI73293.1"
FT                   /translation="MTGNVDKTNVFHKFIQNVLNVTIKRSERQQNLVNQGEQVKVYIGH
FT                   LYGRISGITDTENKYLNVEDLDDVVRSIVYLCILHNKNVLVDLNETYVRTANEISKINK
FT                   NGLTNQNIGCIDENVNSINSLKTELLSVLEKAQSFLISNASILMSFPEYFTITDIISEN
FT                   EIKKAYLNVTDEKILLEMFLDYGTSAHNSTFLQKMVNEMWETDENVGKEVFVKIFGLLR
FT                   NRLCLKTLKSNTSNEAKLLTELFFHKPIVELFLDNVVSVELESALIVSSGVRREISSFF
FT                   GRFLGITTLDEEQYEVAKLVGIKQAYEGAKVDRTSDFYGKKDLNHLKSVFNSKRFESEH
FT                   SMNNFVQLVKVILKVDSVVRNRFLSVMGMFISFNNNRKKMYSLSHIDAPPVSFDEFYFR
FT                   RLILLPDNSFGFCVNFTWLLLLLSQGITIPKSDEIDPAFCQAVNLIKEELEGLENETTE
FT                   DSESLADKVHKLGEMEKEMNNTLGFLATSSCMGDENQVKSSLKLLKSKAEDVYNSKFIT
FT                   QIFWLTIKSINMMFLPSLQENLKILTQTLNYANSNMNLGINDDKLANYISYVYVWRTAI
FT                   QHPSFLKALWHFVNISLRLFLRCFLLYDKEGNVKSDYKILYDSSSNKFGPMVEKYCDKV
FT                   LNTDVGVSSPQFTVLPVDLIETILDLIKNMTILRHYDHYIKPNDSDPLSFMDFELVITV
FT                   CIFIMKSPNDVIKNIHIKCDMACSTILYLCKFSNDSMSRFESINVCKLHLMYSLVRTFI
FT                   SSQKSNYNTRISSRLNIIQSFTQFFVLESYRKNFVTCIISKKDLFIQFMHLLLNDTNFL
FT                   IEEVVSYLTEIRRREIAGISLDETTSEDHQSTENNENSDDQYVQDGAIDANQLRSMAGP
FT                   ELKGRTRSFVEYGFEICSLLNILCSEFPSDITSSSVLLPQVVTCLGCCLESLAGPKCLQ
FT                   LKVKNMDEYGFKPKEWLSKIMQCYISLYEHNDSDEVTPFVKAVVNDERYYKPEIFNRCI
FT                   RFSTREMFLNYRNIKSFNNLSNKLLEYAKQTTMLYDNAVNDEIPENYLDPIMMDIMEDP
FT                   VLLPTSGKIMDRKNIERHLMSESTDPFTRAPLERDQLIEQPELREEISSFLKSLIKSNS
FT                   TST"
FT   CDS_pept        complement(898094..901342)
FT                   /locus_tag="TA05755"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.58 - score = 27.15"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA05755 by TMHMM2.0 at aa 9-28, 43-65, 72-91, 96-118,
FT                   125-147, 162-181, 249-271, 281-300, 307-329, 339-361 and
FT                   768-790"
FT                   /db_xref="EnsemblGenomes-Gn:TA05755"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73294"
FT                   /db_xref="GOA:Q4UHZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ5"
FT                   /protein_id="CAI73294.1"
FT                   /translation="MSSFRRDQIPVVVSGFMNFVWAFSSFLSVDMVKLYSYYFMHQVNF
FT                   PTLYYSVFAFSFICFTFLRFNRVFTTVVIIWFNFLVHLLLVFLIFFPLKNIICYRLLFA
FT                   FWSHLYALNLISTLYLASYNIGGINGLVMGAASSYFFGYLLLHGVERPSDFSIASRKAT
FT                   CNWFICIRCIFAIIAFIFYRDYLEYYFYFEYTDSVNNITMENLLKWFDGKCVDLMTAVR
FT                   IDDLMPTHIDLNCIHELIKDSKSYQHLFLIYMGFCSTSFFSPFFSPTPIVLSIYVRDEI
FT                   CFIDYLAGFLGVIIAVMLHPHLNEQFNVVFLIHYILSGFLFFGFNTYYHDLYNRKIVLY
FT                   SLSFFSSIIGTFVLVFSFINFLCQNLVFKCEKEKEKEKEDCQPCCLNDTGTCLCNKKNT
FT                   NEPCVKPPHATCINIWLPFNNHNTFRDWTHSDCKFCLSQNYKNTKFKCTCCTGGKGNCC
FT                   VCCCPECKNSINTCSCSQPCSESCGTECCCKEGKVCHYLLRNCVASCCPYCDYCLLFEC
FT                   VKLECVCPCSHQNHKPRIQNQNKDNGGNNNDSCLTKIKLKINNGDKHFYLCSYNQALKS
FT                   EKLKELFCCKNTSSSSENCCCIKCCCEKEKICGKHFDIADYKTSSCCHYQLKIWISLRE
FT                   LNSTFHIGQQPFKNKYDQINSLVFTNQKCRECCEKCGCDSGKCKAVDVLKINEKDDNCE
FT                   YGGYITSECKGDSSNCKCCCCCCVSTSGTSNCQCCCGCCSSTSGCSKKKCCAMKILPTN
FT                   LPYHFREMDIKRSEIISLVCFSVVIFCFVKFIASIMISCKMKQYYLPINFKVNDFTEVQ
FT                   KLTLAKYDFKDYKSDSQYARRAFPDFEGDETYLVKYALDVEIQNFQQKTILIKDFMDEL
FT                   NTLRFDNWCEDMIKNRRKIIPGEYSELRFYAHFNSYLDFALKYLVFRDADLIYAYFKRY
FT                   SPTWEVEWNDFEKRFLRNLKIYTDYSLSLNSVGYFDTNTDLQKIIDNRQISILKQLNAR
FT                   NEELTGYLTMNRHLTDELKKSTSEEKLPRHIDLWSFRLSLIREWSGDRSILLNWTAFTY
FT                   SMEMILLWNDLFRLFYIQSFVSSYGSNGQRVNEL"
FT   misc_feature    complement(join(898973..899041,900260..900328,
FT                   900356..900424,900443..900502,900530..900598,
FT                   900800..900859,900902..900970,900989..901057,
FT                   901070..901129,901148..901216,901259..901318))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA05755 by TMHMM2.0 at aa 9-28, 43-65, 72-91, 96-118,
FT                   125-147, 162-181, 249-271, 281-300, 307-329, 339-361 and
FT                   768-790"
FT   CDS_pept        join(901808..901948,901984..902115)
FT                   /locus_tag="TA05750"
FT                   /product="(U6) snRNA-associated Sm-like protein, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.69 - score = 10.97"
FT                   /note="Signal peptide predicted for TA05750 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.605, signal anchor
FT                   probability 0.000) with cleavage site probability 0.591
FT                   between residues 21 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:TA05750"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73295"
FT                   /db_xref="GOA:Q4UHZ4"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR033871"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ4"
FT                   /protein_id="CAI73295.1"
FT                   /translation="MSTIEASAVYLPLALIDKCLGSKIWIIMKNDKEITGTLRGFDDYM
FT                   NMVLEDVVDYSFSADGVKTTELNDALVNGNNVAMLVPGGKPANLK"
FT   misc_feature    901808..901870
FT                   /note="Signal peptide predicted for TA05750 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.605, signal anchor
FT                   probability 0.000) with cleavage site probability 0.591
FT                   between residues 21 and 22"
FT   CDS_pept        complement(join(902123..902215,902247..902452,
FT                   902483..902726,902761..902853,902883..903017,
FT                   903052..903324,903355..903466,903499..903563,
FT                   903597..903698,903734..903787,903817..903903,
FT                   903935..904023,904055..904151,904182..904444,
FT                   904476..904579,904611..904818,904856..904974,
FT                   905007..905045,905153..905190))
FT                   /locus_tag="TA05745"
FT                   /product="recombinational repair (RAD54 homologue) protein"
FT                   /note="Tap349e08.q2ks7.cand.57 - score = 94.86"
FT                   /db_xref="EnsemblGenomes-Gn:TA05745"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73296"
FT                   /db_xref="GOA:Q4UHZ3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ3"
FT                   /protein_id="CAI73296.1"
FT                   /translation="MRTLFPHEKRLRLTNGSEEDSNNGNGYYGSNICLIRAPLFNFLSV
FT                   EAGTPIILKPFKSPLEGHQPGVSEESQRKTLGCRIKSDTKSFLKDFRTGIYLEKPESLE
FT                   DLPPDNPLVLYTSDPEDEVQVEIKVDSILSRFLRDHQRQGVQFIFDCLMGLKGFNGRGC
FT                   ILADDMGLGKTLQSITVMWTLLNQGLDNKPGKTHNYTSSTAARKCAIICPASLVNNWES
FT                   EIKKWLRGKCPCTAVAESSKEKVISSFQGFKYDRTSKVIISSYETYRLHCSYLEGVNID
FT                   LLICDEAHRLKNDKTRTSQSISTSSAQMRLMLSGTPIQNDLNEFYSLVSLCNPDVLGDV
FT                   NNFRRNFANPILIGREPYATPAEQQKASERLAELSNITNQFVLRRTNALLAKVLPPKII
FT                   LNVFCNLTDVQKDIYKSFVNSKRWKNIMNQDRVESRALSAIQSLMKLCNHPYLIKRGGL
FT                   MSSPDVDSLLLDIENATKSSKYKCCRCDLSGKFLVLFRLLYQIRKNSNDRVVIISNYTQ
FT                   TLDLFERLCKECSYPFERLDGGTSIKKRHKLVTTFNDPNSNSFVFLLSSKAGGCGINLI
FT                   GANRLVLFDPDWNPANDKQALARVWRDGQTKVCYIYRFFSTGTIEEKIYQRQICKDGLS
FT                   SMLVTDGINELKDSLSGEYLKNLFEYKEEVLSDTHDLIECKRCSHEDGMFLKQKDMLGT
FT                   VMHVPQLKEFLEDDLNTWAHHADLTTIPDQYLVNAATKNEPQIQYEDMRLSDDFVPVSF
FT                   VMACRIEFQDTEESVDVENMSVKKIAKSDTVSTTFDSDNEDYVPTQETIESDE"
FT   CDS_pept        complement(join(905445..905587,905625..905753,
FT                   905787..905954,905989..906068,906110..906159))
FT                   /locus_tag="TA05740"
FT                   /product="ubiquitin-conjugating enzyme, putative"
FT                   /note="Tap349e08.q2ks7.cand.56 - score = 20.82"
FT                   /db_xref="EnsemblGenomes-Gn:TA05740"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73297"
FT                   /db_xref="GOA:Q4UHZ2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ2"
FT                   /protein_id="CAI73297.1"
FT                   /translation="MTSKGSHIRKQCDFTKLLMAGYDLELVNGSTQEFNVTFHGPNGTV
FT                   YEDGVWQVHVILPDDYPFASPSIGFMNKMLHPNVDESSGSVCLDVINETWTPIYSLVNV
FT                   FDVFLPQLLTYPNPSDPLNNEAAALMMLDKTTYEEKVREHVRIHASKEMWEKRRGFTNQ
FT                   ESLSVTNDGEPSDIESTVDEAELEDF"
FT   CDS_pept        complement(join(906948..907028,907066..907098,
FT                   907131..907234,907264..907363,907397..907422,
FT                   907455..907478,907510..907646,907678..907741,
FT                   907772..907949,907980..908534))
FT                   /locus_tag="TA05735"
FT                   /product="aspartyl protease, putative"
FT                   /EC_number="3.4.23.-"
FT                   /note="Tap349e08.q2ks7.cand.55 - score = 36.33"
FT                   /note="Signal peptide predicted for TA05735 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.799, signal anchor
FT                   probability 0.000) with cleavage site probability 0.444
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA05735"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73298"
FT                   /db_xref="GOA:Q4UHZ1"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR034164"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ1"
FT                   /protein_id="CAI73298.1"
FT                   /translation="MLLYYIIVFFVLSRTTIINCIPASDSLKQPLYEIQLHKPEGSDEH
FT                   YYKILNAERYSQFSTKFYDLKNVLSSTISLKADYTSRLWATYYGNIILGSNNNERNSFK
FT                   VLFDTGSSEFWVPYEMCLSQQCLNRKRYHKGSEWIAKHDKHGNYVPLEIKYLSGQIDAI
FT                   DGTATVNLMNGITLKDVNVGLATNIDIPFLDNAHWDGIVGLGFKTKDMESRGSRPLFES
FT                   IMYNKSLYPNFRNQVAYYVTKNGGNISFGGINPNYKRSLDDEFLWAPVVKDSIYWTLKL
FT                   KNIKIKNNIDKKVNSLVKQYEFTSLMSKIDDVKVIMDTGSFLIYAPQSMGPLLSRLQVS
FT                   SCKEMNDKPSLIFVLEGNKGSDVNLELRPEDYTIMYEGSQGEKHCSLGIVPDNQQEELG
FT                   FSAWTFGELFMRAYYTVYDYESREVGFAPSKKSD"
FT   misc_feature    complement(908475..908534)
FT                   /note="Signal peptide predicted for TA05735 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.799, signal anchor
FT                   probability 0.000) with cleavage site probability 0.444
FT                   between residues 20 and 21"
FT   CDS_pept        join(908892..909223,909256..909367,909396..909544,
FT                   909574..909672,909702..909761,909791..909944)
FT                   /locus_tag="TA05730"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.70 - score = 74.90"
FT                   /db_xref="EnsemblGenomes-Gn:TA05730"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73299"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHZ0"
FT                   /protein_id="CAI73299.1"
FT                   /translation="MAISNLFRLNKVNDKNKSSKNVKKFDKGAKSKPNKKVVPLKHTPG
FT                   PSCIDNLKVSVDSSQLTKVIEAFKKREADSNSNEKDLLDESSRKYVLLQFRLSKLPPEP
FT                   HVKPLQIQLKHPIYSGKEICVLVKDPQKTWKSVIFDLKIPEIKKVMGVGKLRKKYKTYE
FT                   DKRALCNSFDLFLCDKSVLPSVPSILGSYFIEKKKLPVGVNFSKNKIKKSFLTAINSTY
FT                   YKLAQGSFTSVRVATYSMPTDQIVENVMKVLESVKKFHTEHEVYKNHICSVFLNWGGSD
FT                   SLPLYSEELLEVEKINDAAK"
FT   CDS_pept        join(910210..910824,910854..910934,911026..912201)
FT                   /locus_tag="TA05725"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.70 - score = 74.90"
FT                   /db_xref="EnsemblGenomes-Gn:TA05725"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73300"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY9"
FT                   /protein_id="CAI73300.1"
FT                   /translation="MKYRDKNMLQLISARLVENIRQINSAQITSVLKAYSILNFRSDFL
FT                   FRMMIPEISLKLDMMTVDQVSSIFYSYNNLGYYNKNLFQTIQSYLYSNVEKLTPYDLTL
FT                   LLSGFCKNFKGFDEKFLTVLSFQFCKLLNSYDNKLFSLSVNSLSRLNFCKHKYLPSLIE
FT                   SEVYNRVKSSKEPLASRSLSLILNSLSKHYTSCTPLFTFLSQTVLKRLKEFDMHSVCLI
FT                   LSSFSRVTLSDAKTYDKIAEHVGRNSLKLYPRAISSMLYSYARANHLHGALFYFSGKHI
FT                   QLNLGNYTCDEVSMALRAFSVLNVKNEELLDTFAKFILENTPDYVPIKFEDLCPHLRVS
FT                   ICSKEINKFYESSENNASESQGTVLDETDDKTDLYSFEGRNINMLEYIGESSKISSNYL
FT                   AKGKMHSLLWIVQAYARFFFTNDNVTRALTRIANELVVRMNEMTPFLVSRILFSFSQLN
FT                   FSHEAVLQMLLNEVTNPRIGFKFTQKELSLLHYSIPAFGLDPGDYGIYKFKALDFQRIV
FT                   ETTELVELILRIVNRDIPSSKPLFVELLNNPLKMESNPKNLFNESGDGETMELDGFEAK
FT                   ELDGSDIYIHIPKYLKVLVRSEERNDDMKITLEEALTNHVNYNFKID"
FT   CDS_pept        complement(912272..912547)
FT                   /locus_tag="TA05720"
FT                   /product="mitochondrial import inner membrane translocase
FT                   subunit (TIM9 homologue), putative"
FT                   /note="Tap349e08.q2ks7.cand.54 - score = 17.27"
FT                   /db_xref="EnsemblGenomes-Gn:TA05720"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73301"
FT                   /db_xref="GOA:Q4UHY8"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039094"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY8"
FT                   /protein_id="CAI73301.1"
FT                   /translation="MSQSTGLGSELNHLTASQRSAVLEKLNQIQYQDTMDTYNGLVERC
FT                   FNECVSGFRSKDLDKKETQCVESCVKLFFDFSQRVSTRFAEKQSKI"
FT   CDS_pept        complement(join(912839..913052,913175..913244,
FT                   913279..913392,913427..913616,913646..913833,
FT                   913865..913910))
FT                   /locus_tag="TA05715"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.54 - score = 17.27"
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA05715 by TMHMM2.0 at aa 21-43, 63-85, 128-150, 160-182,
FT                   189-206 and 250-272"
FT                   /db_xref="EnsemblGenomes-Gn:TA05715"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73302"
FT                   /db_xref="GOA:Q4UHY7"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY7"
FT                   /protein_id="CAI73302.1"
FT                   /translation="MNVALTNLIVLSINSMDKGGFIVHYNVLAKIGHVVGPLLNILVTF
FT                   LPPIKRRLFYFNALPYENLEYLYISISVFCILRIYASFALRNARRPNVIPSKIKEDFPD
FT                   RNIGTYFRDESVNYSSGRYSYLPWIVFSTNILTTLGSGLSISIMGIYMIEEFKIDFMKL
FT                   WISSLMIPIFTTILLFILNSYQKRHGKLVTIFISKLIALLASFQNAPGPLKTSIVLQCS
FT                   NLKSASYWLSSEYLSRIIMAGMTMLGGHIHMEYGFKYCFVLTGTLCVIILL"
FT   misc_feature    complement(join(912845..912913,913043..913052,
FT                   913175..913218,913237..913244,913279..913339,
FT                   913367..913392,913427..913469,913596..913616,
FT                   913646..913693,913751..913819))
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA05715 by TMHMM2.0 at aa 21-43, 63-85, 128-150, 160-182,
FT                   189-206 and 250-272"
FT   CDS_pept        complement(join(915660..915919,915952..916108,
FT                   916173..916600,916635..916815,916892..917122,
FT                   917154..917369,917401..917535,917569..917898,
FT                   917982..918248,918277..918653,918684..918742,
FT                   918773..919066,919097..919150,919187..919266))
FT                   /locus_tag="TA05710"
FT                   /product="pre-mRNA splicing factor (U5 snRNP-associated),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.cand.53 - score = 119.95"
FT                   /db_xref="EnsemblGenomes-Gn:TA05710"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73303"
FT                   /db_xref="GOA:Q4UHY6"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR010491"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027108"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY6"
FT                   /protein_id="CAI73303.1"
FT                   /translation="MTTLPTGKKFPLSASADSYYMPGVAKGLLAYTRSELGYNNATPSD
FT                   PFGKPPPGYVPGKGRGATSFAGGVSRDDTHDDSDLNDLGGPYQVHCENEQLFKDAEYDD
FT                   DDREADLVYEAIDAKMDERRKSRREQSLKSEITKLRSEKPTIHEQLAQYKRNLSTLTKE
FT                   DWESIPYIGDYSLKRKQQKKQQTYVPAPDSLIYSSRASMQHTSSIGTETPLGFSTPLGI
FT                   MGAKTPLGIQTPGGFTTPSGRTSSLNLLGEARGEVLSSTLDKVTDNLSGQTVVDPKGYL
FT                   TDLNSMKTEFEEADVQKARTLLKSLINTNQKHAQGWIAAARMEELAGKIEAARELIAQG
FT                   CENCPDKEDVWLEAARLEKPEYAKSILAKAIKIIPTSVKLWLEAADKETSNDNRKRVLR
FT                   KALEFIPNSIRLWKEAISLENETNAYILLKRAVECVPESLDMWLALARLCPYEEAQKVL
FT                   NEARKKLPTNVDIWITAAKLEESNKNYEMVDRIIVRAIDNLSKKGVVHIRSNWLKQAET
FT                   AEANSFIKTAQSIIKNTMTIGVDDNNRKSTWLEDGETFVEHGSYECARTLYKTALEHMK
FT                   TRTSLWLALVELESKHGTPDQVEEHLKSAVTYCPNSEILWLMYAKHKWVGGDVESSRAI
FT                   LSKALTMNENNEAISLAAVKLDRETHEYDRARKLLEKARTRCNTPKVWMKSVQLERQLK
FT                   NYEKALELVEKALEIHPYFDKLWMISGQLKLEKQPKDIEGATLTYKQGVETCPWSVNLW
FT                   LLSIELQIELKEFTKARALVETAKNKIRTIVGSSIKKNTDITKVQTKVLTNAELARMAR
FT                   LSMESDDPGSVKEMIEKITSQCDLIWLKGVEIELETGVRENAHFAMSKALQELPDSGLL
FT                   WAHSIFLEEPNAQKTKAAEALKRNQNSPHIVLAAAKIFWNCKMIDKARRWFQTCITLDD
FT                   SNGVSWGTFIAFELDCGTEESMKQAINKFIEAEPNRGYEWCRVTKKVENWNLSLPQKLY
FT                   KFIEQHYPEVLTDKVPEDVLNVLNPPQVKKESD"
FT   CDS_pept        complement(join(919808..920458,920527..920584,
FT                   920673..921763))
FT                   /locus_tag="TA05700"
FT                   /product="hypothetical protein"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA05700 by TMHMM2.0 at aa 368-390, 545-567 and 572-591"
FT                   /db_xref="EnsemblGenomes-Gn:TA05700"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73304"
FT                   /db_xref="GOA:Q4UHY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY5"
FT                   /protein_id="CAI73304.1"
FT                   /translation="MQKDVHNKQSKLLKFSKLNCLWNPEESKNPKLYDSYSYLDLHLNQ
FT                   FLSNITEDYSFLPNTIYKPSIHVFIDNRLVYKTKILDFNNDLFDETIRLKIYSQNTTVT
FT                   LKLFEYEQFNTTNSEELNLKPSLYSEMTDLHLVSWVDLDINLLIPERDYKIICAFKSNP
FT                   AFNSYNPGGILYYPTESNRPSILFKRVCASCKVCSLLSHLSVGDDDQYSSIFKYFDYKF
FT                   KDPNSDSSDLKEEVKDKEKSVDEEDLDVVEVIDMSSLTKRSRKESCKCLQLRYIPLSFK
FT                   KKNFEICLKCHDYEVCCDHTLNNYYLSVNFKLIPSSDKIDFSTELFSCLLSSKQTELKC
FT                   EDLASIFEILYQRYYSFQLLFNHIKEKALLFLKVSLLSLVLGSSAFFFVVRITSTTQFK
FT                   KDHGDILYTSKNLYALDQGVSNWIMKYIEDDVKEKPLIVNGRVYTVDKKSIERNNLNIP
FT                   ERHIADKTKVYTKAHSSYKRTEYIALKTICYAISESIPKVVKAFLLKIAEASEHMVVFI
FT                   NGLLALTRDCGLQLSFTCFFLAVTSFKFYKLYSFVVKLLLVLLLLGSFAQDVDHVRYAF
FT                   TFVRNLFVYLVLRVYRKEWFLNA"
FT   misc_feature    complement(join(919835..919894,919907..919975,
FT                   920438..920458,920527..920574))
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA05700 by TMHMM2.0 at aa 368-390, 545-567 and 572-591"
FT   CDS_pept        join(922006..922125,922237..923032,923063..923151,
FT                   923181..923765,923825..924112,924161..924707,
FT                   924738..924805)
FT                   /locus_tag="TA05695"
FT                   /product="vacuolar sorting protein 35 homologue, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA05695"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73305"
FT                   /db_xref="GOA:Q4UHY4"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR042491"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY4"
FT                   /protein_id="CAI73305.1"
FT                   /translation="MLSDSVVGLVDNYRPMDQGKMLEEAIFFVKEQSYYMKKAIEMEDV
FT                   SNSLKHGSNIISELRTSSLSPIHYYELYMKVFNELEYLADFIGDHAKKTNIIPELYVSV
FT                   QQATFILPRLYLLVMVGAHYIKSKKVTAKEILDDITELCKGIQHPMRGLFLRYYLVQIC
FT                   KDKLPDSDPDNENGFIDSFDFLMNNFCESIRLWIRLNTAGNDKKKLDKERLELGLLVGA
FT                   NLVRITQLEGVDINFYSSTALPRILSEIKSIDDNVAQKYLLDCLIQAFSDEFHIQTIDD
FT                   ILSACVSSVKSGNFTNDITINNINFCTYYHVDGGISILMTMMNRLSVFLTSNPESLPEG
FT                   VDIFSTFQKHLSTINVVYNLSVQGNQEPEGPQVGIKGYLDLQAAFLEFITTLYPGTVEH
FT                   VEFVLNKVVEVLSNILGDVVIEGPAANSIVKLLTVPIKALSLKALELSYNEKLISFLSW
FT                   EMRKEMSYNLIDELVTTNILMDELSSFEIFFNLVSPLFLPFDEEKGEYISDHLLEKIKL
FT                   EQYQICKLIQAIKCSDVCDQFSIYKDLTERILKSGSLRMKHTLPCLVNCSLSLLFSSSN
FT                   REFSQTQSTQFQTPNVQFKNMKISFNHDFSMEILKYIHHLMELLQPISPKKTLKLLMLV
FT                   SISVDEFARSSIGVFGENTKFMTDMKMMCLDFLMKACNCYEDEISGGENQVYCIKYMCS
FT                   AVSSRITILDSEDYLNVAMLLAKYALNLIRLTQRCEVLCCASHLFNSPQYYNEQRLVWC
FT                   LEKCVTLVETLDFYTPSKLVESLMFPLETSKYFKLKNTTKLVQNKLDKLSQLLPKDEMK
FT                   KYEEKVKALQEYTNLLTK"
FT   CDS_pept        complement(join(925812..925939,925968..926052,
FT                   926082..926210,926288..926806,926869..926934,
FT                   926968..927064,927115..927326,927357..927459,
FT                   927534..927675,927716..927814,927849..928002))
FT                   /locus_tag="TA05690"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.51 - score = 37.99"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA05690 by TMHMM2.0 at aa 26-48, 61-83, 98-116 and 168-190"
FT                   /db_xref="EnsemblGenomes-Gn:TA05690"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73306"
FT                   /db_xref="GOA:Q4UHY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY3"
FT                   /protein_id="CAI73306.1"
FT                   /translation="MAKTLSWDDVKWRSSIRVFSSILKYHISLTLSLSIFNLVLFNIFR
FT                   FLISSNKSPIINLWNSFFNLFPSFFFLLLSLCFRHISFKGSFVRSMYLDFCSFISNFLM
FT                   VFAIILTANTLIKIKITEPRLFFVLLGCFLNYLKVRKQNTDVCKVLDKQNITTVHLGSF
FT                   FFQGFFNSLLSYFITLLFFSFLNILYFLSSFLSSSFPNVEAYKYRNFLTHFCYDVNALL
FT                   SKLPYTTNYYHFSFNFIEGLELFLAQVWILSLSDYYLDKMNLESTHMDYYIMNYIDEMP
FT                   IHNVSNINDEMLYARAAYNYTKGVSYTLNNMNMKYVSNPISFKYQNDWTLNGHRQSYHP
FT                   FERVPNSSFFQKSTPNNTYTLEAKKDRYQLDPVVYKMLMDKTKNFWSNYVQSCLETMDE
FT                   SSQNLHHLIDYPFSREHKINILENNMHQFNLHQHQMGFYTSFQSFLLYLASYFKFFHPS
FT                   KSLSNNLVNMLLLCIVYLRGITSWLCIANMIGHSQDSVKIVAKDVIVQSLRIHRALSNL
FT                   NLTTIPSNIKSYIETLNNDINTTLKRLAVYTETLIYSKFDTNFDTYRLMEHLYNNRKLS
FT                   T"
FT   misc_feature    complement(join(927255..927323,927581..927637,
FT                   927720..927788,927859..927927))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA05690 by TMHMM2.0 at aa 26-48, 61-83, 98-116 and 168-190"
FT   CDS_pept        complement(join(928170..928385,928456..929051,
FT                   929083..929500))
FT                   /locus_tag="TA05685"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.50 - score = 27.17"
FT                   /db_xref="EnsemblGenomes-Gn:TA05685"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73307"
FT                   /db_xref="GOA:Q4UHY2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY2"
FT                   /protein_id="CAI73307.1"
FT                   /translation="MEVSGVGSGILFENYYSNLFKSRWENLYKSLKNPVKNIALIPPFY
FT                   SDIPLQNEFNHSNLNSTDYNNLDSMNDNLTDCAEDLTEIPDDAYVYKPTILPWCYEVTL
FT                   KALVDPKEHDKLVFNKNIFDANGYVSRLIDHIYYLDGASAFAAFCLEAKPGDKVLDMCS
FT                   SPGGKMIILASNLFHNTINGISGLTNGIKGSNMTTTELIDEIKNRMNESKMNSNSSETL
FT                   LVCNEPVKSRYKRLIETSKRLIPDKFISGKHIQFVNYDATDPNKFQRFGKFDKILIDAP
FT                   CSSERHLINKNLSWSFKNIKENSKRQLKLLQTAISLLKSGGTILYCTCALDPIENELVI
FT                   NTILKNYDDIKHVQINYNDLINNININNLKIMESTDYNKFKPEKRTHGCSIMPDKSEFG
FT                   PLYIAKLQKL"
FT   CDS_pept        929706..931136
FT                   /locus_tag="TA05680"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.74 - score = 35.57"
FT                   /db_xref="EnsemblGenomes-Gn:TA05680"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73308"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY1"
FT                   /protein_id="CAI73308.1"
FT                   /translation="MEPGKDDPELSRPIKKSRRSLSELNAHTKDHSTSNSSSHKSKNIT
FT                   QSISLYDLEGVRKCDKQSIVRLRKSLGIVNGVSTEVKMPLVPYRSTLSRLEKRKKVKEL
FT                   TEDDYVACMENIIERDYFPDLLKYRYLKAISDAENAGNKRLAKKLTRELEMIKSGQLNN
FT                   NVYLKTLADENIMVNLGKDGLKLDEFNRIFSSEDNRSFDRLMEKDIESKINKTKWIEDS
FT                   EYKHNLAISDIQKKTNLGIRAHYTHHNRFEARNSLYFTPEQSIPDQKPCEIMSQNTNLN
FT                   IDEKELERMKEMHVKKIEENKQRMADEKLSELIAAEGVSKNKELLKNSKYGNSYVFTPK
FT                   IIAGESEPIFTWGTISSIESIPPTPIVGSDNKSGPDDLTSSDTVKNIIKSDKSLKDGKE
FT                   FNMPKPLDREEIANKLYKKLKTPKTPMTPGTPFTPRTPLIVQRLIAKHTKNVDVQLRDA
FT                   YSIRKYKSSKASSISSHK"
FT   CDS_pept        complement(931211..932362)
FT                   /locus_tag="TA05675"
FT                   /product="actin, putative"
FT                   /note="Tap349e08.q2ks7.cand.49 - score = 24.27"
FT                   /db_xref="EnsemblGenomes-Gn:TA05675"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73309"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHY0"
FT                   /protein_id="CAI73309.1"
FT                   /translation="MADDQCVVIDNGSFSLKIGLSGSYSPSFIVRSVVGNPRPKFKQNF
FT                   TEEFYYSEDVYSSLEFMSLDHLIDHGHISDFDKMEGLWQYCFSKLEVHSDCRPVLLTEA
FT                   PFTSPKHRIKSSEIFFERFNIDDLNISVAGLLSMYGLGKLTGTVVEIGDGVTQVLPVIE
FT                   GYSERSSIKRVDFGGIELTMYLQKMLCTRGYCLTSRPDFELVRELKEKFSFCSLDPFTD
FT                   ENRSDLVEVYELPDGNVLRDGETNEIDLSLERFYVCEPLFNPSIVNSDAPSIVNTVWNA
FT                   ITSSPIQDRTTLTNSIFVCGGTSLFPNFEKRLQMELQDIAPPGGRSKVRVTAPQDRHTL
FT                   AWRGGSILSEPKLKDISANMWVSREEWDESGPEIIMRKFGLDN"
FT   CDS_pept        join(932729..932913,932958..933078,933113..933340)
FT                   /locus_tag="TA05670"
FT                   /product="ribosomal protein L11, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.75 - score = 13.36"
FT                   /db_xref="EnsemblGenomes-Gn:TA05670"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73310"
FT                   /db_xref="GOA:Q4UHX9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX9"
FT                   /protein_id="CAI73310.1"
FT                   /translation="MQIGRFRLIVPAAVAKPSPSIGQTLGPLGINMADFCKKFNERTKT
FT                   IRPNVPVQVLITTHHDNSYKFSLRTPSSQWFLRRIARVPMGSSKPKHEIVGNVTLKEVY
FT                   HIAKCKCMDPQLIGTPLYVICKRIIGTANAMGIKVTRELLPEFKKRDYVPVSKLDQMKK
FT                   DIKMQRRSAKRMKS"
FT   CDS_pept        join(933610..933719,933752..934014,934052..934157,
FT                   934336..934460,934535..934975,935005..935231)
FT                   /locus_tag="TA05665"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.76 - score = 31.76"
FT                   /db_xref="EnsemblGenomes-Gn:TA05665"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73311"
FT                   /db_xref="GOA:Q4UHX8"
FT                   /db_xref="InterPro:IPR017423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX8"
FT                   /protein_id="CAI73311.1"
FT                   /translation="MINSFNYDPSKPICENDHVMLIDHIKRCFVVKVERNKLVKICKDK
FT                   FNIGTLIGLNYGQIFTKIDNEWIKVNRNDESFKSYWSLVEQDSDDSESLESPISSDNRT
FT                   FLDLNSSQKLSADDINKMKKDINPSELISKIVQNSETFQARNQFSKEKYIKRKEFRYLR
FT                   FESLAMMLHLANPQFDDKVIVFDHSLGLITGALAQRLQGTGKIYRLVTRGVSDKIVHEL
FT                   GVNHFDNIISVDFDQVMAYSDGSKVQLNSNSHDNTNTVDNIEEHNSSELELESSNSTEE
FT                   ELEVKSKKRKKETIPGIYPLTKITESELENVNLVIGNVSFNKCNKDNSLVDTYTISLME
FT                   IANKFLRNDGRLIVFGQHFQPLSHCYSVLTSSTQYINVKLDETFIREYQVFKGFNFITL
FT                   GQTDVYSSFNWEIPALLWLHFIRH"
FT   CDS_pept        complement(join(935302..936590,936656..936749))
FT                   /locus_tag="TA05660"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.48 - score = 23.90"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA05660 by TMHMM2.0 at aa 310-332, 337-359, 366-388 and
FT                   398-420"
FT                   /db_xref="EnsemblGenomes-Gn:TA05660"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73312"
FT                   /db_xref="GOA:Q4UHX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX7"
FT                   /protein_id="CAI73312.1"
FT                   /translation="MTGNIRSRRAYHNTFGDEVQDTQNKEQFSTQGREVFSNPTQSHNT
FT                   PFQNQSSFHNYPTHNTFASTPKNVMSSDGKTAFTTDADKANLNPRPFNSVPNIVSSPFS
FT                   QNQQTNITSSPFRNTSIPVPSHPFNTNPANIFNPNSVQNFNPNQNFNPNINPSVTQNIS
FT                   GNMNVPNQSQVLEDRSMMYLEGQLNQTTNISSPFSQTSNSSPFNQASNVQTAFSQTTNV
FT                   NTNPLRPNFTNPTSLVANKIAGNRFSPLQSQLGAQLTKFGEMYTQRLQQSEEEDVVDPP
FT                   LLDELGINLVEIYEHLVGVVLPKKGNSLFLNYNDLSGPLLIFVTFAMGLMFSGKICFSI
FT                   IYVLSVFCNLGIYLLFNFLNERYISLSKTVTIMGYSLLPLCLTPVIWLFSRFLKLVSVI
FT                   LVYLCVVWSTVSATYLFQAVSYGTTNNVLGVGFRWKVLLCHVSHFTLLHHLCKRRYLLI
FT                   YF"
FT   misc_feature    complement(join(935425..935493,935521..935589,
FT                   935608..935676,935689..935757))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA05660 by TMHMM2.0 at aa 310-332, 337-359, 366-388 and
FT                   398-420"
FT   CDS_pept        complement(join(937008..937098,937129..937229,
FT                   937260..937427,937462..937536,937569..937654,
FT                   937683..937724,937756..937925,937969..938033))
FT                   /locus_tag="TA05655"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.47 - score = 34.95"
FT                   /db_xref="EnsemblGenomes-Gn:TA05655"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX6"
FT                   /protein_id="CAI73313.1"
FT                   /translation="MLRVNHSVVNLIKLLYDNFNGRPLNLYTQFGLYFELIYSEENLVE
FT                   FLNLVYYEISQLNGLEFQNLSSLEDLKKFSFSKGLLPEMDLENEVFLEESLVLLCSERL
FT                   RLKNKFVKSLNISQKQQNFIDDSLLSKLKDLKISNTNYTCEPEQSGKRQLNKGLDESQV
FT                   DELNRISEELSKDYNSRWNSYLDRFYNLLDVFFKVKGFKDSRDFQVLMETLKEWRKTTK
FT                   FRELNLYDACTYRRDDKNVVKISYKTDNSNRVTELYSKIKSKL"
FT   CDS_pept        join(938139..938201,938232..938346,938377..938453,
FT                   938483..938574,938605..938748,938810..938879,
FT                   938949..939026,939059..939166)
FT                   /locus_tag="TA07020"
FT                   /product="phosphomannomutase, putative"
FT                   /EC_number="5.4.2.8"
FT                   /note="Tap349e08.q2ks7.C.cand.77 - score = 26.51"
FT                   /db_xref="EnsemblGenomes-Gn:TA07020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73314"
FT                   /db_xref="GOA:Q4UHX5"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX5"
FT                   /protein_id="CAI73314.1"
FT                   /translation="MEDGSTILLFDLDETLALSFKPVTDEMKRILLFCKDKGYHIGLVS
FT                   GSDFKKVESQLNPEFSKSFNFIFCENGTQVYKNCQLVHSESIIKFLPDSLYKDLVNYVL
FT                   VYIANLDIPKKRGCFIELRNSIINISPIGRNCSEPERHEFYNYDCVEKVRLKMCQDLNE
FT                   RFRDCEPKLHFSVGGKISVDVFPEGWSKTFCLKFLEDYKTIHFFGDMTDPGGNDHEIFI
FT                   HPRVIGHKVLNYQDTIKQLNELFLNK"
FT   CDS_pept        complement(join(939212..940027,940103..940954))
FT                   /locus_tag="TA07015"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.46 - score = 44.19"
FT                   /db_xref="EnsemblGenomes-Gn:TA07015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73315"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX4"
FT                   /protein_id="CAI73315.1"
FT                   /translation="MATFHENYVNNPLVKALMTGTLLELKEVLSSKYEQYKNQEKVESS
FT                   DSSLNNQDSNQSDSKDVNVDVKDPKDVNVDVKDPKDDSKDPNVVIKVVENTIEELVDAN
FT                   TRITPLCQLSHKTNDESLEIAKLLVEDYLLCNPNHVDLIGQTCLFYSARDGRGELCSYF
FT                   CKKGCDPNHKDRLGQTCIFYAARDGHSEVIKVLVEHGADVNVTDTNSQTCLFYAARDGR
FT                   VDAVKVLLEKNINHGWKDLQRRTALSFAKSKGHNEIVNLLKKSTPEKQTSTPQKRTLDS
FT                   EPSGTFEGDPFSGVPMVSGDVFSNKPKRYRLQFRPFAEDDKLWLDAPLIKVQEFELRFP
FT                   DLAKWDREAAFPPSNTLRNPLLKQWYSLANNLLSTLLKQEGGYVFEKPVDPKKQNCPDY
FT                   YDIIKKPMSFSCVRGKLRKNTYTDPQQFVDDVLLIFDNCSKYNKPETWVATIGNNLRDF
FT                   FQNQLLALGFNEFCKKEQLVKQLLEQSSQYLSTQTNTVNTTTTDNSVNATNGVENTNGV
FT                   DGKLNEHLSNVNSSEPLKTSEPQNTVDVKSETVNEIEF"
FT   CDS_pept        complement(join(941268..941362,941458..941519,
FT                   941589..941779))
FT                   /locus_tag="TA07010"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.45 - score = 10.20"
FT                   /db_xref="EnsemblGenomes-Gn:TA07010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73316"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX3"
FT                   /protein_id="CAI73316.1"
FT                   /translation="MGKKSEYKKSELIQMLNSSSTLREKNRAVKLLKKFDPNPKKHLDS
FT                   SFQPNQATVTKYSSLQSFMCWRCDKIKQTMTKVKWETKEGLKIICTTCYTNLATYLEVA
FT                   RVRNLNINFKS"
FT   CDS_pept        join(942135..942281,942350..942498,942588..942742,
FT                   942793..942914,943006..943144,943214..943330,
FT                   943361..943611,943698..943844)
FT                   /locus_tag="TA07005"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.78 - score = 27.30"
FT                   /db_xref="EnsemblGenomes-Gn:TA07005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73317"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX2"
FT                   /protein_id="CAI73317.1"
FT                   /translation="MTESLTEKLYRSSKIPSCLNSRIRQHYITILKDLLTVEYTGKSRY
FT                   CDSGSVQSDTCAPTNCPLYYYEVEILKCDSQPKIVVGFSYSNYHLNRHPGSEPNSVGYK
FT                   SEDGYCMNGTSKSENYGPSYGKGDVIGCGINYLNQNYFFTKNGSFLGNAVNLFHIDNYP
FT                   TVGLNSFGESVKFNFQGPFKFNIEDYYKKIILTEREEINSNTVSRDDLNGIVHFYLLHR
FT                   GYSKTLRAFKNETNADGMNLDLTNDDKGENKFINQLYISNEVVNKMESTLEKRSMLIDG
FT                   ILKGEIEGALETFSRDFHQINKSSMAYIMLVTQNFIEMLKNGRDTKECLSWLQENIKTL
FT                   AQNDDFEQLFKNEHFKHVFQEACGLLAYQDFENSPLKENLSKNRRLETAIVVNDTILSK
FT                   FKPLTENSR"
FT   CDS_pept        join(944621..944946,944998..945749,945848..945924,
FT                   945956..946036)
FT                   /locus_tag="TA07000"
FT                   /product="cyclin-dependent kinase CRK3 (CDK7 homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.79 - score = 36.66"
FT                   /db_xref="EnsemblGenomes-Gn:TA07000"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73318"
FT                   /db_xref="GOA:Q962B5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q962B5"
FT                   /protein_id="CAI73318.1"
FT                   /translation="MVKRVKKSAEKTGKARKLNEGVKLKEEKDDEIKSENTETVEDSKD
FT                   LKNVDNVDKNVQKINEEVDDKQEDSVTDSNGSDSLDKRFTPVGKHLGEGTYGQVIKAMD
FT                   TLTGKMVAIKKVKNIEYKKGVTKDRQLVGMVGIHFTTLRELKVMTELSHENLMGLVAVY
FT                   VKEGFINIVMDIMASDLKKVVDAKVRLTEPNVKCIMSQILTGLSVLHASSFAHRDLSPA
FT                   NIFIDTFGVCKIADFGLARRTVNPPIFRDCSDLETMELNASRERMTSKVVTLWYRAPEL
FT                   LMGAECYHFACDLWSVGCIFGELLSGKPLFPGTNEIDQLGKIYNLLGTPENSWPQASKL
FT                   PLYTQYSFSKPKDLSLHFQHANSVTLDLLSKLLKLNPNERISAKEALDHEYFKVQPLKC
FT                   KPIDLPFDFITK"
FT   CDS_pept        complement(join(946098..947728,947980..948406,
FT                   948447..948590,948645..948864,948954..949176,
FT                   949247..949337,949371..949478,949531..950127))
FT                   /locus_tag="TA06995"
FT                   /product="transcriptional adaptor (ADA2 homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.cand.44 - score = 73.06"
FT                   /db_xref="EnsemblGenomes-Gn:TA06995"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73319"
FT                   /db_xref="GOA:Q4UHX0"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR041983"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHX0"
FT                   /protein_id="CAI73319.1"
FT                   /translation="MNNITHYNNDSDHFSDNSSQLVNSAGKSDNGVNDSTVAGKAQKRH
FT                   PSGSSKSRSSDLKGKNSAQAKSRDSDPSAVIKAIGSYVQCNICTKLCSRNGHIKCAECI
FT                   DFNICLKCFCSGLERPDDEVLASSFVNVSSKVTEEHHNTHKYIPVGPSNFALFSKGIYL
FT                   LIKIDYITLNNVLDWSAEQELLLVDAIAKYGLGNWTEVSNMVTMSHSGYKTEEECETHY
FT                   YQYYLNSPTGPLPDTSNLVYNYDGKPLMVPFRGPRPLQDKPKPVTSNKPQTKPQIIGYW
FT                   PLRGDFDIEYDNDAELILADMEFRPDDSPEQIELKLSVIEIYNSKLDERIYRKKIIIER
FT                   GLLDTKSLQQKERKYTTEEKELYNLFRPFLRFQTPEEHDHTIQLIVKERKLRSRLYQLM
FT                   VWRTLGLETADDIKKYEDKLQRIEFFKDALEKQDSDPSRRHERRLRTSTTETEVSHYTF
FT                   SHLVNANNANRIRLSDFIDENEIEFCESLHLPPVAYFLAKRVLLQELASNNIYSVDDMC
FT                   NELRIDGTKQGRIFDFLLMLSPKALRNMEQDVVDLAKVKLDKNGLVDTSNVASQITVDT
FT                   STSLEYLKKLTTPSNRQLDPEPKSPHSGIYSEDSDPTELNLRDKSINGILDSDLGSLSV
FT                   SNRIDSHRYNLAQIQKSNFYTISTKSPGDYRKIDLMYRFYRICNNLKIQNPDKIYNMYL
FT                   KRLNKRIRLESSNRKLEIIISALYYIDQCLERGNNYTLRDVLLRIPDCKVNLKSFTRFV
FT                   SKLASELGIKSLPVIDDTLLITNILDQIRLFCSDHIIAIGKDNPQTTTTVINMNELFDL
FT                   EEIMSSLTSTPTSFDSTNLSCISTDNSQNSVDNILHTTIKHDNILDNDDGVLDHSNEGT
FT                   NYENTPNKTSNSSNKIPNSDITTVKSPSSNMARDTACYKQVCKSISLNFVKILKLSGRI
FT                   LVLVDETSRKENVLNPQNRVIFACRKTLIASVLFMTFSALKIPVTPNLIIRALNVVKSS
FT                   FYRNYNKVLSRMMAHFTTKYSCKINDKDNLMSLLHVLLTNNMTTNTNDTVTTVPNTNEK
FT                   MSDGIVPNIIKKENMLNGRGKSDRKTSFSKTIACLDILTNIHDNGKGNGVIVYERSANR
FT                   YACRYKIKGKIKRKCFSVNYYGQKNAYELAIAYSKHISN"
FT   CDS_pept        join(950769..951941,951970..951978,952013..952630,
FT                   952661..952948,953005..953112,953187..953229,
FT                   953264..953331)
FT                   /locus_tag="TA06990"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.80 - score = 119.92"
FT                   /db_xref="EnsemblGenomes-Gn:TA06990"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73320"
FT                   /db_xref="GOA:Q4UHW9"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW9"
FT                   /protein_id="CAI73320.1"
FT                   /translation="MKKVKKTKPSKAKGHSKQKNVKFADYDEEISEDDIDIDDFPNNNN
FT                   VKNNKTGKKNKKHECGELWHYIYDNESDNEDNDNDLIDSQDKENEKDIENDEDGDKVDR
FT                   NGVMYDRLEDSVDISGNLLDFDQVEELSSSYDWITKSRESNEQYKALIKKFKQIDKEVP
FT                   QILTSESQSRLKRIERKAQYESTKRFLTKKWAPIVKEIRKSDNIVYGSEHRSEPTVSTI
FT                   CTNFAPETELEKELNSVGDELETKMDNTALVRAIISREQKKNKRINRIKSKRWHKRQKQ
FT                   RDLQMAAKLLGKIDDPELATEIKNTFERKRAEKRILRKKEAQSKWAKMALRYGGKDLLP
FT                   LITSQQNDLKQNYDLIDQTIKENEDDSSDQNDDDSVEGDDDHSVDNENEDSIPQYYCTV
FT                   HLYNCLVPIPNKGLFNLTFMKNAIQNQREQLNNEDESVGDSDQEDKDSEVKSDDELDYK
FT                   ILVNNEGIEVDEQINKFNNLKKDKDISNIKLEEIYDKEELEREEKELMKISYKDQFDSF
FT                   KLDQDKTSETIRSVGYTRANFTSPLNNTSNIPAENNRPETTNIVDKNLNKKLNVAKRSN
FT                   NTSKEISVDKCVDKLGKDNELDNLINELKVDENEKNKEFVKQMFITRPDEEDYLEDEED
FT                   EEEKKKVTNMAGWGSWTGHNIINGDNKSNNTENNESKVKKKSRVKINTKKDPKLSKYYI
FT                   HKLEHPYTSRNEYNSNMEIPIGPEWNTLNMHQKLIKPKKMVKIGSVIMPLGLEKILSKT
FT                   ELMLDYNVLQNNIIY"
FT   CDS_pept        join(953364..953523,953554..954599,954667..954805,
FT                   954845..955073,955134..955707,955769..956175,
FT                   956205..956265)
FT                   /locus_tag="TA06985"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.80 - score = 119.92"
FT                   /db_xref="EnsemblGenomes-Gn:TA06985"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73321"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW8"
FT                   /protein_id="CAI73321.1"
FT                   /translation="MILRRQIPPWEISSRNTYRKWKNNKTNGHFKLFLNSFKSFNNCVN
FT                   TTQITAISEKNCINELKRGISVNLEEVCIRLQQLSNPVNFGKKNINQLLTQLINKVDEV
FT                   ISYISVDSLFKFLVSYSKVVNSLVYINNDSHILVKNGLKISNIGLFKKLFNVLQTEKFE
FT                   INRHNIIQLIDSYVRLCVGYSQDSETFCNIYKRSVNLIVSGKIKISQPDFDKLLLLFDR
FT                   MGLYDRAFIEFYSRVLCKYFDNFTQDQFGNFCRYLSKLPYVQKKPIITHINTLSSNNGM
FT                   NSSNNVDGFKCVKKLPYSYVIRLLNRRNYDYKVKIDYSTSISTDREREVLKDWDFRNSK
FT                   FVKFLDKKLPYCLHQFTYYNLIDVAEMYYVYGIKSEILPRFASEIWKYLYTLKYGYTIK
FT                   ALIVLGNLGLGDGLTYGRLIRNIPSSLAFNWPPELIAEALITCGSLNIQMFNYSGIYIA
FT                   DLSLYNKLSQYLERRVMYFKDPKLICRIFEALSIAKVPQYGLYYQLLTLLESFPNWLHL
FT                   KHIIQISKSTMLVGMFEKRLFRVLISKLDEVKECSVSEIVPIIVLSKEIVMDSEDSKNF
FT                   YAFILRYISGINGSVELELDELMDLLNGLVTIQVKTKEIEQIILKTIGNNNKRVGRLET
FT                   HHLLRLIEYMSILGKVESKELLSVITGFVSEDLQKFNESEVSTLIWDLIAIGVELNDET
FT                   LLKVVKRFNQLRPMNNKTHLLTVVSMLVRMSEMNDKVWKDFLKIVEGYKDFSWSKSQEN
FT                   INIIKSVANTIKDSETFVKQFPYTIDITALYSNIDSINIPKAIKPLNNYEKEENLITKS
FT                   NDCRNDMALFYYNSDENPFILHLNPDGTHEHYFNFYCQTRKKILQNLGWKDTLIFTPNK
FT                   "
FT   CDS_pept        complement(957073..958587)
FT                   /locus_tag="TA06980"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.43 - score = 18.61"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06980 by TMHMM2.0 at aa 26-48, 113-135, 147-169, 184-201,
FT                   213-235, 255-277, 289-311, 355-377, 398-420 and 424-446"
FT                   /db_xref="EnsemblGenomes-Gn:TA06980"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73322"
FT                   /db_xref="GOA:Q4UHW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW7"
FT                   /protein_id="CAI73322.1"
FT                   /translation="MTVQTEKKYEQDHGFSTGDLQTAAYMFAGLAMMLNIRLSYSAAPF
FT                   ALLRFKLPENLFSVFVRTTSSALELWCLPSMTIGNIMEQVYINYFRDKDAGKKDSDVSD
FT                   GTKVSKWYWIVIPSIITNWLNFLTFVILLIIYVTGGDQGHLTCYYWIMAISGFVFGINM
FT                   VLVYAVDYRYLAFYMAGENSFPMVTSLILYFATSIFGNRRKYNSDYLVVLIDISISIAI
FT                   ALVASVLWTIAFWQYRAPKASRDSPNKEVTSPVLLVLVGMGLVYSIYPGIAPGMIVPFH
FT                   LIDKIEMVLLILTTFPPLIFAFTTKYAPNWSPKTKFVFHSPSKMGFGGWKQYQLHVDKT
FT                   YAQGECDENEPTVYGWLWHFFDILAPLQIILAVIFIYSIHYRDSNISRSIVNQPKMSTF
FT                   LTIIFYMCHEIMLATGFPGLVCNNGVTWVLLPTQWVGALLMVFLAFYSIGYITEYKRHD
FT                   PSEWPTDGMTWWNSVCYWLKMASKITNKNFKQLFTTDLRRLTIYYK"
FT   misc_feature    complement(join(957250..957318,957328..957396,
FT                   957457..957525,957655..957723,957757..957825,
FT                   957883..957951,957985..958038,958081..958149,
FT                   958183..958251,958444..958512))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06980 by TMHMM2.0 at aa 26-48, 113-135, 147-169, 184-201,
FT                   213-235, 255-277, 289-311, 355-377, 398-420 and 424-446"
FT   CDS_pept        complement(958790..961042)
FT                   /locus_tag="TA06975"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.42 - score = 54.93"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06975 by TMHMM2.0 at aa 21-43, 376-398, 405-427, 437-459,
FT                   471-493, 534-556, 563-585, 625-647, 667-689 and 693-715"
FT                   /db_xref="EnsemblGenomes-Gn:TA06975"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73323"
FT                   /db_xref="GOA:Q4UHW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW6"
FT                   /protein_id="CAI73323.1"
FT                   /translation="MANTCTGSGCEKPAGAGVDGCGLLISAYVLAGLAMMLNIRLSYSS
FT                   APYALIRFKLPENLFSVFVRRMASALELWCLPSMLMGNIIDLLQKGFGGDDAFRVKAGK
FT                   SASDGTLRKLAETLHTTAKALNDAVKNPGDDPNAAKVLQHKATTLRALAGKLHSAANDL
FT                   HIAVGSNEKGAENLAKAVGDKDEPPPGSGKPATLREALNQLATGASGHQLTGLAKAVRT
FT                   EYDLVKPKFEKVRQKEAEYNDYQSQYNSVLSAWDSFNAVYKPEELLKDAIGEDDEPGSG
FT                   TKPTTLRQALNQLGTAPGISNIKDLNTKAQNARDQYGSDWGGLKQKFNNVKAQENAYKQ
FT                   GVTIETNQYKKLVEAWNKFDNAYREAISIAKFYSIIVPSIICQWFNFLTYVVLLIVYVA
FT                   GGEKGYLTAFYGTIAVSGFVFGINMTLVYAADWNYTPVYIVGENCFPILTSFIHYITTL
FT                   IFGNRRKWNSDYLIVCIDIWVAIIISLVAAVVWTYAYGYCDNGGNDSVSYGHIFTESFD
FT                   TSPVHWGPIVSPTLMVIVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATFFPPVIV
FT                   ALLNRGTFLGYTKAYSPKSAFEDFGKGMGGWRTYKPKFDEPKTEVNNTFWHGFDILLVI
FT                   KISLAVVFIYSLHYRDSNISRSIINQPKMSTALSITFYMCHEILLALGFAGVIANNGGT
FT                   YVVLPAQYVGALFMIFLAFYSEGYIIEYKSHDPAHWPIECMTKWNLLYILHYLQII"
FT   misc_feature    complement(join(958898..958966,958976..959044,
FT                   959102..959170,959288..959356,959375..959443,
FT                   959564..959632,959666..959734,959762..959830,
FT                   959849..959917,960914..960982))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06975 by TMHMM2.0 at aa 21-43, 376-398, 405-427, 437-459,
FT                   471-493, 534-556, 563-585, 625-647, 667-689 and 693-715"
FT   CDS_pept        complement(961240..962685)
FT                   /locus_tag="TA06970"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.42 - score = 54.93"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06970 by TMHMM2.0 at aa 20-42, 68-90, 110-132, 144-166,
FT                   170-192, 213-235, 268-290, 297-316, 354-376, 397-419 and
FT                   429-451"
FT                   /db_xref="EnsemblGenomes-Gn:TA06970"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73324"
FT                   /db_xref="GOA:Q4UHW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW5"
FT                   /protein_id="CAI73324.1"
FT                   /translation="MPDCPSTECEQAAHGKDKCPYLTAAYILAGLAMMLNIRLSYSSAP
FT                   YALIRFKLPENLFSVFVRRMASALELWCLPSMLLGNIMDIGVKAAYDGSGTNTPTTTDK
FT                   QVRFGAIIVPSIITQWLNFVTYVILLVVYRRGGDQGRLTTFYWVIAISGFVFGINMTLV
FT                   YAADYNYVPVYIAGENSFPAITSFIHYLTTLMFGNRRKYNSDFIIVTVDIWVAIIISFV
FT                   AAVVWTVAYGYYAGSDITTGDLKHIYAQGFFASPEVDLVSPAMMVIVGMGLVYAIYPGI
FT                   APGMIVPFYLIDKIEMVLLIATIFPPVIIAFLRRFKDQVGAIYSPTCKWGTDTLNTFTR
FT                   KYKNSGDANNPVDAWHWHAFDLLIIIKISLSAIFIYSLHYKESNISRSIFNQPKMSTAL
FT                   SIVFYMCHEFLLAIGFAGVVGGNGGGDTVLIPQYIGALFMIFLAFYSEGYIIEYKSHDP
FT                   ARWPTEECGIYMDTTNCTLIFLL"
FT   misc_feature    complement(join(961333..961401,961429..961497,
FT                   961558..961626,961738..961797,961816..961884,
FT                   961981..962049,962110..962178,962188..962256,
FT                   962290..962358,962416..962484,962560..962628))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06970 by TMHMM2.0 at aa 20-42, 68-90, 110-132, 144-166,
FT                   170-192, 213-235, 268-290, 297-316, 354-376, 397-419 and
FT                   429-451"
FT   CDS_pept        complement(join(962984..965277,965361..965991))
FT                   /locus_tag="TA06965"
FT                   /product="1-phosphatidylinositol-4,5-bisphosphatephosphod
FT                   ie sterase"
FT                   /EC_number="3.1.4.11"
FT                   /note="Tap349e08.q2ks7.cand.41 - score = 47.16"
FT                   /db_xref="EnsemblGenomes-Gn:TA06965"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73325"
FT                   /db_xref="GOA:Q4UHW4"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW4"
FT                   /protein_id="CAI73325.1"
FT                   /translation="MSKQINNQWISNLSAGCSNDSPAISEFLSEHLKRISLCDSLNLIF
FT                   KGGYLRKWRRSSRLTLSDPKNGTKNLALPYINATPIYSSQSHGRSHELFFWVSKVCDTL
FT                   FLRWQSRRKRSSESIFPLCAIKSIHRGDELTYFDHRDPFDGVSLKFIFVINGKVSLQLG
FT                   AQSETDALLWISGLYFAARYARNEFSVHWITNSELFNSFLQSCKKNAKPGDCDFDTKAL
FT                   KRCLNDKYVGLLYMSNYDKIKAEDDDWLLPHNLAQFVEYLVTFGFVSRPENADVITSMV
FT                   RRLLEFRNNINAGFVQMTSMIDSSAKPAHIIRVCIEHFDSLNVQYKVLKKDIQAIYPEL
FT                   TDQECEDMFYNIVRQCALRVILRTTTEKSDFIQQISPADYESFLRNIQSSDSNEVVANV
FT                   IQIQSWLSPLSYIPDTPPEVRSGGCFRKVNVPRIPVRFLTVLGFNWSLTSYFNSICIPQ
FT                   DSDEICSVLSLKLTDFWVSSSHNTYLVGDQLGGSASASSIAEALLRGCRCIELDCQDGS
FT                   EEPVLCHAWKNCHLTGSVTLREGLIAIKEAAFENNKLPVILSFEMNCSDDFKFKTFELV
FT                   TQILGDELLTLDDDDPIDIVVRCELGSLLNKFIIKAKHKSSDSTFLGPGETAWQSLITL
FT                   RGLDIDKLEDNKIDSIKRNSVFAISETKFLKMSKDQSLITALSERCFVRVYPSATRLAS
FT                   TNFCPLKPWSYGVQFAALNFQSYDRSMLINHGRFYNSFGYVPKFIYKNYSDDFVEPTES
FT                   NTNIKNSDKINNDIMLTLHVLSGSQLPTSTGFQNQNYSSSFSNVLYSIGEQNMFLNKSN
FT                   LNLQTFAKFKEKRKLKQAIKEGLELDEEESGDTTLFNVINKSAKTVLEYKQKVCPFVEV
FT                   SVVGVDETTFTTKPVNFNTFNPVWSDSNPPFIFKIENPNQAIVLFYVKHYDNISSEIIG
FT                   QAAFPVNRLRPGIRWVQLLDSKFMEIECSGLLVYVEMEPLHKDQ"
FT   tRNA            complement(966554..966624)
FT   CDS_pept        join(966629..966746,966964..967028,967581..968942,
FT                   969153..969398,969446..969660,970077..970570,
FT                   970659..970967,971037..971095,971425..971722,
FT                   971796..971924,972044..972380,972414..972735,
FT                   972836..972957,973313..973574)
FT                   /locus_tag="TA06960"
FT                   /product="myosin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA06960"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73326"
FT                   /db_xref="GOA:Q4UHW3"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW3"
FT                   /protein_id="CAI73326.1"
FT                   /translation="MNVVYFYGEFNDIICNTYNKYILNFNKIFYYFCSVRSCMSLKLTS
FT                   GTHIFVPCKEEVIFTLTLIKYDYIGDKEPHVFSTASDAYYGMLDGFCQSILISGESGAG
FT                   KTESTKYVLKYLCSNLIRNKVNVDQYYLSTPQSNLDSDESVPNTARNNKAKNNKLQNNK
FT                   PTENVEMKVLESNPLLESFGNAATLRNHNSSRYGKYIELQYLEESSERLKLIGATIQTY
FT                   LLEKVRIAQQQAGERNYHIFHQLTAAFRKYGSKYTINFMDNTVNSKEENSNLENDSVWD
FT                   LDLSNFEGEFRIVPNCKPIGNLDEDYDLEFFKENLRAMKTLGLDLEQVNVIFSIIATIL
FT                   HLTNIEFVLNVHCSEGAVVSNQQENSISKISQLLQVDESDLLNVLLTRSIKTVNEFYTK
FT                   PKRVDEAIDTRDAIAKNMYSILFDFVVAVANSAVDSKQSEVDVSTGILDIFGFECFQLN
FT                   SFEQLCINFTNETLQNFFNTCVFKYEQQLYTDEGITWNPLDFPDNQDCIDLFKLKIHRF
FT                   DKVRTDQSSFIVNHFAGGVKYKIDGFLEKNKDRLSDDSIHFITNVKNDKIKLIFESLIT
FT                   SNQVPIHIYNSVTNSILLHNPNLTQLMKKRKTISTQFTTQLDQLMNKIGKTEPHFIRCI
FT                   KPNQLNLPNIFQKNTVNEQLKYNTNSLVILISCLNNIYEILFNSLQELRNRSATVIQKT
FT                   VRGYKQRKAYLECLHKIRTLQIYLKYKVRKIREHRRRRLLAAITIQSTFRMFMARAEYR
FT                   AELAKWVRLQSLFRNIILRIEVRDKYVNNSATVIQSYFKAYLQRRYYKQLKSSAIKLQL
FT                   KWRSILARNELKKLHQESKSLGTMIERNQILQEELKEDRMKMMDYESKVYQLQAKITSL
FT                   KGQLERERNEKGLVIQEKEKLVSNNKDLVDKITHLENTNSKILNDLKMIKQFISKEISI
FT                   PQRTTNNVREASPMSRIDSYQQLANTLNLYTLYGILGDDIGVSVLEIPGEYIDDDRTRG
FT                   VLKNSYLIAVCFDPSSDRSIIECITMVKIIMSYVQLKYTSIVIVQNNLLLLEESKFQTD
FT                   LSLIHKFAFENDILFVKVDNLLNFIKKTMPFIESKKSLRTILNIKKSSPKNVVRGKSIT
FT                   KSPIAFFYERFRNFLTGISSSGTQTRLLQATVAERESVKLPPLGLKRVATVSTYESAVT
FT                   SVAVRSEEPTDQYVVVAVGRRNGSINIFHVHRTTVEHKLLNSSAKDDEELCNLLNGDVI
FT                   YDENTKVVDYLTLKMHSKAVTCLTFSKLNVDELLSLSVDCTIRAWNVLTGELIKVFNDS
FT                   YPGLSIQFHPLQPNYFLSCNSNPTLRIVDYNEGTVIQKTKIKSEIRCLIFDDTRLNVLA
FT                   GTERGSISVYESHSNIYNVNNNHVALPLRSCYTKYGGGWCVSGSEDRNILIFSMSDENI
FT                   PFSIPFHNGPVVCTAVNQSDTVLVTTDSKGVVAFWRRTFHVKS"
FT   CDS_pept        complement(973702..975354)
FT                   /locus_tag="TA06955"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.40 - score = 22.63"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06955 by TMHMM2.0 at aa 19-41, 138-160, 170-192, 232-254,
FT                   292-314, 334-356, 417-439, 459-481 and 491-513"
FT                   /db_xref="EnsemblGenomes-Gn:TA06955"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73327"
FT                   /db_xref="GOA:Q4UHW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW2"
FT                   /protein_id="CAI73327.1"
FT                   /translation="MSTCPSCSDQAGVGQDQCVILNASYVFAGLAMMLNIRLSYSSAPY
FT                   ALIRFRLPENLFSVFVRRMASALELWCLPSMLLGNIMEYSLKGYYLNYYEKGNYATKDQ
FT                   HHYNLVENGKGGNSDDITNSDLLSARNIKNGVIIVPSIVTQWLNFITYVILLFVYIAGG
FT                   DQGHLTTFYFVIAISGFVFGINMVLLYAVDWNYIPVYMVGENSFPIVTSFMHYVTTLIF
FT                   GNRRKWNSDYLIACIDIGVAIIISLVAAVLWTLAYGIFTTTPKKAGTANTGDTLATYGH
FT                   ILTESFDNSTVRWIAIISPTLMVIVGMGLVYAIYPGIAPGMIVPFYLVDKIEMVLLIAT
FT                   FFPPVIVALLNRGVFSEGAKKYSPKSIYVYHSQDDNGMGGWRPYSEHVNIQDPGVPGQV
FT                   PDFNCKTNAEANAVVHNWFWHLFDILIVIKISLAAIFIYSLHYRDSSLSRAIVNQPKMS
FT                   TALSIIFYMCHEFLLALGFPGIIGNNGSTYVMLPAQYIGALFMIFLAFYSEGYIIEYKS
FT                   HDPAHWPTTGMTKWNAFCYWCKRASKITIRILK"
FT   misc_feature    complement(join(973816..973884,973912..973980,
FT                   974038..974106,974287..974355,974413..974481,
FT                   974593..974661,974779..974847,974875..974943,
FT                   975232..975300))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06955 by TMHMM2.0 at aa 19-41, 138-160, 170-192, 232-254,
FT                   292-314, 334-356, 417-439, 459-481 and 491-513"
FT   CDS_pept        complement(975546..976937)
FT                   /locus_tag="TA06950"
FT                   /product="chromatin assembly factor subunit, putative"
FT                   /note="Tap349e08.q2ks7.cand.39 - score = 21.45"
FT                   /db_xref="EnsemblGenomes-Gn:TA06950"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73328"
FT                   /db_xref="GOA:Q4UHW1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW1"
FT                   /protein_id="CAI73328.1"
FT                   /translation="MDSVILSGPSGCKIRRKYPIPSFDQNLPDDYSTSFYNNDTALRNN
FT                   ELNGVEEEELDPYLIWRRNAPFLYDSVSLYNLDWPSLVVEFMTDTFKIKNGSVTQRLLL
FT                   GTHTSSSDTEFAMVAELKSNVYTMKECLNTCENFNQFKAVSSSSSVGSNTSSGTQGILD
FT                   IKAKIVHEGEINRISQVPGAHFLFVTQSNNGTLYLFDYSKHPSSPRDLKVSIPQLVLKG
FT                   GHSSEGYGLAWNSTNQLVSCSSDGTIALWDLNSSSHNKTNCLNGIVDGIGIISPVSTYN
FT                   TMDSTHNCDNVGLNDVEFINDNVVLIASDDTNVHLMDLRTNSTSSNSKFSIGSSVNCLS
FT                   LNKFDKNYFVCGCDNGKISLFDTRMDSNLLVIDHHKDSVNQIEFNSSCCGLFATCSNDS
FT                   TVCIFDLSCRGDELRFVHQGHKDQVNDISWTKLDYYQSSHLGFTLASVSQDNLLQCFTP
FT                   NYFSL"
FT   CDS_pept        complement(977210..977797)
FT                   /locus_tag="TA06945"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.38 - score = 9.65"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06945 by TMHMM2.0 at aa 15-37 and 58-77"
FT                   /note="Signal anchor predicted for TA06945 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.007, signal anchor
FT                   probability 0.925) with cleavage site probability 0.004
FT                   between residues 33 and 34"
FT                   /db_xref="EnsemblGenomes-Gn:TA06945"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73329"
FT                   /db_xref="GOA:Q4UHW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHW0"
FT                   /protein_id="CAI73329.1"
FT                   /translation="MTKKNIFDSLHMHYLSVIYALLTLFYLYLSINSYNLLYLLIYKLP
FT                   STIHTYFMMKGLHIFNLIILIIIYNGGIYGYIKGDVAQRGIDGDTVERVFRIADQIGRY
FT                   SQSVPNMFRVVKKNLESLEREVKIKALLPSSSRIEAFRMICEPFNRFLTRSPKDYFIHN
FT                   PPRGTAYNVQLNNAKEVVREIYRQIQRLWLDG"
FT   misc_feature    complement(join(977567..977626,977687..977755))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06945 by TMHMM2.0 at aa 15-37 and 58-77"
FT   misc_feature    complement(977699..977797)
FT                   /note="Signal anchor predicted for TA06945 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.007, signal anchor
FT                   probability 0.925) with cleavage site probability 0.004
FT                   between residues 33 and 34"
FT   CDS_pept        978189..980465
FT                   /locus_tag="TA06940"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.82 - score = 41.60"
FT                   /note="GPI-Anchor Signal predicted for TA06940 by DGPI
FT                   v2.04 with cleavage site probability 0.10399999 near 736"
FT                   /db_xref="EnsemblGenomes-Gn:TA06940"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV9"
FT                   /protein_id="CAI73330.1"
FT                   /translation="MENALERFISLAPKDVIALLCNFLDFSEFLSLSSASRPIRAALVN
FT                   HHLFWFNYYTKNVHCRTYSDKNVELNGVERSSNKYQLKMPIIDNITKGTDPMSRLLNSA
FT                   RKVEIMKSNNTISSNPMLNLGILDNFKRSRWKGQFKQYVEQLSKIIGINSLNSAMIVHS
FT                   LGSNPFLIISSQFNSISPVYNRYNTTNKQYNNMYNGYQSVYSICGYDTNEDKLICSNVN
FT                   VALKDIRYEVKLCTWLRFDDSSYSPDSSIRSMSTRLGYVPKVLVILCDTNSGVGRSNKQ
FT                   KVKAGKGKIVALFYYYDEDSGFINIPSMTLKMYINHITTDATPKSIGVDAVSSLDVYGS
FT                   LGYWDGREIIFRNLNIFVGTVSGVIYHRAVENNFIALETSERITTHEITSLRYVFSQGK
FT                   SILIVFSYNRFLGLVDVSTYTWHLMDCVNDSVVAFSVDIANCLLGYSLGHSNKVNFIDF
FT                   YNFTNKAQYLVPKPPTALLALERHSKWAVIIKNYIRILIIEFGPDSTNGVNGTNNCLIN
FT                   NFDSVNVPNKGDLRIKSVSTLNGHVGEIRECVHDGWSKLVTIDTLHNLFVWDYTACCKI
FT                   FSFSLVSDFDKSFNHCYYSQDSGPETPHNGYNTPNSVYTNSRYGSNTVYVSVRNTPVQN
FT                   TSRNTPVYNSTRDNVSTGRESGRVEYKISLNVMNKLGSKPEVKDAIDDYLYSYESDPDA
FT                   SPYSVKVDKTPPRGVKYKNAVPASNIKGLLDPNKKGQKYCVDVSVHSLVIYYQSCNVLQ
FT                   VFSFK"
FT   misc_feature    980394..980399
FT                   /note="GPI-Anchor Signal predicted for TA06940 by DGPI
FT                   v2.04 with cleavage site probability 0.10399999 near 736"
FT   CDS_pept        complement(join(980580..980899,981026..981179))
FT                   /locus_tag="TA06935"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.37 - score = 12.70"
FT                   /db_xref="EnsemblGenomes-Gn:TA06935"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73331"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV8"
FT                   /protein_id="CAI73331.1"
FT                   /translation="MAFRLNQNNFFHRGSGNDSSKSYGKGSNSSFERYPTREDSKDSSK
FT                   DDSTNNKSTQQQSSEKPKDDKGREHNGPGHQNGSVDDITKMLLKYHSTRFKECKRLANS
FT                   TDTNETESKGSVSPEAKTESPEASHKSYRYNYSYRSSYSRERTHDRHKFKSDR"
FT   CDS_pept        complement(join(981583..981712,981902..981974,
FT                   982006..982225))
FT                   /locus_tag="TA06930"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.36 - score = 11.49"
FT                   /db_xref="EnsemblGenomes-Gn:TA06930"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73332"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV7"
FT                   /protein_id="CAI73332.1"
FT                   /translation="MVIRAPNSIAWPCKKLIPCKSKTRSTKVVCKSVMKRRNGRKIRSV
FT                   EAFVEIDLTSQGKNGSTLNSKQTNSPKNIGTMEEYLRNSNLKMNDSEKTDRKESLVPSN
FT                   IKSKKEDDDVETDDKTIEWYLIPLFIPFSHMWCQYM"
FT   CDS_pept        complement(join(982408..982601,982632..982705,
FT                   982770..983470,983500..983755,983805..984217))
FT                   /locus_tag="TA06925"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.35 - score = 34.68"
FT                   /db_xref="EnsemblGenomes-Gn:TA06925"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73333"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV6"
FT                   /protein_id="CAI73333.1"
FT                   /translation="MIRRYQKWPIYATKRLVEIIPQLCLQGQKHTVVANILFHLLPTNS
FT                   HTSSTEIAHCSDWNNLFCNDYMETLNYLYNNHYKLNSVSNSTYSLIDRVKPDCGMKEII
FT                   FSPFNMKILNEVSPKIYSSQRDLLISSLEYSLLKFSKYYTNVKENIDINGLYTSVGIDF
FT                   LKLIDLLNLDHKLCELSPQNVNDIFYTLFKGDEFNRITALHFLNSLLNNTNNGRKLDRN
FT                   EEMDISTPLLHGSVRPLDILVMICEVECKKSLELFLNIIPRHMKPQCFLFLKSVDKHTG
FT                   NFSSKHSNYKLYIGLLKYEWAFNECESMLNTTNYQSISPNDKTKPKDYTFDENLEYELV
FT                   VNTVASLYKAFKTIKALVSNNSQTTEENELNCVKLPKNMISVHFEPDIVVVSTKKDMFV
FT                   VDLLIRDTLYRSSLYELLNFIWACNIPKVGHQFLLNIAKLSTEFNQPFKHYNHIIDLKD
FT                   NRVKRVKAYRDDTLQEITHFKRTSIKKSLRGILQEYNIPMPIKSRWNTHLRPIPVDRIK
FT                   YLCIVGRGILAVEYRLRSEGWSPSSTLT"
FT   CDS_pept        join(984505..984861,984954..985580,985649..985759,
FT                   985796..985885)
FT                   /locus_tag="TA06920"
FT                   /product="eukaryotic translation initiation factor,
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.83 - score = 33.70"
FT                   /db_xref="EnsemblGenomes-Gn:TA06920"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73334"
FT                   /db_xref="GOA:Q4UHV5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV5"
FT                   /protein_id="CAI73334.1"
FT                   /translation="MTNDLNGDSSYEISEDYPLVESFEDLGLKEEILKGIFAYGFDKPS
FT                   AVQQRAIKPILEGRDVIIQSQSGTGKTCVFCLGALQTVNSNVRETQVLLLSPTRELAEQ
FT                   SQKVCLALGDYCNVEVHCCIGGKKVSDDIKALESGVQIVSGTPGRVNHMITDRHLNTRN
FT                   IKQLILDEADEMLNRGFKEQVYSVYRYLPPTIQVVLVSATLPHDVIEITNKFMNNPFKV
FT                   LVKRDELTLEGIKQFFISVEKEQWKFDTLCDLYESLIITQAVIFCNTKEKVDWLAKKMK
FT                   DANFEVSKMHGEMSQKERNDIMQRFRKGESRVLISTDLWGRGLDVQQVSLVVNYDLPNS
FT                   RESYIHRIGRSGRYGRKGVAINFVKDDDIRILRDIEQYYSTQIDEMPMNISELL"
FT   CDS_pept        986013..987335
FT                   /locus_tag="TA06915"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.84 - score = 30.29"
FT                   /db_xref="EnsemblGenomes-Gn:TA06915"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73335"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV4"
FT                   /protein_id="CAI73335.1"
FT                   /translation="MNSVVTNKSKLSNSQDLGLPYELINRILNLICKIQLKNFVTRDYK
FT                   EYEWEIKTELIDFLISKTKYNEEQVSELIRRFKSIRFLNPNNTISNLLNFIFGSNKDEN
FT                   DDFTIKPNQDYVNNLDKKLYEIKLDKNNEKRMLCNHVSLIYEQLVELKDKIERSKPSYR
FT                   PEYFMKHCLTNYEEVLKKEIFDIHEMNKVNLVSDRRELIEFLFKYCYRSGYKLSELIMI
FT                   PLYDVSTKNEAFVNFNYPTMLTILYVNDIESVGKNKKNSDKDLEHLEECKVMFSLMNLG
FT                   KYSRIEEGKFESIIPITPISSIKKITIYTRTFKKSINHGLNVDEDEGNSDHIFKCKYSF
FT                   LNPLRKSNKYELKFNNKLEEFDEVEEKVDITILFIQLKGDRGVEYTIHSPFLDEKELTE
FT                   IIKQVFNNICNEHPKIKDQENFNEFLKRCYMHMGSNFIFIN"
FT   CDS_pept        complement(join(987393..987648,987703..987884))
FT                   /locus_tag="TA06910"
FT                   /product="clathrin assembly protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.34 - score = 9.50"
FT                   /db_xref="EnsemblGenomes-Gn:TA06910"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73336"
FT                   /db_xref="GOA:Q4UHV3"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV3"
FT                   /protein_id="CAI73336.1"
FT                   /translation="MIKFVLLINKRGQTRLSKYYTHYSPEERTLLESELLRKCITRNDN
FT                   HCPFFTHKDTTIVFRRYASLFFIIGATSDENELEIYELIHNIVVALDKHFESVCEIDIL
FT                   YNLEKAHLILNEMIANGRIIECNIANVLYPLSVLEKLRQSD"
FT   CDS_pept        join(988146..988476,988513..988574,988617..990740)
FT                   /locus_tag="TA06905"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.85 - score = 51.51"
FT                   /db_xref="EnsemblGenomes-Gn:TA06905"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73337"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV2"
FT                   /protein_id="CAI73337.1"
FT                   /translation="MDLSGDYSDLFNDESLFKVIDELDHLFPNDGKKSKSSDSVLPPKE
FT                   CNLKDQSYSINSTRYDTETSSVSLSDEHFIKGSSLWRSYQSKLDLHISTVLDPFIKYIL
FT                   ETSITEGQKDVYFTKKKEYLTFLINQLVVSYKCEWKQIITGERKAGTEGINAEVEPDKG
FT                   DLYQQISNEYDNLSRGITSSSSIETVVDNNIGNEDVIGEVYIELGHRPEYIELLYIKGM
FT                   DYFYHFMDFLLMLIEKTSYNYKIVQALDLLTNVIKVMPELSILLVVPKNKGTQKYLHIY
FT                   CVDSKILYEKRCYFKLLVKNVEVKLGLNNSVLDTYKQCLEGTFVPFYMTKSSEHDDLME
FT                   QLLVVYVLERLLSLFQLLCENLFEFVQLKLDKAMRTSISKKMKKYLFIPFLGIKTLHEL
FT                   FLPFSGNFEYKNLVKVDYTSLFKKYMYPPPPLYLLRLKLLNILKLLVYSGFVKYKGNFL
FT                   TANRTIIQSEPISGMNQKVDKVLVSYFHMFSFGTSFLLMGEFFKRSKENIAIFFGNYLL
FT                   LMPHFSLNYAYINENMVIEYNVYRLQRAVIDFLLALNESRVFLDENIMNVKSLNLTQNS
FT                   VVKRILSLLIQYVTGTTLSEIQDAENDFNIDNEFNIRNRPVINCNHDCKIIEPYNPSTI
FT                   SKFLLDISCNLVDRPDDNEEEIVGLDMVEQVVDVCIYEEYDKALKLGLDLSKLYVPIEN
FT                   RTVVKYAINNTPQIKLMKHFTSPNVLSDYELELLHQHKKDRKPSSRNKEKLMRLDTMYT
FT                   TTRRLSHDSTVTVDDGTTNIFNNLEGCGINCIINKHIIEEPRFKTVFTLRKILVMKLFE
FT                   TICSFPSKHLGDFEPIYISFLKQIFF"
FT   CDS_pept        990940..993207
FT                   /locus_tag="TA06900"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.86 - score = 38.10"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06900 by TMHMM2.0 at aa 29-51, 119-141, 151-173, 180-202,
FT                   217-239, 510-532, 547-564, 617-639, 659-681, 688-710 and
FT                   725-747"
FT                   /db_xref="EnsemblGenomes-Gn:TA06900"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73338"
FT                   /db_xref="GOA:Q4UHV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV1"
FT                   /protein_id="CAI73338.1"
FT                   /translation="MEASAEPEHVYTCPSCDNKPAENDRGNCPLLMAAYILAGLAMMLN
FT                   IRLSYSSAPYALIRFRLPENLFSVFVRRMASSLELWCLPGFIIADTMELAIKLVIGTEF
FT                   TNWNNLDSKKLKFHWIIIPSIIAQWLNFLTYVILFFVYLAGDDQGHLTTFYWTIAVSGF
FT                   VFGISNPLVFAADYNYIPIYIAGENCFPALTSFIHYITTLIFGNRRKWDSDFIIVFIDI
FT                   SVAIIISLVAAMVWTLAYGFCRDGGTTTDENGTITYITPDDITAENIKSISVTEGGKTT
FT                   TYTKVPKGGPTAPDILTLTIKKKGETGGTAAPPAYFKQGEATPTEGPANTITLNYTKDG
FT                   KEVAILNITITPNTDLQDTADTPECSVKVDTEGKKLTINYGDKCIEITLTTEALKNLGN
FT                   KCTVKVDPPPNHLFIKYKDANGSVTKKGPINENAKKSPEKIAEEIKKTANDDNKYYQVT
FT                   DRTTKIRYTFKLTKQLGTAPIAGADAKIIVHYVYGHILAEGFGKITDIKPYVISPLLIV
FT                   LVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATIFPPVIIAILRKEAPEWSPQHYV
FT                   FHKPGDANNGFHGWTTYKSHIQGSSGFGSCDSSEPDVHAWLWHFFDLLMILMIILAYLF
FT                   IYSLHYRDSNISRSIVNQPKMSTALTIIFYMCHEISLAVGFPGMVSNAAEYTVLAQMIG
FT                   AFLMVFLALYSEGYIIEYKSHDPADWPTEGMWYLYGYYQLNPDFFIMIKFNVCSDGYCD
FT                   FK"
FT   misc_feature    join(991024..991092,991294..991362,991390..991458,
FT                   991477..991545,991588..991656,992467..992535,
FT                   992578..992631,992788..992856,992914..992982,
FT                   993001..993069,993112..993180)
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06900 by TMHMM2.0 at aa 29-51, 119-141, 151-173, 180-202,
FT                   217-239, 510-532, 547-564, 617-639, 659-681, 688-710 and
FT                   725-747"
FT   CDS_pept        993322..994827
FT                   /locus_tag="TA06895"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.87 - score = 17.31"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06895 by TMHMM2.0 at aa 24-46, 128-150, 163-185, 189-211,
FT                   232-254, 278-300, 313-335, 360-382, 402-421 and 431-453"
FT                   /db_xref="EnsemblGenomes-Gn:TA06895"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73339"
FT                   /db_xref="GOA:Q4UHV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHV0"
FT                   /protein_id="CAI73339.1"
FT                   /translation="MAKCPSCAGKQAGMAHKQGAGDTCGLLNAAFVFAGLAMMLNIRLS
FT                   YSSAPYALIRFQLPENLFSVFVRRMASALELWCLPSMLLGNIMELALKTYYKLDGYQAD
FT                   TGNNGGDNLVKGGDFRTPRLAKLIAIIAPSILTQWLNFLTYVILLVVYRGGGDQGHVTR
FT                   FYFVIAISGVVFGINMVLLYAADFNYLTVYIAGENCFPALTSFIHYLTTLMFGNRRKWN
FT                   SDYVIVYIDIGVAIIISFVAAVLWTLAYGVYVDNSDTNELKHIFTFGFTDTINEHMISP
FT                   FLMIVVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATIFPPMIVVILQIVDKNSGY
FT                   SATKHSPKYYGGWEEHSLRYWHIIDVLIVVKISLAAIFIYSLHYRESSLSRAIINQPKM
FT                   STFLSITFYMCHEFLLAIGFAGQISNAPEYVLIPQYIGALFMIFLAFYSEGYIIEYKSH
FT                   DPDHWPTTGMTPWNAFCYCRKIPIKITNVNLSSFFTTDIKGVF"
FT   misc_feature    join(993391..993459,993703..993771,993808..993876,
FT                   993886..993954,994015..994083,994153..994221,
FT                   994258..994326,994399..994467,994525..994584,
FT                   994612..994680)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06895 by TMHMM2.0 at aa 24-46, 128-150, 163-185, 189-211,
FT                   232-254, 278-300, 313-335, 360-382, 402-421 and 431-453"
FT   CDS_pept        complement(join(994895..995648,995724..996151))
FT                   /locus_tag="TA06890"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.33 - score = 23.32"
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA06890 by TMHMM2.0 at aa 80-102, 112-134, 154-176,
FT                   196-218, 231-250 and 254-276"
FT                   /db_xref="EnsemblGenomes-Gn:TA06890"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73340"
FT                   /db_xref="GOA:Q4UHU9"
FT                   /db_xref="InterPro:IPR021691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU9"
FT                   /protein_id="CAI73340.1"
FT                   /translation="MNNMEFNDQDLEGVDQYGEGYPYSSTPKTYDSMQFNPSGPVDPDY
FT                   MAEVASPRGESHTPFVGFFSSKLLRSGFTLQTVTLSLMFVFYWAFGGTGIFVFDLYAAP
FT                   ESVKVSKPFHLTVSTLMALYLLGTLYIAMFQVFVTDNSKSVRGFRAGSKILSAAVTLDL
FT                   LSNMLRLVQYVYSYFFMSMKWWTRYQQTKADWIFFQFGSFSNSFALVMYGAAFFYLEAY
FT                   HDEGTSEEVAWINLTLFSLAGLAELFMVFTGYGALFSLFLLLANFSGTFWAFSFEPLLD
FT                   KWSPSLHSRDVNADFVTDDSMVYDPYSQYCPNQNVNDPNLNYENPNQPGMDYHNSAGMN
FT                   YQNDSNPTNTGYQYQEGGFSYPFDQKGYNEFNPVNFNTYQQGNPNYLVQNYAS"
FT   misc_feature    complement(join(995249..995317,995327..995386,
FT                   995423..995491,995549..995617,995750..995818,
FT                   995846..995914))
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA06890 by TMHMM2.0 at aa 80-102, 112-134, 154-176,
FT                   196-218, 231-250 and 254-276"
FT   CDS_pept        join(997386..997497,997528..998211,998244..998551,
FT                   998583..998789,998820..999071)
FT                   /locus_tag="TA06885"
FT                   /product="tyrosyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.1"
FT                   /note="Tap349e08.q2ks7.C.cand.88 - score = 38.12"
FT                   /db_xref="EnsemblGenomes-Gn:TA06885"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73341"
FT                   /db_xref="GOA:Q4UHU8"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU8"
FT                   /protein_id="CAI73341.1"
FT                   /translation="MERSMISQSTDFVKLDQLLTSYQTQNFNNSMYNSIYYGIDCTNDF
FT                   IHEGTLFQLLLLRRFLSEKFNVVLVIGGGTTLVGDPSYKLRRNRNDKFYFSNFVLNKDK
FT                   SEFDTTNEQSIEQIATKILSLPIKIDNTSPDNNNNYALPKVVRVSDLSTDLDVSSEMCN
FT                   PYRVFIVNNRDIYNRVNLMEYLETVARNMNVGRMLSRDCIKIRTVDKDGTGYKKSINMD
FT                   LSELMYMSLQAMDFVYLAENFNCKIQLGGNDQLGNIISGIELASSLGIGNIFGITTPLL
FT                   KDKFGEKISKTGSNCFLKITNKISPHEFWSHFRSVDDSVLEKYYHYLYSYIYIWPINNI
FT                   LYSYLKWFTDVSLDKIKETMAEHYNSGKVLLADELTRLLYGNQMVELIHKFCMSKQFSE
FT                   LKPFLTNFDTNMEEFESFINFSKAVPHINLTSQQLSKVGVKLLEVLDAVRVPQFSNACF
FT                   HSNKKFIKEGGCRVNGNVVTDVNYTLTEDDVVKLTSEGNHYKYISIQMGNRRLYFLIVD
FT                   YSL"
FT   CDS_pept        complement(999156..1000460)
FT                   /locus_tag="TA06880"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.32 - score = 18.33"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06880 by TMHMM2.0 at aa 13-35, 50-72, 84-106, 116-138,
FT                   181-203, 223-245, 258-280, 304-326, 345-367 and 377-399"
FT                   /db_xref="EnsemblGenomes-Gn:TA06880"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73342"
FT                   /db_xref="GOA:Q4UHU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU7"
FT                   /protein_id="CAI73342.1"
FT                   /translation="MSGDETLKKTAYIFAGLAMMLNIRLSYSSAPYALLRFMLPENLFS
FT                   VFVRRMASSLELWCLPGFVIINLMDLIRTHAYSGKDWGYNYLSIVVQWLNWLTFVILLV
FT                   VYRAGGDIGHLTAYYLVIAISGFVFGLSNPLVFAVDYRYLAAYMAGENSFPMVTSLIHY
FT                   FATLMFGNRRKYNSDYLIVGIDIWVAIIISFVAAVLWTAAFKDKKVEGGGAPEPPHLPD
FT                   IVSPVAMVIVGMGLVYAIYPAIAPGMIVPFYLIDKIEMVLLIATAVPPVIVALLREYAQ
FT                   QHSPQNYGSDGFQKWSDYSAGKVYHFFDLLIVIKISLAGIFIYSLHYRDSNISRSIVNQ
FT                   PKMSTALSIIFYMCHEILLALGFPGIIGNKGADYVVLPAQYVGAFLMVFLAFYSEGYII
FT                   EYKNHDPAHWPTEGMTRWNAFCYWCKRASKKIIES"
FT   misc_feature    complement(join(999264..999332,999360..999428,
FT                   999483..999551,999621..999689,999726..999794,
FT                   999852..999920,1000047..1000115,1000143..1000211,
FT                   1000245..1000313,1000356..1000424))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA06880 by TMHMM2.0 at aa 13-35, 50-72, 84-106, 116-138,
FT                   181-203, 223-245, 258-280, 304-326, 345-367 and 377-399"
FT   CDS_pept        complement(join(1000633..1000849,1000879..1001142,
FT                   1001201..1001300,1001333..1001726,1001756..1002215,
FT                   1002253..1002746,1002779..1002874,1002939..1003253,
FT                   1003283..1003408,1003448..1003576,1003607..1003707,
FT                   1003769..1003983,1004065..1004501))
FT                   /locus_tag="TA06875"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.31 - score = 77.81"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06875 by TMHMM2.0 at aa 387-409, 413-435, 512-534,
FT                   549-571, 813-830, 845-867, 888-910, 925-944 and 1066-1088"
FT                   /note="Signal peptide predicted for TA06875 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.892, signal anchor
FT                   probability 0.103) with cleavage site probability 0.851
FT                   between residues 30 and 31"
FT                   /db_xref="EnsemblGenomes-Gn:TA06875"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73343"
FT                   /db_xref="GOA:Q4UHU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU6"
FT                   /protein_id="CAI73343.1"
FT                   /translation="MKNKNEANKFSLRKLNVLFLILIIFGVCRCEDEDEIGIICIKSYL
FT                   KNISLNEAELKFDHKKFKYNVEIEECIESIDLTLDIPHWRDASSDHIEYNAKGNFFSRL
FT                   FKSHRNGIVFNNNDNINVTINKDPLYKTSNPTVKLPLKCGSNNLFVIKIDVRDKFEAFS
FT                   FQYKINIKILTTTMVNHLISLQAFSGTAKLDCEPSLSRKVFEYSYYIFPSMSNKIKIIT
FT                   KCKYGTARINTTKANEFSFSMRDVNKTLEVLCPNLAVKRFGSTYKVYFVHSLDGPVPPP
FT                   ISIKSVYSQEKCQVDNSDNVVKILCSENFPNNTKLLFETDSRYKYEIIQKSKDSEESEE
FT                   IFNGKPTSVINLKAVTEIRGTAGKSITKYNFQKAVGHPYMGRFYKGLIYFLVLIPKWII
FT                   ISTNLFQTFLEHRFGMAFHISPIIGPFLLILSENICSISTHNDSDMVDYCNSFSLLKIH
FT                   NKNSNFTLSRPLFHNILIMTVIYHLTMKGNSKIVQKIKHYIPPSLIVDSLGFKFCFYFL
FT                   YILSVCFLLFKYFQMLFSKNSRFNILNNDKRLGFSGILSILPSMILIATVLTSFTKYLL
FT                   NDFKKTVLKIKNREVVWVVDDSNPDQKDNWLTKLLSKLNINKYNGYWSDKNCNVLCAPF
FT                   TDCKLGKSVPFLKNKSSRKIATIKNINIKFELCNDYELTNYVLPELIELDTNKIDDVIK
FT                   LNDPMSIFKGISSIAYAENNDLVFGNLEGLSEISSKKETYVEIQSLETINQDLNSLIVG
FT                   KVQNDDITYYIYLNVLRNTENKIIDKFLPLKVSVDQIMSSDMVNSHSFNRNVRLLMIDK
FT                   FIFIFKGINALFFIFSMRHNSPTLNLIRTTLNILFTLYFIGISHLVFKLIKFIIFTQLL
FT                   FFKRIFYSAARPYLNIFDNLFGSLCLALGTLYIFKFGYYEFINKPKSTGAIDKLIIVSI
FT                   IIILMYSLLYSILYSIDLILSLKHTKSNEEYKSNIDIILYIKELRLSEKISGYCEIPVM
FT                   IGTICLYEENIILRDETLDYQRPTIAVECNIICTEFFPFLSLFNNRGDYFSFSKEQFTY
FT                   AILDRYLDEIYNKKSSMIIARYLLSFKICLVIYKILSLTIRNATASRYKLLDNIQLKLV
FT                   LYSIYRIY"
FT   misc_feature    complement(join(1000717..1000785,1001236..1001295,
FT                   1001370..1001438,1001499..1001567,1001610..1001663,
FT                   1002453..1002521,1002564..1002632,1002957..1003025,
FT                   1003035..1003103))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06875 by TMHMM2.0 at aa 387-409, 413-435, 512-534,
FT                   549-571, 813-830, 845-867, 888-910, 925-944 and 1066-1088"
FT   misc_feature    complement(1004412..1004501)
FT                   /note="Signal peptide predicted for TA06875 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.892, signal anchor
FT                   probability 0.103) with cleavage site probability 0.851
FT                   between residues 30 and 31"
FT   CDS_pept        join(1005091..1005213,1005255..1005342,1005384..1005586,
FT                   1005618..1005746,1005776..1006034,1006090..1006299,
FT                   1006360..1006463,1006514..1006605,1006666..1006864,
FT                   1006931..1007038,1007076..1007369,1007437..1007718)
FT                   /locus_tag="TA06870"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.89 - score = 58.81"
FT                   /db_xref="EnsemblGenomes-Gn:TA06870"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73344"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU5"
FT                   /protein_id="CAI73344.1"
FT                   /translation="MEQTKNSSNTLVQSPLSELPFDHIIKYSYKYSEDPDFENFKESDK
FT                   IQLFLKFLSQIWSYLTDSSLYNDLKPKKNHKFVPFMESDAIREQLCSNIFKFLDNYREE
FT                   VSPNSKDNDSHSLLTTVAQGHLLTCFKLLSSLIMYNDGELSEFSVYPLTNLVKVFMKLV
FT                   PSAVDLSTLLDFLTDLVKNLSHESCLVFGNFIVDSTEYFSKIFKELELNPTSQRLLQTC
FT                   GAKLIGLVKVFESNFDQFLRDPKYSNNLFHLRFLLAICLPISHLGICNRQSVTTEPKPV
FT                   NKVTQEEWNKLERTTLRSKCESISDYEIATYESLLPSSTTKVPPNQIYDIKSYLNIGEK
FT                   TEKTGFRSVKMPTYEVYSNFCDLYTFLQNPEIILVKTQEYVEELQKNYTKVLSFVNTLA
FT                   ETSNGTVVLGPDLDFVLDEFDGGMCEFANKAMDLTFWSNFLVYSCLSFQNLKSFHKKSK
FT                   ESTTYQLLKDRCATVLDNIYKNVWATIFKIRNLAQTTNCLLDKEQHWINWKLNGCSDEL
FT                   EPVNDSKFELVRSEFSFVPDDEDLDEPETEDKSVLTTLRELEKISHKFGDKDSSIGVNY
FT                   VPMISDMELNKESNYWYIQDSDHDFSKMSCDDQLLMKFNDYCKKLDMDEDPENDISENE
FT                   RSKNNPLFKFRFTRLFGKFHLEKFMEMSRDDLASGSVESMLKAIRETKGEAKVSPTRNQ
FT                   KK"
FT   CDS_pept        join(1008419..1008530,1008627..1009150)
FT                   /locus_tag="TA06865"
FT                   /product="small GTP-binding protein (RAN subfamily),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.90 - score = 20.89"
FT                   /db_xref="EnsemblGenomes-Gn:TA06865"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73345"
FT                   /db_xref="GOA:Q4UHU4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU4"
FT                   /protein_id="CAI73345.1"
FT                   /translation="MAEEVPQFKLLLVGDGGVGKTTLVKRHLTGEFEKKYIPTLGVEVH
FT                   PLKFRTNCGTVQFNAWDTAGQEKYGGLRDGYYIKGECAIIMFDVTSRITYRNVPNWHRD
FT                   IVRVCENIPMVLVGNKADVKERQVKAAHIQFHRKRNLQYYDLSARSNYNFERPFLWLAR
FT                   RLLNKPQLVFVGECAKAPEIAIDPLLVQQSERELEAAANVAIDDDGDM"
FT   CDS_pept        complement(join(1009270..1009429,1009501..1009679,
FT                   1009712..1009899,1009943..1010118,1010160..1010791,
FT                   1010856..1010945,1010980..1011154,1011201..1012254,
FT                   1012293..1012353))
FT                   /locus_tag="TA06860"
FT                   /product="DNA mismatch repair (MLH1 homologue), putative"
FT                   /note="Tap349e08.q2ks7.cand.30 - score = 71.90"
FT                   /db_xref="EnsemblGenomes-Gn:TA06860"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73346"
FT                   /db_xref="GOA:Q4UHU3"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR032189"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU3"
FT                   /protein_id="CAI73346.1"
FT                   /translation="MEIPSYTSNKSIKISMCGNKISVIRPLPAEVVKKIAAGEIIARPS
FT                   SAIKELIENSVDAGATEIRVNLSSNPLDFCEIIDNGSGVSEKDLMIICQRYTTSKTTDS
FT                   IEGVRSLGFRGEALSSLSQNSHVTISSRTENENMRTVMTYSECEPVLDEIRYEEGPRGF
FT                   HLKYENLFYNYEIRSKSLLSNINSEFISCLHLVQKYSIHFPNINFVFNRTSSPILDLNN
FT                   LNNVSSQQSSGSGSGDSCSSQPNCNFSTSSRFDDYDSSDDELDITLTQKLEYDYHYFTK
FT                   MYDDPKSDDLRTEYIRNVEKVSFDCLRVIKENIKRIYGLKVSNVLQEVVFNNFDDLFFN
FT                   CKGLISHPNQPCKLDMFILFVNNRLIDLPNLRRMIFNTYNDITNNRYRRFVYLSIFVPY
FT                   DQIDSNIHPTKKRIMIENQAEIVEQITKFFHDKITELIKSATTSTSSETSIKIIQDYKS
FT                   SSEYVNKFKERGVKRQPDISYFNSQIYETSVGTDFIGIVDYHSSGSDSECVREVPEVIN
FT                   SPDREKFFLPYYTTTTAAGSPVSTQLETETNNRLSNDLYNSQDTTDMLDIVPVSNPIHS
FT                   THLSHTFRPTQLCHTLNSTGVKFKSQEFETENDCGLDFDDEAEENEFLNDPNLIESFDY
FT                   NRLRVEKMQKISNLSYNQIDDARKLGRFYTMKEVQTLQKPIYCFRMVDEIIQNKDEDLT
FT                   KVVLSSNYIGVIDKSYVLVEYDGGLYMMNVLTVSKECCYQSIIWRLGNIPTYELIMPVS
FT                   LVRLLSHAIHKYYSEYEVSDLVNPRTIKILNVLFGFQIKNMMVYKIPDLLNGYFSGEEY
FT                   LPDLMYSIFIIKQPSLKDLVTQIAKAISFYYVQPPLDLLEDDIDWNYQQFMHRILYSTC
FT                   QKFLDLSIPQRYFRPLMIFSGSITTAPLLSYLA"
FT   CDS_pept        join(1013005..1013052,1013086..1014139,1014171..1015042)
FT                   /locus_tag="TA06855"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.91 - score = 56.48"
FT                   /db_xref="EnsemblGenomes-Gn:TA06855"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73347"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU2"
FT                   /protein_id="CAI73347.1"
FT                   /translation="MTDSTLSVEKSRNKFYETKNRVNSKLGEHLNRSRSLLSDVRNSLL
FT                   RSSNSNSRNSQSYHVESFAPFKEHDYKQNFNCGSEEYKGHLRCDNIDSFRCSTRFSSPC
FT                   YTTKGGALGPSETPKHMTQAMWLLNTSNITCNLSDEMVEDTQEKIPEILLKDPADLLRG
FT                   EGQVTELKNQDKLTEILNDKTEDNVESSTVKKQFDSSISYDILSTLDFHKKTVDNKPFY
FT                   GSDELINKLLNESNNSLDKISNSLNLLNSNNILNPKDNGPVGLTGPASLGGLCNIGGFE
FT                   NLDVIAQEFVRNSGIDFRKQSEALTETLLKLNEKGLYIVLNNCLDKLKETELAPKILVE
FT                   ETKEKKGAEPEKVDNKFPTKTNNDLVTGLETDLLSNFSIIKDTKVGRKMYRLSDFDKKF
FT                   KTSSKCNNSVQVQTDIPEPEEVITPKKIKTNVKVVYHSGSEGRLRPLNGMEGQKKQDLY
FT                   AQKIVSNLKPRLEMRFQSQNENKYMYEEPSDVEAENDVIKEMKEYNRRLEEKEKEKMRK
FT                   WRSQRAPIYDKMMSNLRSGVGHSIMCRGGKRNSRILHNYKAQISNSSPDKSELYYISPT
FT                   NRKSIEAENLYGYDFDHVDSTQENRKLSESTYNDKYHDHKNPQTRLKPKPDLKSLNPID
FT                   HFEQWWKFNTKELNVLREQLSI"
FT   CDS_pept        join(1015184..1015365,1015419..1015563,1015594..1015725)
FT                   /locus_tag="TA06850"
FT                   /product="clathrin assembly protein, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.92 - score = 15.60"
FT                   /db_xref="EnsemblGenomes-Gn:TA06850"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73348"
FT                   /db_xref="GOA:Q4UHU1"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU1"
FT                   /protein_id="CAI73348.1"
FT                   /translation="MIKFFISLNRQSKVRLVRWFIPVTSKEKSSIIQDLSHMVVNRSLK
FT                   QCNFLEWREYKVVFKRFASLYFIACVDKDANELLILEMIQRYVEILDSYFCNVCELDLV
FT                   FNFTKAYHLLDEILIDGDIYDTNKKGILRNMAAQDAMSEKTKTFSSKS"
FT   CDS_pept        complement(join(1015811..1016093,1016126..1016382,
FT                   1016414..1016515,1016557..1016662,1016748..1016872,
FT                   1016925..1017108,1017149..1017532,1017575..1018101,
FT                   1018131..1018175,1018231..1018398))
FT                   /locus_tag="TA06845"
FT                   /product="heat-shock protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.29 - score = 75.16"
FT                   /db_xref="EnsemblGenomes-Gn:TA06845"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73349"
FT                   /db_xref="GOA:Q4UHU0"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHU0"
FT                   /protein_id="CAI73349.1"
FT                   /translation="MDKGKILTSFSKIQLKSNRIPLKLSKSTPISNFSKNNFPNTAFYS
FT                   NFIKSSSGLLKKETYVLNQNLTIYNHVYQFKAETQKLLQIVAHSLYTDKEVFVRELISN
FT                   ASDSLEKLRFLESTREGLSASKVDPDVGYKIRISVDPKTKTFTIEVFGFIQHFYQDTGV
FT                   GMTKEEIVNNLGTIAKSGSLEFLEDPTINAKDKANAIIGQFGVGFYSSFVVSDRVEVFT
FT                   RSFDSEKDPKGYHWSSDGTGSFTLKEVDNLPRGTKIICYLKDDSLLFCNSNNVKKVAEK
FT                   FSSFINFPLFLQEKDKDVEITTQKPLWVEKKSSPEEHTKFYRFLCNTSWGEPMYTLNFH
FT                   SDSPLSIKSLFYIPEDAPNRMFQASNELGVSLYSRKVLIKKSAENIIPKWLFFVKGVID
FT                   CEDMPLNVSRENMQDNQLIAKLSNTIVTKLLKFLQQQSKSDFDKYLKFYNKYSYYLKEG
FT                   AMDEYYKNGKHKDLLLSLLRYESTMNEGLTSLDEYVSNMSPDQKNIYYFCTTSRQMALN
FT                   SPYMETFKSKNVNVLLMYDEIDQFLSMNIQEYKDKKFVSIDSPEEDFEMENKTESSDTE
FT                   KAAESQESQHKLEENDKETLINFFKDNLGNKVNSVKFSDRLVDSPAMITGFLSPALRKV
FT                   MKATMKGSGEDPLANLPCTLELNPNHKTNLKILQLVTKNPEVAKVLVNQLYDNASIAAG
FT                   VVDDPRVMLSRLNQLLELTADFACNQNNNQTN"
FT   CDS_pept        join(1018717..1021010,1021070..1021539,1021628..1021743,
FT                   1021827..1021937)
FT                   /locus_tag="TA06840"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.93 - score = 73.97"
FT                   /db_xref="EnsemblGenomes-Gn:TA06840"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73350"
FT                   /db_xref="GOA:Q4UHT9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT9"
FT                   /protein_id="CAI73350.1"
FT                   /translation="MKGSFDSSHNGFVKVTSFKIKHVELSEYLSLSTGLRVFFMQYETP
FT                   IVNTYIVIPTREETDQGLPHTLEHLIFLGSENHPFRGILDMVSMKSLSSGTNAWTATDH
FT                   TAYTLSTAGIDGTMQMLPIYLDHVLKPLLTEIAFMTDVHHVTSDGSSSGVVYSEMKSRE
FT                   NHSDELMFFEVLDKLYPGDSGYKRNTGGKLSALRSTNIDRVKEYHKTYYKWSNLSVVVC
FT                   GDIPDPQSVLSLLNEQQKLISETTNEEIFGDERLSKKIKTDDDLKEFYENRFLVWNDEK
FT                   HVQKLEKSIVSTIYFPCEEEECGTFTMSWRGPRWEDFELIRAISVMGSYLVDSTASPLE
FT                   KALIHTDNPYGSCVDFSMELFKETYFQLTVKDVPLVKNVKVGTEDKMELLGDKVKSLLQ
FT                   NIYREEFDMERMKMLIKRCYHNYLRQIETCAHETLIDNVIGYIIYGNKREQLEKIIADH
FT                   DIVKILLEKDEKYWKELLMKYFIEPPSVIVKCMPSLERSKVIEREEKELMKQQLKKYGK
FT                   EKLRKNKEMVDEDLKKNNNGPPVDIIEQYKQCDSRLIKLPTYPLYRNFHFKPQDNIDKY
FT                   DENLKNKVNDEVKHEFDEDKKKKTKELYSYNDQLNRIKYPIQVNNIPSDFVRMYIIFST
FT                   CKLDLSIKEKKLMLLLCVLLFESDVRFGDYLMKSEELIKTLMENTTSYGCNLGLSSSSV
FT                   LPDSYSELVTLQFTCPAENYDKLIEIMYNIFYNVEYSKEILTNHVQSLLNSFSKKKRSA
FT                   KTLLKQLSNYLKVDNGSVRYLCSLGQQDQMFKNIMSEPGGADRLEKELRKLHQKIFNTE
FT                   NISVHITADLSKLKKNWLDFWVNLGESGCKNEYNHEIRFWEGGEKMVLNEYFGLKYGKD
FT                   KKLKKETGVLSSLASTDVSYFCVTVPAPYGYNHEDYFPLLTACEYLTMTEGSVYRAIRG
FT                   GGYAYHHRFSYSPSQGEIQMFITEATDLVMALKVTRECLCKYTEPESDLEKELSAAKSS
FT                   LIYRILR"
FT   CDS_pept        join(1022512..1022670,1022729..1022817,1022848..1023041,
FT                   1023083..1023326,1023395..1023499,1023532..1023877,
FT                   1023943..1024164)
FT                   /locus_tag="TA06835"
FT                   /product="histone acetyltransferase, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.94 - score = 35.66"
FT                   /db_xref="EnsemblGenomes-Gn:TA06835"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73351"
FT                   /db_xref="GOA:Q4UHT8"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037995"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT8"
FT                   /protein_id="CAI73351.1"
FT                   /translation="MVTKQVQYKEDPADKNKQPTLNKSNSESQSLAIQKAREKSVILSK
FT                   AREIFSQQFPTAYPMEYELWGKDLMHNTWRRCTVVHARPVDPNKEIPLLKPNEYDYYIH
FT                   WLGLDRRLDCWLTIENIRTMEQGPPKGAQVIHDIEPEFHHDHTGIDDEYLREHEINTKL
FT                   KTIRRIKLGPFLVDTWYFSPYPPPYQNIDTLYICEFCLSFFRYEEELNFHIVHCELRHP
FT                   PGNEIYRDENLAMFEVDGAMSTVYCENLCFLSKLFLDHKSLRHTVFLFIFYVMTEFDEN
FT                   GYHITGYFSKEKHSKNNVSCILSLPQVLDYGLITLQHQRKGYGKYLTAFSYLLSKKEGK
FT                   TGTPERPLSDLGKASYMSYWSEVLLEILFDPKHENLTIQELSQMTAFEPNDIISCLEEL
FT                   GILHTLSNGNSVITILPEKKRELLSKSRTKTRKLYMEKLHWIPYDAHNELTPV"
FT   CDS_pept        complement(join(1024238..1024537,1024569..1024814))
FT                   /locus_tag="TA06830"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.28 - score = 20.09"
FT                   /db_xref="EnsemblGenomes-Gn:TA06830"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73352"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT7"
FT                   /protein_id="CAI73352.1"
FT                   /translation="MEVNSYFEELCTQVYNYYGKARNVDPKKHALVMLRSMGEFWTEEE
FT                   LKNALSNLNYGQEFLSFTDFRRLAKSKWYEPTSNENEEGEQVNEDGYGNQIYMHSEDIQ
FT                   KFKNAFDRVSKFYTGNEGENKTLPVNVLYNILTNFEDPMPKRVGTYLVSNLNVYNNEVS
FT                   ARSLLCFLARREEFGNVV"
FT   CDS_pept        complement(1024942..1026612)
FT                   /locus_tag="TA06825"
FT                   /product="ribonucleolar protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.27 - score = 49.72"
FT                   /db_xref="EnsemblGenomes-Gn:TA06825"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73353"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT6"
FT                   /protein_id="CAI73353.1"
FT                   /translation="MTKTYLLFETAAGYGLYQIDQWDQIGSDLSLDELVSNSERFSGTV
FT                   KFKAFQPFRTAKEALENMRSITEGEATLLLTNFLSQNLPSSDHVLAIVDVSLAKSLSQK
FT                   GFKVIYDSNVLELVRGCRLYETKRLTKLASGGTSFDMNNFQVGLGHSYSRSKLKFDPSK
FT                   QDKPIINSVSLLDTLTKNLNSFAMRVREWYGWHFPELCKLVPDNKTFCEAVKLLKKKEE
FT                   YDFENLEPLSELLGEELALTVKKASRHSIGHELADLDLENILNFADNVIKLDEMRNKLN
FT                   GYLNDKVSMVAPNLNCVVGTLLSGRLISHAGSLVNLAKSPASTIQILGAEKALFRALKS
FT                   RTNTPKYGLLFQSTFIGKASNKHKGKAARYLANKCALAARLDYFCDVNTDIYGKKMSEQ
FT                   LTKRMNYLLGGPQHDRNINVMKQAHEEYKQLSNLAKLNEKAKTVPDDQADEKPKKKRKT
FT                   SSKKNKEQNEAESMNNVENEQQTSDKVSDSEQKLNHVAQSENLPAVDREPTKKPKKSSK
FT                   KKKEQTENSEKSTEIADAVPSPESNAAKSSKKQKEQKES"
FT   CDS_pept        join(1027331..1027514,1027547..1027774,1027808..1027993,
FT                   1028024..1028179,1028212..1028633,1028666..1028793,
FT                   1028834..1028921,1028962..1029042)
FT                   /locus_tag="TA06820"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA06820"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73354"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT5"
FT                   /protein_id="CAI73354.1"
FT                   /translation="MYNNRNEETPTHCSSPEKVSEDEGCSPRDESETPKYSSEVTCFTK
FT                   ENIDSLVRVSEVPGKGRCLFVRKAFDPGELIFAESPLFMIDPTSNQELWDELNKLNEES
FT                   PFVLPPLWHKAALFSILEGNEESNSILENKWVENRNQEVSADVLRVLNSICTIEDGEFY
FT                   YDGVVIKPEVYQLYLQVWPLNAFGRTSEPDGLVIYDKISYVAHSCNPSCCWHHTENDEF
FT                   VLRARKKLVPGDEITISYLGETDLLSPTFRRRTLLQNWHFFCTCERCSIPIDNCRGFLC
FT                   KCCHYGTIFLNYDSFFSSHSSMQCELCGYQFTESEMNEYIELERAYVYRIDGIDKSNLM
FT                   DILQVYDHAKNVFKQHWALYQLQTLLYDIYKEKSNFEQAKIYLMQRIHYVDKVILGPLY
FT                   CVAFMHEEMADILTYICDLDQNLSKIGNPNSDIGALNMIMGYYFNSAALLSILCGYKHS
FT                   YYHSVISKRYRIEELAISLIKLPQEVESPDEA"
FT   CDS_pept        join(1029167..1029335,1029399..1029474,1029533..1029644,
FT                   1029816..1029828,1029858..1029924,1029954..1029991,
FT                   1030030..1030151)
FT                   /locus_tag="TA06815"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.97 - score = 21.22"
FT                   /db_xref="EnsemblGenomes-Gn:TA06815"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73355"
FT                   /db_xref="GOA:Q4UHT4"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT4"
FT                   /protein_id="CAI73355.1"
FT                   /translation="MDFGSFKSFVLNLYESSVLILKFGFVLVRRFKIACQKVSIARSQG
FT                   LLDDEHFYTLYGLYKQARFGDYEDYGSYFVTHPSDKTELWKKLRGMPPKEALLEYIRYA
FT                   NQVVPTFKESDDLESSMVEKQPSLVEVKSPEGLTALHLAADRGHLDIVVFLLDNGSDVN
FT                   AADDNGDAPLHVALESEQDEIVKILVGRGGNLEQR"
FT   CDS_pept        complement(join(1030218..1030349,1030403..1030494,
FT                   1030526..1030570,1030628..1030728,1030757..1030806,
FT                   1030838..1030895,1030929..1031218))
FT                   /locus_tag="TA06810"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.26 - score = 26.03"
FT                   /note="Signal peptide predicted for TA06810 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.903, signal anchor
FT                   probability 0.055) with cleavage site probability 0.860
FT                   between residues 21 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:TA06810"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73356"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT3"
FT                   /protein_id="CAI73356.1"
FT                   /translation="MYSNRNITVVLLLYITHFVHSKTTGYDSSDSNLIVGSIGFKRLSQ
FT                   ITELCEVNNDFLFRTNEVQLRMNQDIFECLSKMKLNGTLKTTTMTSLSVKQWVLWEVDR
FT                   FNFKDEMNWISGTVNTCGNSKDSFLGGPCVLGPGGVKRFYNHIPEHTEIKITGRVHFFD
FT                   EWNGESVFLKVNDKILWSQWHNWCPTIPDSACMKFGIDVCGIEYPDRLSVYLEVSMVNS
FT                   DSSVALEFFSNLSKERNPCDVSWGIDDIVLHIR"
FT   misc_feature    complement(1031156..1031218)
FT                   /note="Signal peptide predicted for TA06810 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.903, signal anchor
FT                   probability 0.055) with cleavage site probability 0.860
FT                   between residues 21 and 22"
FT   CDS_pept        join(1031624..1031903,1031935..1032027,1032059..1032091,
FT                   1032121..1032166,1032196..1032355)
FT                   /locus_tag="TA06805"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.98 - score = 19.12"
FT                   /db_xref="EnsemblGenomes-Gn:TA06805"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73357"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT2"
FT                   /protein_id="CAI73357.1"
FT                   /translation="MRRHKPKIINEHSPILDEFNAENSQNIAESENNLGKMNDLMKINQ
FT                   DYNILNFDQMQNYNYDFHFIPEWFNTLPPSLSSTKGFVVDSLASLAHMGLMSLISTQAF
FT                   QNSYCSVFSSETEKAVCLKNSIENINKIAQTGRQIMSLNFRVLAGGRMAKEALVSLNTL
FT                   ASDPQNVGMIKTLGSTIIMYLTLMRESVGDEFVYLLINKP"
FT   CDS_pept        complement(join(1032789..1032929,1032965..1033111))
FT                   /locus_tag="TA06800"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.25 - score = 6.99"
FT                   /db_xref="EnsemblGenomes-Gn:TA06800"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73358"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT1"
FT                   /protein_id="CAI73358.1"
FT                   /translation="MSHLIFSINLNILKYVKTIKIPFIADDFFGRFGFGEIPTLATSTC
FT                   TSNQISLNPTISENSVIGAFIDSLNTLFWKGKHFKGILFFFKIQRNFYSK"
FT   CDS_pept        complement(1033159..1036122)
FT                   /locus_tag="TA06795"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.24 - score = 65.93"
FT                   /db_xref="EnsemblGenomes-Gn:TA06795"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73359"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHT0"
FT                   /protein_id="CAI73359.1"
FT                   /translation="MSNCEVDSRTHSLDSCRNPNDNLIPESDFCYAEGDSLEGGPCGEW
FT                   LVFQVHLRNKCWPGTLRLHLKTCDDFCFRATVHVGGLKDERDQRRSAPSCVNDRLMNNF
FT                   YGESIYKNFEWDVCVSDENTYNVRYKVSMKGMFLLYVRLDGNDIAGSPFNIFISDGKTC
FT                   PQSTRVQNINNLKCRAMPYIKSIVEVIDDERWDYECKNQVSEDYQRRRLYSVEKLRQYS
FT                   LVNELTLNACDKVGNIIKYKTPYVKAWCTNFGKVIEVKHLGNGVISIKYVVIVQKEDLD
FT                   KVKTFYSSKNETVLPSYLRNLGTPCTLNVQLDGETIYGSPFVPEITNVSELEEYYASFP
FT                   ETLNSLSLSLNHMLSEDNLEGCSQAIFNFFHANKDMEESDKSKAVELISKLVDDKSKHI
FT                   KRNNFLMESQMYKINHVKTYALGQLHQFMDSQYQKMVKAKTSSIIECIKELNSYNTSVN
FT                   GETKGFKNLADVIFNYTRIGDELRKLHRYDLADKFDSISDRICEEIELNRWENLLHDKK
FT                   KKLIKIREQVDESVKKLQDFKKKVHEKYDNLEFKPIKKMQIDKEVQTIQQETVTARLLP
FT                   LVKNRCIPEDPKTEVDKVVETFWRRCSNYDIHSGITKVLKSSIRLKNALNEIFFYYSNK
FT                   YNTKDNMIQYAIPSNSMYLFHMDSSISKTLLNNKRKLEEMFDKFSVMISGKRVLPENMW
FT                   CVYLRELAYMNLLYKIAESGDVNLLRDNLHPSRLSAFHHFCQFHILNLYEKLFTTRPEF
FT                   QKSLKFYNTKKLLRSSLNFKYEKESAQMHYFPTETDMANYITTEIPNKVGNSLNENILH
FT                   LIFKHYSRLSMFGKQKQDPKSYKCNDDSWLSTAMFVVFSRDFGIVPGYMDGSSVQKIAD
FT                   DTILANIEQNTYQSTTFRGRLFYKDFVDALVNIISNSIYKICLNRHEMYTKHLKDNSIL
FT                   NITKKNKFHETRNCIQTQESVLEEVNEVLQILGLNNPLHIDLTIEAIYGSEALEFLH"
FT   CDS_pept        join(1036871..1037015,1037077..1037145,1037175..1037452,
FT                   1037483..1037719,1037751..1037961,1037993..1038111,
FT                   1038141..1038255,1038294..1038689,1038721..1038929)
FT                   /locus_tag="TA06790"
FT                   /product="disrupter of silencing (SAS10 homologue),
FT                   putative"
FT                   /note="Tap349e08.q2ks7.C.cand.99 - score = 82.63"
FT                   /db_xref="EnsemblGenomes-Gn:TA06790"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73360"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS9"
FT                   /protein_id="CAI73360.1"
FT                   /translation="MGKNIFRKPKKTSEESDSKKNKNKSSSSGFKALITDDGKDYIPFN
FT                   EDEENSQDEDYEKLGLPRSFTPEVTDDELDEELEDEYHEDEEEDEEDDDEDEEKEDRTN
FT                   WGKRLKEYYVEGSDEESDEEALEDRIAEAREIAEEMYEDVEEEDAELDRYIESEKEDDS
FT                   TALDTLIDNLSESLKKDSEKIELPENFLKMSDEDKREFLDKEHPEFLLLLKEFKDKSDI
FT                   SREQIFKILNDPKSYKLCTKDGLEYLDIRNELFLMYLSYLTYYLLLKVHGVSVEKHPVI
FT                   DRLLEIRLLLDKAKPIENKLQYQISKLLNNLKAKEEDEEELVPKPENIEVDTVKGKKYK
FT                   APKHLINQYTTNEEKEEGEGDQYKFMKKLNEIEEYEMDHMRRIPMSKKYKKYLKMMDKN
FT                   QRNLVGSNLQDLTNFGSGIVGSERKSNASDLNLVAQKLRQSVIMSEKRNNPDLLYTGST
FT                   IKKAKKGTPVENLHSNKQEKEKRRKPDEVDKIKNKYNKLKEERKKKYQEKNVKVYKPQP
FT                   VVDGKREIGKDIMKNRGLVIKRTKTQGNARVTNRKKFEKKMKVFNAMTNRNRIENLDYS
FT                   GEETGINVNKKKSLNA"
FT   CDS_pept        1039034..1041298
FT                   /locus_tag="TA06785"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.100 - score = 76.63"
FT                   /db_xref="EnsemblGenomes-Gn:TA06785"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73361"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS8"
FT                   /protein_id="CAI73361.1"
FT                   /translation="MDFIRKINKNVQESFSILNEGIQITNSILELNTIHLPQLFQLRPS
FT                   KNKNDKEGGLCCLFEENKPEIVGSVEQIKTNGLKSKEVGEQTNKSKFLNRLRTGYQEKY
FT                   DLSRNQVTEPGKILELECAQGEKCLLKSFSVNLYRESIDFVSFFLNTLSNVLKDSNKAS
FT                   RKLVENQTFLVLFEISKLVEVTVFLRSDNQKVRKIIQDVDSIYGSLVSLVSFSLKLLNE
FT                   VLQYPLHIFFNNLEKEYDDCRIEKRKYESFLKQRYPSQNLDEYDMIGSFWFINITDEER
FT                   IDLDQYLQYLDSILDSSNNSRSIINYISLICEQEDDSYKNILYGFLLIFQKLFGYNDLN
FT                   WHLSENDTNKLYFWNRYYDSCSYYLYYNDCCYDCTKPKMNPNLSVEGDYCTCLLSNERC
FT                   NFRVKIVLEEDLKTNKEVLRILSKVLEHFSEVYIKTRVLGLILQIVSQIDPFMDLMHKH
FT                   GIFESVFETLSECSNDQFYLLNNTLNVVTYQSQNPINFLSLIREEDLKILMTFPPCTIE
FT                   SILLIHKYVVASKWKIPVKYRKILLNYSKPLTRLYTYYKCTYQSSKTLELSGLFSQILT
FT                   VVIESVLVAQVALRNLTEVIYPFCLHLVSKLRTLEYSSDFGEFRDNFDLELFNMLACSY
FT                   VILLNLSKSGGIFVEYQLFSSISNYLSVSLCFMDKFGSDNVVEWMTTQTVSNLHEVYKY
FT                   MLNVAHTRETNNEEVVRIKMDSLLDFCTFPIFQLAVTLFDPYINTRICDKLIKSVSSKK
FT                   K"
FT   CDS_pept        join(1041347..1041547,1041579..1041650,1041681..1041801,
FT                   1041834..1042244,1042275..1042489,1042520..1042678)
FT                   /locus_tag="TA06780"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.100 - score = 76.63"
FT                   /db_xref="EnsemblGenomes-Gn:TA06780"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73362"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS7"
FT                   /protein_id="CAI73362.1"
FT                   /translation="MTLKMGLFGTFSGLGESLNKYISNSCHEFSIALTQDFEDGKIIFY
FT                   KKFMLNYTMILLSIDPLIDVPEAQFLTEYNINFLLNTASRIVEILKNQPSVNLQTILMD
FT                   VLKFLLCAVFSVEYTTLLETFEYGFLFELIELSQSGPTLEMMKGISSVILVYLIMIGII
FT                   PDEKVKRLGLMCEHLKKLYESVEFKASEVALKADNIKPVDTLGQDFNQVVNYCLNNLLK
FT                   TTVTDFLEIFYWNVNNYFNFSLAPQIFKILIMFKLYIHPHIFGQLSRFIDSFVRTEDPV
FT                   SSKSIGNLVIDDNLLDKPHVLLKTLYSEELEFWKQKLYAMECQLHVISNSLSLTRLENE
FT                   RLRNNIELLKKKLEGPGSEEDFNLELELEIERQRYSHLEEMYNVRNKNDNKL"
FT   CDS_pept        complement(join(1042746..1043132,1043164..1044453,
FT                   1044484..1044615))
FT                   /locus_tag="TA06775"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.23 - score = 71.78"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA06775 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.967, signal anchor
FT                   probability 0.002) with cleavage site probability 0.848
FT                   between residues 19 and 20"
FT                   /db_xref="EnsemblGenomes-Gn:TA06775"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73363"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS6"
FT                   /protein_id="CAI73363.1"
FT                   /translation="MKILNFLSILYFFIANCLCRMDDKSGGLLGKMYQKVPHFMESTRK
FT                   RNYDRNKHSAVRNRRSRLNEEDTGTDEMNSKKYGNDFKNYKFMSTMNNFRDKQGEALTL
FT                   DNFSSDFNNFFQTNHRTYASYIKRNENDATCPFSVGAPGQVGQSCKFNDPSGTYSSTTL
FT                   DGSQGSCPLKQDSQTSASVVTPANQWPDHKTFDQSNAEQEKAHEELKSEVDQVKQEQKN
FT                   LEEKVNEANAAEQALKATAEDLKEGQEELKQEQDNLDQAQDKLESTQKEVEAKEHNLEQ
FT                   TADALKSEANKLEEEKESLDEQKEELENQQNDLNKQKNELESEKKNLDKEKEDLTTGQK
FT                   SLDTEKESLDNEKKDLEQQQKSLDDQQSKLEDQQDKLNDQQEKLEEAQKASANEDTEAS
FT                   SKLEKTNENNAQADGLKNLQPVASPLVNGSPEGVVSPKTLVDNSSVPSCDNSTEEVDKA
FT                   YEVLLTTQLSILTITTSQGEVQQPTADTTNASTSEDNTNNNAAESEKTTEESEPQTASK
FT                   SEEAKENTESDDKTSKVESSEPNESEEHEDQNEENEKDEYEEDESEQNEDEESESKSTT
FT                   KSSQKDNKNENEPATAEELEEVNDEV"
FT   misc_feature    complement(1044559..1044615)
FT                   /note="Signal peptide predicted for TA06775 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.967, signal anchor
FT                   probability 0.002) with cleavage site probability 0.848
FT                   between residues 19 and 20"
FT   CDS_pept        complement(join(1045217..1045408,1045445..1045546,
FT                   1045586..1045618,1045651..1045938))
FT                   /locus_tag="TA06770"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.22 - score = 22.20"
FT                   /db_xref="EnsemblGenomes-Gn:TA06770"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73364"
FT                   /db_xref="GOA:Q4UHS5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS5"
FT                   /protein_id="CAI73364.1"
FT                   /translation="MPNSFSHIYNNFVKYLNLIYRNKGSHSRLGLVNCIIFGPIKFYNH
FT                   ETKERKSKTKPSFNFGSLNIRFQTKLPEYLSNIIAYAESDNKGCCSETESKEYVLTDRA
FT                   FEKIKFEIETYEVVLFMKGTAKEPACGFSRQALDILKTLKVDTIRTVNVLQDEDVRNGI
FT                   KAYSKYPYIPQLYVRGKFVGGLEKISKMFSDGSLEKLLRDG"
FT   CDS_pept        join(1046218..1046329,1046367..1046602,1046638..1046994,
FT                   1047026..1047205)
FT                   /locus_tag="TA06765"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.101 - score = 24.57"
FT                   /db_xref="EnsemblGenomes-Gn:TA06765"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73365"
FT                   /db_xref="GOA:Q4UHS4"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS4"
FT                   /protein_id="CAI73365.1"
FT                   /translation="MDSNLKSALKKHFSNYEMLMCDINGLFGKYHNFSCSMSTSFDCHR
FT                   LNISGTVPYTFSGFTLNAPLLIQVFSDYPFSCPSFFVPSRNTKIVKNHPNVDLRGNVTL
FT                   KYLDEWNHTSKLVQAVDHLCYAFSKISPIITFSNSPETILKSQFTQSPPEVTNQPMPEN
FT                   LFAKHKLSDRDRNLVEHAHQNILTLLKKTREDVIKQYNFNMKKYELHRKILLNWVEALL
FT                   ELNIVNLKMDEVEGKLENEMNTDALEKAESLQDEVSDLVRNLTNSRQILSSLEHGDLEI
FT                   EQVVKFKDPDSEK"
FT   CDS_pept        complement(join(1047453..1047796,1047852..1047911,
FT                   1047946..1048069))
FT                   /locus_tag="TA06760"
FT                   /product="mitochondrial inner membrane protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.21 - score = 16.44"
FT                   /db_xref="EnsemblGenomes-Gn:TA06760"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73366"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS3"
FT                   /protein_id="CAI73366.1"
FT                   /translation="MGDYLNVGSINPNLEILEKKKSQSKSDILGGNLSSRQLYLTGYGR
FT                   HWGEKLTYSVGLAYGSGILCGGSFGLLKGISKGGATTKLFVNSILNNCSTYGPKLGNRL
FT                   GCLTIIYCGINSLVKTIRGSDESDKYSAPIAGLLSGAVYKISGPLKATAKYSLGTGLVF
FT                   TAIDYALRNSFI"
FT   CDS_pept        complement(join(1048203..1048265,1048301..1048345,
FT                   1048375..1048426,1048456..1048525,1048555..1048705,
FT                   1048748..1048825,1048855..1048950,1048988..1049026))
FT                   /locus_tag="TA06755"
FT                   /product="ubiquitin conjugating enzyme, putative"
FT                   /note="Tap349e08.q2ks7.cand.20 - score = 36.25"
FT                   /db_xref="EnsemblGenomes-Gn:TA06755"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73367"
FT                   /db_xref="GOA:Q4UHS2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS2"
FT                   /protein_id="CAI73367.1"
FT                   /translation="MYMESREHLRLKRELKDIENENDSTVEAYVVDDNIFKWKGHILGP
FT                   PGTPYEGGHFTLDISIPEDYPYSPPAIKFETKIWHPNISSETGAICLDILKSEWSPALT
FT                   IRTALISIQALLSAPEPDDPQDAQVANMYKRNYQEFENTAKLWTSTFARSRDESREGKI
FT                   SLLLEIGIDRESAVRALEENGWDTTVAINRLMDG"
FT   CDS_pept        1050242..1054822
FT                   /locus_tag="TA06750"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.102 - score = 113.52"
FT                   /db_xref="EnsemblGenomes-Gn:TA06750"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73368"
FT                   /db_xref="GOA:Q4UHS1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS1"
FT                   /protein_id="CAI73368.1"
FT                   /translation="MKRICSSCIPSSRVSKRNPDNDENNDDQNTKRKKTDKSSECKDCY
FT                   VEILLDFPGRLCSSGYNVHSSTHTAATNNTHQLSTELDFKNCTKNDDSKSDNKDLEVEI
FT                   SLEVKDDSYKDSQVYSFNPASGQERPELEVVNLSNTKELVKSEPEVKEVKNVYNKSEST
FT                   MCKDEFINKYDEENSDNDSFFTESKKIYEQLLMTYNSSSKSSDTKSKSKEDRSENNKNS
FT                   DTKTENTNTANMSNTNKFITKNRTKSTNNAVNNIANDSATNYTSSTASNVSDDSSNAST
FT                   TDALDSGANNTTPNNNISKQLKKETEKVENNLRARIKETLENEIEVNDIVKFNTYICNL
FT                   NNNPMINNFFNEFSDTTNTTSSNTLDSYGNSTILQRSTPNEQFDDLNSDPKRRMSDPEG
FT                   HELVLRDNLMESEPMDERKPIGVEVLEDNLRLENTFEPELVIEDLRFKPKPVLEDKIPE
FT                   AKESSTSEVLVLDKVLEQVVNGNKNEMAVKKSKVGEFKLKRTQVESNNISNDQRETNNI
FT                   SNDLRAESNNVSNDRGESSNFNLYNSVNDRKMEPNGLTSSNIANHNINQNVNHNNLGMN
FT                   GVNMGRRIEEEDYNNICTPKNKKIGTINLKGLEMIKSNSDKLIKTINYTLNKRNKRSYN
FT                   GTNNNNGKRKRYILINPNNYDPNNNHVANNSTYSKDIVMNKLKNRGRTHHNPMDSARMG
FT                   MDDKVPERNCSSEMWNDDINVIIYRKMKLGYGSFSTVSLALLRFINQKTQHNENETVTN
FT                   DANSTANTSTLHSNVTSVSDKMEKKRIYECAIKNINNNYGEMSRYQYIREKEMMLHYNQ
FT                   NVLKPISYRILYNNNNDKIYQLLLPRAKGDLLSMLIKLIIYRTNTINNKGSFSTFGKSN
FT                   FNTSGNGNFNNIGNNESNEKRNKWKFYGLFIIEIKYILIQIINSIIYIHNCFQGNILRH
FT                   TDIKLNNILVFCSEEDKYNPLKWQLNLSDFGSSILLQPNNFINNIQNIVASTQPSNIAK
FT                   TTAQYSGTVKLNDDDDIFNYHMKEYIEQMNTQLLSYNIGTLKYNSPETLLYDEFLNKRI
FT                   NNNRLLLDYFYTNNNESSDPFFDKENSASQASDGNWSDKDNSQLEPLKIDDNGLKNVNE
FT                   MVEINNVRYIKISNKSDIWSLGIIITELVKYMIHYDFNNLGDLTNVNLFNLYITDNIEC
FT                   DLNFKVNENINNTSRFKSDVNRINTDILTSNLNRLNTDGFKSGSRIEPRTVPKTNKFSP
FT                   KRSTANIRHNMPRVGSLKENHRASSSKGSNIKNILYNNIGNGIFYKNKDKLLVDEENKL
FT                   LSTYINNVCNNEFKVRRSRLLKLIDSKLYPNHDDREFDGSRCDDQELEDKDVSLPHDYS
FT                   QESLPDDSSKVQYDLLINLLTNLLSYYPSERLNSIEILGHEFFTNSRNIFQLIDHNNKT
FT                   FVNKYYNLYENINSSDVNLYDDKYSYSWYKGPLYYYIYISNSSLTATVQDSPEDSLKMI
FT                   IYNLEYEMLMSKSKELYGDEFIIYKILKKLKIQNNFNYRQITSTYTSHLLSRELYLLNR
FT                   HKYQLE"
FT   CDS_pept        complement(1055026..1057029)
FT                   /locus_tag="TA06745"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.19 - score = 33.28"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06745 by TMHMM2.0 at aa 29-51, 72-94, 99-121, 126-148,
FT                   163-185, 253-275, 539-561, 582-604 and 609-631"
FT                   /db_xref="EnsemblGenomes-Gn:TA06745"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73369"
FT                   /db_xref="GOA:Q4UHS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHS0"
FT                   /protein_id="CAI73369.1"
FT                   /translation="MMLNIRLVYSASPYALMRFKLPENLFSVFVRVMASALELWCLPSM
FT                   TIGNIIDFIRKQDMDDETKKWLFTYQSIFWSWANFATFGILWIVYVIGGDQGNVTAFYW
FT                   VIAASGFVFGINMVMVYAMEFWYLPYYMVGENSFPMVTSLMHYVSTSIFGNRRKYDSDY
FT                   IVVYVDIVISLAISFVAAVLWTCCYYSGTQGYPPKDSNQKDCVTLKLETKTGGTATELT
FT                   YSIGTDYGNKDVFGAHIKTTGDKCKYQGIPYYLYLVPPSLMVLVGMGLVYTIYPGIAPG
FT                   MIVPFYLVDKIEMILLIATAFPPVIIKLVPVFDERFDPYVLKGSWGVYHKKVCKAGDEQ
FT                   DPGPTGCPEYTEKIKSIKLAISNSGTGGNIHTITLSDGGSGSAGVLSTSNAINLATNGT
FT                   GTLTIKIPGGEIALKELSIGTGNKLTIKSGNSKVSVTKMTWGQEEPVMLNETAALTTSG
FT                   KTLTINSGGGGTDATINITGDTNVELNYSGGTSEITISGSAIDALGARLIATDELHDNH
FT                   KTDKCCLYGKVYKWSDEHPNAVYWNIFNILMPLQICLASIFIYSIHYRDSLIARVIVNQ
FT                   PKMSTALSILFYMCHEILLAVGFPGIASDDDVLLPMQLVGAFLMVLLAFYSIGYITEYK
FT                   RHDPSQWPTTGMTKWNALCYWLKMASKIKIKI"
FT   misc_feature    complement(join(1055137..1055205,1055218..1055286,
FT                   1055347..1055415,1056205..1056273,1056475..1056543,
FT                   1056586..1056654,1056667..1056735,1056748..1056816,
FT                   1056877..1056945))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06745 by TMHMM2.0 at aa 29-51, 72-94, 99-121, 126-148,
FT                   163-185, 253-275, 539-561, 582-604 and 609-631"
FT   CDS_pept        complement(1057252..1058778)
FT                   /locus_tag="TA06740"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.cand.18 - score = 37.58"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06740 by TMHMM2.0 at aa 5-27, 47-69, 89-111, 123-145,
FT                   150-172, 185-207, 313-335, 348-366, 403-425, 446-468 and
FT                   478-500"
FT                   /note="Signal peptide predicted for TA06740 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.770, signal anchor
FT                   probability 0.004) with cleavage site probability 0.525
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06740"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73370"
FT                   /db_xref="GOA:Q4UHR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR9"
FT                   /protein_id="CAI73370.1"
FT                   /translation="MSAYILAGLAMMLNIRLSYSSAPYALIRFRLPENLFSVFVRRMAS
FT                   SLELWCLPGFIIVDIMDLAVKLIIKPIGTLGDNTLASKQLKFHSIICLSIVAQWLNFLT
FT                   YVILFFVYLAGGEQGRLTTFYWIIAVSGFVFGINNPLVYAVDYNYVPIYIVGENCFPAL
FT                   TSFMHYITTLMFGNRRKWDSDFLIVGIDIIVAILISFVAAVVWTVAYGFCTAAPECQIT
FT                   YTATTKQLTIKYLGTETEKKGNINTTAGTYTFTTGTNTVKNINSKIRYSFKLNSGQDSA
FT                   FNAGTAITATVTIEYGHIFAEGFGGTDANPYMVAPLLIVLVGMGLVYSIYPGIAPGMIV
FT                   PFYLIDKIEMVLLIATIFPPVIVAILRKTAKPWHPQSPLCEWNEDSKPPWLKDKPETPG
FT                   EGPGYFWHVFDLVVPIMIILAYLFIYSIHYRDSNISRSIVNQPKMSTFLTIVFYMCHEI
FT                   SLAVGFAGMIGNAAEWTVLAQMIGAFLMVFLALYSEGYIIEYKSHDPKHW"
FT   misc_feature    complement(join(1057279..1057347,1057375..1057443,
FT                   1057504..1057572,1057681..1057737,1057774..1057842,
FT                   1058158..1058226,1058263..1058331,1058344..1058412,
FT                   1058446..1058514,1058572..1058640,1058698..1058766))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA06740 by TMHMM2.0 at aa 5-27, 47-69, 89-111, 123-145,
FT                   150-172, 185-207, 313-335, 348-366, 403-425, 446-468 and
FT                   478-500"
FT   misc_feature    complement(1058719..1058778)
FT                   /note="Signal peptide predicted for TA06740 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.770, signal anchor
FT                   probability 0.004) with cleavage site probability 0.525
FT                   between residues 20 and 21"
FT   CDS_pept        complement(join(1058998..1059036,1059218..1059351,
FT                   1059386..1060300,1060331..1060384,1060417..1060456,
FT                   1060490..1060570))
FT                   /locus_tag="TA06735"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.18 - score = 37.58"
FT                   /db_xref="EnsemblGenomes-Gn:TA06735"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73371"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR8"
FT                   /protein_id="CAI73371.1"
FT                   /translation="MQSHLPEKYKKKLRKPGDNSSGNLVNTVTVKAEPIVSTSNIHVTP
FT                   HYSDLSTVIYVWGDNPGRSDESSGSSASEYWTPTIYRNLSDVKITCVCCSESHMLFLTE
FT                   QKLIYTLGNGDYGQLGLGKGIIHVSEPTFVSKISDVKQICCGKFHSVALVEGGSLFSWG
FT                   RNDFSGHLNGFATFSPKEILTNKESSPGVKIVCNCVSSSDLQTIAVCDEGRCLYFWGIA
FT                   FNGERIRHPRLFFSFSSERICQIAVGTSFALALSERGIVFNYGDGTYGEIYSESTITNS
FT                   TPIFSRIKHNLIKNITQIAVGSRHALLIDDNNNVLAFGDNNYGQCGAPQRHHTAPVIVE
FT                   FTEANFLPKYVYTGNRTSACINSGNQLFLWGHSSNHKLIFTSSVDILIQQQKQPGVSII
FT                   SGYKNSVNQLNVCSNGYCDFK"
FT   CDS_pept        complement(join(1062713..1062862,1062895..1063064,
FT                   1063099..1063232,1063306..1063465,1063570..1063713,
FT                   1063743..1063881))
FT                   /locus_tag="TA06730"
FT                   /product="cdc2-like kinase"
FT                   /note="Tap349e08.q2ks7.cand.17 - score = 26.30"
FT                   /db_xref="EnsemblGenomes-Gn:TA06730"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73372"
FT                   /db_xref="GOA:Q26671"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q26671"
FT                   /protein_id="CAI73372.1"
FT                   /translation="MRRYHKMEKIGEGTYGVVYKAQNNHGEICALKKIRVEEEDEGIPS
FT                   TAIREISLLKELHHPNIVWLRDVIHSEKCLTLVFEYLDQDLKKLLDACDGGLEPTTAKS
FT                   FLYQILRGISYCHDHRILHRDLKPQNLLINREGVLKLADFGLARAFAIPVRSYTHEVVT
FT                   LWYRAPDVLMGSKKYSTAVDIWSVGCIFAEMINGVPLFPGISEQDQLKRIFKILGTPNV
FT                   DSWPQVVNLPAYNPDFCYYEKQAWSSIVPKLNESGIDLISRMLQLDPVQRISAKEALKH
FT                   DYFKDLHRPSEFLNGVH"
FT   CDS_pept        complement(join(1064185..1064323,1064355..1064421,
FT                   1064486..1064817,1064848..1064916,1064949..1065083,
FT                   1065144..1065287,1065342..1065448,1065516..1065597,
FT                   1065629..1065712,1065762..1066231))
FT                   /locus_tag="TA06725"
FT                   /product="glutamyl-tRNA synthetase, putative"
FT                   /note="Tap349e08.q2ks7.cand.16 - score = 39.04"
FT                   /note="1 probable transmembrane helix predicted for TA06725
FT                   by TMHMM2.0 at aa 7-29"
FT                   /db_xref="EnsemblGenomes-Gn:TA06725"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73373"
FT                   /db_xref="GOA:Q4UHR6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR6"
FT                   /protein_id="CAI73373.1"
FT                   /translation="MCICSTLWTIYNVLHIFLFWTSCTLSYRLNNIKFNNVNGTKTFFN
FT                   PSLIDRKNISYTSNFQLFDVLNHPAHENNNYLQHNENRLTYDDVLNDLKTQEVRVRFAP
FT                   SPTGPLHIGSLRTYIYNYIFAKKNKGKLILRIDDTDSSRNNQDSLKDIFSSLNWIGLVW
FT                   DEGVHRLNGDMYYQSNRKEIYKKFAQKLIDNNKAYYCFCRENIFTKFLSKIFKIKFNYK
FT                   CKKCPKLSQNEIKTKLKNLKFIILLRSEGDDFDDFILVRRNGVSTYNFSSSVDDVLMNV
FT                   THIIRGSEHTNNLHKQEYLFNLLDYKCPKFVHLPLLHDEQKTKLSKRNPNSKDYTVKNL
FT                   RLNGICRLPLINYLTFLGTRFISSNEIYEVADIIKMFSFDLLNNEPAVFDYKKLLHLNR
FT                   KYINNLSIEEFKSEILSFQQFYNENKETEEDEMNTSLIMDQLLEIYQKRLVTLRDYFNL
FT                   VNSALGYNYENLTKNKDEELDSGFKEWLKFELNLIFEKSKNSVDLHANFANLVNEAMVS
FT                   GKKNLKHLRFLLTGEEVGPSLIDLV"
FT   misc_feature    complement(1066145..1066213)
FT                   /note="1 probable transmembrane helix predicted for TA06725
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        1067084..1068430
FT                   /locus_tag="TA06720"
FT                   /product="elongation factor 1 alpha, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.103 - score = 43.43"
FT                   /db_xref="EnsemblGenomes-Gn:TA06720"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73374"
FT                   /db_xref="GOA:Q4UHR5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR5"
FT                   /protein_id="CAI73374.1"
FT                   /translation="MGKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKE
FT                   SADMGKGSFKYAWVLDKLKNERERGITIDITLWKFETGKYYYTVIDAPGHRDFIKNMIT
FT                   GTSQADVAMLVVPAESGGFEAAFSKEGQTREHALLAFTLGVKQMICAINKMDKCDYKED
FT                   RYNEIQKEVCGYLKKIGYNVEKVPFVPISGFLGDNMIDKSDKMPWYKGKILVEALDLME
FT                   PPKRPVDKPLRLPIQAVYKIGGIGTVPVGRVETGQLKPGMIVTFAPSQITTECKSVEMH
FT                   HESVEVASPGDNVGFNVKNVSTSDIRPGHVASDSKNDPAKEANKFDAQVIVLNHPGTIK
FT                   EGYSPVVDCHTAHISCKFEQIQSRMDKRTGKTLEENPKTIKNGDAAMVTLKPNKPMVVE
FT                   TFTEYPPLGRFAVRDMKQTVAVGVIKTVDKKEPGSSAKVTKSAQKAAKK"
FT   CDS_pept        join(1068641..1068721,1068976..1069145,1069175..1069478,
FT                   1069538..1069814,1069846..1069982)
FT                   /locus_tag="TA06715"
FT                   /product="ribonucleotide reductase R2 subunit or
FT                   ribonucleoside-diphosphate reductase small chain, putative"
FT                   /EC_number="1.17.4.1"
FT                   /note="Tap349e08.q2ks7.C.cand.104 - score = 80.26"
FT                   /note="1 probable transmembrane helix predicted for TA06715
FT                   by TMHMM2.0 at aa 184-206"
FT                   /db_xref="EnsemblGenomes-Gn:TA06715"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73375"
FT                   /db_xref="GOA:Q4UHR4"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR4"
FT                   /protein_id="CAI73375.1"
FT                   /translation="MTMSTLSEKMKALEAEEFILNRNPNRTCLFPIVYPDFWEWYKKAQ
FT                   ASFWTAEEIDFSMDYNHWHKLNKDERHFITNVLAFFAASDGIVLENLALKFLRDVKIPE
FT                   AQSFYSFQIAVENIHSETYSLLIENYVKDEAEKRRLFMAIETIDAVKDKANWAKKWITD
FT                   ENSFAERIVSNFKNKLINYYRIVAYAAVEGILFSGSFCALFWLKKRGLMPGLTFSNELI
FT                   ARDEGLHADFGCFIYHNLKHKLPEEAVQQIIKEAVVVERSYICDSLPCDLIGMNSQLMT
FT                   QYIEFVADRLLQSLGVRPVYNVTNPFDWMQLISVQVKFMVN"
FT   misc_feature    join(1069473..1069478,1069538..1069600)
FT                   /note="1 probable transmembrane helix predicted for TA06715
FT                   by TMHMM2.0 at aa 184-206"
FT   CDS_pept        join(1070191..1071045,1071077..1071655,1071717..1071953,
FT                   1071982..1072170,1072201..1073004)
FT                   /locus_tag="TA06710"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.104 - score = 80.26"
FT                   /db_xref="EnsemblGenomes-Gn:TA06710"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73376"
FT                   /db_xref="GOA:Q4UHR3"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR3"
FT                   /protein_id="CAI73376.1"
FT                   /translation="MFLRIVKRAPSHALKCKLLFKKYLHISVGLSNEKILENQSLLLND
FT                   SVLKIKNKNAKKMLEVLSLRNPYVGNNKVNFLSQFIKSEKKIYPNNIILLRNGLKYESF
FT                   DTDSVLLVEHCDLEFLAETAHVEFPVTELEKIVNKLLDAGIDVNVYDELVNGSIFTNEN
FT                   KSLYLNRIFYSKKLMDNEVEKEKNNFGEIESINESEGLEITTEAISKSDNKIVGLGYDE
FT                   DGYSISVVDLKGEVSIYRNLNEICVEDYLNKLNNRIIILQDGSAKIKSVFKNLPNVLHY
FT                   HIMQGGCVGDAFHTSVLQEIMTRINMKINFKVNIVNLRSLETGRFNYLDNRVINKLGNF
FT                   HEQIVPNNSPSYVKRYFKRLLYRYPEEFSGTIREINKILSNLTVSIIQVKNVYNLDELS
FT                   LENLVSLINVYKYYSENLPKKLVQLLFDLVVKDLNVGVKHENLNKIFRKMTKVVDSYVS
FT                   KDWNNQPKPQNFLFRQLIQKKSKSEMINRNLLENELNRVERSFERLLSEIYTKFVDSQS
FT                   ANVSEYFKSNMTSDIRYNNNMIYLKKITGKVNHVNLNTTQVVEDKKLISCYVSDQVNLR
FT                   LLEYINECQVLDHKVSEVISKLQKSLNPYKQLIQIVLHFVVTLQSFYEHVTHAILNQWA
FT                   LVEPKGLDVDISLSSILSNLGLYCPSKHDSCSVDTNSNFNIENKEVREKKINRALKRLD
FT                   PKLVDRVKMLINHLYNLTSFNIERDFVHLSYDNLPPPSFTNSPILYILIFNTSSSAMDF
FT                   QDTPEDEKVDSLLVYVGETGDILSRLQRHRSKKSVHLSDYFQEQFINYNQELNNYLQYI
FT                   YMKNAGDNGNKSDIVNKSGLMVEFNKMEAILVKLKSRRECKEAEKKMIQFTYKYPDLFI
FT                   TLSKRDGQQHHIPYVD"
FT   CDS_pept        complement(join(1073039..1073220,1073293..1073599))
FT                   /locus_tag="TA06705"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.15 - score = 7.72"
FT                   /db_xref="EnsemblGenomes-Gn:TA06705"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73377"
FT                   /db_xref="GOA:Q4UHR2"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR2"
FT                   /protein_id="CAI73377.1"
FT                   /translation="MVEIYSFYIFYRFKLIYSNLYNNNVKNAIENLTHSTTSHNSSDVD
FT                   GYKTYEKLLIGFLNGLKSFSKTICEINEINGFKGLSTSYFNSCTTHEYKIHYFETITGY
FT                   KLVCFTSCDVPSLEDTLKFIYIDILTNLIIVNPTYVVGSRIDSTDFDKLIKKSLLSNL"
FT   CDS_pept        join(1073674..1076834,1076874..1077061,1077166..1077294,
FT                   1077419..1080613,1080679..1081790)
FT                   /locus_tag="TA06700"
FT                   /product="amine oxidase (flavin-containing)"
FT                   /EC_number="1.4.3.4"
FT                   /note="Tap349e08.q2ks7.C.cand.105 - score = 170.39"
FT                   /db_xref="EnsemblGenomes-Gn:TA06700"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73378"
FT                   /db_xref="GOA:Q4UHR1"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR1"
FT                   /protein_id="CAI73378.1"
FT                   /translation="MKYKEVTDDLYFSFEYFMFSNLTKIITNNKKCQVCNISTSIAFIY
FT                   KNITFYAHSECLSLHFFHQFFNLINESQNKGINDTQLDSSLGSSRSNRGLVPSTNSVNE
FT                   ITLNGKQNDSNLNTSGDSKTKNTQNGLCTDEKRYGKVSLHILYDAKISMEGEEKICYSC
FT                   GGTDVYFKCLVKNCKNYMHFNCSGNGYIIIYSNYSQFNPQYMTNGSESGLTSRQMQNSK
FT                   EKLISYRFLLCYNHVKNEIIAHIKQLFLNQLYNITEFNVQNHIHKPTIKPATNKKQNKF
FT                   NAVSVQSTTTSSFAPGSSPVTGSAPHPPRPHPVGLSTNVAINNIIYEYNIYKKSNIIKN
FT                   NKPININHFNILFIPIYTHRNTNTQTTQILNSNISNTSDSYTSNKHLSSAHGAPYTPQP
FT                   EECYSDIIEDLKSLLNAENGSMLNVNELKKLVINSEYGLQNIVNVIRQLLYPNTAPKLP
FT                   PQYSGTNTLLEDKIYNLVYKKPKFVLLKLYNKYIWMSIIKLYNNKYKFEKHVILHYLSI
FT                   SQMEYIYLKYIVNSIYFFNTHTLNPINGLNGDNITNGSGVSTTNPANRSGSNSNILFMY
FT                   TRKSENDTIHEDMEEEGNSRIVSLYGYNWSINPSAGLGTDDTEDEDENSEIHENGFVER
FT                   QITCIVRSLKLIKNEIEKHKVAMNERISNEKYKSLIYNKAETNYYINLSNVLFHYNKFL
FT                   FSIKKLILHYNNVGLDEDEELDRLKAFDGRSDPGDSSDNLDGSDRRGSDVLDESVKLNY
FT                   NDNINLEYCSVCLLSELSHKNILLQCQKCFIRVHYNCYNPTVNNSNNSVSNNNTSCIPS
FT                   YGSVGAPTNDNTNNQVGESVFFCDPCLMERKFENNYNTAICVSCLSSGGAMKIIYVNNN
FT                   AKYIHLVCLAFIMPSVTYNFQTNHFSLTSTSSFTNMKVCSICNVLGGIQIQCCSTQGLY
FT                   QPDFDSTQPDNSPNQTYTELNGVDNLRPTKESKAENKMELDQKLDGLGEMKIAEVRFNE
FT                   GGTAEKCDMSFHPMCCLLSGCYIKYSNLNNINMYKLNNTINTNLLQYLMLKPFCIKHTT
FT                   QSFTNKFLNEQCVKRSYAYTHYMYHPDGFKSKKNYLSLPIEPIYSPVTITKNGPIKSQP
FT                   KLISNNIYNYELMNKKMKYNEPYLISVIYGLPRGLSGDVSKYGIYSITQYLTNSLTEDE
FT                   QYRWLFLYLTLTDKQRIELHSTINNNYGKPFKVNVNPKFRVTYIDYYKKCKNISNSIID
FT                   TYEKILNRFENDKIEYESYDKVQGNYNLYINKENLLNVLIQLKKRFNVPNIRPIWNKIG
FT                   ISVKLRVILDPLPSYDAEFNDKEGIINKETYSNDEPSVLQENPDQLLNEDVTEKVKKLA
FT                   REKKYDANFVITDGTLNSCYRKLVQLRNSFYKDVIRNIEVGEKIKETFLDRLKTQPQYF
FT                   QNEDQPNVKNSPRFIKYLNILKYKLNQNFITSRNRYYILFEATHDFPNGTYLTVSGGIF
FT                   PGKPKSPKTSPIPAKKNSKRWNMARLKRCIIDDPPILPYCTFNNVGTETEGDKADEDGP
FT                   DISGPDYRSYSDIVDGSKYEVVIVGGGVGGLAAFNYLKSKNVNVVCLEARNRIGGRTFT
FT                   TYFNKNVNNSGEQINVDLGPNYLHCNNYIIKNSKNDKTQISFNYKNDTSFNSQVTDSPN
FT                   PDQNEIENTVSLVHEVYNPYKDIRNKRKYNKSILGVTNYIKPLVGDLSGYSNWEPTVYT
FT                   NWYNHKNGNKINFGSVAKTNFIVDKIIVHSNQLFHQLHDNHSFFKKYIYKGVNDNLLTD
FT                   GSSNGKEQVEVIEPENYVDSQTLIADSDNKEWYVKEVENNKVLEMNEIKSLWDVYYTVY
FT                   RNIIEEFKRNNITISKEEQSLLFNIIQSRLGYNSDLRETCISMCKLPISISHNSHVVSS
FT                   SLQNLDPSQTNLLKRLNKDDPLVNSVCDDNCSSTTSTTANCSSFSVSPNETTTIQCNED
FT                   TGLDKSSLDLYKKRIKLVYNRLTTLNIEKFQGNSDSDKLVIDGWEWLFRYLVGNDKKFI
FT                   YLNTLVTQIELRKDNVGDLKREEKIVDSLESEGYDVKLVLKNSDNVVESSSMIGTAINQ
FT                   DTKCVYSKYVIMTVPINLLNEISFEPKLSESRVKSMSNYSMGYHNKIVMRFKPSDIFWP
FT                   RNEMQFNSLDHRFQFLNLHCYGKKGCILAHSFPPFSKNFDKMSKASLLKLCLKLLHRIF
FT                   NVKRKVYPVEAFVTNWKGDRYSKGSYSYPKVSANDEDIIHLKSPYPTDDPKILFSDGTF
FT                   DTSIRAAEDIYNIGLNKNVADKSCKSDSVDVIGDEVKRNLKKEIEDNENMEYSLDNILN
FT                   NRYSDNYVGIPIPLPSRNLLGYYLTDGSDELISDDNMYLDNSILNDYYTNYNLVEGKSL
FT                   DFNSNYKKINNDSVCGQTEVFNFLSSDTDISSCDGSEQVDENQMCKRVCKQNLEEYELE
FT                   LLLIIKLMFSESEISIGKMLSNYDKINKIKTHLQNGNYNNKYIYYSKVIIEALLYTTYY
FT                   MEYGTVGEKECDTRKNVDTNIAEVVEGLEKRSEKEVEMRNQNFSTEMLKNTCKLLGLWY
FT                   DFLCYYCQRGGEVLLCDSLSCSKIWHYNCIPEEFRPDNVAGAESEREKWLCPICKKCKI
FT                   EVRENNINNKIF"
FT   CDS_pept        join(1082075..1082458,1082500..1082825,1082858..1082930,
FT                   1083001..1083078,1083136..1083301,1083331..1083436,
FT                   1083468..1083673,1083772..1084171,1084201..1084294,
FT                   1084346..1084825)
FT                   /locus_tag="TA06695"
FT                   /product="DNA replication licensing factor (MCM5
FT                   homologue), putative"
FT                   /note="Tap349e08.q2ks7.C.cand.106 - score = 68.39"
FT                   /db_xref="EnsemblGenomes-Gn:TA06695"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73379"
FT                   /db_xref="GOA:Q4UHR0"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHR0"
FT                   /protein_id="CAI73379.1"
FT                   /translation="MLGLQEGRVYNTNVSRGLGDEYLKLPNKLPSLDNVYTYFSSFLNA
FT                   YSSTSLQQGKLKRTLLENLKNNNYLLELKLEDLFHFQNVMDTTSEREEESITKQLREAN
FT                   NEDVNSNNRNSEKLPPFYVHELAKVLTQRPLIYLSTIEKVCYDVCKMNMDYEDEKFNFI
FT                   QINLLNNYASPTPIRSLLSDKQETFVVVPGIIVQANRTQHKMRVCTIQCRYCGHKMIIE
FT                   VPLWISRPQIPKTCRYSSTMKTMGENIHVDQQLGCHSVQNPYVIIVNECQFVDVQLLKM
FT                   QELAEDVPTGDMPRHLQLNVTRYLCDKVIPGDRIYAHGVLTSYNNSPNSHTDINSSYLH
FT                   VLGIQKLNVNETYEFDIDEGNDLLLLASQPDIHTKIFNSIAPSIYGLDDVKKACACALF
FT                   GGTRKEVGNGAKIRGDINILILGDPSIAKSQILKFIDFIAPISIYTSGKGSSAAGLTAA
FT                   VVRDSMGVFSLEGGAMVLADGGVVCIDEFDKMRPDDAVAIHEAMEQQTISISKAGITTI
FT                   LNTRCSVIAAANPNLGNFTTQIKLDISIDLNFNFLILNLILGSYNNYQDNNEQHDFKTT
FT                   ILSRFDLIFMLKDNEDINHDKLLCKHILSLHNNQNKQNVVGPISNNKLRRFIQYSKQVV
FT                   SPILSNEAKDSLRNFYVQKRKEYREDKRSSTKKIPITLRQLESLVRVSESLARMELSPI
FT                   ASEKHVQMAIQLFIVSTGEAMKSTLNVDNMSLDDQHKIKLSEELILNIVKKGQRTTRRF
FT                   IIKELQKQYINMVYIQQ"
FT   CDS_pept        1085655..1086134
FT                   /locus_tag="TA06690"
FT                   /product="ubiquitin, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.107 - score = 12.40"
FT                   /db_xref="EnsemblGenomes-Gn:TA06690"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73380"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ9"
FT                   /protein_id="CAI73380.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGKVKVTDY"
FT   CDS_pept        complement(1086304..1090380)
FT                   /locus_tag="TA06685"
FT                   /product="cation ATPase, putative"
FT                   /note="Tap349e08.q2ks7.cand.14 - score = 102.53"
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA06685 by TMHMM2.0 at aa 199-221, 228-245, 390-412,
FT                   425-447, 1100-1122, 1287-1309 and 1319-1341"
FT                   /db_xref="EnsemblGenomes-Gn:TA06685"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73381"
FT                   /db_xref="GOA:Q4UHQ8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ8"
FT                   /protein_id="CAI73381.1"
FT                   /translation="MEPSTGEDINGRVGDNVTNARNEGHGTSSSDENEQTKASNENNGL
FT                   NTPETNGTVVINVENEVPGRPTEIEPKRSGTIEPERQISTSKILSTPSYPAFADIIEME
FT                   TVQRLSKSHIYPGDLIELVKSRDLSKFYEAQQAVEQVQPTTGKSEMAHLPLPAIMNKFG
FT                   LEDTEQGLSDSQVVLNRQLYGSNILDLGKKDPIWKIFLSQFKSFVIVLLFIAAIASLAL
FT                   KNYVEGAFIIFIVTLNSIMATYMERSAANVLEKLAQLSSPTARVIRNNAEVLIDTTEVV
FT                   PGDVLLLQTGDTIVADMRLFEVMEVRINESLLTGESVDVKKTIVAEDLDSPFSTNLCFA
FT                   STSVVSGFGKGIVINTGMNTQVGKIAKQLKKASETSKVTPLQRALNRLGGTIGIISTVV
FT                   LISIVIVAILTGFDDPTRPNTNRTLSIVLLAVGFAASSIPEGLPMVVTISLSLGAKDMA
FT                   RENANVLKLPAVETLGCCSVVCSDKTGTLTEGKMVTTDIVIFFNVRSVTSDNLLKNIIK
FT                   NTNFSLFGATTANVIAERFSFYPTFGFNPVGGVFNPCDLTDSYKRKLITLYKKEADFFT
FT                   IPNNLLSHYVSQNKVDPQPMSKEFTFEDHAKGSGEISSQESLPASATSSANESYLKSVM
FT                   VRLNMCIGYLNSYNTKLVLDKNNKWTCVGNMTESPLIVAANKCGLKPELLEDYPRLETL
FT                   EVPFNSKRKLSITVHKLKVENKFEELEFQQKGKNYTHVALVKGAPDVLRPYCKYVPSLD
FT                   NGVFVDFKYRINSDEEGQDSDDVVMHSNDQLSNDSLRVIMLGLVPLTDEDISYLQSLDD
FT                   SIYRQQYLLSTTNTDDSSYNSGKIVLIGVTGSFDPPRPGVKESIDTCRSAGIRVIMITG
FT                   DQKITAIAIAKQINLITLGPETEDDELGLECNKLHINGNPNMDYLPDEQIDLITSKYSV
FT                   FCRAQPEDKVAIVASLKRKGEITAMTGDGVNDAAALKTADIGVSMGINGTDVAKGASEL
FT                   VLLDDNFCTIVKAVRAGRTIYSNIQKFVSFLLGTNIGEILYLTTSIIINTLPPVEALQI
FT                   LFLNFLTDGCPAVALSREPPDSDAMKKPPRKPNTPIMTTEWWLAGNLPHTIFEALAVIA
FT                   SILIGLYLCTGVITLRDLNERCHYVKVDDYTKMVYFCSSYEYLFTPKYVGWVTNVDYFD
FT                   PEERKMKCFLGAAKGRLEDFHVSHPDLHPELRRKLENLDLSSLEGISGFVEKDDNGWIR
FT                   SNRIKDGTSYHGVGEMGYNDIVSRKSKQARTISFITAVWAEMLRAYTVRSWDYFYNVFN
FT                   RNPWMHIACSISATVTFALTVFPGLSNVLHVVSLTYWQYLLAILLAFTTLILDEFLSKF
FT                   IYRRIKKRRAQKLTT"
FT   misc_feature    complement(join(1086358..1086426,1086454..1086522,
FT                   1087015..1087083,1089040..1089108,1089145..1089213,
FT                   1089646..1089699,1089718..1089786))
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA06685 by TMHMM2.0 at aa 199-221, 228-245, 390-412,
FT                   425-447, 1100-1122, 1287-1309 and 1319-1341"
FT   CDS_pept        1090862..1091974
FT                   /locus_tag="TA06680"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.109 - score = 26.48"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA06680 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.682, signal anchor
FT                   probability 0.023) with cleavage site probability 0.551
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA06680"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73382"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ7"
FT                   /protein_id="CAI73382.1"
FT                   /translation="MGELRKILIYYFILLTNCNCVRFTNKSFRYSMANNKYSSNERLLD
FT                   ESGVYFKNLLKERVNTEGLSASDLKYFENVKNQLANHYSLTLLNYVNNKFKNINFLFNS
FT                   NSTGNNGKTDSTNTTDSDNKLESTNKSDSDKEVNDEQQDRNSQMSAEVDMNENMAKLCK
FT                   IYENSVVSTLLLYLQLTEDALSKSKKQSFEEERLRVFVELYNILYNKIYSVVSLNVNNL
FT                   KMYYINYFFEDKNTKSVPLVVGTYSKNLNSLIPNVLKFNNINSLLSFYNIKLKVSSENE
FT                   NLSLSKNTLVNELKFILTNIQKHAKSDSADNAGKSGANKNLMKVISNQQNKIEQYNKLI
FT                   SNKAGGSRLNYVFTYRIPHTNLTLTTSYIK"
FT   misc_feature    1090862..1090921
FT                   /note="Signal peptide predicted for TA06680 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.682, signal anchor
FT                   probability 0.023) with cleavage site probability 0.551
FT                   between residues 20 and 21"
FT   CDS_pept        complement(join(1092166..1092333,1092366..1092500,
FT                   1092608..1092844,1092895..1092960))
FT                   /locus_tag="TA06675"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.cand.13 - score = 15.80"
FT                   /note="1 probable transmembrane helix predicted for TA06675
FT                   by TMHMM2.0 at aa 5-27"
FT                   /note="Signal peptide predicted for TA06675 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965, signal anchor
FT                   probability 0.005) with cleavage site probability 0.751
FT                   between residues 21 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:TA06675"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73383"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ6"
FT                   /protein_id="CAI73383.1"
FT                   /translation="MYNTFYLLFSFVLLSNFTIFAQSNYNINVIFNGVMYNKDVKNNDL
FT                   LSAIDSIVREQNFEYKSIVNHLNYYSIYYQNKLINNLTNLKINSNNNYLYVYYTQQGLN
FT                   EIYLSNNINNLLSLVKKFINNSEMYTIIEQVFKSDFIISLLQTILFSNGNKNNSQNSLL
FT                   LKLLLNKFDNASTPNNKDKGKESKDRENKISNVLVSLN"
FT   misc_feature    complement(join(1092830..1092844,1092895..1092948))
FT                   /note="1 probable transmembrane helix predicted for TA06675
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    complement(1092898..1092960)
FT                   /note="Signal peptide predicted for TA06675 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965, signal anchor
FT                   probability 0.005) with cleavage site probability 0.751
FT                   between residues 21 and 22"
FT   CDS_pept        1093083..1094627
FT                   /locus_tag="TA06670"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.110 - score = 34.06"
FT                   /db_xref="EnsemblGenomes-Gn:TA06670"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73384"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ5"
FT                   /protein_id="CAI73384.1"
FT                   /translation="MSDSEDLDDFDIILNSNQLDTDSDDEYTNKNKYRNRTANRKGSKK
FT                   KSRIKDEDVSFVSGGLLNLNAETNEEPVEETKPKPNVQLNDASLSKLYGKGLNMIKKMG
FT                   YKGGTLGTSSNIPEDRKVSQDYPKSPQRQNLAQDNYRRLNHKRQEIILEIKKLSENNLE
FT                   IQLDIKLINNNINNKQSVINNINDNKSLVIDNFKLLLSSLTSTDEKTTDDDLREEQLIN
FT                   KIIEILIDNINLLKKVIKIIFKKKFKVKNDSNLDFVSNLLRNENVLSNPAVYNTVLDCV
FT                   NYYLINNLITYYKSNLNLENIEKCIGIYNMIKGVKIDLEAVNKFLISKFCKEIDTNLKT
FT                   SHLVTFPFLEFLEDDEIEVITRKFTGKFEEEFKILSLNEGEKIDQLFQILNNWLSLLSN
FT                   PSDLVYNVLYNKLTGYSIEDNPNDVSDILRNVMKFEKMVNVKELLEKTVIMSFRNHLTR
FT                   EISSALSYSAVESCVDLYLKFKSSLPDYINSDQNIQNNYYRPILQNIDLYVNKSSQ"
FT   CDS_pept        join(1094716..1094797,1094832..1095373)
FT                   /locus_tag="TA06665"
FT                   /product="30S ribosomal protein S16, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.111 - score = 15.90"
FT                   /db_xref="EnsemblGenomes-Gn:TA06665"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73385"
FT                   /db_xref="GOA:Q4UHQ4"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ4"
FT                   /protein_id="CAI73385.1"
FT                   /translation="MINRMFLPYYSKSRGPPRLRFQVMGKRGKRFLMLVAANQRDPRDG
FT                   KHMEVLGSVQRRPINPIPSSIGENHESLSEIRLRFSRIKFWLGVGCDMNVSVATVLSQA
FT                   NLIPPHPPKFGERTRGHFHLLSQIVENRQQVHLNRVKTFLLRESPCVNDDEDVYKPDLE
FT                   ETPARIVQNKIYPPELKELDQAAHFDITEEPLNPEKKVLRKLVR"
FT   CDS_pept        1095634..1098153
FT                   /locus_tag="TA06635"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.112 - score = 41.43"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06635 by TMHMM2.0 at aa 20-39, 127-149, 159-181, 223-245,
FT                   656-678, 685-702, 735-757, 777-799 and 803-825"
FT                   /db_xref="EnsemblGenomes-Gn:TA06635"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73386"
FT                   /db_xref="GOA:Q4UHQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ3"
FT                   /protein_id="CAI73386.1"
FT                   /translation="MVCTCGETTIDSYLDDCPYLTTAYILAGLSMMLNIRLAYSSAPYA
FT                   LIRFRLPENLFSVFVRRMASALEFWCLPSMLLGNIMEIAQKVTADKKSEFKLDHSKQQQ
FT                   QDQGDNKTKLGTLIQMKRWKFMWIIFPSMVTMWSDFITYLILLIVYVTGGDTGNVTGYY
FT                   FVIAVSGFIFGINMVLVYAADWRYTPVYIAGENAFPMLTSIIHYFATLIFGNRRRYNSD
FT                   FMIVTIDICVAIVISFTTATLWTSAYYIMDHKSPNKILRFGVRPGQFGTADAYGTTRNT
FT                   DLTFSVNLNGGTGFQSSGTIIITVGSDNFTELNSHTGDVTITLSGSGSIKKSDGEFARG
FT                   INEPLNKGTQLVINATGRISTPNINGSDITIKGNLTVTSEGGKKLGTSLTLGPDSSDPS
FT                   SNGLGGSITTEGTSNTVTIKENSTITLKDEALKAIKSLTQNAVTLSGTGGFKSSASITV
FT                   SRDEGNNTDLSNLNVTSNLQITINDGSIRNSDGSELQRGTTLNKGTKLSIEANGQITEP
FT                   RDASGTVKLTGTIVVTSNNVTIGNSGLNFNGGPNRTGVDGTLTLNDENGPPKYVKITNA
FT                   SSKITITSAAYTIIKKASDTIPSFFTIGAADPRNPEKVKHADGLDKEHDFTKHWHIMPS
FT                   DKYDSNDLPDPTVVSPALMVIIGMGFVYCIYPGIAPGMIVPFFLVDKIETVLLVLTTFP
FT                   PVIIAILQKHKAGWSPKTQHNGTRFGGWKSYNAFGDYNTTFYHGFDILMIIKMTLLVIF
FT                   IYCLHYRDSHISRSIVNQPKMSTFLTIVFYMCHEFLLALGFSGVIGNNGATYIVLPAQY
FT                   VGALLMIFLAFYSEGYIIEYKSHDPAH"
FT   misc_feature    join(1095691..1095750,1096012..1096080,1096108..1096176,
FT                   1096300..1096368,1097599..1097667,1097686..1097739,
FT                   1097836..1097904,1097962..1098030,1098040..1098108)
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06635 by TMHMM2.0 at aa 20-39, 127-149, 159-181, 223-245,
FT                   656-678, 685-702, 735-757, 777-799 and 803-825"
FT   CDS_pept        1098412..1099746
FT                   /locus_tag="TA06580"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="Tap349e08.q2ks7.C.cand.113 - score = 16.46"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06580 by TMHMM2.0 at aa 20-42, 108-130, 140-162, 202-224,
FT                   256-278, 291-309, 337-359, 380-402 and 407-426"
FT                   /db_xref="EnsemblGenomes-Gn:TA06580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73387"
FT                   /db_xref="GOA:Q4UHQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ2"
FT                   /protein_id="CAI73387.1"
FT                   /translation="MAQHNCTEAKENYGGKFSCPLLIAAYVFAGLAMMLNIRLSYSSAP
FT                   YALIRFRLPENLFSVFVRRMASALELWCLPSMLLGNIMDLGVKGAIGSANEDNKKWWKF
FT                   YCIIWSSIICQWLNFITYVILLIVYVIGGDQGRLTTFYWTIAISGVVFGINMTLVYSVD
FT                   FYYIPVYIAGENSFPIVTSFMHYLSTLMFGNRRKWNSDYLIVMIDIGVAIIISFAAAVI
FT                   WTVGYLCEVDDSTEVKDMKHIHANGFDGKFSEHLISPFLMVIVGMGLVYAIYPGIAPGM
FT                   IVPFYLIDKIEMVLLIATFFPPVIIAILRKHASDYSPTHFDRGKAQPWSTYTAGVFYLS
FT                   LNILMVIKILLAAIFICSLHYRDSSISRSIVNQPKMSTALSITFYMCHEILLAVGFSGV
FT                   IGNDGGDFILIPQYIGALFMIFLAFYSEGYINEYKNHDPEHWSID"
FT   misc_feature    join(1098469..1098537,1098733..1098801,1098829..1098897,
FT                   1099015..1099083,1099177..1099245,1099282..1099338,
FT                   1099420..1099488,1099549..1099617,1099630..1099689)
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA06580 by TMHMM2.0 at aa 20-42, 108-130, 140-162, 202-224,
FT                   256-278, 291-309, 337-359, 380-402 and 407-426"
FT   CDS_pept        complement(1099951..1100970)
FT                   /locus_tag="TA06475"
FT                   /product="sugar transporter, putative"
FT                   /note="Tap349e08.q2ks7.cand.12 - score = 61.65"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA06475 by TMHMM2.0 at aa 35-57, 129-151, 178-200 and
FT                   227-249"
FT                   /note="GPI-Anchor Signal predicted for TA06475 by DGPI
FT                   v2.04 with cleavage site probability 0.3306 near 305"
FT                   /db_xref="EnsemblGenomes-Gn:TA06475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73388"
FT                   /db_xref="GOA:Q4UHQ1"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ1"
FT                   /protein_id="CAI73388.1"
FT                   /translation="MKGATSLSFLSLYYLGKTLYYESNKKLLSYLNNMVALSVLNMLSA
FT                   VPFFALKWVLGLQSPPVFYPLQYTPEKINFKVDGVLGSVKKTLKNGVNRVKSYVMAYKT
FT                   VMLQTTFLLAPKILTDSASLFTFRNTFFLNFLQTMEPVLTSLIYYFFDDLKLDTKTYLS
FT                   LLPLVTGAAYATYSGVRSSFGVIAYFLLTNLGVYFTTDEMKEFLSQNMDKVGKNLTKSN
FT                   LNSTVTISLYLLLSFVLVSEGCGFSYACDNLLKRIKGGDYEIIKYIFLSGLSNYMMNTA
FT                   RFGLFSELSPITKSVATTMLNLFNSLVVSVVSEGKLSKNELYGTALAIAGTFLYLLTK"
FT   misc_feature    complement(1100053..1100058)
FT                   /note="GPI-Anchor Signal predicted for TA06475 by DGPI
FT                   v2.04 with cleavage site probability 0.3306 near 305"
FT   misc_feature    complement(join(1100224..1100292,1100371..1100439,
FT                   1100518..1100586,1100800..1100868))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA06475 by TMHMM2.0 at aa 35-57, 129-151, 178-200 and
FT                   227-249"
FT   CDS_pept        complement(1101179..1101463)
FT                   /locus_tag="TA06420"
FT                   /product="hypothetical protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06420 by TMHMM2.0 at aa 10-32 and 53-75"
FT                   /note="Signal peptide predicted for TA06420 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.732, signal anchor
FT                   probability 0.124) with cleavage site probability 0.204
FT                   between residues 28 and 29"
FT                   /db_xref="EnsemblGenomes-Gn:TA06420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73389"
FT                   /db_xref="GOA:Q4UHQ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHQ0"
FT                   /protein_id="CAI73389.1"
FT                   /translation="MIFCTSPGQVVSHTLSVCVLLSIISTSCNISRIDKPSKHYNRASL
FT                   KCTYLHYILDYLSNIVKFLTYLFSVWVGILGIHNKFTSNKPRISTSKVQ"
FT   misc_feature    complement(join(1101239..1101307,1101368..1101436))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA06420 by TMHMM2.0 at aa 10-32 and 53-75"
FT   misc_feature    complement(1101380..1101463)
FT                   /note="Signal peptide predicted for TA06420 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.732, signal anchor
FT                   probability 0.124) with cleavage site probability 0.204
FT                   between residues 28 and 29"
FT   CDS_pept        complement(join(1101752..1101945,1101976..1102063,
FT                   1102098..1102246,1102277..1102442,1102476..1102553,
FT                   1102589..1102686,1102716..1102830,1102873..1102947,
FT                   1102979..1103150,1103198..1103256,1103328..1103375,
FT                   1103425..1103523,1103558..1103731,1103762..1103878))
FT                   /locus_tag="TA06365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA06365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP9"
FT                   /protein_id="CAI73390.1"
FT                   /translation="MISRRFFSFLSKCNGNNLNLDVFSKNGSQLSQTIRIASQNKYEDS
FT                   KFWNLAKTRFQYLYKGLNARNLAFIANGFARAKIADNSIWNSIISRSHEILNDLDIQDL
FT                   ALLLNAMCKIECIDKANLTHLIVKIKELPLALFMYDYALLGKSIQPNLNQLSLVSISNL
FT                   VNSFYNLKYYDKAMMKQLIDVIRDKMNDDKSVKTVASIYQSYAHSGVYNKELYSSFFNY
FT                   FISNVKDLKILEMIIIANAMKVSKFHSEELIEKMSKKIINSPRKYNLDDLSSYLQSLTP
FT                   KYSTKANVEKIMKSVETNRFTGNFTTSNSVIFLQVYNNFDIKNENLLKTLLKNLKDNEE
FT                   KLTELELVNVICCCKVIENDLDKFLGLFLTHDSSLLNLSRVLYHTTKSKIKLGTFEDEI
FT                   MGKLSKSNIKNCDSTVTISNLLFSLKSVKDSEYKNELINQCIEYVKVNYSKFTNQLLTS
FT                   SLDSINELERTEEILDKFTRNIGKFKGYTSYGDNLKLLKMLNSVNYFQLSGSLESVLES
FT                   YQVILNNIKSCENGSTAENPEFREVS"
FT   CDS_pept        complement(1104121..1105425)
FT                   /locus_tag="TA06310"
FT                   /product="clathrin-adaptor (medium) chain, putative"
FT                   /note="Tap349e08.q2ks7.cand.11 - score = 25.91"
FT                   /db_xref="EnsemblGenomes-Gn:TA06310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73391"
FT                   /db_xref="GOA:Q4UHP8"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP8"
FT                   /protein_id="CAI73391.1"
FT                   /translation="MGGISGIYILDLKGRLIICRNYKADLLTNVCDAFYENVILQDSST
FT                   LKPVFHSDGCTFSWISQNGIYFIAVASSNYNVSLSISFLYRFVGVLTSYFKHLSEESIR
FT                   DNFAIVYELLDEMVDNGFPQVTEVSVLREFIKNQYHQLTLDKVRPPTTMTNSVSWRREG
FT                   IKHKKNELFLDVIESLDLILSASGTVLRSEIKGCLKMKSYLSNMPEVFLCLNDKLLFST
FT                   DSGTIGLDANGNSVKSFVELEDVKFHQCVELTKFNTDRTITFIPPDGEFELMTYRLRCR
FT                   VKPLFSLYVTYNSKSSTRIEFYVKATSQFKSKSMATNVEFLIPVPSDVNCPEFNPTQGS
FT                   VKYLPDQDAITWYVKQFQGDKVYTMFASFGLPSVSDESRNTFSKNPVKIKFEIPYYTVS
FT                   GINVKHLRITDKTGYKALPWVRYITKNGDYQLRMT"
FT   CDS_pept        complement(join(1105866..1106120,1106181..1106514,
FT                   1106568..1106778,1106807..1106916,1106948..1107000,
FT                   1107082..1107260,1107338..1107419,1107532..1107615))
FT                   /locus_tag="TA06255"
FT                   /product="26S proteasome subunit, putative"
FT                   /note="Tap349e08.q2ks7.cand.10 - score = 43.57"
FT                   /db_xref="EnsemblGenomes-Gn:TA06255"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73392"
FT                   /db_xref="GOA:Q4UHP7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP7"
FT                   /protein_id="CAI73392.1"
FT                   /translation="MKDAEEDSEEKKKTVPLSETEVKILKSYGVGPYAAPIRAADNDIK
FT                   EVINRINKLSGVKESDTGLNPPHMWDLVLDQRSLQEGAPLQVARCTNIINPGTPQAKYI
FT                   INVKQIAKFVVGLGEKAAATDIEEGIRVGVDRNKYKIQITLPPKIDPSVTMMTVEEKPN
FT                   ITYNDIGGCKDQLEKLREVVEMPLLQPERFVQLGIDPPNGVLLYGPPGTGKTLTARAVA
FT                   NRTDACFICVIGSELVQNIIIILNDEIRYVGEGARLVRELFQMARSKKACILFIDEVDA
FT                   IGGSRGEDASNGDHEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDSALLRPGRID
FT                   RRIEFGLPDLEGRKHIFKIHSRTMSVDKNIRYELLARLCPNSTGADLRSVCTEAGMFAI
FT                   RARRKSISEKDLIDAISKVIKGYKKFSATGRYMVYN"
FT   CDS_pept        join(1107894..1108032,1108065..1108141,1108172..1109072,
FT                   1109163..1109356,1109392..1109478,1109509..1110405)
FT                   /locus_tag="TA06250"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.114 - score = 51.84"
FT                   /db_xref="EnsemblGenomes-Gn:TA06250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73393"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP6"
FT                   /protein_id="CAI73393.1"
FT                   /translation="MVENELVTGKPKQNVLTCTEKDYLNSLISLDLNDSLSFSKAINPS
FT                   EHETELYVEALLKRLNSLDEDIWYSVETIQNNVCNTLTRLCNLFYDKSENSNHDAELFE
FT                   TVYTRLKRIEDLSLAIKCKYDKTQSLRELKRLKNVIIANQKVLSLIYNWDNYIKSIQSM
FT                   FLQYTNRRNEHVECSSVTDGVSQSEMYFILNSEGFTISDLDRLKAIISQLKLDYDTCLD
FT                   NLVNTNVAQTLSFIMDKYYIILQDFTSDIVNYVITTCKIDRNDSFKPTSIDISDDVREK
FT                   LVKYVEYYSVDGGLNYTCLNRHLKNKLEEIFMNHFKTLGETSLNLFSNTLTLNLALMNK
FT                   VQSVLNSFFEYFFNFFITFKPSYHFIMSHQQNENVMEMYNKLIVNILLKCILNSNVYNS
FT                   ILRSEEVFECVESILNIYNEIFNKFQNYIDQLNLNQHIESANLIPFDILDNYTFHIYNQ
FT                   QVSNTEQMKYNSLEDCISNFRLLLPSQVRNVDQRPQILLWLSIYCKLNNLKVEYDNYVE
FT                   SCCKFVKEYFSALVPRFDTNPINTKFELSLRDFIVELLETHGLLVESVHQLLLTATMSF
FT                   QSKIDLNVYSSLRENHDWKLAHHLSQPFRQLVFSNSKFSDSNSDNFSNKFLGLDSSSDM
FT                   ASTKCLDSNNLMNQFEIKTLLYTASQSVSKYISNVVTFLIKNLYEDASGKDNKVNMYVE
FT                   YIGEYYINLLSKYCEHNETFKILQKSFEMFIDEEFENLTKLKNQKDNIQYLIKIAKLLN
FT                   INTSDSLSMLL"
FT   CDS_pept        complement(join(1110461..1112262,1112351..1113866))
FT                   /locus_tag="TA06145"
FT                   /product="26S proteasome regulatory subunit, putative"
FT                   /note="Tap349e08.q2ks7.cand.9 - score = 81.24"
FT                   /db_xref="EnsemblGenomes-Gn:TA06145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73394"
FT                   /db_xref="GOA:Q4UHP5"
FT                   /db_xref="InterPro:IPR002015"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016643"
FT                   /db_xref="InterPro:IPR040892"
FT                   /db_xref="InterPro:IPR041433"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP5"
FT                   /protein_id="CAI73394.1"
FT                   /translation="MSKNKENLSEVDAAYKEELDSLVLDLLNRDLCSPESESILLKLVD
FT                   HATNDFGNISTIPKSLQFLISHKVALDEYYKRYTLKNGQDNFPLVLLLEIISFLDAINL
FT                   NDSANNGNSSEDHGSSKVPEAPSFKLLLYKLEANLIAQRLNNLVSSDCHPETAQNALKN
FT                   GVNNVNSELGGDTTQYKHSKTPVLSDVAKKMLSERKVSDWGNEYLISLSSQIVSYYSTL
FT                   STRQFLSNNAINVSNLNNNTVNFPDSVNLVNNADGVKKTVVGEVNTGLVIFESLKLIEE
FT                   MTSYWLANGFEFDAIDLLLEVDRIESLEDKCSDDYDLVTRVSSYLAAVSAYGATLTETC
FT                   RILTVTYNILLRNGRYLEATRVALKLNQYDKVIEVLNKCKDINTLKQIALFLGSNHLFI
FT                   PSLTDASSNTGMNLDIDIDYTVVYLNSGENRSSLFLSLCKELDILDPKHPNDVFKGYPS
FT                   KSNLNLTQSISGVSIDSARDNLSYTFVNSFINCASSKDKLITTSTQSDKDSSATNEQES
FT                   SKDKSGEPDFWLFKHQGYGLLCASASLGLIHLWNLDEGLSEIDKYQYSTDQYIRSGSYF
FT                   AFGLVSCGVASELDPVQGLLVDKLDSTNFLERLGAILGLTFAYSGTNRNDMLELLTPHV
FT                   VDLSSIECSLFSSLALSVIFVGTGNQESSEAILQVLIEYISSHTDSTPNLKYVRMYLCS
FT                   LGLLQMCRGELCEPVLDALSVLGKYEKVAVTLVESFAYATSGDVLKVQTLLKNCSATST
FT                   TSTNASNTTAANTDSDTNTNTAGNIDGTGNIRDTETNATGTTNVNSTKDTNAGDNNTNS
FT                   GTNTNGNTDNTNAETSNSGGEGNAAKEDNSVDNELYGVSILCISLLSMGESIGSSMLVR
FT                   LLEHPLQCGTVHERRAVPLAIALVNVSNPAPAIVSALSKLSHDTDKDVSLCAILGLGLV
FT                   GAGTNNSRISQLLQNIAKHSYRDSTLMYVLRISVGLLFMGKGTLTLTPLHSDSFILNKT
FT                   SLAGLIITLFCALDLRSLVCEEFPFLPFFLALAVRPKWLITLNQDLEVVHIPVRVGTAV
FT                   DTIGTAGKQRKISGFQTHKSPVLIGVGERAELATEEFETFTPFLEDIVLTTQVSHDH"
FT   CDS_pept        join(1114727..1116508,1116612..1116905)
FT                   /locus_tag="TA06140"
FT                   /product="hypothetical protein"
FT                   /note="Tap349e08.q2ks7.C.cand.117 - score = 44.50"
FT                   /db_xref="EnsemblGenomes-Gn:TA06140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73395"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP4"
FT                   /protein_id="CAI73395.1"
FT                   /translation="MVSLRNSAIVNRVRNVYRDNTKDSALESLRLQSVSISNIRNLSAG
FT                   LSSSDSSELDLESSHSSLHFNSRKRLNERKVIRSRSQSLESIALQRNNTFSQNDKRLHY
FT                   DNSLQYENGIQCDNQLEHNGLQYEKEDSGESENMDEYEDRVEDEYESIIGSDDEYRTAS
FT                   GTQEDISPLDLLMNFTNDTNDNVDRGKSKISYKTTQRYNSSDNSKLLNSDDSSITTPLS
FT                   NLLLFESQVNDNINKSRTKPGNKIKPTLNHSNKPTNNTIYTDINVNGVDNMIDAGYIEN
FT                   KKLRLNFEPKLSVVDDYSYVPSRVVINKSTFVIGSDVFCDLVLPKKRFKFIAPKHVKFV
FT                   LEHPITDQSTSKPVSNNLDFRIKLSRCSTSGALYLNNNFIRGSSYIESGDVICLGPRNN
FT                   FLAFKFYFQEENSNSQNQSDDRIVISDDISLMDVKIFVFQLPKTVNTSRNGANTHRSSY
FT                   SDDDSDEEWSENNYKSPSRRYFSQLSHNTSGVNSVDSTVEKSGYYRLKSPVRKYNFIQQ
FT                   EIKEAETEEQFDNLDSKETEPFLQFYSSENKNNEELNPNEELDLNDKVDINEEIDINDE
FT                   DINSKSTPRNDQYKLIGIIDCWNNMAISEILPDLNEKMSKNVDGNKKGKYGLIVNNKEL
FT                   KGKELELKVYQLELLNREIPEIKDALDNYNNFKDNENSLENIIKNNLCKILFVNLN"
FT   CDS_pept        join(1116941..1116956,1117142..1117374,1117407..1117494,
FT                   1117601..1117708,1117772..1117872,1117966..1118253,
FT                   1118284..1118379,1118412..1118561,1118654..1118770,
FT                   1118841..1119017,1119091..1119396,1119489..1119599)
FT                   /locus_tag="TA06085"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.C.cand.118 - score = 38.73"
FT                   /db_xref="EnsemblGenomes-Gn:TA06085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73396"
FT                   /db_xref="GOA:Q4UHP3"
FT                   /db_xref="InterPro:IPR011387"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP3"
FT                   /protein_id="CAI73396.1"
FT                   /translation="MDDIITDGLNGVSLRDHSMASDHWFLVALSKKTLHIYKFYPKTAT
FT                   NPGKQNSVILLRFLVEKLELFREYSDISKSFVSNKGNLVCLLKESSNSIQLTELESSKV
FT                   LKSLNLPNDSVLKEVVFSPLDTFLTVLTSWSQSNPNNLVVYNLKDPNYSVVLSLPYEKS
FT                   YVVSRFPTWTQDESFCILRVMDEIKVWKNNDFSKLYSSFTVNLTPESVTNDTTNSPPTD
FT                   KTDSLPTDKTNSLLSRGNNYLTTDKTNTLPTRVTNSSPTSKTNSLPSGATISLSPPNDK
FT                   GFCYIGIFASNQGKFDRGVLRIYSTTQLEKPIFNKEFDASEEGELFWNSKGTSVLFRTF
FT                   ANSVKGLASYYGANSLYLINLNNSKFKTISTVNDGIIHDISWSRNGKDFLLLKGPMPAE
FT                   IDLYDGVTGLKTLSFGKNNRNTVKRDPFDRLVLMGGFGNLRGEIDIWDMKTKKKISQSK
FT                   SECSVSCEFSPDGMYFVTATTVPRMRVDCCFKIFSYSGKLVQRVDFEELYHVYVRNPKF
FT                   KFRQRDPSPSVTLENSTTSTPLYRPPGSLSGPKIIKQTNIPANTAVPVINKPKLVGPPG
FT                   ADAALLSAASKIKKKNRNKK"
FT   CDS_pept        complement(join(1119719..1120051,1120109..1120642,
FT                   1120718..1120810,1120887..1120983,1121099..1121247,
FT                   1121277..1121345))
FT                   /locus_tag="TA05980"
FT                   /product="molecular chaperone, putative"
FT                   /note="Tap349e08.q2ks7.cand.8 - score = 33.14"
FT                   /db_xref="EnsemblGenomes-Gn:TA05980"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73397"
FT                   /db_xref="GOA:Q4UHP2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP2"
FT                   /protein_id="CAI73397.1"
FT                   /translation="MFFGGFPFDGMPGGGMPHSRSKEPVDTEKLYKLLDLSKDCSDSEI
FT                   KKAYRKLAIKHHPDKGGDPEKFKEISKAYEILSDPDKRRIYDEHGEEGLDGSYTATDAS
FT                   DIFDLFFGGSRKPKGKKRGEDIVSHLKVSLEQIYNGTMRKLAINKDIICNGCDGHGGPK
FT                   DSFVTCTSCNGQGIRVQIRQMGSMIHQTQTTCSSCNGQGKSLPESKRCKNCNGKGVKQT
FT                   KKILEVFVEKGVPDQHKITFHGEADERPNEIPGSVIFIINQNPHDTFKRNGNDLFMTKS
FT                   IPLYQALTGCTFYLTHLDDRILKINVIPQLHYTTPAGEVVKPGSCKVITGEGMPIYKSA
FT                   YGKGNLYVTFDVIFPVGRTFSPSEKEMLLELFPFTPETPAKPDTQVDEYTAQHFDLDDY
FT                   KSSDNSREYEEEEGGHGDRVQCRQQ"
FT   CDS_pept        complement(join(1121883..1122227,1122259..1122310,
FT                   1122362..1122591,1122654..1122701,1122735..1122840,
FT                   1122879..1123087))
FT                   /locus_tag="TA05925"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Tap349e08.q2ks7.cand.7 - score = 38.76"
FT                   /db_xref="EnsemblGenomes-Gn:TA05925"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73398"
FT                   /db_xref="GOA:Q4UHP1"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027517"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP1"
FT                   /protein_id="CAI73398.1"
FT                   /translation="MSLQSLIDEFIKLDEFSSPSKDLITSILLNPEVPLSLQLRALYYC
FT                   RDLPEEDCSKILISALDVHFDTFMRHEIAYVIGQSGCFSASKKLAELVEDVTEDPMVRH
FT                   EAIEALAALKSKDHIHLIKKYCDDENRAVRDTCNLALHTLINAEDSNTEGCTSFPISSS
FT                   PYRAIDPVRTDSVDESDLNSLSEILFNQSLPLYKRYEALYKIRGISGDEAAKIIGEALV
FT                   KDKVSEVFRHECAFVLGQMQSVAPVKSLIECLRNRNEEPMARHEAALALGSCASLYCQE
FT                   QTEGFEDWEKLIVEVLEEFLQDEVKVVSDSCLVAMDYINESKHELTAH"
FT   CDS_pept        complement(1123466..1126027)
FT                   /locus_tag="TA05870"
FT                   /product="rhoptry-associated protein, putative"
FT                   /note="Tap349e08.q2ks7.cand.6 - score = 49.03"
FT                   /note="Signal peptide predicted for TA05870 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.938, signal anchor
FT                   probability 0.000) with cleavage site probability 0.522
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA05870"
FT                   /db_xref="EnsemblGenomes-Tr:CAI73399"
FT                   /db_xref="InterPro:IPR004318"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UHP0"
FT                   /protein_id="CAI73399.1"
FT                   /translation="MSIQSVLIILLLSKTLVKQSNAVINQKRPSELGAKNEFFENTEGD
FT                   NTDSFVNKNSNNSVQSEIGNLERAFSKGTKTINETASSVFEAFSNGLGLLVSGSGVFGD
FT                   KADQLITEGIGTTGRIIDRTKDVTRGVTELLEDTSVEFDSRVGSKENLDKFNHYMSHYL
FT                   TQNKNKVDDKLGKENLMGEKYYNLYCQRCLQGDCLTFDNFKVADMGNNIKLFLPSLVQV
FT                   SVALYLFKESVNNEYNFITTLLRRTNYNSTEFFILVLARHNLKKREFLNSNDEGVNTFY
FT                   YKATLLYKKFTSESKIKNQLDSKKTLTTVLGFFVKSDLIKVAQMSTFGSDIKLDGDELN
FT                   QLTVNFKNYLMNDSEEFNYLSDSYANLCRDCLQGSYEENMFNTEMMDYLIEGKYDADDI
FT                   CDGQEEECLVMLDKYVERCKGGDCYTLDSVNLMENIRLRVLMPNIPQAKLALRIFRRSK
FT                   AHRAGNFLVGLMKRLFRMETHRTLRTFILMLAKHNVKMSYYNNEAEKVINRFLYQSTLF
FT                   FVRFLTVSKLVTFYSLGKFTLWLFSFGRYKYLKELAKDITFGNKIVLTHDLSTVMVKYS
FT                   DYLVKFNQKKLHTIARYFASMCREVVMKHVNVDKISADMFDTMEEIKPTDICGKSEKLD
FT                   CPTLVQIFLDRCKNGDCYTLDSKNYFTLNRMTKLTLPILHQVDAAIYVFNNSSSNKGRF
FT                   TRLVKSIGSVADIDPFIQFYRNLVNHNSKLITYKSLDNEVLNRYLFNSAVYYKFISDKH
FT                   LLDSVDSEFLREFNHTSEKVEMFMNRTLRSLVGAERIRLKGIDLDEVFKIYRKYFYTTQ
FT                   VVT