(data stored in ACNUC22857 zone)

EMBL: CR940348

ID   CR940348; SV 1; linear; genomic DNA; HTG; INV; 1979170 BP.
XX
AC   CR940348;
XX
DT   15-MAY-2005 (Rel. 83, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Theileria annulata genomic DNA chromosome 2
XX
KW   HTG; HTGS_PHASE2.
XX
OS   Theileria annulata
OC   Eukaryota; Alveolata; Apicomplexa; Aconoidasida; Piroplasmida;
OC   Theileriidae; Theileria.
XX
RN   [1]
RP   1-1979170
RX   DOI; 10.1126/science.1110418.
RX   PUBMED; 15994557.
RA   Pain A., Renauld H., Berriman M., Murphy L., Yeats C.A., Weir W.,
RA   Kerhornou A., Aslett M., Bishop R., Bouchier C., Cochet M., Coulson R.M.R.,
RA   Cronin A., de Villiers E.P., Fraser A., Fosker N., Gardner M., Goble A.,
RA   Griffiths-Jones S., Harris D.E., Katzer F., Larke N., Lord A., Maser P.,
RA   McKellar S., Mooney P., Morton F., Nene V., O'Neil S., Price C.,
RA   Quail M.A., Rabbinowitsch E., Rawlings N.D., Rutter S., Saunders D.,
RA   Seeger K., Shah T., Squares R., Squares S., Tivey A., Walker A.R.,
RA   Woodward J., Dobbelaere D.A.E., Langsley G., Rajandream M-A., McKeever D.,
RA   Shiels B., Tait A., Barrell B., Hall N.;
RT   "Genome of the host-cell transforming parasite Theileria annulata compared
RT   with T. parva";
RL   Science, e1252229 309(5731):131-133(2005).
XX
RN   [2]
RP   1-1979170
RA   Pain A., Renauld H., Murphy L., O'Neil S., Harris D.A., Quail M.A.,
RA   Berriman M., Hall N., Barrell B.G.;
RT   ;
RL   Submitted (31-MAR-2005) to the INSDC.
RL   The Wellcome Trust Sanger Institute Genome Campus, Hinxton, Cambridge CB10
RL   1SA, UK
XX
DR   MD5; fdda05da0d692603c254c315fdbee3fb.
DR   BioSample; SAMEA3138180.
DR   EnsemblGenomes-Gn; EPrG00000717705.
DR   EnsemblGenomes-Gn; EPrG00000717706.
DR   EnsemblGenomes-Gn; EPrG00000717707.
DR   EnsemblGenomes-Gn; EPrG00000717708.
DR   EnsemblGenomes-Gn; EPrG00000717709.
DR   EnsemblGenomes-Gn; EPrG00000717710.
DR   EnsemblGenomes-Gn; EPrG00000717711.
DR   EnsemblGenomes-Gn; EPrG00000717712.
DR   EnsemblGenomes-Gn; EPrG00000717713.
DR   EnsemblGenomes-Gn; EPrG00000717714.
DR   EnsemblGenomes-Gn; EPrG00000717715.
DR   EnsemblGenomes-Gn; EPrG00000717716.
DR   EnsemblGenomes-Tr; EBPr00000717705-1.
DR   EnsemblGenomes-Tr; EBPr00000717706-1.
DR   EnsemblGenomes-Tr; EBPr00000717707-1.
DR   EnsemblGenomes-Tr; EBPr00000717708-1.
DR   EnsemblGenomes-Tr; EBPr00000717709-1.
DR   EnsemblGenomes-Tr; EBPr00000717710-1.
DR   EnsemblGenomes-Tr; EBPr00000717711-1.
DR   EnsemblGenomes-Tr; EBPr00000717712-1.
DR   EnsemblGenomes-Tr; EBPr00000717713-1.
DR   EnsemblGenomes-Tr; EBPr00000717714-1.
DR   EnsemblGenomes-Tr; EBPr00000717715-1.
DR   EnsemblGenomes-Tr; EBPr00000717716-1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1979170
FT                   /organism="Theileria annulata"
FT                   /strain="Ankara isolate clone C9"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:5874"
FT   CDS_pept        complement(3563..7171)
FT                   /locus_tag="TA16055"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="chr2.cand.535 - hypothetical temomere family
FT                   protein"
FT                   /note="Signal peptide predicted for TA16055 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.975, signal anchor
FT                   probability 0.000) with cleavage site probability 0.696
FT                   between residues 25 and 26"
FT                   /db_xref="EnsemblGenomes-Gn:TA16055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74026"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU0"
FT                   /protein_id="CAI74026.1"
FT                   /translation="MKRWIITLNLLFYITFLNQWNFAESQTVNGDSTTPDSDGSTPVNS
FT                   VDPTGTSAGQASQSPITESQPKSSSSATDQSSTEGTPTDTTLTNPVTSVTKVTLDLNAT
FT                   QSTTQFDYTDENGLVTFTPMSGYVFYKVSQGTNLIWESKGNIFGSLVRTNTKDDAKYLA
FT                   ILLKDNMFKLFKLENNEWNDITSQTSDIKKLKFFGDNDTELKSSDYTVILIYLSYQYTF
FT                   KPGINCTNIKYGEDDVWKHSEYTKFSKIKIFSLGLITNSFFVFNNEFESKKLDFKPTPE
FT                   PEAKPETPEPVTPTPEPTPTTPYETKPETEESTKPPQEPTQSTEESSTHQSTQPETPEA
FT                   KESQPEAPDDTIEPKATPPTPTPTPTPTPTPTPTPTPHSQPTPSPTTVEDSTYSEDTTT
FT                   QETTPSPTKVTLEIKKTESTSEFDYTNKNDVVTYTPKDNHVFSKVTDGIKDIWESKNNL
FT                   YATLVVTNIYDVEKYLALLLQDDTFVLFNYESGTWKDITNDRYDVSKLRYFGEDDAELS
FT                   KTSYTVSIVDLSYTYIFNSGVTCKKIMLEDGDVWTHTDYTNFSEIKSLQLDLPNNKFLI
FT                   TNLQDLTKEVSTKVTLDLNATESTDQFHYSKDGNFRTYTPKDDYVFNKIVKKSKVIWES
FT                   KPEDHGLKAVLMGSGRNEKHLGILLKNNFLVLHKSGKNKPWEDITSQRHDVTKLKFFGD
FT                   NDLELSKTDYEVTLQGLSYTYKFNEDVNCLKITYNNNTLLWTHTDYTKFSEIKSFQLDL
FT                   PKDQFSVTNTSDQTKDLTKAKRTLVSLEIKTTQSTDDFDFNYYDGVITYTAKDNHLFTK
FT                   VTQGTNVIWVSKDGIHCTLVMSKTVYGVKFLAMLLTNNMFILFKGSDGWHDVTSKRRDV
FT                   TKLKFLDESDTQLTKTDYSVRTVFLSFIYTFNDDVICKKIKLGDDEVWKHSDDPDYSEI
FT                   KIFSIGLVSNSFYVFNNKNKSKKLDIKVSLDINASQSTDKFDISEHNSIVTYRPKSGYK
FT                   LTKVLDGTKEIWQSDTGNECPTEVRIGSSDDAKYLALLLGDGTFKFFKKESDNWTSISD
FT                   DTLLREHIPNFPAKSQTQTSSTTTETIGTPATTTLTKVTLNLNATQSTNEFDFNDQNGV
FT                   ITYTPKDNHVFSKVVKKPLIGTTVIWQSKDNVFGRLVMSMTKDDGKHLVILLTNNMFTL
FT                   FNERKTMSGPSQVSSMSPSSNSLVKMIMRLKHLTTK"
FT   misc_feature    complement(7097..7171)
FT                   /note="Signal peptide predicted for TA16055 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.975, signal anchor
FT                   probability 0.000) with cleavage site probability 0.696
FT                   between residues 25 and 26"
FT   CDS_pept        complement(8106..23891)
FT                   /locus_tag="TA16050"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="chr2.cand.534 - signal peptide"
FT                   /note="Signal peptide predicted for TA16050 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.977, signal anchor
FT                   probability 0.000) with cleavage site probability 0.682
FT                   between residues 25 and 26"
FT                   /db_xref="EnsemblGenomes-Gn:TA16050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74027"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT9"
FT                   /protein_id="CAI74027.1"
FT                   /translation="MKRWIITLNLLFYITILNQWNGAESHPTYSSTGSPTSGTAAVDSG
FT                   STESTPAATTLTHNGTESISTTPDATQSSDTATTVATPIALDLNTSKSTNEFDYTDQNG
FT                   VVTFKPNSGYVFSKVSQGTKMVWESTNNVHVTLVRTKSEDNKKYLIVLLTNDMFKVYQL
FT                   EGNEWNDITSMRRDISKLKFLGDTDTPIKSTDYTVSINYFSYEFIFNDGVKCKMIKYGD
FT                   HEVWKHSDDTKFKMIKKFRLGLVTNSFFVLNESDSKQVAIKVSLNLNISESTDHHNYTD
FT                   HNGVVTYTTKDGYVFNKIVDGTTGIWESKDDVFSSLVMSKTIDDGKYLSMLLQDNSFKV
FT                   FHLDVGEWKDLTSKRHDITKLKFLREGDTEITKNDFTVSIADYSYRFTFNSGVKCKKIN
FT                   FGNAEVWKHSDDSKFAEIISFSLGLASNKLYVTNLNDQSKQVGIKVTLDISKTTSTDEF
FT                   EYKDENEVVTYTPKPGNLFEKIVKKGLVTSSVDVWESKDNVYGTLVRIKVTKGVKYLAI
FT                   FLDNNMFILFHEEAGTWLDITNTRPDVTKLKFLGDTDVELTSSNYTVTINYFSYEYTFN
FT                   DGINCVKITYNNIPVWKPTDDSKFAEIKSFRLGFASNNFFVTNSSDQTKHVGVKVDLDI
FT                   SKTQTTSEFDYTDENEVVTYTVKTGYVFNKVSQGTTVVWVSKDNVFGTLVMSKSVDSVK
FT                   YLAVLMTNSMFKLFNHYYYEWTEITSTKYDLTKLKFFGNNDTELKSSNLEVSLVDLSYT
FT                   YQFNDGVNCKKIMLAHDDLWKHSDDPKFSSLKSLSLDLSTNKFYVKNQSDQIKEVAIKI
FT                   SLDIFKTESTDEYEYIKDLDFRTYTPKPGHLFKKISHSTIDIWQSKNNLYATLICIKPE
FT                   GDLKYLAMLFQDNMFKLFHEQEDKPWDNITSKRHDVTKLRFLRDNDTEITSSDYKVNIV
FT                   DLSYTYIFNSGVTCKKITYNNTPLWSHTDDSNFASIKSLSLDLAKDKFIITNQSDQLKE
FT                   LDFKTTPETQTTPITLDIEKTETTDEYSYSDQNGLVTFNPKDNYVFNKITQGTKDIWDS
FT                   GDDVYSTLVMTKDDENQKYLSMLLNNNTFKLFQLENNEWTNITAKRHDITRLRFLGDND
FT                   VDLMFTDYTVTLVDLSYTFVFKSGVNCKKIKLGDDEVWSHSDDTNYAEIKSFSLGLPTN
FT                   KFFVKNSSDQSKELNAVTEIPDEDDDADDQDDDGTIEEDDDDKSDTTSICSDFTESTSA
FT                   DTTPTSAVNKVSLDINKTESTNEFDYTDQTELITYTPKDNHVFTKVSQGTKEIWKSKNN
FT                   VHVTLVMIKSDDNKKFLAILLTNNTFKLFNYDNDKWNEITKDRHDVKKLKFFGDNDAEI
FT                   TTSDHKVTIIDLSFTYIFNSGVKYRKIKFGDVPIWTHTEDPEYADIKSLQLDLPTNKFF
FT                   VTNTSDQSRQVSKPIITKVTLDIEKTESTDQFDYTDRIDLITYKSKDNNLFNKITQGTD
FT                   VVWKSKSNVHGTLVKIKTQEDGKYLVILLQNNSFVLLKLSDIPWKDVTSDKHDVTRLKL
FT                   FGDNDTELSKTDYKVTINYLSYKFTFKPGVKCRKITYNDNPLWTHTDDKDFESLMSFHQ
FT                   DLLTNKLYVMNSSYQTKEVGIKITLNIDKSKDTDQFNYLKNGNFRTYTPKPGYLFTKIM
FT                   KKGLVTSGVDIWESKEDDQALKAVLIGSKKNSKYLSILIQSGTFVLLFKSGKNKSWVNV
FT                   TSERPDVTKLKFLFENDIELYSSDYDRILFEPTYGYKFNDGVNCKYITYSDEFVWKHTD
FT                   DTKFKSITIFYLDLISNKLFVKNSSNHKMQVGIKVALDIDKTESTEKYYFNDQNGVITF
FT                   KPKPGFLFNNVTHGTTDIWESKPGLYGSLVMTKTEDGARYIAILMTNNEFVLLKLSGKD
FT                   LKDITSERPDLKKLKFLGDNDTEITESDYDVTLENDSYTITFDEDVKCKKIKYVDDDLW
FT                   THTDDTNFSDIKSFQLDIFMNRFYVTNSSDKTKQVDIKVTLDLEKTETTDKFEYIKDGD
FT                   CEKYSPKPGYVFNKISEGTTGIWESKDNVYATLVRTKSKNGVKYLALLMTDDMFTVFQE
FT                   EAGEWHDITSDRHDLSKLTFFGENDTEITKSQYTVTLQDLSYTYKFNDGVTCRKITYNN
FT                   TPLWTHSDDTDFSDIKSLSLDLPKNKFSVTNKSDEKKEVDVKVSLDIQRTQSTNQFDYT
FT                   DDNGVVSFTPKSSHVFNKVSEGNTVIWESRDDVYCTLVRTKSVDGVRFLALLLENSLFK
FT                   LFHLDGNNWKDLTSDRPDITNLKFLDDNNLELKSSDYQVKLVGLSYTIKFNTDVNCKKI
FT                   TYNDMPVWTHTDHANFSEIKSLSLDLPKNKFIIKNSSDQTMQVGVKVSLDIQKTQSTDQ
FT                   FEYFKDDDCHTFTPKSGYIFNKVSHVTDPVWESSDCVFGTLVRTKVSKDVKYLAMLLTN
FT                   DMFKVFHEESGQWKDITSMRRDVTRLKFIDDNDVEISSSDYTVSIVDLLYNFTFDDGVK
FT                   CKMITYCDDEVWKHSDDPKFSEITKFRLGLVSNNFFVLNASEFKKVGIKICLDIDKTES
FT                   TEKYYFNDQNGLLTFTPNSGYVFNKVTEGTKEIWESKDNVYASMTMSMTLDNKKFLAIL
FT                   LTNNMFKLFNLYDGKWKDITPDKYDVTKLKFYGENDAELKASDYNVSLENDSFSYIFND
FT                   GVSCKNITYSDLDVWTHTDDKDYSEIKSFSLGLSSNKFSVTNSSDHSKQVDVKVTLNIE
FT                   KTQSTDHFDHSKDDKFHTFTPKSDYVFNKIIKKGLVTSAVDIWESGDDLCGTLVVTKDE
FT                   SGLLSKNIHLAILLKDNTFVLLHSSDKGKNWKDITSQRYDIKKLKFFDEKDNELSQSDY
FT                   EVTLVNLSYQHKFNDSVNCKNITYNDITIWKHPDDSKFQSIKSLHLDLLSNKFSVINSS
FT                   DQTKELKDITMVSLDIDKTQSTSEFHFTDKNGVITYSPKSSHVFNKVSQGTTVIWESSN
FT                   DIQCTLATITSKDNIKYLSLLLKDNMFKLFKLDGNEWNDLTSQRHDPTKLKFLGEGETE
FT                   LTPSDFKVTLAGDSYEYKFKDSVKCMNIMYDNMPVWSHIDDQDFSEIRSFSLDLPNNKL
FT                   YVTNTSDQKKEVDIKLSLDIENTQSTTEFEYTDEDGLVTFTPKDSYVFYKVSHGTVAVW
FT                   ESKGDVYGTMVMTKTLDDQKYLAILLSDNMFTLFNEDDNEWKDLTKDRLDITNLKFLGD
FT                   NDTPLKPSDLEVTLQDLSYEYKFNEDAKCRKIKYDDLDVWTHSDDTKFAEIKSLQLDLP
FT                   TNKFFVKNSSDETKQVDIKVTLDIEKTESTSEFDFSDDNGLFTYKPKDNRVFNKLVEGT
FT                   KDIWQSKSNVHATLVMSKTLDDVKYLAMLLSDNMFTLFDLESDGTWHDITSQRLDISKL
FT                   KFLGEGDTELTKSHYSVNLSNFSYTYKFNTGVVCKNITYGDSDVWNHNDDTKFSEIKSF
FT                   ALDLPTNKFFVTNLDDQTKDVDIKVLLNLDTSHSTAQFDFADKNSVITYSPKSSHVFSK
FT                   LVDGATDIWESKTGLYGSLVMSKTVDDGIYVSLLLTDNTFKLFKLSGGSWADLTSEKYD
FT                   VTNLKFLNENDTEIKSSDLEVSLVDFSICYSLDNDFMCRKIMYGDDELWTHTDDAEFAD
FT                   IKSLSLDLPNNKFNVTNTSNNKKELDIKVTLDIANTHSTDDFDFTEHNGVTTFTPKSDH
FT                   VFTKVTQSDNLIWESTNNVHATLVMNKSEDNKRFLVILLDNNMFKLFHLENNEWTDITI
FT                   QKHNINKLKFFGENDTELSKSDFEVTLQDLSYEFMFKAGVKCKKITYNDNLLWTHTDDS
FT                   NYSEIKSLQLDLPKNKFSVMNSNDETKEVDIKVTLDLEKTEPTNEFEYTDHNDVVTYKP
FT                   KDNHVFNKVSQGTTSIWQSSDGVFGTLVMSKTSKDVKYLAMLMNDNMFKLFKEEDNKWN
FT                   DITSQRSDLMKLKFLGNNDTPLIFSDFTLTLHDLSYTYTFNTGVNCRKIMYGNNDVWTH
FT                   IDDPKFASLKSLSLDLPSNKLYVTNTSDQKKEVDIKVSLDINVTQSTDEFDFADQFGLI
FT                   TFTPKDNHVFSKVSQGSTGIWESKDSVFGILVMSKTLDDKKYLAILLTNHSFKLFNEES
FT                   GKFNDITPDRYDITKLKFLGENDAEITKSDYKVDLVDLSYEYNFNEDTKCKKITYNNSE
FT                   VWNHTYDKDFSELKSIALDLPTNKFSVTNTSDQSLPVDIKVTLNIQRTESTDEYDFNDQ
FT                   SGLFTYKPKDNYVFNKVTQGSTDIWQSKNNLYGTLVMSKTVDNDKYLALLLTNNMFLLF
FT                   HQDQDGNWANITAMRHDIKKLKFLGDGDNPLSNSDYTVTIVDLSYQYKFKDGVKCHTVK
FT                   LGEGDLWKHSDDSDFSEIKSFQLDLPTNKFSVTNLKDESIQLSKARVPLDIQNTHSTNE
FT                   CHYSYDHDIHTFTPKPNYVFTKVTQGTTGICESKTDFYGTLAKFKSLDEGNKKYLLVLQ
FT                   DNNTFKLFHEVSGQWHDITSKRHDLTKLKFLRDGNTEITSSDYSVGIVDYSYEYKFNTG
FT                   VRCKKIKLGEEELWKHSDDTEFQSIKSFSLDLLMNKFFIKNSTDKTKQLGITVNVDIPK
FT                   LLSTPKFILVSQTPQPESAPTQTQTAPTSTTQTPSTTTQTPETPETPETKPVTTPETTE
FT                   AEATPESTSETAEAPPQTSQTLQAKSTYEPVYQTLTAKSDNLFDKVSDGNTVVWESNDD
FT                   VCGTMVSIKSDRKEIHLAVLLQDNDFVLVHKDNKDDTWKDVTSERADVTNLKFLDDTDT
FT                   ELSPSDYTVTIVDLSYEHELKPGVICKKVTHGDDEVWTHSDDTNYSEIKKLSLDLPSNK
FT                   FSITNLDDQKKELSTTFTRVSVEIKKKDPNRQYDYSKSSNFHKFTPKDGNLFTKVSKGS
FT                   DVVWDSKVEYVTLVNIKTEQNQKYLSMLLQNNSFVVLQKSDNTWKDITSERYDITKLKF
FT                   FGDNDNPLTKNDYTTTIADCSYRFKFNDEVICKTIKYGDDDVWKHSEDTNFEEITMLDL
FT                   NLTNNKFSVTNNQSNSKELDYNGSITPAETTPADTSKPKLKLPKLPGAKSQSQTSYTKP
FT                   VSTPAVSTKNTLISLDINSTQSTSEFDYTDQSGVITFTPKDNHVFSKLVEGTKVVWETK
FT                   PVLYGTELMYIEGVKYLVVQLQDNTFKLFVHFAGIWTDITHKRYDITKLKFLGENDLVL
FT                   TSSDYKITIFRFFYTFTFDDNVKCKKIMYGEDEVWKHHDDPDYSEIKKFQIGLASNESF
FT                   VFNNKFKSKKLDYKPETTKSKPKSETPDEDETTDSKAPETPPVTEPTPVTPTEDDTDTK
FT                   PVTILTVDIDKTQSTDDYDYILEH"
FT   misc_feature    complement(23817..23891)
FT                   /note="Signal peptide predicted for TA16050 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.977, signal anchor
FT                   probability 0.000) with cleavage site probability 0.682
FT                   between residues 25 and 26"
FT   CDS_pept        complement(24579..26027)
FT                   /locus_tag="TA16045"
FT                   /product="Theileria-specific sub-telomeric protein, SVSP
FT                   family, putative"
FT                   /note="chr2.cand.533 - signal peptide, telomere P,Q-rich
FT                   family"
FT                   /note="signal peptide, telomere P,Q-rich family"
FT                   /note="Signal peptide predicted for TA16045 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.931, signal anchor
FT                   probability 0.049) with cleavage site probability 0.901
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA16045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74028"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT8"
FT                   /protein_id="CAI74028.1"
FT                   /translation="MKCKIYAFLILFIQIGYVYCADNESHTYSEGSDGGDNDENNYQVT
FT                   ENTGQFGQEEEPLAIKEEPEQEEPTQPTYQPITQEPEQIEPLDLSTNTRHTIPQPRPQP
FT                   PPSYQPPQPPYQPTQPYYQPPPYPYYGPYQPIPYQYYGPYRPQSTPIQPPSQRTQSRPP
FT                   QPTIHIPGQPPIPQPIQHPQRPPIPQPVPIRQPMPIPQPQYQPYVPYGPQPTPPIPIPY
FT                   LPIPQYQPPTRYPLPQPYTIPTGESGTSLGKRKVTHIEPSKTQKAESKKRKSDTCGLHI
FT                   FCKKDDSGNLIPMNYRDYEKTHSDSSRKKYTLMSELEKILCDGETVYVHEPGKPYVSTI
FT                   TKNMRRKEFVLKRDNELIVVNKVDEDWITSVVEIPEIIESFTKDDDGNEVPIPLDKFHI
FT                   DLSHFKSFKFAFMSDIKCHKIIVKGDLVWEKTEGDEGYPIAIIITTKENVAIFFSKKTA
FT                   VYKRKYEGYKLSYFAERGRRVRDK"
FT   misc_feature    complement(25968..26027)
FT                   /note="Signal peptide predicted for TA16045 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.931, signal anchor
FT                   probability 0.049) with cleavage site probability 0.901
FT                   between residues 20 and 21"
FT   CDS_pept        complement(27623..29470)
FT                   /locus_tag="TA16040"
FT                   /product="Theileria-specific sub-telomeric protein, SVSP
FT                   family, putative"
FT                   /note="chr2.cand.532 - signal peptide, telomere P,Q-rich
FT                   family"
FT                   /note="signal peptide, telomere P,Q-rich family"
FT                   /note="Signal peptide predicted for TA16040 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.915, signal anchor
FT                   probability 0.000) with cleavage site probability 0.699
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA16040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74029"
FT                   /db_xref="InterPro:IPR011695"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT7"
FT                   /protein_id="CAI74029.1"
FT                   /translation="MDFVTYIYIIVLLLLQSNECADKTTQEQNQEGQYDPLTLEQYGPE
FT                   LEPQPILYYVPHYQFQPQPDQQHIPVYYGPDTYQPVQYQAQEQHTEPTSIPQPQQPYQP
FT                   TPPQYYTGYGPPQQYYQHQPQPEQSQPYYPGPQYPVQQQYYQEPQYQPVPQYYPPPQPQ
FT                   EYQLPQQGIGYYGPQYQPQYYPGYQPQPYPQTGYQLQYQQPISQPLPQGPPPHPQPQQP
FT                   YYTGPPTQPLQTQGPGPTTIQPQPQAVQHPQPSQPSQVTQSRQPIGPQYQPRHTGPLRQ
FT                   PSNLRPGILGPAPGTLRFPPQLQKKPRQQNIRTPTQRPTQRPTQQPTKEPTQRPTKEPP
FT                   TQQTTEPSGLQPETVPVEIGSDEDEEPLEPPKGPGDGDKPPDKPEEGEDEDDGDEDDDD
FT                   EEEKKPSKDVKICNTITFMKKNSEGKLVPMSEGDYTVISYSEYNIKYVFNAELEAVLCD
FT                   EETIFTHLAGRDYCKSVIHKRHHGSFNFRRDDGFVLVKFKNGKWKFRARNNPDYVRLYA
FT                   LDNEGKEVELDEKSYYLKFTSSGSFKYEFLQNVRLTKFIIKDKVVWEKTITDNHPSAVA
FT                   VTERFNAIIYFDTYTRVYGRRKGKYRFLFTRPNIKYIKK"
FT   misc_feature    complement(29411..29470)
FT                   /note="Signal peptide predicted for TA16040 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.915, signal anchor
FT                   probability 0.000) with cleavage site probability 0.699
FT                   between residues 20 and 21"
FT   CDS_pept        complement(29797..31008)
FT                   /locus_tag="TA16035"
FT                   /product="Theileria-specific sub-telomeric protein, SVSP
FT                   family, putative"
FT                   /note="chr2.cand.531 - signal peptide, telomere P,Q-rich
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:TA16035"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74030"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT6"
FT                   /protein_id="CAI74030.1"
FT                   /translation="MNKCVKCIYILIFILIGYSGCSDKSDDLHTGPIASCDSDEDNFDV
FT                   GQSNEEESTQTPQPQPIPVPSPHPQPQPITQPPPQPYGPYQPPPTHPQPVTYPGYPQYY
FT                   PGYQPYQPTQPVPQYYPVYDASPSQPPSYQLPLPQPQPPYYPGYYQPYPPYQPYQIPPT
FT                   EPYQQYQGYLPYQPYHHPTQPYQPEQPTTEESKDKESKKFKKCETIGFLKMNEEGNLVP
FT                   MTNEDYIESFPNNKTSKYVFKSNLEKLYCNDKIIYTHKIGKDYCTSLTYNNKTNCFIMT
FT                   TPSGFYLIKYYKGKWETIEKKIHKYIKLYGIDESGMPITIDENFYYTDFLRPNTFKYVF
FT                   LPGVKITNIDAGTKTIWKKGKKEQFPIGLSFSSFNNIVLHFDEYVKIFRMFDGEYRLHF
FT                   TKNK"
FT   CDS_pept        complement(31417..33132)
FT                   /locus_tag="TA16030"
FT                   /product="Theileria-specific sub-telomeric protein, SVSP
FT                   family, putative"
FT                   /note="chr2.cand.530 -signal peptide, telomere P,Q-rich
FT                   family"
FT                   /note="signal peptide, telomere P,Q-rich family"
FT                   /note="Signal peptide predicted for TA16030 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.780, signal anchor
FT                   probability 0.065) with cleavage site probability 0.687
FT                   between residues 21 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:TA16030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74031"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT5"
FT                   /protein_id="CAI74031.1"
FT                   /translation="MNKCVIYTYIIILILIGYSRCSDKPIDQYLDGQLDEDDNFDVTVK
FT                   ELENLLDEEDNYDLIEANIESIIEDDDISPGAVDIETGFQHPPHQTLPPYPGPTHPEPP
FT                   PQGTGYYQPQQPPIQATPPGQRPPTLVQPVQHPQQQYPGYHPQPTLIQPQQQALHIPIA
FT                   QPQIHLTAQPLPIRPGYLVEQQSQIPVSIPIRHPQIQPLPIIIPPPQLRIQPTPIHPPQ
FT                   LPIQQQIPIPQTIQVPPVITIEQYGPYRPQSTPVQPQPTQLIVPTPPFQPGYPHILQPP
FT                   RPHYQQYVRIPIRNSGYEQHIVQPVSQPRFPFSVTRESFRPGYPGPRDFARYPIPPGQQ
FT                   PVRYVPPQQIIEDEQKSKDIKQKSVNPKPVIPELPSTYFYGLDASNNFFIMNKNHFKFI
FT                   FDNGNKIKVKFLVEVIEIIFRGRCLWKQKPGEEKAISFIFNRKSNILYIYTKKELISFL
FT                   ISGRNWTQKKFDIPQNVTLFKMDETGKEVELSDEEYNIQITRSKLFRFSINIGVKCIKV
FT                   MRSGLIVWENNSDNICLLNVTIIAYRRTLLFFKKCVHLYVLDGGKWNLKKVRNT"
FT   misc_feature    complement(33070..33132)
FT                   /note="Signal peptide predicted for TA16030 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.780, signal anchor
FT                   probability 0.065) with cleavage site probability 0.687
FT                   between residues 21 and 22"
FT   CDS_pept        complement(33419..35101)
FT                   /locus_tag="TA16025"
FT                   /product="Theileria-specific sub-telomeric protein, SVSP
FT                   family, putative"
FT                   /note="chr2.cand.529 - signal peptide, telomere P,Q-rich
FT                   family"
FT                   /note="signal peptide, telomere P,Q-rich family"
FT                   /note="Signal peptide predicted for TA16025 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.935, signal anchor
FT                   probability 0.000) with cleavage site probability 0.723
FT                   between residues 18 and 19"
FT                   /db_xref="EnsemblGenomes-Gn:TA16025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74032"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="InterPro:IPR011695"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT4"
FT                   /protein_id="CAI74032.1"
FT                   /translation="MCKYKCLIILILIRFIQCSDKYPYRAGSKGRGGDKNNPNDQENNL
FT                   DLIEKELENILTDDEDENNTIVRGIKKILIDDSQSSPHDKQEPYFIDDNTDEDIEYTYS
FT                   TEQQNITSGITEPISSYQNWSSLPCFLPGRTDPPLPIPVSQFVIQQNHDTYKYPIQTHY
FT                   NPSIFSITEKHLTKPEQRLEVNHLEKHRFVLRTPNATELPSTHHPYGFIPNSQLINTGP
FT                   GLLPIPTFGLLSLQPGLLSNPPKKIKKPKYRPTKQTKPSGLNLTVEIQINVTKPTKQPQ
FT                   HSTQQHTQLATEPSGLEPETIPVEVGSDEDEDEEPPEPPKGPTGPGDGDQPEEGEESGD
FT                   GEDGEEKDDDQTQKIPSIDAIVFYKKDIKGNLVLMGKEDYSVSLSTRNILRYEFFEKLR
FT                   KIMYLDEVVYEDVGKKRYIKVLTYNKYFKTFTGIRKDGYFIMKKIKKRWIFYTRKIPNF
FT                   VHFYTKDHQGNDLELTKESYKIELSAMGSVKFIFHPNVKCFKVLTKTQIIWQKEGDDDG
FT                   DYPTTICVTDRHNILLYFNHSSIVFGKTRGKYKKMHHKNEKGY"
FT   misc_feature    complement(35048..35101)
FT                   /note="Signal peptide predicted for TA16025 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.935, signal anchor
FT                   probability 0.000) with cleavage site probability 0.723
FT                   between residues 18 and 19"
FT   CDS_pept        complement(35497..36564)
FT                   /locus_tag="TA16020"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.528 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="Signal peptide predicted for TA16020 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.986, signal anchor
FT                   probability 0.013) with cleavage site probability 0.808
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA16020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74033"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT3"
FT                   /protein_id="CAI74033.1"
FT                   /translation="MKFLSKLLLVYVLIIWSYNLVLGSSSDESSSSDNEEVTVTHSKKI
FT                   NGKVVTQSTTHKTKTKKRKKKEYIRSQKGEYSGSNYGDYSSSSSDGSESSKNDSSDSEE
FT                   ETIVTTKRKVGNRVIVTTTKTVTKVTSIKKKDKKRSRKRRKIRHLRGTDQEESYDELLK
FT                   PEKTDKSSRDLNLHIRDIIAIEEGGMTTQPQIAITSPKISIDNFGLFPITQPEDKSNQV
FT                   SGSTNLDDSFYSTIPKTPSPETVDDISDEDKIPDEDKIPDEDKDKDEDDETDDETERED
FT                   KELDASINENISEDNEIYNQSFDDENVESENESIQHVDHSNKPDDPEIVKVEMESDIES
FT                   EGHDENDQDEEIDSE"
FT   misc_feature    complement(36496..36564)
FT                   /note="Signal peptide predicted for TA16020 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.986, signal anchor
FT                   probability 0.013) with cleavage site probability 0.808
FT                   between residues 23 and 24"
FT   CDS_pept        38170..42720
FT                   /locus_tag="TA16015"
FT                   /product="(subtelomeric) ABC-transporter protein family
FT                   member, putative"
FT                   /note="chr2.C.cand.4 - ABC transporter"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16015 by TMHMM2.0 at aa 140-162, 174-196, 289-311,
FT                   318-340, 397-419, 439-461, 842-859, 904-926, 995-1017 and
FT                   1078-1100"
FT                   /db_xref="EnsemblGenomes-Gn:TA16015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74034"
FT                   /db_xref="GOA:Q4UFT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030244"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT2"
FT                   /protein_id="CAI74034.1"
FT                   /translation="MVKHRNISELCNDFRSSVNSKYDSNHHYWESESYSKVYFKDPYRG
FT                   KKFKYYDSSSFLKYFFFHWVTKWAYYVSKQYVEPYKLHPLPVADQILRWQPLLSKHLSD
FT                   GLLRLESHQSKYSESDKFGAYRHILLRAFFLTFWKRTLFGLLGIVFTNVLSMSISILIK
FT                   HLLGILNTKSFTLAKIFLFLFAIIGLQIVDGLFMENFNFYLNRLKSVCENSVAITIFQH
FT                   GLCYRRNFNNNVNGSNVLNTCNSVLHSCSPESNCSKNPLFCPARRYQNKDINSNIFTYE
FT                   YYDSFYISMFLESLIYLVDFSSNFIYGFVLISLQIKANLWVLFLVGIFFTFLMMVVEII
FT                   NTYLFHFISLIKDYRVGESSEIISELPLIKKLLYDDIAINIITETRNSELLLFLVRVFL
FT                   TLLNKTFSVVFTNLSFYVLMRYFVKSVRDAEVITEIDTAGFLSTFYIFFRIINSMFMFP
FT                   FALKRLTTSYVSYNRVKKYLTTCSPNFYISDNKFTGSTKMSSVLSDVTKEIDKDVVVLY
FT                   KDASFSWVNNRKDFANKNNEVHLNNINFQLKRGEIAIISGNQGCGKSNFIKSVLGEMTL
FT                   VSGCMAVVPLHTSMPIFYASQDIWLQQGTIRSNITFGYRFDEDIYKSVIKAVELEFDIL
FT                   SWEKGDLRVVSDNAHSLSCGQRVRMEMARAIYAYLIFSKVNKDYNSQCSFLMCLDGPFH
FT                   VLDPYVSRTVFNNLFNAQTGLLVKDDLAVILSSSLTLLDKCVSPSYTKIFPNIPIYEID
FT                   NKSLYFHCYLSDVFSDKTLNGFEYITPPSGQYKLNFFTKDLMKLCYSGSNTRPGRRILT
FT                   KSKYEQSFNSIVKSDYSEEKFNQYAQYFKAAGFTFVLFTIITFVTSVMDNAKFVLATDL
FT                   TDYISNKIKDFNSGLSIGLSEVRSHSNSALNTILIIVSIITVFSLLSTLLFTVSCLVAS
FT                   RRIHEYCINSVFKNSSSVIKIKKQINQIITYLSTDIYFIDEYVGNMISSALCSFIQTVI
FT                   CIATLFYTIPLSVPVMFTSVIISYHFFLSKYFKASRNQHIGDLESTSHINTVCENAIFG
FT                   SPIYRSFKKEWELVNDLIERIDYKFRCRFLAISFASWTSVLSTWIFSLTTALFLTTMIL
FT                   LDKFTNYKMNVGYFGLGLSLGSSVIKSFSNFSFSFARLQVFMCSVQRFQCFIPPGTKCV
FT                   FDKFRNVHEEDIVVNSSKLEDQVDKKMLLKKRALEFKETKPNLIKRIMFRPKINIIDIC
FT                   KYLPSEHNGIVLKEVCVYTTSQMNEEGLILNNINASPSRSDIIGIIGRTGAGKTTLLSV
FT                   LQNTVRYRTGQVLLDGRDLQDIPKSVIRHIIGVLPQLPFVFKGWTIRRFLDPRRLFSDD
FT                   EINDALHKCGLLEFVNNLHGGRDLDTVIAPRPVNLKTRDPSAKESLGKDQSIDNHSVGI
FT                   VLSVTQLRTLWFAKLFLCRHLYRMLIIDEPPSDNCSEDGSEVQDIGIPIYELLDKYFKH
FT                   CTCFVIAHYAKVLRSCTSVWVMHNGKLIKTCKASEVSKNESISNIIEEMVNKYSN"
FT   misc_feature    join(38587..38655,38689..38757,39034..39102,39121..39189,
FT                   39358..39426,39484..39552,40693..40746,40879..40947,
FT                   41152..41220,41401..41469)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA16015 by TMHMM2.0 at aa 140-162, 174-196, 289-311,
FT                   318-340, 397-419, 439-461, 842-859, 904-926, 995-1017 and
FT                   1078-1100"
FT   CDS_pept        complement(join(43190..44333,44379..44816,44856..46132))
FT                   /locus_tag="TA16010"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.527 - signal peptide, hypothetical
FT                   protein"
FT                   /note="secreted protein, putative"
FT                   /note="1 probable transmembrane helix predicted for TA16010
FT                   by TMHMM2.0 at aa 7-29"
FT                   /note="Signal peptide predicted for TA16010 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.901, signal anchor
FT                   probability 0.078) with cleavage site probability 0.606
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA16010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74035"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT1"
FT                   /protein_id="CAI74035.1"
FT                   /translation="MKNTYTFLLYLGIGLFVLSSNCFELDIGQISKYRKGGNEINVYKD
FT                   DSDNFYKHQPVEPFLLKELYYDDEVIYFDPLLTSDQLLISASVLWVLDNPTVIHLNLEK
FT                   STIMLLNENNSSLSVEAIFSGGNISNINHKFHPGSDKAVDVDIKQTQNYTSNSLNVSVN
FT                   QLHLSGNGLEIFVLRYYDLGSYKLNSLKYGNDVLKTVTETSTPNKEVILEVPNKEQVYG
FT                   VYVYSYNDFPLMIELVYTYNKRLYYGNCNVRKWHKLLMVPLNDPSYYENLLNKLNYYAC
FT                   RNGFKITIGADKIALKAQDYYNIDNYCLGPNGVERIKNRLDLKLIKHGQNYSCNIHKAL
FT                   NDGKFFTDNLYYENSIFELQNLPKKIDCIRVYRIKDNKPCLITIVSKNSLLYYKLEGDS
FT                   WKYLNTDENLTDINNEFNEKINILLYEFDPDKELLEENLIDHKWKKEPKLNLNEETVKL
FT                   LPDNVTIKVQGDETYEMPTLKYDNKQLKSKILKRFQFDIYSYMDGKQKTGLIINGDLES
FT                   KIVVETKPFRALIGIYYDGRPIIEFEKEDVLIHKAIYFYDKNNHDMNVYLYTNSLWELV
FT                   SKEPVTLADSHKTNQNLINYFDQVKRLNRADTQKPKEITVTNVEINLMPNEEVEILTRN
FT                   YFKEKIETIKRDYKKGITTGTRIDVSTLKLSSTTKQSGSFSLVQYKNKTLVDLNNRYYH
FT                   FVKLIEYRDLKYELNLYLYTNTLYVFRFQKKPNDNEWKFIILQPVMCLYKNVSESLKPF
FT                   FTKMNEINKFDYNVNIYEEVVDLLPLGVEIRTNKNRKYVIYSIKQKLPLLKGNKIKKIS
FT                   LDVYYDFYDNYWDYNLHKYVKSMNLKKVGYYDSEAEVIGNHVIDNVKWYSYDILKVSPE
FT                   DMSNFLIVEYFQTQEIEKIYAYSNTLYEYHAIGTYIDYYYDWKIIKKPVEIVNKETLTE
FT                   KGLRDLKRYYKLTMNVKVFDFV"
FT   misc_feature    complement(46046..46114)
FT                   /note="1 probable transmembrane helix predicted for TA16010
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(46067..46132)
FT                   /note="Signal peptide predicted for TA16010 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.901, signal anchor
FT                   probability 0.078) with cleavage site probability 0.606
FT                   between residues 22 and 23"
FT   CDS_pept        complement(47220..48503)
FT                   /locus_tag="TA16005"
FT                   /product="hypothetical protein"
FT                   /note="signal peptide, transmembrane protein"
FT                   /note="transmembrane protein, putative"
FT                   /note="1 probable transmembrane helix predicted for TA16005
FT                   by TMHMM2.0 at aa 405-426"
FT                   /note="Signal peptide predicted for TA16005 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.961, signal anchor
FT                   probability 0.000) with cleavage site probability 0.872
FT                   between residues 18 and 19"
FT                   /note="GPI-Anchor Signal predicted for TA16005 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA16005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74036"
FT                   /db_xref="GOA:Q4UFT0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFT0"
FT                   /protein_id="CAI74036.1"
FT                   /translation="MSMILLRFLFLYIPFIFSENVIDSSNDPKEEQIQTVPSILTPESF
FT                   NFVTYKDVDPDNLKENYSDHFSLINTGSTFSYEINSAFKCSEVKYKDTLMWIYLPKESQ
FT                   NGFPKKIVVDSHLFLVFLFFADLVKLYKCDESLCKFISQKQSLFNPTSLSLYKSESGSL
FT                   VELDSSNFLSNHGFEIHYKLHDTSSFPDSSDFIKCTQIKYATHTLWNYGSDEPGNKYPN
FT                   KVIFNSFIDSIIVEFDTFYMIYKYDGKHFHALSTESLNGTTPDDFKLIGENDLEINKTD
FT                   YETVNYPHDNAFAYKFNEKKIIQLRFKDKLVWNYQNQEVPKLLYINIPKRKVMVQTQTL
FT                   LLVYMYTDSWTLIFEGKTLDKIHDDEYNPQESEYEVDKDGLKDKYVLRLGKKPFRIMEF
FT                   SSKTKTILVMVGIFLLFLITVCLIIFIK"
FT   misc_feature    complement(47226..47291)
FT                   /note="1 probable transmembrane helix predicted for TA16005
FT                   by TMHMM2.0 at aa 405-426"
FT   misc_feature    complement(48450..48503)
FT                   /note="Signal peptide predicted for TA16005 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.961, signal anchor
FT                   probability 0.000) with cleavage site probability 0.872
FT                   between residues 18 and 19"
FT   CDS_pept        complement(join(49046..49236,49280..49432,49550..49760))
FT                   /locus_tag="TA16000"
FT                   /product="40S ribosomal protein S8, putative"
FT                   /note="chr2.cand.525 - 40s ribosomal protein s8"
FT                   /db_xref="EnsemblGenomes-Gn:TA16000"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74037"
FT                   /db_xref="GOA:Q4UFS9"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UFS9"
FT                   /protein_id="CAI74037.1"
FT                   /translation="MGISRDSRHKRRLTGGRYPVHKKKRKYELGRPSSNTKLGSRLVRK
FT                   VRCRGGNLKFRALRLDSGNFSWGSQNVTRKTRVMDVVYNASSNELVRTKTLVKNAIVTV
FT                   DPTPFKLWFKTHYGVELEDPQASEKVAGLVPKTLLEQFSSGRLLACISSRPGQCGRCDG
FT                   YVLEGEELNFYRRRMDKKKRV"
FT   CDS_pept        join(50479..50681,50719..50776,50828..50908,50939..51160)
FT                   /locus_tag="TA15985"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.1316 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15985"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74038"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS8"
FT                   /protein_id="CAI74038.1"
FT                   /translation="MTDSTDSSCSNDFDETNDSSSTVTDQLESNDPYYSTDVCQPSDQS
FT                   DSKDKESLKRKLSETAPIDEPSKLEKSDISDTPSFLDIIKSVVKDDPNKVDNFNVLTNT
FT                   KEYDCPIAKLAKLNPGDSFLKASKVDNFSDFNQTDNKPETPGTSESTEENGNTEEEKTV
FT                   LESSISEDEILLREMVFYLLVTSI"
FT   CDS_pept        complement(join(51506..51670,51707..51897,51961..52086,
FT                   52409..52530,52570..52667,52701..52808,52840..52959,
FT                   53070..53120))
FT                   /locus_tag="TA15980"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.cand.525 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15980"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74039"
FT                   /db_xref="InterPro:IPR024253"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS7"
FT                   /protein_id="CAI74039.1"
FT                   /translation="MTIHTDRLRTANKSYLMDVAKRKYLEKKSDLISEEKNTDENYTND
FT                   KDWRVDRLEMLRKIHEKRREYLDRGSGNLEILTDEKELINIANSNTRVLCHFYEDDFER
FT                   CKLLDSLLVSLASRFLDTRFVKIKATKAPFFTHKIGIKVLPTLLATIDGNITRIYIGFE
FT                   EFGDIFNSVSNGNNRIPLKIALNKLNTFFNSTKNPYKKYMCKDSIDDNITTEEFMDQFY
FT                   SRHIDKKHGVRSQILMVGGPKSIRGNPGGIMNSMLSFPQITSYQFVGIAKDMECMFLEK
FT                   ILQCSQSSKLTRSYNTSEFTKVQKMKSKEIVKELNSKVQSSDHLE"
FT   CDS_pept        join(53604..53880,53956..54072,54103..54210,54239..54310,
FT                   54341..54414,54443..54514,54547..55268,55335..55443)
FT                   /locus_tag="TA15975"
FT                   /product="serine/threonine protein phosphatase, putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="all_bases.C.cand.1317 - serine/threonine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TA15975"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74040"
FT                   /db_xref="GOA:Q4UFS6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013235"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041753"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS6"
FT                   /protein_id="CAI74040.1"
FT                   /translation="MVEIFSIGKNNKAQALEKAELKKLEGNRSFSENNFISAIEHYSES
FT                   IRLVEDSHLVSNLKKEGYNWITPELRKTNLHQYYSNRAICNIKIENYGSAISDANVAIQ
FT                   LRPDFFKAYYRRGCAYLCLLKFQDAETDFLKVLSLCNDPTARMKLKECKKIIREQKFSE
FT                   AITRESPPPLHETINVDSIQVDQGYTGPAFSFKEPINHLDKSYLFHNTLEYLKVPGNTI
FT                   HKKYVCMIILEVIKIIREYESVVDLNIYPCDELTVCGDIHGQFYDLLNIFSINGEPTDE
FT                   NSYLFNGDFVDRGSFSFECVFTLFLAKVLFPSSFHIVRGNHETEALNKCYGFKGEILNK
FT                   YDEKVYNLFCESFRYLPLGYLINKKVLVIHGGLFGTENVTIEDLKKIDRFKEPSDSGLM
FT                   TDMLWSDPKPSNGLSPSKRGVGFEFGPDISNSFISKNNLSYIIRSHEVKQEGYEVEHDG
FT                   KVITIFSAPNYCDQMGNKAAFIRIKGDTLEPRFTQFEAVEHPPIRAMHYANPLFSGIY"
FT   CDS_pept        56158..58461
FT                   /locus_tag="TA15970"
FT                   /product="CTD-like phosphatase, putative"
FT                   /note="chr2.C.cand.8 - CPDc catalytic domain of ctd-like
FT                   phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:TA15970"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74041"
FT                   /db_xref="GOA:Q4UFS5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS5"
FT                   /protein_id="CAI74041.1"
FT                   /translation="MSRPRFTGEPIAPPEVSTDPITPESNNRNFAGNTWVRRTRHKDGF
FT                   TANPEWPNKPEPPSTSPPMYKMVPASPIIGKQPTGLVPYQLFNQSLYPNMVIKNDRGKD
FT                   PKTRFPMANYIGPPLNVPPGSYIPGPIFPIANVGVDAKPMYENRFGTPFMQGPYYKEPP
FT                   IHPITCKQPPIHTPNMDHIGFVNLSQVKGMSTGTKRNYETMSEISDDQESSGSESDKNE
FT                   RNDTTSKPTYEIKYFTPFLPKPPERYKTEYDLHELKVFLPLGVKAYLKNMSLNPKLSSC
FT                   FETGPVRNGKLVLLLDLDNTLLHTASQSRLDMLNIDTSDFVDSLGDPELYTFTLPNFAN
FT                   VNYYMKLRPCIREFLQILSLYYEMSIYTNATKEYADVVISILDPDRSLFMDRIVARNSV
FT                   DEKDLLKSASRLYPDLDTRFILAFDDRRDVWSDIPHKQVVRAEHYDFFESYITELNNNY
FT                   SSSPSPPNKQTPESNSFNSTINVSSTNGGKTTNDYTFNIEQESESDPDVTREKVSIVDY
FT                   DRHLKYMVKIFLEIHKRFFADPFNNDVGSILESIQSQVLKGIGVLLTGYRKNTKVVNSV
FT                   LHADCELRQKENLLEMGASLVLRLNDSKLTHIMAGKNCTDNITKSRDPQYNHIHKVHTL
FT                   WLYSCRATFSKVDESLFKVDDICKIYSNEPPQLPNKDHWKFINPNAGSFKDTNKNDNGK
FT                   SKQELPTRIFMGTGAYSNGTEVLSSVEKIVIRWDPSKTKLLQNSISDNSRQNNKQKSEY
FT                   TPFTNAINPNKYAF"
FT   CDS_pept        join(58880..59294,59324..60252)
FT                   /locus_tag="TA15965"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.9 - signal peptide, transmembrane
FT                   domains"
FT                   /note="transmembrane protein, putative"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA15965 by TMHMM2.0 at aa 29-51, 66-85, 92-111, 121-143,
FT                   155-174, 189-211, 322-344, 349-371 and 408-430"
FT                   /db_xref="EnsemblGenomes-Gn:TA15965"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74042"
FT                   /db_xref="GOA:Q4UFS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS4"
FT                   /protein_id="CAI74042.1"
FT                   /translation="MDLHIIVEAVPQLEDNIIPSKKKISFQSILNKFLFFLLGSSVTCL
FT                   GSTGRLTSKAFGTADFISDCFSVYIYLNLAAFLVVLLFIKCSYRKAIISGWLCLMLHVS
FT                   YILIVLLSSGNLAKGLYISVYGGIAILEAFLIQSNSFVVSEYYSPSLFSNLYSGYYGGL
FT                   GIFSLIQTIFQRAVGTNTPKQAKICLLLTHGSFTIIVFCAVIAQSIIYFKNRVDLSPIY
FT                   APTKSSWVTKIKGMYRVFLSLPKYSSRFLVFILSDLCKCAFFQVFIPYRMLLNDSQLAI
FT                   VFFVDNFSDIIGRSIASSTNDTVVTKGTVTNHQKFLYKRDLPYLLIPCFSWVICFLVVW
FT                   GTWTLKSRFLTEFMTILFTTLLVCFSMGYCSTKGVNGCIPVLEYYKNIGTGGKSRLVDE
FT                   KNYSYVNDLNNFLIKFLWMVFFIVVYFLAQIMERYQATDHYQHLKTLL"
FT   misc_feature    join(58964..59032,59075..59134,59153..59212,59240..59294,
FT                   59324..59337,59371..59430,59473..59541,59872..59940,
FT                   59953..60021,60130..60198)
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA15965 by TMHMM2.0 at aa 29-51, 66-85, 92-111, 121-143,
FT                   155-174, 189-211, 322-344, 349-371 and 408-430"
FT   CDS_pept        complement(join(60315..60455,60532..60652,60682..60805,
FT                   60835..60940,60970..61035,61066..61140,61169..61328,
FT                   61360..61529,61559..61724,61774..61861,61891..63154))
FT                   /locus_tag="TA15960"
FT                   /product="aldo-keto reductase family protein, putative"
FT                   /note="all_bases.cand.524 - signal peptide, PF00248
FT                   Aldo/keto reductase family"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA15960 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.705, signal anchor
FT                   probability 0.003) with cleavage site probability 0.191
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA15960"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74043"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS3"
FT                   /protein_id="CAI74043.1"
FT                   /translation="MYNFLLLIKCLLIIHLFSKESYCVLAPSPLIIFRNLNKILADFNT
FT                   NSKPFYLSNLSPYSYRSIVNSLFSCHPNHKLNDIKQFSGDFNHKYSCKLKNSCRFYKFF
FT                   ISLSTHLSLPYYGFVESSHILKNGSSIGKSAHFSLPRLSRSIPHDDLDKDLNKIFEPEE
FT                   PEIEQDTDSKKTEQMHKEVKKDFSSEIKTYPKKLSRKQFNKEANKIWKKYSHIFKPLET
FT                   LEEKMERISKLPITKINVDGVEIKVRMGTLGQPWYIDKEEALKLVNTFEPGVLNYIMKH
FT                   ESDKYTRFPLIKEERDRIWIPLPGIQATYFPEIKVLDHRTDIPDYEYVTLLHDTLRNYT
FT                   WTYQQSTDKRAKSFNGDGKLDTFEIVNDKIVPIEKKTKEPYKRYVPRDYFSIPKNPSKF
FT                   FARKTLDLGIFRQPKMQDLLNIKYKYLPREPKELELGYIREYQNFWKTVEYRDNKDKPG
FT                   LRYKQLGKTDLKISEVGLGTMMFGSRVTESEAHELLDYAYDKFGINFFDTCELYPVPFS
FT                   FETYGNSEKILGNWIKKRGQEVRSNIVVSTRIACNNDNLKIIRNSKDTSLSKCNIIKAV
FT                   DSSLQRMGLEYIDLLQFSWPERYVPMNENGDYDQVFFDVTKMGNYDNERMKEQVETIGL
FT                   LIKEGKIKAWGLSNETPWGVLKFTQLSKELGVPPPSTIQLNYNLLTRNELEKGFVELAR
FT                   PQNTGIGIIAYGPLAGGILTGKYLEFVESTTSGRLLKFPSYMKRYRGSLAARAVKEYYD
FT                   VAMEFKLPNLTVMSLRWVYSRPFIFSTIIGCNDMYQLRENLYCLDPELPITDLMERRIN
FT                   QIYWKWRDPIRIVQ"
FT   misc_feature    complement(63086..63154)
FT                   /note="Signal peptide predicted for TA15960 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.705, signal anchor
FT                   probability 0.003) with cleavage site probability 0.191
FT                   between residues 23 and 24"
FT   CDS_pept        complement(63465..68000)
FT                   /locus_tag="TA15955"
FT                   /product="(subtelomeric) ABC-transporter protein family
FT                   member, putative"
FT                   /note="chr2.cand.520 -ABC transporter"
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA15955 by TMHMM2.0 at aa 133-155, 168-190, 195-217,
FT                   279-301, 316-338, 390-412, 448-470, 824-846, 896-918,
FT                   962-984, 989-1006 and 1071-1093"
FT                   /db_xref="EnsemblGenomes-Gn:TA15955"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74044"
FT                   /db_xref="GOA:Q4UFS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030244"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS2"
FT                   /protein_id="CAI74044.1"
FT                   /translation="MKADHSKISGETDCQNEVEYCFWQNEVYSKLKSCLFFKENLFKFM
FT                   DNGIFIYSLFTWAKRWISLISKQYVEPYKLHPLPVADQILYWQPIFSKNVSDALLRLES
FT                   YETRHDGYPNTKPPRSIMLGATFKTFGKNIGLILFGFLILCFGNMSMVIFIKKILDTAT
FT                   GEQINIKLLFILVLSFVFVQFNIVIFLDHLNFYMYRIIHVIQYSFSITIFQHGLCYRRK
FT                   YFNNINGCNYLNVCNNVLHSCSLDSECSKNPLYCPARRYQNKEINSRIFSFEFMDSYYI
FT                   SLFIESLAHLLQFIVTFTVGFYSISKLIPIKAWPLYTFCLTTTLFMIIVEILNTVILKH
FT                   IYNLKDYRINKSREILSGLHLINKMFIDDVAHNIITETRNNELNLVLLRFVLSFINRLL
FT                   VIITVAFSLIYMMDNYVNNILELDDISQFKSSCTVSSLFVLVKICDAMLFIPDSIKFLT
FT                   YSLISLIRVEYFMRTCSPNFYISDNKFTGSTKMSSEVPDVTNEIDKDVVVLYKDASFSW
FT                   VNNRKDFANNNNEVYLKNVNFQLKRGEIAIISGNQGCGKSNFIKSVLGEMTLVSGCMAV
FT                   VPLHTSMPIFYASQDIWLQQGTIRSNITFGYRFDEEIYNSVIKAVELEFDILSWEKGDL
FT                   RVVSDNAHSLSGGQRVRMEMARAIYAYLIFSKVNKDYNSQCSFLMCLDGPFHGLDPYVS
FT                   RLIFNNLFNSKTGVLLKDDLSIIITSTALVLDKICITKGEFGNLTLYKIENKSLKRLKD
FT                   IVSNKNQASKKSFSRIPIVCSPKEIIRICEPDRNDPIIRAEIIKGKYDDSLIIDPESKK
FT                   TTRKFKESFKSYILYFKSTGFLFIFFVLFTLVYISFENAIFVLAGILGDEVMEIVVNVN
FT                   TPFEIMSAYSTIRRLCNDTLDKLKILSVIIVLICLCANGILTYTCLRGCKRIHEYCIAS
FT                   IMNSSTNVKIKKISSEVLTFLSSDIFMIDENFGPCLSSLLILFLGAIVQSFIIIYSFPY
FT                   LTPVLCLGLFIIMNYIFKNFIHASKNLQISSLESLSRNNSVCENAVSSSSIYRSFKKES
FT                   NLMEDVVEYTDYCIRSWFYSKSFLSWASFVSKFVFLFIILTTLLIPVTIRSFKRINSFV
FT                   GYYGLDLMTSVRIIFTFTNFVVNIAKIEMLMCSVQRFQCFIPPGTKCVFDKFRNVNEED
FT                   IVINSSKLKDQVDKKMLLKRRALEFKDTKPNLIKRMMFRPKINIIDICKYLPPEHSGIV
FT                   LKDICVYTSSQMNEEGLILNNINASPSRSDIIGIIGRTGAGKTTLLSVLQNTVRYRSGQ
FT                   VLLDGKDLQDIPKSVIRHIIGVLPQLPFVFKGWTIRRFLDPRRLFTDDEINDALDKCGL
FT                   LEFVNNLHGGRKLDTVIIPEDIDFKKTKEQSAKESFTHDEALTEDSFKSEDIMLSISQL
FT                   RTLWFAKLLLCRHLYRMLIIDEPPSDNCSEDGSEVQDIGIPIYELLDKYFKHCTCFVTA
FT                   HYANALRTCTSVWVMHNGKLIKTCKASEVSKNESISDLIEQLLNKYSKIY"
FT   misc_feature    complement(join(64722..64790,64983..65036,65049..65117,
FT                   65247..65315,65463..65531,66591..66659,66765..66833,
FT                   66987..67055,67098..67166,67350..67418,67431..67499,
FT                   67536..67604))
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA15955 by TMHMM2.0 at aa 133-155, 168-190, 195-217,
FT                   279-301, 316-338, 390-412, 448-470, 824-846, 896-918,
FT                   962-984, 989-1006 and 1071-1093"
FT   CDS_pept        69133..70176
FT                   /locus_tag="TA15950"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.10 - possible signal peptide"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15950"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74045"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS1"
FT                   /protein_id="CAI74045.1"
FT                   /translation="MNYVLKLLFLTSLYRCIYNNASEDINSLITTGVGDSTSECTEISL
FT                   EASCKSSNDFYVVEKKKFGGNDFRTYTPTHSNIITAVNYKKHSVWKAQEGEHSKFVRIR
FT                   DKGGKERIIVIKIISDGSDKEKTFKKVHGFYHESGTIAVNIKDKGNDDFTFTSNVANKN
FT                   GENTYTPKDNKKIALVFSKSFLSTAQLFWKATGNWYCTKVKTTIESDNLVKITLDTTDG
FT                   SNTSEVVLIDQGDGIWIPDKTVYLDIEKKGNAKNCKYSAEITNKNGSYTYEPIKDFDII
FT                   KVSEGDKVVWESTGDLFCTKVTGKVESDKTTRLRLDFKDSDGKKLNRVFCIYEGNWIEG
FT                   TPDNNNL"
FT   CDS_pept        complement(join(70258..72863,72975..79711,79778..80240,
FT                   80274..80422,80504..82322,82390..84424))
FT                   /locus_tag="TA15945"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.519 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15945"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74046"
FT                   /db_xref="GOA:Q4UFS0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR022099"
FT                   /db_xref="InterPro:IPR022105"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFS0"
FT                   /protein_id="CAI74046.1"
FT                   /translation="MSWIWKDQSFMEHVCNEFLSFNLGSVVPPTLLSPSSNLNASANFI
FT                   VRTINKTLEKNGNLIASDVYKSILKSKEVISTTDSILWQHLQDAVTSAATGNYSLLYGF
FT                   IFSMINRVRDLHDDEWILVPGGVLLSENSPVEQLCYSIYKCRGSSTYIFCVINNGGHGL
FT                   KYHSCRVNKGIKLGTVQRDSTVVLKDVKSDSLLHSSFWFMLYRLLYVPSSHNYEILYTV
FT                   LLPFLNNKSLLLNWKIETNLTSSASKGVTSNNANIINNSKISSDDSGNKKLLIEAFTQL
FT                   HETHESKQVKTESARSLSMELNNNLGGVWIDVPVNKYKPSTMFESLMSLVEIILRHNGA
FT                   KQCDIDLVFIMLQLSTCLIIHEDIAKLTQNEAQVHLGHRSTLLFIQLSCKKLSMMVAES
FT                   LLQECGKSKLIDIDEDALTIEQASDLSNSINSPQSDVTSAVNSVGSINTKKELYTLISH
FT                   LINSIDKKVCEVVPGKLIGMGNGSCTMDRKMCSIANNFGLNLEFDNFGKFRLDGANVNE
FT                   LAKGTLKSLILLPVELTSVDYPVKDYTDLCKVLRKCVQTCTILSNQRDAMPYTYAWRYQ
FT                   LIKHVVLNLLPIPLPVTHINEESGEKTDFWTSMEMLRETQLDLLRLLQLLARHLCCVFS
FT                   SLVKTRQIEGEKTVLFAAICAVTDVIVRKVALDTPSYLSLFYSGRSDGPIGSFGFFLGN
FT                   FANESSFYGLTDPMVVIVRNKILEYFKSLEKTVDKYNVLFSWENNMEISKGDELLLQLL
FT                   SLQLGFNRNPDDIRKYYVNESSEFSCVFPEFANLRDVVFLAKSIGWSQNSISISRYSLE
FT                   DSTLKYSLNSSGSSSCTISVKVFGKSLKVSPIVTSSKRGVNVSYYRKMMKWFSGSSSKN
FT                   ITSAADPHNLTDIEINNETDVLHLSSFPDYGGKLGRRDSEILLQYLTASYVRIPLVTQF
FT                   FSDEANLQALVSEELQKVVVASIFEPGTWQSSTMGYKLPQTAPVQTRDVLSTSLGLLFN
FT                   EILNSPNCLLSSIEQMLDLTLQRDHHVYTGESAKLLLFISKLAVYVSNYIKIVIEYNNR
FT                   SKSESADSGSFQNLNYVPEIVVDEETFKELNNFQNRINKLLRESARVLTKRAIKAEIAN
FT                   EHNAAAASMAHVALIYNYLILLNQTGSNSAASSSRSSSGQYEDLYIKLASCIFFVFVHH
FT                   QFNVEHCSGMDTESEEDPLCLPDMEMFSVMQTSRNLLLNYFRNTTDVSSKMDHLVKVVS
FT                   NLGSTGMQNQNATSENYNHRFDKNENQKEVDIWQEILTPSLSGRFTKASAAQKALLQIT
FT                   NNEDDIELDDVLLESFYVDEEFEDATQTSWGFDSQVTTGIKEELQAPQTKVEEKEKHDK
FT                   GLVASTKNQVISKTNKAIKQSKSLGKKMYRKLKKKSKRVDQVTPLDKYENWLKMKVMQH
FT                   CDIEINFQTAEFSLKKNKLQLLGQWVNNYEHFVNIFGKVTNKTTIQSATVQLHKNRHWL
FT                   RLTGRDYDLIKWEPDDQQYQLSNKTTFKYNNPPKGMEWVTNILEPFISQYASKWSFFID
FT                   RDVVSRITQNSSSTDTFYDDFQNPDDEMDSLRIYAQYTAPIQPPSGGSYNLVTTSPTNN
FT                   DIPVDLFYQSSMCKMIDYTQAYAPQEHEGLIRIATDTFSTISNVITDTASTITKLAGTS
FT                   SSSKSKEKEKEKEKEKEKSSREKNVKNSMVNKEVYVTRSPPCIYVFDILEVGRTWYRSL
FT                   CYCSDVTMSFCSSIPRYITTSNLYSSGNVANKRCNIVLGDPMDLSNTVVDPSLLIIRHK
FT                   KMSNTADEVQRLNSIDSASSSDSVTSKGVEYEMYVLPKLLYGLLPQVLLDEYQFWQNLK
FT                   TSDLIGYPINQTKTNSMEIELETESEDSVVDDVTKKNYIVVELVSLGPIDTGYFQQSEA
FT                   KATVCRRNKMIDDVYYLVNLQNTKDSTIRDFVSTLTRLDDLSHILAWSLQSQVYESSSG
FT                   LSTSSDKVTNKIDLIEYTKLGLTFRLDVTKSNSNRYICDEYNGLYLNYGDVNSSPLTSK
FT                   LIRGLENSLLLSDDDGELYILVSTVRCPMRIYPNVPNSQVASTTIYNYLVGLAWPELVY
FT                   DGHNPNWLNNLDSRHYLYKVHTSRCFLFVPTSSSLLYLLMCRFLDRQYEQVCRLSANMI
FT                   FDQVQNDESILFWSILSRIDSSRDTHPDAYASRLHILLAAHKQGMTVSKGINILTVSTN
FT                   KFKRGFSAFKSIFSGRNTSETSHDKHVSNSLSNTQLNQDKDDKIFINWQLHQELCYYIN
FT                   LNRFVSAGCKLSLEEELELLSLCQSYFSSYPLLSNRYYLLHSLKKSGNMLIREHVVAND
FT                   IEFSVPSKPIVTNFDEIVDRSVVDKNLLIDAATSFTTIRYKRPQEMQSGPNSLEFVDKM
FT                   LQKGMTISEFMTVYELLLGVFPLSTFPNESSHGWGAILTRVISYKEKGSKNVMMSTLKV
FT                   LCSNPSLAPHMPPCPEDLNKKKQFTAMFTRVHQPVHKFLGDLQRVFNKLDEDKEISWDS
FT                   TAKSVSRIDYVIKMDSVIPKGTLTTPWMFRSYSTDYGRTQFNMKNCTIKSITITNDLLK
FT                   DMSTQLISDNILLDLYNSKTNGVVPDDEYGFGKNKKMPIDLDNHWIMKYDVCKKYMERL
FT                   KLEYQRYLDQQEEQSVMMNSYVGFDEQTIDETIKGDKDQLTKGVSQLTTLKERLLNLFK
FT                   SDGQFIDSSIKTVLHQANSITSASLPPQTGFSSPTATNASGTTVDGVTTMVDKMSKVGG
FT                   NIKAVVNTTIKQGIGKNTGINIKNVINTITKSHHAQDNQFPVLNYNDGNLAWSFVFGKL
FT                   GGLESMITFEHLVECLVSSKGDHSLRYLNPFISDTNEIFSLVAVIMLSVNRRIHVAKCI
FT                   SLLLSILQAIKRLYNLLSLHSTASTTDEINMLKCEIVTSSKLLSEKLKISRHYIKNESK
FT                   GIQFDPRLLLFEFNCGILLYKRQVELVENFTKNAKNNNSCCHQMIMGEGKTTIVGPLLS
FT                   LLLADGEKLFIQICPNSLLEFTRSTLRETFSAVIKKNVYTFKFTRFDKATPELYLKLLQ
FT                   AKQTRSVVIATPTSIKSLFLKVLYCFHKLESGELKHDVSRRVNNLHKKLVGIWNMTSSK
FT                   VVDLAYSTTRSKDSSSGRSPKDNSSKDKSKKSKDKPKSNEAGTSDLNKEYVYQRDVQLE
FT                   LDMCLRILELFNNAVLLMDEIDLLLHPLKSELHWPMGEKVPISHLNNSDFQIRWLLPWH
FT                   ILRVLYQNPEEQIVKGERFIFARIKRCIEEAVVNSYLSNFPHIILLSVKWYQNELLPLM
FT                   VEWVYQFLRTKNLIVETYNEVYQYIVNKNVSSNLRSVKVLVFTREWLCSIFPHVISKVN
FT                   QVNYGILSLKQVEEGLAYNPNMPQTRKMLSVPFVGKGTPARDSEFSHPDVLIGFTILST
FT                   IYQGLRFTDFVLTIRHLCSNFYQEPGKTEFRPSYKLFNRWLNSVGYYANVTHTSKSTSK
FT                   NSYHYIKYVDPTGTTELKPIKPDHLNEQMSNNINGFDGLVDKNAAELNDMVEEVLEADT
FT                   DRVWSLDGINVFDNEQLTVLYKILKKSPIVIEYYLCRVLFPLAMEYCEMQMTATAQELG
FT                   SSILFPTRLGFSGTPSDLLPVEMNGCNFSPGVDGKMIAVSTDETIVSGPVLLPVGWDSD
FT                   SIINLVANSPDKPLALIDTGALITNYTNYEVAKLLLVRGLAHVDGVVFLDDDDRQMILL
FT                   RNKWNVTLLAHCGIPLQKRFSFYDQIHATGQDIKQSARAIAYVTIGPDMTFRDFAQGSW
FT                   RMRGIGQGQTIKIIQPPEINQQINSLTNNKGVLGCISWLLLKGLLNEVRLGRLLIEQCV
FT                   ENIARKRSFQALVQDHLNIGGNVHLGAHVQLFREFRDFAIPNTFAPKVTLNKRILDFSA
FT                   RHQISHNQLNSITTFLNQQEIKDDFVNMNYSNQFDITKNKYNTGPDYSFSGHGSSRTSN
FT                   INQMGNKTQDLFALTDDEDMFETQDAPKPVSSREINDYLGMEITIDDEFSMEAEHEQEM
FT                   EVLEQEEEATQMREQMKEEEHVTEEELPAPHSYSRSDEDLVYWPLNDLVDPNKHLEFLR
FT                   CRDFYLYRKDGHKYKLPFPEYLSITPNFYKIKWSSSTYRRMKNVLVVVDVTNQTEDMTR
FT                   ILQNNHAHQSSMNTYHSYSGQTNQISIPTNIVYDVMRAYEALDDKYIPRGHGSSGAIVD
FT                   SDSSLSILHAVDPEGPDEWELISELVTLNINKYRVENKTNMIGVNDFLSCIQNLYSIDP
FT                   TRRYIVVTLAEAEAIRAWLHKNKKTGTKIALRHLAAKFQPFDSSAVYAPKYFDKLKCLV
FT                   GLQSRVVNSCLRFFNSEVQFSEAQIAILSSILKGVSPQDRLAYYQNLRETRLVVQNMKM
FT                   AISYCELLGKLFSHNNIDDFVIRLMSLKFQHLMDQKGGPSCLLSSLKCDKLSYAHLDKI
FT                   LNPNPQKPLAKNEELKAFFTIIDIDCDGVISLEDLQNIYQEPTKPSLLKIITSVQFSLV
FT                   KYKQVRLVASCSTLLSFTAKRLTHVKSETAVISHYFVPTNSTTNVTLGGLGMDLEMHIN
FT                   VLMLIRGNGIDLFMKPPLSFKAVWKDQVDQNLVLWEPESPTGYSSIGLVATTGNQPPKT
FT                   TVHCTPTKWLEVLDKYDTIVLDGVDFENQPLKLTVYLANGVLSLSPPMRLMYDNFALQQ
FT                   DFFDDSNIPAILPL"
FT   CDS_pept        complement(join(84935..85267,85354..86667))
FT                   /locus_tag="TA15940"
FT                   /product="chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15940"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74047"
FT                   /db_xref="GOA:Q4UFR9"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012722"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR9"
FT                   /protein_id="CAI74047.1"
FT                   /translation="MAVNILNSRADSLQSVAALATNIHAAKSLFDILKTNLGPKGTCKM
FT                   LVNGAGHIKITKDGSVLLSEMMIQHPTAMILCRAASAMDEVTGDGTTSNVLFSTSLMKN
FT                   AEEYILYQNVHPKYLCDGFDLSLKKLADILPTLAVTIYDRTGTSDDRTLESGRIDWELM
FT                   SNIVKTSIATKLPYKLAIHIAEQVLESVKIIYEPGKQLDLFMVEVLHMKHRFASETKLI
FT                   RGMVMDHGTRHPDMPKKVTKAFILTLNCSLEYEKSEVNSGFFYDTAEKREALVKSEREF
FT                   TDEKVRKIIELKQKVCSENDHTFCVFNQKGIDPMALDMMAKEGIMALRRVKRRNMERLT
FT                   LCCGGNPCNSVEDLKPEDLGYADLVYEVVVGEEKYTFVEGVKDPKSCTLLIKGSSDYSI
FT                   SQIKDSIRDGLRAVKNAIEDKKVLPGAGAPELVLYNHLMEYSKEVRGKAKYGVMVFAES
FT                   LLVLPKVLADNAGLDGKEVVLEVLDQIRESGRTLGLDLETGKYLVPSVDGVWDNYSVKL
FT                   QTFTIATTVAEQLLLVDEVIKAGRSMHNAPS"
FT   CDS_pept        87035..87910
FT                   /locus_tag="TA15935"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.12 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15935"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74048"
FT                   /db_xref="GOA:Q4UFR8"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR8"
FT                   /protein_id="CAI74048.1"
FT                   /translation="MYLNVLKIIKNTSSRFFSTLNSYKTIKLTNNPKFPFLTKTPTIIN
FT                   NSGFYNILLDNRILLTPLGNTLYTSNLEVANLIIEEFKTNLNKLTNFNDLPYTMLLSKS
FT                   IDLSLDDKINHLKTLKESINSDSVLFFEKVDFCPDELSCISDIDSLSDSSLENLRKFDL
FT                   EMVQSFFFPGVLRSFSKLLNVPSLVTSSSVSKIPRQHPDTVSVFESYIDSLNTFRLIST
FT                   LKVLCNLKSIILSLLYLNGLITTTRCLRLSRIEETVQCSHWGLTDSFGLEERRIISELE
FT                   KCSNFYKLNP"
FT   CDS_pept        complement(join(87995..88468,88535..89036,89084..90433,
FT                   90530..90612))
FT                   /locus_tag="TA15930"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, putative"
FT                   /EC_number="2.6.1.16"
FT                   /note="chr2.cand.517 - glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TA15930"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74049"
FT                   /db_xref="GOA:Q4UFR7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR7"
FT                   /protein_id="CAI74049.1"
FT                   /translation="MNFATKFLDFLSIKKSKNDNDTCYIKKKGFYTYCCGIVGYLGNED
FT                   TNEILLHGINAMKSRGYDSCGVCTLHKGKLKVTKCCSVETPADSFNILKDKVLSSHPPS
FT                   TVGIGHTRWATVGKLSNKNSHPHIDLAKNIALVHNGTISNIEDLYHDYYAELISQKNKF
FT                   SFGGSKYHSINKNIGNSANSTPTTKESSDETQQNAFQLPDSDSESVAIFVGLEYENTGD
FT                   LLLAFKNTIKKLKGTWALCMMSQHYPNSLFVAAHEAPLLVARSERGVYVGSEPNVFMKY
FT                   VKDCIVLNDGDILELSLENVESYYSQYNLLKLESEVVEETCEPYPNWYTKEILEQIYIG
FT                   RIIISLLSEQSNFLYQFSFDDMAPIGNQQNQNQVMNEEANELLSLRDKYLGNDNLCVIE
FT                   GDPNHDNSLLSKVDISTFGFDFPNLPQDILIRLKKTKKLLFVACGSSLHAATYVAKILQ
FT                   KIHHFDLVEVDDASDLTLYRYHDKDVTVVHISNSGETLDCILALNFIKRINPDCLSISI
FT                   INTVHTSLERSSDATIHLRIGREKSVPSTKAFTAQVTVLLIFSLYIISNNEIILDPLDD
FT                   STDYCSSVDKDEPSEYLELTNKDFSEQLTTDEDEDETYNEHYGSCHNYTIASLYKSLSI
FT                   FPSAIAKLLKNDEQYDSLAQWLLKEKIVYILGRGCGHVVALEASLKMKEVAYIQAEGVL
FT                   SGAMKHGIYAMIKEEENTTTISIITSEDKEMTINSTLQIKARGGYIIVITDLEDEVDFA
FT                   DVLIRIPSIGALTPALAIIPIQIITSKIAILSNRNPDIPRGLAKTVTTL"
FT   CDS_pept        join(91595..93236,93334..93464)
FT                   /locus_tag="TA15925"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.13 - calcium binding protein"
FT                   /note="calcium binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15925"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74050"
FT                   /db_xref="GOA:Q4UFR6"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR6"
FT                   /protein_id="CAI74050.1"
FT                   /translation="MSTRINLSHEENDFYSSLFVQCDTDGYGYASGDTVSFLLRKSDLD
FT                   EDLLYSIWEIADKNKTGQLDFSGFCICMRLIAHVQQYGPQALNDPTLLNEVPEHLPIFA
FT                   FPEQINPMENFNTQFQFNNHENQFGNTDDDLKNENGFNKNRPEEHVESDPFTISSSDFE
FT                   GYKYSFIQLTNSLDGYLLGDEARAFYLSTTNLGLDDLMHLWNLADFDKDGRLTLREFCV
FT                   MQKLCESVNIFETLPKLLPDPLFEFLQSDNFPDYASVAQTPPDTTLPVDVTVPTVQANV
FT                   PTLPPQISNTVNKKSVMTMGEKGIRSDPFAPNELDHPQVSTTYITNDLILQCENLLKTL
FT                   RDAINSEKNSILATNNESIEIETKLKSDTKTLENLMAEYRTIVGDSQNMSKRRSLLNSK
FT                   LSIVNDQIQEIRNQIQSIRVSSVALSSSIDKNNEEQSLLQNARQMFLKQLEEDTNLLKI
FT                   EERELAEISNHLQQLKRQRDLLKEKNNQLKECLSQSENATKTMLRSIQHQQGKIMAVRN
FT                   ERINLLEERLKMTNEINSLNQQDANPNDSLGLADNSSSSEASRNFTVNRNVNLDKKGIR
FT                   VSSSSLKVGDEFPK"
FT   CDS_pept        complement(join(93576..94030,94094..94430,94507..95797,
FT                   95835..95864,95900..96081,96112..96138))
FT                   /locus_tag="TA15920"
FT                   /product="RNA binding protein (nil per os homologue),
FT                   putative"
FT                   /note="all_bases.cand.519 - RNA binding protein"
FT                   /note="1 probable transmembrane helix predicted for TA15920
FT                   by TMHMM2.0 at aa 52-74"
FT                   /db_xref="EnsemblGenomes-Gn:TA15920"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74051"
FT                   /db_xref="GOA:Q4UFR5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR5"
FT                   /protein_id="CAI74051.1"
FT                   /translation="MSTLWRKIHVPGRLNVYKFEKVYREGPATVVRNLNKLPSPDKIRN
FT                   SVQKVTFLEVMNKITYSVYLILLFLLIPFKESQLIKKFGKTGTLKMNKDPKLQKKNVLE
FT                   KVKTSSKKHKTKQNKNKPAQKKVNESRNVNVVTTNSLSNHIKRVKENDEKGTKNPNVVK
FT                   LKFKNFSGTLNDFKTLLDSNVKNLGAYKSVNYKQNKIVVSFDDNQSLDRYLSFYNKFIY
FT                   NDEALKVSVLDYFSTVKSDYKVLNLYGVPNEYSLESVQKGIKRRIEVEFKIKTEDDHYK
FT                   LTFKNVPDCVKANSILNNARIPLVKDKKESLVKVNTAMELFGKATRNSSRVFVRNIPFK
FT                   TTYEELASFFKEYDKGAKVHIPSKSKGYAFVNFSSLEKSKKLINELNGKMFKKRKIQLS
FT                   LSLPKQLYLSKSTPENTAETNTNTDTDDTNVTNPVDTSADEEVIEEPEPEKDEIRNTIF
FT                   VRNLDYECTEKELFEYFSKFAEVESCNICLNEDKSSKGTAFVKFKNRDQLKQLVENEKL
FT                   SNMRDKELNNKKPVLGLGYTLRGRRLKLDLALPKEEAKILKEKKAEEDSNRLKEQKNLH
FT                   LLMVGVIKEDSPQFSQLSDDQKETIKQTVASKMEKIKLKNTFVNPKMVNSVIGICIKNL
FT                   PSNVKSNDLRAVIYNHLKTSLSESEYLNLKKLKNRGIVELTLLKGDSYTKDDQGVKVKK
FT                   KKPFAFVQLVDHNIAMKTLEFFSNNKTLYPPKTLQCEFTIDTVKQARKQKPKNTQKSKN
FT                   KTYSRGKRQREKRRLMKLKT"
FT   misc_feature    complement(join(95852..95864,95900..95955))
FT                   /note="1 probable transmembrane helix predicted for TA15920
FT                   by TMHMM2.0 at aa 52-74"
FT   CDS_pept        complement(join(96297..96391,96431..96740))
FT                   /locus_tag="TA15915"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA15915"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74052"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR4"
FT                   /protein_id="CAI74052.1"
FT                   /translation="MNSELKIKGTRLSGRVWKGTSKPVRSIISKSFKKMSKDKIRGKWL
FT                   KSKLIKEEMEEIKKEAKELIEKDKEEKKKRAKVIKDKRKKKIENEIRSAGKNLIVIGQK
FT                   KFSKMSKKARKGLTKLTPEMIAILKSNKRL"
FT   CDS_pept        join(97366..97474,97524..97721,97762..99684,99752..99875,
FT                   99917..100376,100448..100688,100743..101701)
FT                   /locus_tag="TA15910"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.14 - hypothetical transmembrane protein,
FT                   conserved"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15910 by TMHMM2.0 at aa 1120-1142, 1162-1184, 1204-1226
FT                   and 1283-1305"
FT                   /note="Signal peptide predicted for TA15910 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.644, signal anchor
FT                   probability 0.000) with cleavage site probability 0.290
FT                   between residues 26 and 27"
FT                   /db_xref="EnsemblGenomes-Gn:TA15910"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74053"
FT                   /db_xref="GOA:Q4UFR3"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR3"
FT                   /protein_id="CAI74053.1"
FT                   /translation="MRINSLITNTWKLCFLCMLSSKFSLSLRFNPDVSNKRVISRLELF
FT                   NPESTGGPSFAEIGGFFIPTPILDKSGNNSYSYLQHSTTSLGVDHDVVKLSKESLKFRN
FT                   VEGLIKEKPLTLIVGTTYGSRFDMLFEKIVSKDDNKFEFSLPKGTFYIKTEGSGYFLPG
FT                   VKKVVLPCKLKFCPFVNDSFKDSIAVELAKDDGSIYTYNWKLQDESQFGVESINRIPQD
FT                   EASILSPSSTVVSHVDASDASAKLKLLFGIELHGVWGSEYANRLLSVFLKFDFLNRENS
FT                   PNPKKQKWLLTDESLYPQDIEIIKNVVDRNGSRNKNQNVVEDTEYEQIVKISREAFKYS
FT                   VKQAIDKKKNGFYFSRRLYKSVIRAICLHNPENMKRLFKDAHNVVILEPFELEHMIRAK
FT                   NSFTHYPSSHYQSWFKHPEELIEILTSWREYPSGLHKVNGLRYFLRRQDGMVNPEQPTA
FT                   PAIAYPRGPNSDSYIEFMESGFHNYHDVSQLILHEIGHFIHFNTVPEDLKTKWIELGGW
FT                   YEDPKDPDGWSTRKQTEFVSAYSHQKNPGEDFASTLADYVLNPKLVRSRALQKFMFIKD
FT                   NIMGGVYYLVKASHEFKVLNLGNADYFYPGRLSEINVVVNGKVNEPKKVKLTFKLLNKR
FT                   NAQGEDSDTCAKKITFRLFSEIGTFEDIVLKSNTGCSHVLETEITINQMKKRGVWTTDQ
FT                   IVVTDDKGLQRFVGSADFGLRVWINNGSEDFQDPRALTNSVSLALVKKGDEEAVRVGWL
FT                   VVDDSELRKKNAGYAAINGNSNNQHSMGAYSRFDNSDSTPNNFWRKDVWSGARKVPLEF
FT                   CSLNSPDIKNSLSDPNIKFNTHKLGGLDNFEGLTSDQVSSGSFNCFRVAVNIPISKSSR
FT                   TGDYFLTQIVTYDSAGNSQLLQWPQKTGPFITYTSSNPNPDNSPPTVKDIRVTSRPSNP
FT                   NSPNGETLVEISFNLCDSGSGISSLSASLRDPFGATFILYPSWSKTEGCQKIVHTHVLP
FT                   KGSIPGIWHLNKIYAQDFAGNELSADLTELLTLSSCSVLDGCKTTTCYLVKPINKNRPS
FT                   VGAIKNNPNSNGRTVIKGLVRSKSYATIPSTLEIGDFLDSAMKRLNPFNLKSFFQKYDH
FT                   IIYHRFLRSITRIPPLTGFYVLLSTITAFVSYFFNDNLPFSWMKFDLDRVLKGEVWRLF
FT                   TPYFLYGQLWINHYMLSVSNLNYMANVELAHINKPEKFIEFLAFGVLTLSAYSFLEAYF
FT                   SKKYLPQSAVTYDNMAFHFHVFVLYFWSRINEGQRVECMDFFSIPAEYIPYLFILQNLI
FT                   FYNSGLTSDFVALLFSYAYFTLFSNKKTCPIFRGFKTSCLRRLYLKFRDEMQY"
FT   misc_feature    97366..97443
FT                   /note="Signal peptide predicted for TA15910 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.644, signal anchor
FT                   probability 0.000) with cleavage site probability 0.290
FT                   between residues 26 and 27"
FT   misc_feature    join(101045..101113,101171..101239,101297..101365,
FT                   101534..101602)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15910 by TMHMM2.0 at aa 1120-1142, 1162-1184, 1204-1226
FT                   and 1283-1305"
FT   CDS_pept        complement(join(101731..102039,102070..102253,
FT                   102286..102865,102928..103018))
FT                   /locus_tag="TA15905"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.514 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15905"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74054"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR2"
FT                   /protein_id="CAI74054.1"
FT                   /translation="MLSLRNLFLNSANTSSIDDFIISVKKIISHADRTLRCVNQLNLSQ
FT                   ATTLLHSFSIIIYRNFQLFTCLTGRIISLLNSEPPSVRDSIKIINSCGRLHYSDSQLFK
FT                   ILVNFIKTNLDNIKSKDLVSILHSLTKLRYNDHELLSELSLVPLRVLNEINEISLANFS
FT                   ISVSKIYTHENTTKYELLNNGKKVLSQLLPEIKSRASISSSIDNVRHIVALSNMKHLLN
FT                   NEEELNECIGQLMKFINPTVLYYEHSVVLLECLTTANCLEPELVEILLSNLLNKRTETN
FT                   STPELDLRILNCLKSIPPSNKAHQFLMEQILDNLSNNCKIHPRFTKQTFSLINLIKADP
FT                   DPFLKNLENFVQKKGPKFDQDTISKIKETIEKSNRNWKELESSIENS"
FT   CDS_pept        complement(join(103157..103262,103316..103455,
FT                   103532..103662,103812..104022,104119..104250))
FT                   /locus_tag="TA15900"
FT                   /product="proteasome subunit alpha type 1, putative"
FT                   /EC_number="3.4.25.1"
FT                   /note="proteasome subunit alpha type 1"
FT                   /db_xref="EnsemblGenomes-Gn:TA15900"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74055"
FT                   /db_xref="GOA:Q4UFQ8"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ8"
FT                   /protein_id="CAI74055.1"
FT                   /translation="MYRNQYDTDCITWSPQGRLFQVEYAMESVKQGTCCVGIKSNTHLV
FT                   LCALKRKISKLAQVQDKLYKVGEYIGVAMSGITSDAKMIISYMRNECLSNRFLYGCDIT
FT                   ASQLVSLVSEKSQANTQVSSKRPFGVGLLVAGYDETTGLHLFETCPSGNVVEFNATAFG
FT                   ARCQSAKTYLERKIVNFSESDLNGLIYHAIKALKTTIPNDGEFDVDVISVGVVGKGTPW
FT                   KILDSNFVQTFVDKVLT"
FT   CDS_pept        complement(join(104652..105260,105329..105451,
FT                   105488..105712,105811..106197))
FT                   /locus_tag="TA15895"
FT                   /product="metallo-protease, putative"
FT                   /note="chr2.cand.511 - metallo-protease"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA15895 by TMHMM2.0 at aa 94-116, 126-148, 168-190, 205-224
FT                   and 358-380"
FT                   /db_xref="EnsemblGenomes-Gn:TA15895"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74056"
FT                   /db_xref="GOA:Q4UFR0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFR0"
FT                   /protein_id="CAI74056.1"
FT                   /translation="MGLRNLFHKPLHFEYALLAHSLYKLLRLYALCRQLCLVKKELAGE
FT                   KKVVTTLAKKDDENYKKTLALLKPYLTSAAYQKTLEYSKDKLKFDMTFELVHWLVMFAF
FT                   MFNNNVLKYWHLSGELLRHKCHYSQVLVYFALRLGFSFLFRLPFRYYTAYRLEKKHGFK
FT                   TKSRFVFLKQYLLCYAFYVLLLTGLASGLTWLNKFSKSNFRALAFLVFFKTALVFVVPL
FT                   FLTLKHKLLPLSDPELRREVDAMGKKLGLTSKNVHVVSANTAHTHGVSLSWGFCKFKHA
FT                   YLNESYVTLGKPSAMALLSHVFGHFKHHHFFKSFLFDLTKGTVFLFLFDHFKGDTALFK
FT                   SFGTHSVSALTMKLETVYMAYLCPLLLLVVVVKSVYSHFLEFEADRHAVRLGHSDELVN
FT                   FWTTVYREKKWFFNVDPLYGRLFSERPSLFERVYAVYDATVASKPVSN"
FT   misc_feature    complement(join(104856..104924,105392..105451,
FT                   105530..105598,105656..105712,105811..105822,
FT                   105850..105918))
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA15895 by TMHMM2.0 at aa 94-116, 126-148, 168-190, 205-224
FT                   and 358-380"
FT   CDS_pept        complement(join(106644..106918,106975..107141,
FT                   107189..107451,107503..107733,107800..108180))
FT                   /locus_tag="TA15890"
FT                   /product="metallo-protease, putative"
FT                   /note="chr2.cand.510 - metalloprotease"
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA15890 by TMHMM2.0 at aa 10-32, 85-107, 172-194, 201-220,
FT                   305-324 and 337-359"
FT                   /db_xref="EnsemblGenomes-Gn:TA15890"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74057"
FT                   /db_xref="GOA:Q4UFQ9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ9"
FT                   /protein_id="CAI74057.1"
FT                   /translation="MGVSNLFHSPLHFEFFVSVVLLHELFEQYLNFRQYRFVKKKLSGD
FT                   KTFFLENSADKIYKKTFEAVSEYLNSDDYKKTVQYSYDKLKFSVFNSLFHFLLDILLLF
FT                   VLFSPKLWKFSGTVIKKNNEYTQSLIFCGIKMLFDTFIELPFGLYSDFVLEEKHGFNKK
FT                   TYKLFVKDLLLTLLLQCVIGGPVLCALIFLVNWGGELFYFYVFGFIVVFNFIMLIIYPE
FT                   LIAPLFNKFEPLQDQELRTDIENLVLITILIMFRHVKLISHSKKLNKWMVLRDPRIPTH
FT                   IYTACGSSKSCVVSHELGHWKHKHVAKMLTFSFANLFAMFFLFKKFKDNKNMYNSFGFH
FT                   GVTSFVIGISLFSNIFTVLGILTNLVNVTLTRFHEFQADKYAVKLGYGEDLTKSLLSLH
FT                   KDNKAMIYYDPLYSWYHFDHPVLFERLYSLYQTMDEGKL"
FT   misc_feature    complement(join(106884..106918,106975..107008,
FT                   107045..107104,107404..107451,107503..107514,
FT                   107533..107601,107860..107928,108085..108153))
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA15890 by TMHMM2.0 at aa 10-32, 85-107, 172-194, 201-220,
FT                   305-324 and 337-359"
FT   CDS_pept        complement(join(108362..108467,108521..108660,
FT                   108728..108858,109010..109220,109317..109448))
FT                   /locus_tag="TA15875"
FT                   /product="proteasome subunit alpha type 1, putative"
FT                   /EC_number="3.4.25.1"
FT                   /note="chr2.cand.509 - proteasome subunit alpha type 1"
FT                   /db_xref="EnsemblGenomes-Gn:TA15875"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74058"
FT                   /db_xref="GOA:Q4UFQ8"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ8"
FT                   /protein_id="CAI74058.1"
FT                   /translation="MYRNQYDTDCITWSPQGRLFQVEYAMESVKQGTCCVGIKSNTHLV
FT                   LCALKRKISKLAQVQDKLYKVGEYIGVAMSGITSDAKMIISYMRNECLSNRFLYGCDIT
FT                   ASQLVSLVSEKSQANTQVSSKRPFGVGLLVAGYDETTGLHLFETCPSGNVVEFNATAFG
FT                   ARCQSAKTYLERKIVNFSESDLNGLIYHAIKALKTTIPNDGEFDVDVISVGVVGKGTPW
FT                   KILDSNFVQTFVDKVLT"
FT   CDS_pept        complement(join(109869..110504,110566..110688,
FT                   110731..110961,111060..111446))
FT                   /locus_tag="TA15870"
FT                   /product="metallo-protease, putative"
FT                   /note="chr2.cand.508 - metallo-protease"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15870 by TMHMM2.0 at aa 126-148, 168-190, 205-227 and
FT                   359-381"
FT                   /db_xref="EnsemblGenomes-Gn:TA15870"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74059"
FT                   /db_xref="GOA:Q4UFQ7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ7"
FT                   /protein_id="CAI74059.1"
FT                   /translation="MGLRNLFHKPLHFEYALLAHSLCKLLRLYALCRQLCLVKKELAGE
FT                   KKVVTTLAKKDDENYKKTLALLKPYLTSAAYQKTLEYSRDKLRLEMTFELVHLALSVPF
FT                   CFNNTLLKFWHLSGELLRHKCHYSQVLVYFALRLGFSFLFRLPFRYYTAYRLEKKHGFK
FT                   TKSRFVFLKQYLLCYAFYVLLLTGLASGLTWLNKFSKSNFRVNALAFLVFFKTALVFVV
FT                   PLFLAFEHKLLPLSDPELRREVDAMGKKLGLTSKNVHVVSANTAPSHGLALHWGFCKFK
FT                   HAYLNESYVTLGKPSAMALLSHVFGHFKHHHFFKTFVFDLLKDSLFLFLFDHFKGDTAL
FT                   FKSFNTHSVPALTMKLDTFVAFVCPLYFLCNALKSVYFHYLEFEADRHAVRLGHSDELV
FT                   NFWTTVYREKKWFFNVDPLYGKLFNFNPLFGAKHGGAPSLFERVYAVYDATVASKPVSN
FT                   "
FT   misc_feature    complement(join(110103..110171,110626..110688,
FT                   110731..110736,110779..110847,110905..110961,
FT                   111060..111071))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15870 by TMHMM2.0 at aa 126-148, 168-190, 205-227 and
FT                   359-381"
FT   CDS_pept        112475..114355
FT                   /locus_tag="TA15865"
FT                   /product="phosphoacetylglucosamine mutase, putative"
FT                   /EC_number="5.4.2.3"
FT                   /note="chr2.C.cand.15 - hypothetical protein, some sim. to
FT                   phosphoacetylglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:TA15865"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74060"
FT                   /db_xref="GOA:Q4UFQ6"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ6"
FT                   /protein_id="CAI74060.1"
FT                   /translation="MLDFSQIPNGPDIPEGYVDVIYGTAGFRANTENPPGNLEHVAYRC
FT                   GLLFASLPFISEPYFQKYSRSFSFNGSMGLGIVVTASHNPCSDNGIKLFSPSGRTLECA
FT                   WEPIFTSFVNTRDPIQSTLSNMFTKFGYKPRDLNLNILIGCDTRPSCLSLVSNLTLGIK
FT                   AIYKLLNLTNSNVNFIGMITSPTISYLLSSNTTWAKDDEMYISFLSNSFNKIYNKLQDL
FT                   GLVDFSQNVDNPEELFFDCSYGVGGYKVIRFFDLFRKLGIIPSICNFHRFGKDQDLNYK
FT                   CGASYVYSTSCFPQALKKSFNIYFNKRFCCFDGDADRVLYYIPCDPVPNANGEYTVLQL
FT                   HGDRLLIVTMMLLWTFLANHKKKLTVGIFQTRYSNGSSVNYIDALIDRYSSENKNVSWK
FT                   HEYFNSGLKNAEKLAEKYDISVYYETNGHGNVVYNRTFHSKDCYQNLSDQSTNIQSPKS
FT                   FDALELSSLDTCMTNSTISSLTDFKEEFSDTLLFDFLGIFFPSGDGIMNSLFLELTFRI
FT                   LKLSFHDCLNFYTDFPSSHFQYHLTPELKTLFSSTANETVLKEPKILQDKIDSKTKEFS
FT                   FCRAFLRPSGTEALLRIYVEGETQEIVQNVQNYIVNEIDVFLASHKLLQS"
FT   CDS_pept        complement(join(114556..115066,115096..116543,
FT                   116599..116643))
FT                   /locus_tag="TA15860"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.507 - signal peptide, hypothetical
FT                   protein"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15860"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74061"
FT                   /db_xref="GOA:Q4UFQ5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ5"
FT                   /protein_id="CAI74061.1"
FT                   /translation="MVGVQKNQRDAKTIQEKDYFPKFLMLPLPFTKIRSNETTPKRVED
FT                   KKPNSPQSSKIESFRFTETWSQLLEPENLQEFTNMDVGIYMNGNIMYLFFENFLMDAIL
FT                   GENFQGPAAVYNHGRILSVNNECLNRGIKKGMYVETSLDICKDMKLVKYDWDKVNERGL
FT                   RIIRLLKKYTDRILSPQYNEFYLQISYTECRNLLETVCSNTDENICNLAIQISREVPGD
FT                   PVIGIGKNMLVSKLASKRCRNLKINSQESEYDYDLSPVLCITSIYGGCYMVSDKICIVT
FT                   DGFRFLNNVYLSEIPGVGYLSQVLKSKGLVTCNDVRKIGTPLCLQSVLGGRIGKLVYNF
FT                   CFGYDYRCANLPKKQQDFFLNKSFMSCVTIGSQNSSISICDNCTQNSTKQNEPEKEQEE
FT                   SKSSSKGPSQETVGDSEGGNLERGSEERVLRKLLSKVLKDLCSVYSLFDKCIINYSIKY
FT                   KCSVKLHIHSDTQYTKTITSILDKQSLRHTINSLYDKIKSEFGIEFSQIKKMELEILDV
FT                   VRVEQDNTIIDKFLKERNPTSQESQSPFRFSFPSSSSATVTPNDSIYSPSEMCTPTRRL
FT                   NGWKLDSISLDSKTPQSQTKSISSISASRTLNTPNILGYLEFKGQVSQKSNPDSSVDSK
FT                   TRTPSRSRRSLKLSRGQKYITEYLSPSKFEFS"
FT   CDS_pept        complement(116989..117594)
FT                   /locus_tag="TA15855"
FT                   /product="synaptobrevin-like protein, putative"
FT                   /note="prenylated protein, putative"
FT                   /note="chr2.cand.506 - prenylated protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15855"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74062"
FT                   /db_xref="GOA:Q4UFQ4"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ4"
FT                   /protein_id="CAI74062.1"
FT                   /translation="MQKHNITYLGVLQCKEEPVVLTQSFHFSDLPYFSRSQAKNVSTFM
FT                   ARELSKRVDYGFTATTVDEYLVYSNKWSTGLCILCICNSQYPARTAFGLLQHSFFIFND
FT                   KYCYEDLKFDNDLNLSLPELKELILKYKNPEAVDMYQNVYGKVQNTINIVHKTVKDLLN
FT                   CEENLESLVNQSKDLSSRTKDVFAKSKKLKRRSCCSLM"
FT   CDS_pept        complement(117827..119983)
FT                   /locus_tag="TA15850"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.505 - PF01142 uncharacterized protein
FT                   family UPF0024"
FT                   /note="uncharacterized protein family UPF0024"
FT                   /db_xref="EnsemblGenomes-Gn:TA15850"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74063"
FT                   /db_xref="GOA:Q4UFQ3"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ3"
FT                   /protein_id="CAI74063.1"
FT                   /translation="MATKSISVGIEKTISDCVPKVKSKRVNGFVKFLLEDFHVHEIDLE
FT                   GKILNLGQFVNIAQIEQAFERKKRTETGQQFLSTYKENSSVNYPDDLFQDLDKVRFDAL
FT                   LRSLSNKLQLQTKNNEAHFALLCCKNKEDMKKIRTRVHQWIRTELPFLESTTVDLKSCK
FT                   EDEKMSEYLESYSDFSTLQPDYNLIIVEPTKLCKKFLTTKVNENCVEPFLGPESQLTLD
FT                   EIVKKVDKTDYETFKPKSYARYLHFNMLKINRETSEVVNMICKSAKRSSFDIFSAGNKD
FT                   KRGITVQRMCIRRCKIVDLFEAMTKGWFNDVYLSDFLYKNKRISLGDLTGNHFKIVIRG
FT                   IEDQSNIHKCMETLKTYGFINYFGLQRFGTKKVGTHIVGAALIHQKYDLAIRLILGDIE
FT                   TAKQYKVFNKFFKDSEPEKVDNCESTSIKPENLEGEMEGRKYRWATDYYLIDNDPETAL
FT                   KNLPSHLFIEKSILKGIISKIPSDKCLGRVPKNILSIYVHSTQSLLFNLAASERLDKFG
FT                   YKVVAGDLVATGEQELSESSESEENEPNLSKNKRIQILEVENEEEAKRYTIEQVVLPLP
FT                   GDNVKYPRNIEEFYRKIAMENFNISLDDFSSFKDVEGKKHRSLVSVRGSYRFLIVKPKD
FT                   ISYEVIENLEDPFQVLIKPEIEGYMQYLENYETQKNSENIFKLGDLIRNKSALLLRCSL
FT                   PKSSYITVALREIITDQSIENNYI"
FT   CDS_pept        complement(120077..120742)
FT                   /locus_tag="TA15845"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.504 - possible signal peptide, conserved
FT                   hypothetical protein"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15845"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74064"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ2"
FT                   /protein_id="CAI74064.1"
FT                   /translation="MKFCELPILLTTVIRPVQICNQIPLRKAPKPKTKPKPKQQETVGV
FT                   TRYYPYIPPNLIVDTVNSLKDKESLSEILDLIFSPLSPSDTIEDRKLYQKTYNIYQLYK
FT                   KKIIEKYKERESYVKSQMFDAIENLPENLYDETVQSETEPIPEELTFQKAYREQLINKH
FT                   LSDYEIEKLDTFRMLMYLRFPHTETKLKNPGLFWLEEKKMISRQKQASLLSRNSKSKN"
FT   CDS_pept        complement(join(121262..121430,121486..121699,
FT                   121730..121829,121862..122113))
FT                   /locus_tag="TA15840"
FT                   /product="apoptosis inhibitor, Bax-1 homologue, putative"
FT                   /note="all_bases.cand.508 - PF01027 Uncharacterised protein
FT                   family UPF0005"
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA15840 by TMHMM2.0 at aa 36-53, 57-79, 91-109, 119-141,
FT                   148-170, 174-193 and 209-231"
FT                   /db_xref="EnsemblGenomes-Gn:TA15840"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74065"
FT                   /db_xref="GOA:Q4UFQ1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ1"
FT                   /protein_id="CAI74065.1"
FT                   /translation="MDNFTKFNTGRPYFNVNTILDFAPLTEPQKVHLTKVYTTLALSAL
FT                   ITFLSVVINGPWALLHPLFGVLSVLGSLFYIIFTKTSRNDSNYKRLVALLFFSLGLGIT
FT                   YRNYVLQAFAFNPEIVTTALMGSIGIFGSFSLASLFMKTRTAMYLGALIFSLSNYIMMV
FT                   NFANYFFRSKFVNNVTLILGLFLFVGYIAFDTQMVLKEVKNGNEDYIYHAMMLYYDLFA
FT                   LFLELLIYLMEKEKSKSKKDKN"
FT   misc_feature    complement(join(121304..121372,121418..121430,
FT                   121486..121532,121542..121610,121629..121697,
FT                   121755..121811,121877..121945,121955..122008))
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA15840 by TMHMM2.0 at aa 36-53, 57-79, 91-109, 119-141,
FT                   148-170, 174-193 and 209-231"
FT   CDS_pept        complement(join(122239..122302,122358..127531))
FT                   /locus_tag="TA15835"
FT                   /product="hypothetical protein, conserved"
FT                   /note="zinc finger protein, putative"
FT                   /note="chr2.cand.502 - zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15835"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74066"
FT                   /db_xref="GOA:Q4UFQ0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039795"
FT                   /db_xref="InterPro:IPR039804"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFQ0"
FT                   /protein_id="CAI74066.1"
FT                   /translation="MGKKSSRQEEKKVRASDFSNFHTSDFRPTGLHQIFASFNNIATLQ
FT                   TNTSIKSESSTKTKGVNAQSYPTKDVSESQADILAILNKLTKKDSITKVKALETFNEIV
FT                   EIIPEELLEEFIVDLIHIFKKLAVVEPVKKIRLEFGILLSKISKKLRKKLQNYLESFIT
FT                   YWWISMHDESPEISQVYFDSFKNLFSTTLSESEFELKTLKILDFYLTRIISDYLEWLNR
FT                   DMDSYTKEWIDTFGKSAQNSATTADMHNRLFYSISHSLKKLFEYVRVHRNDYTFVLDGL
FT                   INSEFISRVNEVYKSPSFKKKLSCLLMLVEMVKVLPKKTYNHLETIISNCVTSLKKDTE
FT                   PSLIYHSVRLICACTRENNSCITSFLANYDDLVISILKNFNGGYSNKIDLYTLFPSLYM
FT                   YLDVEYFKKYPENFDNVLNYLCDLMQTEVSNLKRNSYTFDLDLYRNMGTSMLCSFYKLL
FT                   LLSKLKSVHYITLPLKKMTPINDKSRDFLWYYHIVMTEYLLESNLDKEDFFQDFLKELF
FT                   SYSESNTVLVTLIVDNIYSKVGDTMNEVYPEFQSVYNHLLENVKTKFVENLVQHLENQA
FT                   DLSLDIDQMTQLLRKSTIKLPNEIPMIIFKLESRSDFVKKYTFLLEVYKKLEWNDLGGT
FT                   LEVELDNKLHLFYSAVLMERNPKLVLQVFEKKFCLQDKRTFYMLNEVVNLCNSPETSEY
FT                   LVQLAREHPNLDLLDSIFQRVDHSLLTGENKTVYEVLLVLYQLYECKKVEFYQNYDNNL
FT                   VETILTVYLNAVLRKQMYDFGVFATFVLEQFSKNTDSEVKLEEPHMKKLRELNPVDLED
FT                   FEKFSKNLGTILGNLFETEFVTKVLKKARKLAKEDDTKILERRSYHLVVNLYLDSDESN
FT                   IEVDEFLDLFLGTFVSSEPDSWVTVHEDFINIANKYGFKNEETMLRFIKKMLNKIMEQK
FT                   YTSLTELNRTVGLFQYFYKTLRSYLRKHHDLVCFIKSNFCKNLTAPYLLSALYSVDTIS
FT                   DHDIICEIIEFGKFVENKRKSEISRLEKPDTYTFLNYITLVTRLLTNYKKVNKIGQLES
FT                   EDPFKMFNLPLKNANSHDSTPHNHIDNKSTNSESVENFLNSEQFQQNRFFSNLFSLFSS
FT                   ANLEETVDFFWAHLSLFKFLSLFSVDIHKNYKDDISTNISGSLANLYGSLALHGVSTSL
FT                   ISTLINFQVEQGYVSEFNFLVSPDAEHFFKHANRSEFDLYKEFTNLKITKEAYDPKSLV
FT                   TWLILCLKYGQESLKLEDSDSVPDFSRSVSLLLRSINSLQPSSYFVNVYAASLWNCRVF
FT                   YPSISEVGIFCNFPNHNYVCVIDNFPEWDFFHDLNSCKIDFFKLLYAFNNYSQNTVELE
FT                   DNELDEEELTINDLSEEVESEVVDAQESKEDQASQSDEEQKEPEHNIIDVKNSYDIMKL
FT                   YFSMIIGPYLTSKIMRTYKYLEGGDSQEIEKCLICWLTVFNLQGRYKKLGNLNCANAMV
FT                   KLLTLKPNEFTEYIDSFQDNLAEAICDSYHEINNMSFFYSEQFKLYELYEDEFYTGEFY
FT                   KSSLLDLFLQLLILCLEKMLIKDEEFCQTVKLVYYKVAKIFPMQVSEMWNNCKNTYVKK
FT                   NIKKFTKHEVTQKLVKDELDTIKVLANDLTVFYDTIKREVTAKLLTKNEITAKITIKVP
FT                   SAFPLEPLTFVSQEKKNHKWIVYSHSEANRSGITQGLLLWYNNVIKYYQGIDECPICYS
FT                   IVHAQFQSIPTKSCKVCKYKFHKECLFKWFRNAAKAKCPLCQSQVSFL"
FT   CDS_pept        complement(128000..128863)
FT                   /locus_tag="TA15830"
FT                   /product="formate/nitrate transporter, putative"
FT                   /note="chr2.cand.501 - score = 18.43 PF01226
FT                   formate/nitrate transporter"
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA15830 by TMHMM2.0 at aa 37-59, 69-91, 112-134, 164-186,
FT                   193-215 and 241-263"
FT                   /db_xref="EnsemblGenomes-Gn:TA15830"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74067"
FT                   /db_xref="GOA:Q4UFP9"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP9"
FT                   /protein_id="CAI74067.1"
FT                   /translation="MFEYTRQLASAKDNYERIAKEAGDKVNGNILTLFVKSLLGGWFVA
FT                   IGGYAASVIASLFYEQDASNGAARAAFSLIFPGALCAILFTGSDLYTGNTMSFTFALCK
FT                   KHITFLNYFLKLGISIMGNYIGAVIGALILSGGTTYFLKDVGKGAPYLLDMAIAKTNKP
FT                   FWKTMFSAIGCNCFVCLAVWSFYACYDSAGAVLIVFAHIGAFAAGGLEHTIANFYLLNA
FT                   ALISQSGVSFLDVYYRNLIPVFLGNTIAGTMFMGLPIAFMYRETPKHPIFKDSRSDDVE
FT                   IKALIV"
FT   misc_feature    complement(join(128075..128143,128219..128287,
FT                   128306..128374,128462..128530,128591..128659,
FT                   128687..128755))
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA15830 by TMHMM2.0 at aa 37-59, 69-91, 112-134, 164-186,
FT                   193-215 and 241-263"
FT   CDS_pept        join(129635..129661,129705..131582)
FT                   /locus_tag="TA15825"
FT                   /product="26S protease subunit, putative"
FT                   /note="chr2.C.cand.17 - PF00004 ATPase family associated
FT                   with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:TA15825"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74068"
FT                   /db_xref="GOA:Q4UFP8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP8"
FT                   /protein_id="CAI74068.1"
FT                   /translation="MTDDDFYLKALTLAYDSELPPECALKIAEMLNNLYYSQEDVCTDE
FT                   TLGVLYSFNDEISEDFNDSLNPNFDVLINNIDTNYNFNPYVSIYDNSRLLQEEGSESKV
FT                   KRRLYMDNFFEGDSYVSNIPLTNVTRRYLINTINENIFERSKIANTKSEPPKKSEPGPI
FT                   LKKPEPKDKIVPDEPKLQKSADDYRNLNNYHPKVQTNSSTSEKNYSNIVNNAPYVKPKS
FT                   INKFNANNKVEKNVGFKSGLEYLNSQIKEGNAKPMEEIDLTKSNVSDYKNLARNQLNDQ
FT                   YAKQNSYPGYNLGNYNNYKPRQGMNNKVDGPHLDPKYLPLVTGDVTPEMISMALDMKVL
FT                   ECQKITKDDIVGLDDVKKVVIDKIVNPILMPNLHIGLFKAPKGILLFGPPGTGKTTIAK
FT                   WIANVSNATFFEISPSSITSKFYGESESIIKTLFKVALVDSPSLIFIDEVDAVLGKRKS
FT                   TDDDSSVRMKNQLLQMMDGINSGSLSVDKESGEERVVIVIGATNRPHMMDSAALRRFTK
FT                   RILIPPPDHETRKKFIIDIINKRSSKKCLLSEEDLEKISVSTDGWTGCDLLTLCYKAAE
FT                   YCYDDTIDLFGGIENIKSFNDFRGVEMKDIERALECTRPSTDEGMEFFLDWSSKHGSV"
FT   CDS_pept        complement(join(131684..134631,134719..134767))
FT                   /locus_tag="TA15820"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.500 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15820"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74069"
FT                   /db_xref="GOA:Q4UFP7"
FT                   /db_xref="InterPro:IPR015894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP7"
FT                   /protein_id="CAI74069.1"
FT                   /translation="MEIPSSGELHEVEGERGNFVVRNDGHLKNEATLSFGPEWSKSRLT
FT                   NLLDVVNYYKPNPKNHIYLPENTFDSNGKIRGHMGGETTFRRETQSNRQEQLSTHTNDN
FT                   NANQQFNELEFVDSDKDTVVPEARVKGLFEVPFDVYSMPRLIAPFKGFSKIITPRAIRL
FT                   INFTETEEGKLVCKIDKNAMNIVQKQVGNLNVVSVSFVGDPKSGKSFLASLLVGKDNTS
FT                   FNISESYIDPNNMLTDGSVWVYVSVYQEKHAYVFLDFEGFEHSEKNKVKMLLFAFSLSN
FT                   LVFCNVKYSLMNGIYNSVRAMIQLTKKPTSNETLGSSENLQDENEFLEMIKGQGTRLLS
FT                   RSYDSQNFVDLVQDFEDSEKYNSDRKELWSAPIVQFVFRDSSGFVKCIDDRIFTPETLV
FT                   EQGIFENYLDLFTTEEREPNFRNEMLDSFEVFNNRKYLSLPHPTLSTHPYGDKDYSDNE
FT                   DSNLTDFFMKLLSSDKDDFKKFTRLSYDDFTLTSNLSSLFHEKLDQLKSLLYHDTLNYA
FT                   MSRQQVNGRMFGEYLKKMATHFNKSNTLTVDNLNDMLSSVFLNENNVILKEALIKFLKE
FT                   IRAKVAPKLPMDGKALLNLTLSSKFTSLNYFESNAFGTREEYQMKLNELSETLDDLIRK
FT                   LENKNRTLMMEQLASYVDRKEYIIRSKLLKREYNLNDLNQDLSALKKSLNNKFSDSELV
FT                   SKVLARASNNLVSLFNDTHPETFIHNLSYSKSSSIEETFQNLNTYISNITTNSQLETKT
FT                   KSPPAYSGADDSVMSMHRGNQSNKLDSDLGDHTLDGEYYDSEDEEYEDEDDEDEEEEED
FT                   ESEEEEESESDFEVEDDEEHEYEDNDVEEEESEDEETETSEEESASVEDEDEQSQDSLE
FT                   NEPDVPLDENSSDENDSEQDQQNGESEEDDQVEQNTESNQDYWLLGESGGTKSFMDDSG
FT                   PVSSQNFDEVYVDNEKMGNEQEEVVEVLEDDFAQSDIEVSEKKAILKEIFEKSADEFME
FT                   SRGAKKNPL"
FT   CDS_pept        complement(135161..135457)
FT                   /locus_tag="TA15815"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15815"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74070"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP6"
FT                   /protein_id="CAI74070.1"
FT                   /translation="MLKNVCKHAFELNFRIYFLVNQLNICRKMTTYKISHCSNTPKCST
FT                   TIIVHKGNKGPVYQELQRVKVIKEKECSGCQCQNSTQEYLVYEWPNSTNYIII"
FT   CDS_pept        complement(135560..136195)
FT                   /locus_tag="TA15810"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein, PF00226 DnaJ domain"
FT                   /note="small overlap at the 5' end with gene TA15805"
FT                   /db_xref="EnsemblGenomes-Gn:TA15810"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74071"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP5"
FT                   /protein_id="CAI74071.1"
FT                   /translation="MKRLQPFNAMESYMINKLTDAVRILELSNELKIDFPKVKSNYNRI
FT                   VKSVHPDKNCGLDRGLDSVLEAYKLLDYYFNVVLNGKNRQLCHLSCISDSCSCYDTRHG
FT                   NSQQSCRYHKSENSEPLTCTLCKPNQLLEDSPKSRQSPTSRFRCINSKDNLSSRFYIEI
FT                   SRNSLDVFEGIPYVTCRCGQILFITKEATALGIQTFDCDVCSCSYNIV"
FT   CDS_pept        complement(136173..136709)
FT                   /locus_tag="TA15805"
FT                   /product="hypothetical protein"
FT                   /note="small overlap at the 3' end with gene TA15810"
FT                   /db_xref="EnsemblGenomes-Gn:TA15805"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74072"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP4"
FT                   /protein_id="CAI74072.1"
FT                   /translation="MIINVGSLTAHPGLRGHTTSTDTLSDIDLSLSDFKMNACKLIMDK
FT                   CSEIIRDDKACYTPGNCNDAYKKFIMPITHSFCSFSSDQCDDLSFDEALDKLYSAGALT
FT                   FNMEDTKNIDEKIKELNELKHKVKMVSLSSHAEEAKKAREKYLQDRSESHKIESKTSKG
FT                   AEETEKKLDEETPTV"
FT   CDS_pept        complement(137294..138166)
FT                   /locus_tag="TA15800"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.498 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15800"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74073"
FT                   /db_xref="GOA:Q4UFP3"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP3"
FT                   /protein_id="CAI74073.1"
FT                   /translation="MIDLNFVWTGYENACRTVKYATSIGWSTIGFNVYFIANEQGINQM
FT                   KFDDHLEEHKGNSRTNDLGPLLSNQIFPLISSISVESGLILGNNFVRRITVLLMDEFKP
FT                   NSLIKFEVSNEFEIFSVIPTSKRSFQVACQNLNCDLINLNVYCYYSPFKLKRGFINSAL
FT                   QRGCYFEISISDEMFKNLESVKIPGTNTTDPVNLTFLRNLPGLLKYIPPTKLVISSGTR
FT                   TITNLTDPESFLRTCNELFRGFSGRDLNLKSCLTKVPNDCITKGAARMTFGTGVVSYKE
FT                   ENNLGRTFK"
FT   CDS_pept        join(138816..139025,139055..139678)
FT                   /locus_tag="TA15795"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.1327 - signal peptide,
FT                   transmembrane"
FT                   /note="transmembrane protein, putative"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15795 by TMHMM2.0 at aa 13-35, 39-56, 63-82 and 102-121"
FT                   /db_xref="EnsemblGenomes-Gn:TA15795"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74074"
FT                   /db_xref="GOA:Q4UFP2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP2"
FT                   /protein_id="CAI74074.1"
FT                   /translation="MKVSSKEVPLKKLWRANLVLSVLFHICLLVISITSRNPVFFVLCY
FT                   FVTFLSSLILFDWKYLTLILNIFIQVFSIVSSLYICFSPKIPESSFKARWHKDSLKWMF
FT                   PLVCFHSVSVSVTIICLKRKYNVNDEFPLSDVISVLKNPEPYFRECKELKEKLLENQKI
FT                   AQRMRMIEIRKEEEVAKKIVDSLYSFTNRSNFPELETRTNRTTGSNIMDKYKVERSNFN
FT                   EFSQDMEVKYIGNDANFNFHISIPEEMESVDSISWVNDTTNRNSNEKLDESNDSN"
FT   misc_feature    join(138852..138920,138930..138983,139002..139025,
FT                   139055..139090,139148..139207)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15795 by TMHMM2.0 at aa 13-35, 39-56, 63-82 and 102-121"
FT   CDS_pept        join(140038..140078,140145..140209,140247..140301,
FT                   140335..140407,140467..140601)
FT                   /locus_tag="TA15790"
FT                   /product="ran binding protein, putative"
FT                   /note="chr2.C.cand.19 - ran binding protein, PF00641, Zn
FT                   finger in Ran binding protein and others"
FT                   /db_xref="EnsemblGenomes-Gn:TA15790"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74075"
FT                   /db_xref="GOA:Q4UFP1"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFP1"
FT                   /protein_id="CAI74075.1"
FT                   /translation="MERREGDWFCPDTSCGNLNFSKRTKCNICGKLRPTNQSSNLATTQ
FT                   KQGDWTCNKCGNLNWARRTHCNICNISKTSQEPEDRLGRGGGYFDLFDPKDRKEHDSED
FT                   EEYDEFGRKKKKSLKNKN"
FT   CDS_pept        join(140677..142126,142157..142227)
FT                   /locus_tag="TA15785"
FT                   /product="5'-3' exonuclease, putative"
FT                   /note="chr2.C.cand.19 - 5'-3' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TA15785"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74076"
FT                   /db_xref="GOA:Q4UFP0"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UFP0"
FT                   /protein_id="CAI74076.1"
FT                   /translation="MGIKGLIPFLSEKVPSSISELSLECLSGESLAIDASAALYQFTIA
FT                   IRDSSYFSSLVNSKGESTSHIYGLMNRCSKLLEYGIKPVFVFDSKPPELKSKTLDKRRQ
FT                   KREEAKTDFKKAISEGDKESAKKLVGRTVKVTKDMNDSAKKLLRLMGIPVIEALEEAEA
FT                   QCAYLVTKNLCHFVASEDTDTLVFGGWFLLRNVTSSANKKIVKVDLQKVLDGLEFNFDQ
FT                   FVDFCILCGCDYCDTLEGVGPKTAYSLVKKYQSLEEIVRFKGGDYDEFKEAKDYFLSPK
FT                   VNEYDENSVKMGTIDPEGLTEFLVQENNFSKERVEKFIEKLLKFKTKKIQTSLLSFLTN
FT                   PQPTNKSKSLDEGPKQSSTEDYKVNTNPSTKGSNVYTTDTNSTKDTKGIECTATTTNNN
FT                   LENKVKIENEENDTGRRDSIDDLFKEFEDETNLFEQDEFEPKSKEYNLEKQHELELNVH
FT                   NRNVILIDDDDDEVLTTANSEKMNCEIGKVKEEPNKKGKFSLISIYIF"
FT   CDS_pept        142268..143128
FT                   /locus_tag="TA15780"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.19 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15780"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74077"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN9"
FT                   /protein_id="CAI74077.1"
FT                   /translation="MFWFHIVNQLKGLKSKSPFTNQWTNSNRVIPHYFRKNYYTTHSQE
FT                   RPQTPSYVPHKDYIYENDTYKICGVPIPDGLVQFIVLEKFVPFVTFYDIFTDKSSPHTI
FT                   LPQNNILESNIFENNKLLSTFRNQLIENMDNDDNKLSEIEKTRLKRLFDISNSHGISWD
FT                   ALDNLYLDFYTAKQEALKAWEQNKHQLIRFANEVTINRIESSKSLNQMRGSGRLIKLFT
FT                   QRYYNRWLNLYMSPFSTGMLIKYLKAHVTFALLNREKYEAVGESVSIKFERSEINPYFQ
FT                   KPIKN"
FT   CDS_pept        144034..146370
FT                   /locus_tag="TA15765"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.20 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15765"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN8"
FT                   /protein_id="CAI74078.1"
FT                   /translation="MIIKLLIINLILYIRVSKQVIRKGFAYTDTRGPWHNDVNLFHNDR
FT                   HLNSIFVDIDLYPNQFIGLHFQDDQDVDRVEPIEEGKYFVNLDELTKPVGSFRRKKNDI
FT                   KSIGSLELIKKGKDYKIYFDGSKIGDKVVKMFFELFSKQGTTKGIVQINVIPHWKYVVD
FT                   TEEKIFLGASPYKELNFFHYYKEARYGAKTELSCDWTQGETKEFEANEYTNTETTIKYQ
FT                   MIKRDSFSNIASSVDTLLLNLTNNVIYYIPGSKAVHMFTCPGWRTVIIWNYKYEKLPGL
FT                   NFLTRKTVSNYVDQSKTFIIRSDDLIAIVVPKDTFEIDCLKVFKNSFGDVVQSNEFFPG
FT                   SIYTEITETIKVLNIIKAGRYNSSNLYCKNRSESGPHVQFKIRPSCDLNNPDHLDKDGI
FT                   SCTIFLNYSNNKVYIHAGKTLSLRGHESGALTYYLDDPDSMSLKSKFKPIPKSDVNFDV
FT                   AKIHDYLELTSKKLNKFTMGQVFILLEDTQKVLKNIVRIYIHDDKAFKNVKVPKIYELA
FT                   PNKKNMKFNCKDLDPTVEYNSIIYPKGKNTVFRNIVDTVEPEKIETVQFEELFGSSGIT
FT                   ILKSPETDSDLEINFDENYDITANHLRPIYFICHMTRKTFALGYENEHKVVISVDPLYS
FT                   RVNYKGSGIREDIFSNSDNQVKNGRIVDFDLNKDKDLRFFCPDYVPEHFLEGDQDQYKT
FT                   DSLSEDTENPFKPLVRCYNRSSFMSRFFKSKSEVNILEKRTSVSELRSLWKFDIESMKQ
FT                   GKISKALCVCYNKMGKAKSAVFVHI"
FT   CDS_pept        join(146670..146838,146870..147007,147041..147630,
FT                   147661..147822,147852..148050,148086..148195,
FT                   148229..148393,148423..148552,148585..148598,
FT                   148629..148719,148784..148865,148896..149376)
FT                   /locus_tag="TA15760"
FT                   /product="mono-oxygenase, putative"
FT                   /note="all_bases.C.cand.1330 - mono-oxygenase, PF01494 FAD
FT                   binding domain, PF01360 Monooxygenase"
FT                   /note="1 probable transmembrane helix predicted for TA15760
FT                   by TMHMM2.0 at aa 7-26"
FT                   /note="Signal anchor predicted for TA15760 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.062, signal anchor
FT                   probability 0.696) with cleavage site probability 0.025
FT                   between residues 35 and 36"
FT                   /db_xref="EnsemblGenomes-Gn:TA15760"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74079"
FT                   /db_xref="GOA:Q4UFN7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN7"
FT                   /protein_id="CAI74079.1"
FT                   /translation="MSHPLKTSVLIVGSGPVGITLYLLLSRMRIPSVLVEKNTVSRSHP
FT                   RAHYLSNRSMEIWRQLGHIDKLFECFLEPLDSWRYFKYCRHVIDPQLNLYAVQDHFANN
FT                   YRYNNTYFEELSPSRIANFPQHKLLFLLKSVTLDRSQLFKHDKKEFLFWMQNEYNSILS
FT                   KFKIDNSKAEKLMKLDRPLNFPKSPISRSNSEFTTQIPFIDGGLKFEGFLEKDKFIVSI
FT                   VRNVRDGSLFNIHSLFVVGTDGIHSKVSKELFGERNVNSNVKDTSNLKEVLSVYFESQQ
FT                   LGEIVSSNPAMMYFIFSQCICVLVCQGGNPPEFVVQIPFFPEFETMDYFDEKNCSMLID
FT                   EAVGTKLTDLKIHKIKRWTVTTDVSRSFIDKETCRVFLAGDAAHLVAPAGGLGMNMGIS
FT                   DAYNLAWRIARVIYSKSLNHNLFDFNNLMEAISKNGLSEEDKILLTEYSLERKAVAEYT
FT                   RDVCLKEVENGSKFAKYLWYNHENTQTILSLLSPIISNKSRFFPILFNCIKSLMKYMYN
FT                   TPKSMDTISSFSKILFSNQDGSLGLAFPGSDLAYSYNYGDLKTSKSHRHYTPQSLNGMR
FT                   IPHCYFYSQYDSIVYKISTVDLPSLMQPPIFYCVLIFDRKMIDLVIPEIDLNLYYICLW
FT                   ETGLSVGSGSETVINDQFLSKPNTFINNIGEYNPPPIPYFNSFLILLNPLGLISPRAES
FT                   DCKVDDHFIINKMENIHDFEYFNSTLKYVSKIREGVVKEVFSSKETLDRFSKSLFGEVL
FT                   NMDKTYIILRPDSHILKFKTLSV"
FT   misc_feature    146670..146774
FT                   /note="Signal anchor predicted for TA15760 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.062, signal anchor
FT                   probability 0.696) with cleavage site probability 0.025
FT                   between residues 35 and 36"
FT   misc_feature    146688..146747
FT                   /note="1 probable transmembrane helix predicted for TA15760
FT                   by TMHMM2.0 at aa 7-26"
FT   CDS_pept        complement(join(149412..150238,150296..150881))
FT                   /locus_tag="TA15755"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.496 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15755"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74080"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN6"
FT                   /protein_id="CAI74080.1"
FT                   /translation="MTVVSCGFGKSDVNGTSDNGVSFGLNCNNKRTNSLITLPVIDTNY
FT                   YGNQFIYQNIDLEAYQNLELSNLQKLNDLGYTNQDQLSGLNSENMLSLGFNKGFNFLSK
FT                   KMTENNMNEEEAKPDNLEEAQVSENEEAFNESYPSIKADEHETSSNIDDIFRNVSIDNV
FT                   KTRPVCNIFGNCLNNKKNSYQASMNYEMFRLTGALSSFFDPPEFVDSDTVVDENLKRNF
FT                   FSKFFGVFKPKLENDLTNNFNSQHLSSILSQSSLIPDDVGCFSTCNKKLRKYVDLDKLG
FT                   TFATSTSLGLKNLYHSFPSFNQNTFTSTKSFESLPSNASNEPNNFSVSDNVKEKSFFNL
FT                   GTFRRNEDKKLKPKYKNLRPNTFRLHAVEIHQYVPLPNLPTSRFVDQKMRTEQFKSDAN
FT                   SYFANCFFNPNSTGPVAPMMNNIMNGVNNYPDLYSMNSKFQRLNTQDLSVCVMPHESSN
FT                   GFNQQNPLRLVE"
FT   CDS_pept        152797..153927
FT                   /locus_tag="TA15750"
FT                   /product="actin 1, putative"
FT                   /note="actin"
FT                   /db_xref="EnsemblGenomes-Gn:TA15750"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74081"
FT                   /db_xref="GOA:Q4UFN5"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN5"
FT                   /protein_id="CAI74081.1"
FT                   /translation="MSDEETTALVVDNGSGNVKAGFAGDDAPRCVFPSIVGRPKNPALM
FT                   VGMDEKDTYVGDEAQSKRGILTLKYPIEHGIVTNWEDMEKIWHHTFYNELRIAPEEHPV
FT                   LLTEAPMNPKANREKMTTIMFETHNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVTHT
FT                   VPIYEGYALPHAIMRLDLAGRDLTEFMQKILVERGFSFTTTAEKEIVRDIKEKLCYIAL
FT                   DFDDEMTTSSSSSEVEKSYELPDGNIITVGNERFRCPEVLFQPTFIGMEAPGIHTTTYN
FT                   SIVRCDVDIRKDLYANVVLSGGTTMFEGIGQRMTKELNALVPSTMKIKVVAPPERKYSV
FT                   WIGGSILSSLSTFQQMWITKEEFDESGPNIVHRKCF"
FT   CDS_pept        complement(join(154044..154340,154406..155463,
FT                   155496..155814))
FT                   /locus_tag="TA15745"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.495 - signal peptide, transmembrane"
FT                   /note="transmembrane protein, putative"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15745 by TMHMM2.0 at aa 7-26 and 528-547"
FT                   /note="Signal anchor predicted for TA15745 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.023, signal anchor
FT                   probability 0.937) with cleavage site probability 0.009
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA15745"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74082"
FT                   /db_xref="GOA:Q4UFN4"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN4"
FT                   /protein_id="CAI74082.1"
FT                   /translation="MKSQRLFILYYFSLIFGIFYLKYFHLLKNETNLLNLHRLKLFLNL
FT                   NPKFFKYEYVLYYDPNNLLTKKISVKLSNFLSSKGLSSSLSNLEASGLDLLSDDLPDDE
FT                   SEDSTALDKKFAIVVNYENADKKSKFNLRVKGGNTLIFTINSTTIYSEDLVQRIFSLIY
FT                   KLFFDTSGLKIKEYKPFLDLNFVLLSDKGRVSWDFTKDVLSPYLNVILSSISLFYEVNL
FT                   HSRVVSNVDYYKKMVLNSDKEESEESNEEALFELGNQDTNFYNFFEGISNIDISMKDQH
FT                   SFRHSLNFFVILSSKPTFLKDPFTGQKRDSFTIDNLGVFTFLNNRIKSDEYKLTEEDIS
FT                   ELVSTWVTYIRHMHSLPASLSEYVLWLCNLDENLMMVSDNEYFISKGPDSNNISMSDSF
FT                   ELTFDAPANVSFYRFELLKLSKIFYHCYIKGTLINLKKLSQVKKVYFNNQVPKSTAEFV
FT                   KNTFYALEHSMGHLFMQSENSLDTSFPTLVSMDMNQKALSLARFAYSQSLEALSDDQMF
FT                   PKNILSHEHNLAVFMCDVFPFVFPVFAFYLRMGLQNLKSR"
FT   misc_feature    complement(join(154077..154136,155737..155796))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15745 by TMHMM2.0 at aa 7-26 and 528-547"
FT   misc_feature    complement(155764..155814)
FT                   /note="Signal anchor predicted for TA15745 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.023, signal anchor
FT                   probability 0.937) with cleavage site probability 0.009
FT                   between residues 17 and 18"
FT   CDS_pept        join(156545..156643,156676..157213,157279..157796)
FT                   /locus_tag="TA15740"
FT                   /product="cyclophilin, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="chr2.C.cand.24 - PF00160 Cyclophilin type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TA15740"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74083"
FT                   /db_xref="GOA:Q4UFN3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN3"
FT                   /protein_id="CAI74083.1"
FT                   /translation="MKMGEKALLVIQPEYGYGKSGAGEAIPPNSVLNFEIELINFRVKP
FT                   KNKWEMSIDEKLQASLDVKLDGNNKFSQGNYRGAISMYLEGLEYLSESSEWPDESMKLA
FT                   NTTKLQCYLNLSNCYLKVSEFRDAEKNASEALKLDNHNIKALFRRALARLNYDILDGAI
FT                   EDLNSLLKLDPNNLDGQKYLKLAKQKQASYNQADKKRFGTIFSKMTLYNEKKGVRDLKS
FT                   LPKVFLEISLRDKTFKMVVALFSDTVPKTAENFRKLCQPDHEFNYKNCKFHRVIRGFMV
FT                   QGGDFTNGDGTGGRSIYGEKFDDENFIDKHTERGLLSMANSGPNTNGSQFFVTFGPAPH
FT                   LDGKHVVFGKVVEGLEFLDELENVETGPSDRPVNDVVIVNCGSV"
FT   CDS_pept        complement(join(157857..158210,158254..158559))
FT                   /locus_tag="TA15735"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15735"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74084"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN2"
FT                   /protein_id="CAI74084.1"
FT                   /translation="MNQNEPNSNLNGSDFSNIKNLKPGLKNVSLHGVIVEFISDPPQST
FT                   TELRNYRYHYKLADSSGSITLAVPHGILMDTISKLTSYVSLTSGHNASKVEQYLFSKIP
FT                   VLDLDSAPGFTIKEVQPTQSNSTKGEMKYIDSEFDEDSDWNGWSDDEESKRESLKWLLQ
FT                   PGDVIYIPSALTTWSHGQMVLVPNETKNESLTKIGKFQTQLKMEPDMSKQFTGSKE"
FT   CDS_pept        complement(158684..163117)
FT                   /locus_tag="TA15730"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15730"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74085"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN1"
FT                   /protein_id="CAI74085.1"
FT                   /translation="MVLFACYARSNIPRDLVHYKKKELEKQYVRFIKSSSHETSRAFCE
FT                   SLVEKCSIRNLKTLVALGEYGIKNNKLSVMDKTNIVQMFVLISKVRDYNCLLLYKSDLL
FT                   KILYKYAMVLKTCRPYCFRKDIPQLEIIRFSEYVVHVIDEFSNCNSYGTLPDDGIPVYI
FT                   KKFSKEANKIKSKLMKKGVKFTMGSWDMPYHRNESLNTLGDTDELIMVKSLGERTQELQ
FT                   ENISTIEAQMQSNNIFEPDSSVDESLISELIRTLSLYEFKTQNLIQESVDSESMENYDQ
FT                   LMNILDYIKHLINTLNSKMCISLDQEYIGNNLSPVSFDPFNNSTQEHNVNETSTEQINR
FT                   DESDVSTELCDISRQDETESLHQQVETQSQLLNYRMTSEESSKNISKERLEDIFDPFGI
FT                   NLNNQSSISTHRTEHLSTSVLSTVDELIDANLNKSNSEDVQYSNKKSIQSYQRSKSLDE
FT                   FAQKSMFSREKSQENRSQELDSDSNSDKTIENEESMEVQMNQFVDKKDKKLFKSKRSNS
FT                   FKSTQRKSNEFDLNNLTDELVLDDTQVECLVNNIQIPEEIEIQEDERDCDDSTKTDDVE
FT                   NMNEDISYVMNTLKRINKYLESKPPKFVANSKTYQEIQASLHTDYFDKCHTFGSDNLSK
FT                   TISEEQEKQFDQEEKTAREEIFGKELFSNLDENLYKRLSNIYLPKKNSNFPSNVPYDNT
FT                   LVKPSISSPIPFPSYSTYSINTHITNGYHTPLTINSYIPTSYNPGQTNYYTINYGSTDL
FT                   QKSSDLLDKKGICNDSKKAEIVFTKGIPSDNLKNKLIKQSQLAKRLLGGIEHLSFERQQ
FT                   ISDFEDESIFSEEELDVKNSNRSTKLSPDNFSADEENNPEHFDDFENQQEPSKFEDNIN
FT                   EYGYPILDFNEVDNESTKSGENEKIPEGIYEKFSENKEESEEEVGDAEGEDDLEEDSKE
FT                   GSLNYHKVFYNKYKSNEELSDFSFEEELKSSETSDKSSKSEDKKSRKKSHKGEKDRYES
FT                   EKSHRKEKGEKRRGKDRKESENEEKSHKSKSKSGKKHDKIKKQPTNDNDFRYQHSLYTT
FT                   SNLEGSQYDYGMPTNYRVHPAHYYNRHMVNRNHRRRSQYEDRYDPSYYEHVSATSPFDN
FT                   HTSFTDEYDSYLSESSYVHKPDPRYYASNRNMYRRDDQFGKAETTSKIVELSSTSNTDY
FT                   GSNKNMDNIGKYVKIVNDNEKFVKNFKIQENGGKKDKNEETETPKSTEEKEPEQKLDNS
FT                   GAITNSNIVKRVIKRGGDIIYQDELFSVKFKQYTRYEPVLYNENTITIENNSLFSFSIS
FT                   LDYSNFENFPINLKFLNKEFKNLSLTPEAKITQYFSTYCFGPFVGLPKLEITAHVDAST
FT                   DKKYNIYLPIAISCFFVPTLDINSLSQRYFNSDKFRHIMKNKVYFNIPKVLNLRDVLTI
FT                   ITTYGRFKILQQSDQYFYLASTFSAPFYFNSTELYKFTIFAMIEISPSYYNVHISSDSY
FT                   RLANTTSMLFKYILQQ"
FT   CDS_pept        163826..166807
FT                   /locus_tag="TA15725"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.25 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15725"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74086"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFN0"
FT                   /protein_id="CAI74086.1"
FT                   /translation="MVRLVPPFLRNIIGSPEDSQHVTANHDNKTETIEENVNINKESDL
FT                   NSFEPVDPPYFIKDEQLKGLVITSNIATIASIDWGPPKLNATLLDELGNSGKYLLDIIR
FT                   GNKTTVENLEEITKNIKNVPKVYESDFNVYLNQIEEIYSECPEFNILRDNVQEIVESPS
FT                   VAVETNIDNIPREYFEDDYNIHENVIFNKTLDEIPESIEFLESQLMQINTQLRELVGTH
FT                   LKHVGESFVCIEDLKSSFLSINDQISNVRSIFDNLKGIYNSPVNYSYFKNSKIGEDDIT
FT                   PPSSKSIDSQTNESRSYTLHEVLMLKKRVLEVLEYLYLLKGISCTPDYIQGIIEINNMA
FT                   LARVFASVAMEYFENDLSKFKITNSVLLVLKDTISNLEQVGEAKFIDLTFFTLTECYSC
FT                   DDLEKYEKELRPTLEKLEQVLVVLTISGSISDTLSTLKNTPIIPINYSTESPVTMETFQ
FT                   EQLDKVLRGFEHSNLFLLHLLNSLTCVYLFNKEGQYLPDSSKSSDIGRKMILKIQDSFT
FT                   DGINRDYQKIAETTQFLKTHLKLPLTCKSGSYSERYLEILSGFDLDDENSRCDSTTKTI
FT                   TDCDNGDSTNDEDSCVETQDKVTSDLFDYYENLYCVMEGVLVKALEKLFSNFKIETPNE
FT                   GAVTEIEPVMLSLKKVENIYKESLKNYINCPKTTEKMLAEILRNHLKFHKIQCELPLSF
FT                   VEKDLGSVLTGVLYKYISAESKKNVELIFEQSLVKVHENLNQETWVVFEKLELEGKTFN
FT                   LIHSSILLNENLDVYFGISEKFSFLSSASISKSINLFAYFSTLIENELEKNLCVKKLCL
FT                   IIQTLDFFTLSIPLKIRNLSIHTQKTGQTEENDTKDYDLLLVLGINAENCVMEAKLLRK
FT                   KSAELLSNFIFSQIKIHLINWVFKYTDLQDNTQSEDPTEDVNLVMKTISDLYSECSQIF
FT                   SVEDLRETFSDSFDKLVDLAKKQNLDFTKFDRFSDDCSRIMTELSHLSDIKLEILSLAH
FT                   RLSN"
FT   CDS_pept        join(167581..170692,170731..170841,170892..172189)
FT                   /locus_tag="TA15720"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.26 - membrane protein"
FT                   /note="membrane protein, putative"
FT                   /note="13 probable transmembrane helices predicted for
FT                   TA15720 by TMHMM2.0 at aa 13-30, 60-79, 86-108, 112-134,
FT                   147-169, 189-211, 236-258, 273-295, 563-585, 959-981,
FT                   1002-1019, 1029-1048 and 1069-1088"
FT                   /db_xref="EnsemblGenomes-Gn:TA15720"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74087"
FT                   /db_xref="GOA:Q4UFM9"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM9"
FT                   /protein_id="CAI74087.1"
FT                   /translation="MRGTTEYSRYETHLAFFMAGLSCMIINSVVDLESYVFLRFLGTTS
FT                   YDSQTISFFLRRFNLVIGIVMCSISIVYGSSVVCSEWHWMLFILYFLVSIYIYMLSNNF
FT                   ILVGKFALIPVFCISLVSNGLMIATIKYIFEGSYNKYDDNNTLSLLIFICGAFTSGILV
FT                   KLILQLSGDLKISEDENYPGLKLFNRLFVVFAVITLVTSFLISRLPYSPEDEISPKSPN
FT                   KSLRNVLYSKSRWVFIIGSLSWSFSPILNNLTLSVINDLNPLEALNLEHIQFLTSLTFA
FT                   FGYYILILVKIVNLHKKSGLPYTFYDLICKILKITHESNPEVILDKGIAEDLMSNNAIS
FT                   IRLYRGIQPWCYLQHGFWTPWEVYDCVDSARLMNVTSVKMKIAKIRGGPDFSNLDDDCL
FT                   EHKTLQDEYLEIVDAKHLLMWDITCFITQCGDILTLMPDIFHCCEQTPISCACGSASSE
FT                   CGCCTPVPETKKSHCCLTCLKNCCSEESKAKCVCFTKCFENCFCGEDCKFIECCYACDM
FT                   SKYHHYKTFVYGILVTCCHEARCLLQKISESPDLEDNLIVSRTNEVSLSILEMYAISFL
FT                   CILVYARIADEFLLIFQVMRQIALDLTKSVICFLCKCKCEGPCEPKKDEKEKEKICSEP
FT                   SSKEKEKKECKCVCTLYCKFIKCVVLLHERQNEVCKIILGLSKKSLAEELPTLSMTRSV
FT                   SLFASYFGDFMCSAFLCEESTCNCNGKGKNNCNDDNKKCPCCRYSTRIDDLLCMMYKGL
FT                   QYLSEFDGVLSTIIFHLAYFREFKLEEVNEQVVATSECTCCCKKQGNNGCQCTCSTSPP
FT                   ANCKCCLCCLCCPADNSKGCSCDCAGTPKKCCICCICCEACQTKKGGCDCCNGNTGKCC
FT                   VCCEKCPKTCSEKCACCSKDCSGCCCMCCLICKKKESERYPLLKLCENSKKNLELITST
FT                   RRCMVVQSMLDYMNKANLFRDTMKNLNRTSIGLTLILLYFISSLLLYSFCVVGNHISYV
FT                   RNVPNIKKLKYTIPFFSIITVITIIHSFVYLSDFGKDSSLIINLMILISMIISTLCSWI
FT                   TQWLTYRILLYNQFEGFYTKLRLIYTGVLTTYQPSFSWWSEGFTSFIKTDFYTMYILLT
FT                   LKNFYEYYDPFSFGFTSKLKVNYTMLQSHQYMNIQTKMGHLITSEEFVKKVERLLLDKS
FT                   KFGKKYHLKDLLDYRAFQLIPKDSYSFLTDLGDFDKVDYSVDMLYESWCKGRKMTQEMD
FT                   RLQTLREQSLKIVENFVQEEVKRNNYDRESIKKLKKFFDFQTHILTTLAERCLEDAVNI
FT                   GDKLSSIDSSILITVYELEYRKKWETYFNKIDDLVEEIVEEIEEEYVPYEKKRLMNLCT
FT                   VWKMVKTSHCLDIYSSLVCKAAVDTAMDEFQVLLLDQNNDDPVQSFIDLISTSEQTDNV
FT                   SNEIKLSKYLSHVSKTGDISELNKIKSEISSLILSNASMNKYLGSLLEGYISVCKSICN
FT                   ESNIYSYVNRNNEIIIGEWIRWQGQHITHDLIKLLSKIYTIQSIR"
FT   misc_feature    join(167617..167670,167758..167817,167836..167904,
FT                   167914..167982,168019..168087,168145..168213,
FT                   168286..168354,168397..168465,169267..169335,
FT                   170455..170523,170584..170637,170665..170692,
FT                   170731..170762,170823..170841,170892..170932)
FT                   /note="13 probable transmembrane helices predicted for
FT                   TA15720 by TMHMM2.0 at aa 13-30, 60-79, 86-108, 112-134,
FT                   147-169, 189-211, 236-258, 273-295, 563-585, 959-981,
FT                   1002-1019, 1029-1048 and 1069-1088"
FT   CDS_pept        complement(172265..173338)
FT                   /locus_tag="TA15710"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.492 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15710"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74088"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM8"
FT                   /protein_id="CAI74088.1"
FT                   /translation="MNLVTSGIILYSFYICVCMDPDGSEPEKSDSGIRLYGDGDPVFTT
FT                   TLKLTPEEANILKDLLVSYQECVSKSGSKPSDDPKPDLGIIRRDGDGNPLFLQTHEVTQ
FT                   EEAEILSWLLKNHDPKQDPSAPPEERPPPYSPGPYLTPGPSAPPYPIETPGGYGGYMSQ
FT                   GPYGQPSGAGYGAPGYGPYFPGGYGQQTPGTYPYPYPQQGPYGAEGATGGYGGGATGGA
FT                   GGYGTSWGQVPSAPEADPSGPSGVSTPGAGGLRLVHLDAKVENECGLYEVLEYNLPGKG
FT                   GKHRRYKPNCGFGIRMVTYAGVVVWKMDGQHHATEVTLIGVGTGNKKIDVKLSNGTRVR
FT                   FKRGGKDKQWKRDIEKQ"
FT   CDS_pept        complement(173922..174929)
FT                   /locus_tag="TA15705"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.491 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="Signal peptide predicted for TA15705 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.600, signal anchor
FT                   probability 0.030) with cleavage site probability 0.264
FT                   between residues 18 and 19"
FT                   /db_xref="EnsemblGenomes-Gn:TA15705"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74089"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM7"
FT                   /protein_id="CAI74089.1"
FT                   /translation="MNLLTSGIILYSFYLSTCMDSSDSDEDGDGDGDSMLPPHQRSPMF
FT                   EGTLGESFTGGYSKEELESKFPKMRMGKGPKDKGPAKPKPTPGPVKDTMMPGDQEARGA
FT                   SGGPGTYPYPPQGYPTGGYPPQATGGYGQPGPYQTGPYPYPQGQPGPYPVQTPGGYGQP
FT                   GKGPAYPPDPYGASGGYGPPGHGPAYPPDPYGASGATGGYGGGASGGAEGPGQPTGPPG
FT                   PSSGPPTQAPDGTKLGPVDAKTAKNGEHVNVDEFRAGSHDHRHRRITPKHGHGFNRVNY
FT                   DGLRVWIMDGFKYATGVLLFPLGFGEKTLVITYSDGSKKTFKKRGNAKPWEEKD"
FT   misc_feature    complement(174876..174929)
FT                   /note="Signal peptide predicted for TA15705 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.600, signal anchor
FT                   probability 0.030) with cleavage site probability 0.264
FT                   between residues 18 and 19"
FT   CDS_pept        complement(175343..176524)
FT                   /locus_tag="TA15700"
FT                   /product="26S proteasome ATPase subunit (Rpt6A homologue),
FT                   putative"
FT                   /note="chr2.cand.490 - AAA-ATPase, proteasome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TA15700"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74090"
FT                   /db_xref="GOA:Q4UFM6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM6"
FT                   /protein_id="CAI74090.1"
FT                   /translation="MNNCLGLQSYYTHLIEDYQALLSQKLMTKSRLEAQRNELNLRVRE
FT                   LKDELHSLLESGSFVGEVVKSMCNDKILVKISLEGKYVVDLASDIDVSLVTPNTRVALM
FT                   SDSYKLHKILPTKVDPLVALMKVEKVPDSTYDMVGGLEEQIKQVKEVIELPIKHPEIFD
FT                   SLGISQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKYIGEGSRMVRELF
FT                   VMARSHAPSIIFMDEIDSIGSSRGDGSSGGDSEVQRTMLELLNQLDGFEPFQNIKVIMC
FT                   TNRIDILDEALLRPGRIDRKIEFPNPNAEGREQILRIHSKKMNLLRDIDLLEIAKSMSG
FT                   CSGAEIKSVCTEAGMFALRERRVHVTNEDFQMAVVKVMKKGEERGMSFKKLWK"
FT   CDS_pept        complement(176980..177507)
FT                   /locus_tag="TA15695"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.489 - signal peptide"
FT                   /note="secreted ptotein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15695"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74091"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM5"
FT                   /protein_id="CAI74091.1"
FT                   /translation="MNLVTSGIILYSFYICVCMDPDGADGGNNPPGDNPPPSRPAKCTL
FT                   LPTDDEAQGALGPPVCTPGDCGPHPHAADGTLLTPVDAKNVSNNRHTFFCKYTGPDKKS
FT                   HHELKPGHGCGFNSVSYGGEQVWEMERENYGTGVDVHPIGDSHKTLVVTMKDGSKKIYQ
FT                   KRGKGKPWEEKN"
FT   CDS_pept        complement(177908..178915)
FT                   /locus_tag="TA15690"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.488 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15690"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74092"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM4"
FT                   /protein_id="CAI74092.1"
FT                   /translation="MNLVTSGIILYSFYICVCMDPDGAEPEKSDSGIRFYGDGEPVKSD
FT                   MMPTEEEAKGALGPPVCTPGDCGPPTPGHGTPGYPSEAAEGYGTSDYSPYVPRPYGQSS
FT                   PGSYGAPGYGYYVPGGYGTPRHSTTQGYRTPVYCPCFPGPYGTPGATGYGGYIPQGPYG
FT                   ARHSYYSPGGYGSPRYPTQPSPYRATSGNGAGASGDAGSPGQQTDQPSGPPTRAPDGTK
FT                   LFSIDAKTGSNCSNVIVKEYISGRHNRFHRRLNPKPGFGFNSVSYNGVSVWEMRVDKYA
FT                   TEVFLYPLRSPQKTILIMLIDGIIKTFKRKGKNKPWKEKDVNIRGELFIRQALS"
FT   CDS_pept        complement(179384..180154)
FT                   /locus_tag="TA15685"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.487 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15685"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74093"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM3"
FT                   /protein_id="CAI74093.1"
FT                   /translation="MNLVTSGIILYSLYICVCMDPEDGSEHESAVVDGDDATEPPPYET
FT                   VVQNPNPPPYHHGYHFVHTHTSGTDDDDPPPPYTPEPQNYPLPPLNQQSQASYTYPYYS
FT                   PRSVDSRSPTGSDATPDYYGSSLYGQGATGYTPSLSTTSQAASDQLPPDELQLVDLDTK
FT                   SKCSSNSTLFSTHLIKVKGMIHKYSPKEGFGYKKITHGNVVVWSMENGIYATKASVIGV
FT                   GFGSKQITIELINGITINLKKRGHKKEWVQVTPR"
FT   CDS_pept        join(180707..180745,180859..180975,181025..181651,
FT                   181872..182231,182277..182407,182440..183184,
FT                   183242..183397,183498..183569)
FT                   /locus_tag="TA15680"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.29 - hypothetical protein, PF00481
FT                   Protein phosphatase 2C domain"
FT                   /note="PF00481 Protein phosphatase 2C domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA15680"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74094"
FT                   /db_xref="GOA:Q4UFM2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM2"
FT                   /protein_id="CAI74094.1"
FT                   /translation="MKRSINNFGPKWKKLKQESGKLVPGSKGILISCSITGKHKDAMQE
FT                   ILYILRQHSERFHPDASICSRNVDHVDKEMLLKSELENLNQEFNRFVPGPCISKGLDYV
FT                   YFKKIEDTPSKYVSEIFKEIKNNKSYSARFLSRIVPVDYICEAKEEDLRCTLKSLISKE
FT                   FPLSLANSCKVTKLKEPSTDEDKINNESEDKENYNSRKEDEESDKMESMVTWALEFKRT
FT                   NSNALGREQVLDIVNELMGKEYKVDLKKPEKLIIVYVIKNNGLEIPEDGEWVICGDSGE
FT                   DSKWYTHESQKWMYNSEEHVYFHIESQTIIPDLKYFETKNEENYPDHDYLYEDVQYVDE
FT                   NVEYPDEVGDSNQLESDLENDSEDFSMDFNKDLIAGTESRKGNLETKIENEDRFITREC
FT                   MSIQYLTDSKALCYFSGVFDGHYGPKCSDYIVKHLKNNILTVFLQNIQCSSSFKKRKLF
FT                   STGNANFSINEFPSNTNNETLDEEDQEDAIEDNSSTNKGSNELSDEVNVFLYSISKGVQ
FT                   MVDNNFCSYARKEFILDGSTLNLAFFYGPDSFGSLKLILANLGDSRSILCVKEGDKYVA
FT                   KDLTREHKPDDKLEKERILKNKGFVEHVQGCWRAVLRKGNRIVCAISTSRAIGDFILKS
FT                   PNNIISSQVDLYVHDVDFDNFIFLVQCTDGITDVLTSQEIVDFVMNCINSGYDPKKAAK
FT                   ILVDKAESLGSMDDKTCNIIYFGWQKEVFSKLNSDEEENEVKSQELKQEEEDIF"
FT   CDS_pept        183734..190177
FT                   /locus_tag="TA15675"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15675"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74095"
FT                   /db_xref="GOA:Q4UFM1"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR032302"
FT                   /db_xref="InterPro:IPR040007"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM1"
FT                   /protein_id="CAI74095.1"
FT                   /translation="MEKGKPRIKRKSIDETEKEEPEKVNQKLQKEPQKNSKRKLDTDSK
FT                   DEQHKNITTEGRRKSESLEVPEVSKSSRNPSQEKELESYSTNTDHKKTNHPNTNGPGGP
FT                   DYKNTRLVESTNSQSNANSSKITSRTLSTESKRELYKNSQSMVDKNVLEMLENFEDEVD
FT                   LTLFKFVSSVANGTINPVTSVDALRTKFHGVSKNSTLVFKVLDLVSFFLDDTKKRQNLL
FT                   LFLESLENFGLVSSMEIISVIDPAKLDSCNYSEGLVKISIRERTKNNYVLKIYNLFRES
FT                   YHGYTALSNYLSSLVDKHGRNGLRFDVVQRPKQAQNKLKELDPDTVVATVNKISGMYKL
FT                   CPIRTLYEVLKWLVLTNHSDEFVMKILKSYPSKISYVVLLYLKNNYQNKDKLLRINNNK
FT                   QLIKELEEKNEKNGKLDGKNGKLNEKNGKDEKNLENVNVNENLNGYSNDNIYKIVGMLI
FT                   SEKLLKIDVVYNYLDPSDELLSNISNHFLNILKTSPNKDTRDNLTIPIPLLKKLVTSHL
FT                   NLNCLNPKYKRSTRMKEEHMSTRMKEEHMSTKLDKEHMSTRMKEEHMSTKLDKENKIRK
FT                   TSLTLLENMINKYESNDYSILLRIDNYHYLKECIYLMESGKFLVLSTLLNQCTDFEGEL
FT                   WDICYSYILHLYTINYPIFLNTSVTVSLTNIMNKILNTSVVYRNIPEVSRGIDLDNELI
FT                   IIKKLEYYLKFVGFRCSENIIMFNNILTYLQIILTKINKHTGYSSLSTVDSDLRSSDSN
FT                   LRTKDSSLSTEDSDLKTCDSNLKTVDSNLKTRDSNLKTRDSNLQALNTEDKHLIVKRMI
FT                   KKLLYKYIIFSIMNCCEGNFQISDRIWNILKQFTTLERYQIYSKTLQILNSKQQINTEK
FT                   MNIEQINEKMETTGVNTNSEGVSTNSVGVSGTMNTEQRNKKIWNRLVNLYYNYQMDMIK
FT                   KLYEGYNYKLKNIFKKITFELLKSIKSPTIRSIVSIITAISAINPFSVSILIIKQSELF
FT                   NNLLLPLCELTKYFLSYTIDIFIYQLTINLIYLTNTSTNNTTGKLSSIIGTGTVTTNTM
FT                   GTSSTMGTAGASTVTYMKEYSLSKNRLEDNNNIIEEENNKMYINSIILCKIYKRHTECD
FT                   IIPIITILILLLNFSISNHLILCRTNQTNILNHTMDTGDTKDNGDSKDNEDSDGVGMST
FT                   KGVSTKDIKDGKDSKDSSKGSMSNVSTLVASTVTEGKGANSMGMECTTENNTNKIAIVT
FT                   NSRESSTFSVDSKDTKEAPLGAVSTGCREPHSVTEIKIIGICIENYYNIIYIIYNVLDY
FT                   LIRLIEIIGGMIDVDMNKMTQEQLLCQCGSYSLKNESITNLDEEINKKSLIKVICRPFF
FT                   INSLVIVLGRLINELLYDSNFNNCKLLLSIVDKFNNLLILLINFLQLNQQTFLLPNKQL
FT                   LMKFFTLNQLQFINTVKCTEIETTVEFTKPVTEDREPGSTVGSESTVEPKSTVGPKSTV
FT                   EMKSTLDPKNTLQPKSNLQPPSSLDPKSNLQPPSSLDPKSSLDLQPLRFKRKLEFPTVD
FT                   NILDDNFIGFINNLNIYDIYTPVEQYDNYITKLTSGIGNTVRRIKRIKNRITILETDKN
FT                   EHIQHTNMILSHLKEVLKRFVKNDNKVGPHITMRFITRIIFPRLFVSELNALFCCKIVD
FT                   TILENKMNYFNYFDFVNCYTKMLIPMISSLTEREVISLSIFFNHSFQLIKAWVNDRDAF
FT                   EKLVYDNPCFCTTFKFQPNKEFKYQQLLQVIKKWEYFILLSIFSSVTGSGQTATNINKV
FT                   NSTNNSNSIKDSSSTVVTSNKDSTSNKVNSSTVVTSTSNTKSTTTSNKDSNTKDSKANK
FT                   DTNSIKGAPFGAGNKDSKSTSSTMGSTMGTTTGTAGASTVTGTVTDESPIVQSWIEIKN
FT                   VIIFLNKVSNNFPITINSSLKVLNFLKNVLKLAKQNNWQDVTVSSNTLIKLIQMYQNQN
FT                   KYITINIPNINTPGQTSTNSSNSSNSQANSTSNPITSTPTNTSTNTNTPNNPSKNTNET
FT                   TSRRNSDTSPKISEETTKRNLEESTKGSDETTKRSSEESPKSNSKETTVKNSKETTPKN
FT                   KSNETSPKKTKETTKTVSKELTKGNSKETTKGNSKEPTPRTTAKETTKTTTNTHTKTTG
FT                   TKETPKTSKETPKTPSKDTPKSTTKETPKTTKAQTTT"
FT   CDS_pept        complement(190224..190799)
FT                   /locus_tag="TA15670"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.485 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15670"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74096"
FT                   /db_xref="InterPro:IPR014810"
FT                   /db_xref="InterPro:IPR039883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFM0"
FT                   /protein_id="CAI74096.1"
FT                   /translation="MNENLEDNSVVNLKDEIDLKLDLNNYLSDQTNTNLNTNNINLNNK
FT                   LNNKLNKKEIEKNWFNISEKEVTPAVMREWKSIQLRGFVDPKKFYKNSKKLENIPKQFQ
FT                   LGTIVTNKSNIEDTVNNVTGITKSRNTSGIKSRNIIKKTRVRKKSSLITSTVKESEWVS
FT                   KRYRDIQNEKTSGRKGWYQRQVKKRKKT"
FT   CDS_pept        join(190929..191024,191156..191424,191575..191630,
FT                   191662..191715,191855..192953,192983..193038,
FT                   193275..193414,193451..193614,193644..193780,
FT                   193928..193990,194103..194347)
FT                   /locus_tag="TA15665"
FT                   /product="cathepsin-like cysteine protease, putative"
FT                   /EC_number="3.4.14.1"
FT                   /note="chr2.C.cand.32 - PF00112 Papain family cysteine
FT                   protease"
FT                   /note="Signal peptide predicted for TA15665 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.663, signal anchor
FT                   probability 0.260) with cleavage site probability 0.331
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA15665"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74097"
FT                   /db_xref="GOA:Q4UFL9"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR014882"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="InterPro:IPR036496"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL9"
FT                   /protein_id="CAI74097.1"
FT                   /translation="MLFKVCKLKYFILLFIIIISHVKLDLPIHTLTKDVIGIWKIYETE
FT                   LYDKFQNCGSTYPNKNIENLKIDNFKEYLQEIYGELYVKFIELSDERFFNRTLLYPRNT
FT                   WSYFTIKNPLNNQILGHWTLVYDEGVMIDINDKNYFGYFKYNNIKNNECKQITQNIEDE
FT                   YGNIKCYVTDSNRLQIGWYSKKINNNYKFGCFYMEKLKYNNNKNYIIDLTFNTTHNELE
FT                   FSTPTEFSTPSQFSPNFPPTNPNSPNNKINTLNSLINPINPISTNWKNNINNPIDPINM
FT                   IWKNKLGIGYENISPLRFIQLCKGVNYQVINNFNTSVTVTGPPNSSNRTNGTSTEDTTG
FT                   ASTVTEGNSTIQIAAPKVGTSTTNTLGKGANSTLMECTTTNNTIEEKNINTIAVVTKTG
FT                   ESGTNSNTHTDTTGKGVNDTFNSPGKGANYTFDTTGKGANSTAMECISEKNLNEIAVVT
FT                   KTRESSNNSKDVTNDIKHTEDGEEVVTKGPLRTVGTKAVGMVGPSGSVGTACRGPVTVT
FT                   EKSFPNNWTWGDPFNGLEEDIYTTSQGECGSCYIYSSLYVISKRYQILFKKLYPNYNWK
FT                   LKQFQLSINDILTSPYSQGCYGGFLMLVGKHIKEFGIHSDNRIEQNNQIEQIEQIEQIE
FT                   QFNDQNDNKWYIENYGYVGGCYECTNEINMMNEIITNGPIAVAIYSPIQLFYYTNGIFN
FT                   NNYKHGIICDLPYNNLNGWEYTNHAIIIVGWGIEIINDEEIKYWICKNTWGKNWGIEGY
FT                   FKIKKGINLCGIESQAVYFDPTLIKGLSKKLIQIYNKIK"
FT   misc_feature    190929..191000
FT                   /note="Signal peptide predicted for TA15665 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.663, signal anchor
FT                   probability 0.260) with cleavage site probability 0.331
FT                   between residues 24 and 25"
FT   CDS_pept        join(194524..194799,194923..195034,195542..195870)
FT                   /locus_tag="TA15655"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein, zinc finger, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA15655"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74098"
FT                   /db_xref="GOA:Q4UFL8"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL8"
FT                   /protein_id="CAI74098.1"
FT                   /translation="MESARDITILKDEKSEFPILCETCLGPNPLIRMMKQNMGKECKVC
FT                   ERPFTIFRWKPGPKSRYKQTIICQICAKIKNLCQTCLFDLQYGLPIQVRDKFMNNPIEL
FT                   PDSNKNLIYKLNNIQTNNEPQIDPHNEEILKRISRVAPYYRRNKPRLCTFWIRGICNRG
FT                   EECPYSHEQDSFDPSLSKQNILGRYKGKNDPLALKIFKQLELERDNERDKEKENEKGSE
FT                   MEYPSMNPTEAIKRLN"
FT   CDS_pept        complement(195940..196266)
FT                   /locus_tag="TA15650"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA15650 by TMHMM2.0 at aa 10-32, 39-58 and 62-84"
FT                   /note="Signal anchor predicted for TA15650 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.997) with cleavage site probability 0.000
FT                   between residues 37 and 38"
FT                   /db_xref="EnsemblGenomes-Gn:TA15650"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74099"
FT                   /db_xref="GOA:Q4UFL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL7"
FT                   /protein_id="CAI74099.1"
FT                   /translation="MKFDIKLLEFYSNIFDIIFLLITLLFYLLFLFKLNFTKLKFNFIF
FT                   FLSIFKFLLNFFLFHKFNFYISFLYNFIWFIIFKGYNNLKPLHMISHTNTNTTTTTHLT
FT                   HKLH"
FT   misc_feature    complement(join(196015..196083,196093..196152,
FT                   196171..196239))
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA15650 by TMHMM2.0 at aa 10-32, 39-58 and 62-84"
FT   misc_feature    complement(196156..196266)
FT                   /note="Signal anchor predicted for TA15650 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.997) with cleavage site probability 0.000
FT                   between residues 37 and 38"
FT   CDS_pept        join(196478..196625,196662..196704,196796..196889)
FT                   /locus_tag="TA15645"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.35 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15645"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74100"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL6"
FT                   /protein_id="CAI74100.1"
FT                   /translation="MKKINIIEEEEDYGNINVEEEIDDINFEESDEELPIVINEDEFIK
FT                   QFTINEKTKSPSPPRKVINELDIEDDIVYRDKYGKRITRDQWLLLNQVK"
FT   CDS_pept        join(198517..198607,198742..198857,199016..199078)
FT                   /locus_tag="TA15640"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.36 - hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA15640"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74101"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL5"
FT                   /protein_id="CAI74101.1"
FT                   /translation="MFSYDIDEEYDEELKEKLRWNDPINQNIIQQNDIPKCRYNMVPNR
FT                   FNIEPGYRWDGVIRGNNYEKRWFEARNIEIAKNKESYLNNISEL"
FT   CDS_pept        join(199420..199591,199622..199936,199980..200070,
FT                   200193..200242,200319..201373)
FT                   /locus_tag="TA15635"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.37 - hypothetical protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15635 by TMHMM2.0 at aa 91-109 and 239-261"
FT                   /db_xref="EnsemblGenomes-Gn:TA15635"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74102"
FT                   /db_xref="GOA:Q4UFL4"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL4"
FT                   /protein_id="CAI74102.1"
FT                   /translation="MSNRLIYNLRLFNKFNKNFSTQINKNIKLTNKNNLPINNLPINKN
FT                   NLSTEKNINILKEKNIKKNNQQFVKELYEKNIYILNLKRLRPFLKFLLYQSIPIFILMF
FT                   LYKYFEEKKLKSIKPILTEIDLIKHIINTLKNSTTILINKNNFIFINQTNFTNLLQTIS
FT                   NNKLYELQLYIQDYNEELNNIKLLTINRNKYTYIIFEGKLKNIENNLQIIFILLLIKME
FT                   SGQFYNKIIKLINFKKIILIIILIIILIIILIILLIIFSILRRKSINVMVIGPNNSGKT
FT                   SFVYKFVNNKFPLTVTSQKNNLIQIFINNKRINLYDVIDIKFINNCKYILLLDSTCRKS
FT                   IKQFSYILFQIINYVTGSSVTGSSITGSGTRKSIYNTNITKVNSSKDITVVPGTNTLTT
FT                   GTLRPSTVTEGKGANFTAMECTIGPSTVTEEKILNKIAAVTNFGESDTFSVDTNTNITK
FT                   GISKAPFGAGTVGTTGAVGASTVTALIICNKNDIYNSKNINEIERIIMLELELLSTESN
FT                   ELNKFLCNLTSLKDLERIGISINLMSYSIKNSNLQEIKEFIMK"
FT   misc_feature    join(199720..199776,200405..200473)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15635 by TMHMM2.0 at aa 91-109 and 239-261"
FT   CDS_pept        201674..207469
FT                   /locus_tag="TA15630"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="hypothetical telomeric sfii fragment 8-like protein"
FT                   /note="chr2.C.cand.38 - htsf8"
FT                   /db_xref="EnsemblGenomes-Gn:TA15630"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74103"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL3"
FT                   /protein_id="CAI74103.1"
FT                   /translation="MGSEILTQSTGTGTSAGQVSQSPITESQPKSSSSATDQSSSGSGT
FT                   EGTVVTKSVEPTKVTLDINSSQGTNQFDYTKSDKINTFRVKDGHVFSKVTKGTTDIWDS
FT                   KGGECGTKVIFIDENKKYVSILLTNNMFLLFHLESGQWKDITSTKHDITRLKFFGDNDA
FT                   TLCQNDYDVTIADYSYRFTLKAGVNCKKIKYADDDLWKDTDDSEFAEITAFDLGLISNS
FT                   FFVKNKTKFKKLDFNPTQAKGGPVTPEGEAITATSAQQTGSVILAELPPEKASVTVLSP
FT                   TGRPRPSKTPEVSTGSRTAITLNIGERESNSAIEFKEDYLKNVTVFSAKEKYVFNKIIK
FT                   TGGSNCCGSRCCDSETVIWQAKDQTEHFHTVYVDGLGTFSSTSNLSLHLCNGTFKHFNK
FT                   PSCGNWTPSPGVVDLDLKISNSNIQVDFFQKDNFRIYVAKPGYTIRKVVKKDTNIWAAK
FT                   PDDHALKVVLMGSKKEPKHLAVLKKSGGLTLLSKIGKGEPWEDITSSKNKITDLKMYAM
FT                   ADDKETVELHRGHYSITLFNGFYGYVFYDGVGCVKVTHKGKNIWDLREEGDFGCLKGVF
FT                   LDLKSNKFNVMNDDDRCWVCEQVRKVNPVTLDVSSKASTDDFDFTIDHNRNIMVYTSKG
FT                   NAMFYQVIKKSSTNCCGSTCCDSETVIWETNDPKGYASKVFADGVGACSSTKNVSIYLL
FT                   NGDILHFGKGGRNKPWKPSVHKIILDVDKTSSTIGYDFVHHGETRTFTVKPGYQFKTVK
FT                   LGSSWKWLVCGSSCCNSGCLGDHIFWEAERDEEWSNMVTVYGVETNVKNVNIFLNNNQV
FT                   KHFHKADKKWVSKTTIVLNIEKNTDNDLFEYRSTRNFGHFNPKPNLTITMIVKSTLKIW
FT                   TAEPDDHGLKAVLMGSGKDEKFLSILLQSGNFVLLRKCGKGECWEDITKEKSDFSGIKM
FT                   YSLEEGTSNYHLLTENDYDAIIFESRYGYEFKDGVKCVKITYNDKLLWSHTDDPEFGYL
FT                   KGLYLDLPKDQFSVTNLKDQTKQLTKAKVTKVTLDINKKVSTSDFEHSESHDFHKYTAK
FT                   FCRVFSKVVQDTTDIWDSGDDVFGTSVGFTSKDGQNYVVVLLDNGNFKLFRLDAGNWTD
FT                   ITSSKFDVKMLEFYDKNDNELTSSNYTVELLGHSSCFTISYVFDRGPKCTTVSYGYDIV
FT                   YFKNMFSCYKTINRFDFNPVSNTFYAVKNCCDWRTIDYKPPHSRTKVTLDIDKTETTEH
FT                   YEYFKDDDCEKYSAKTGCVFSKVSKGTTNIWESIDDVFSTLVRSKTKDDGIYLAVLLTN
FT                   NMFKLFHLESGKPWADITSERHDVTKLKFIDESDTELKASDFKVTIVDYAYQFTFKSGV
FT                   SCRKIKLEEYDVWKPGDDPKFSTIRKFQLGLISNSFFVINNNNESKKLEFKPTPETAVV
FT                   ITKVSVTKPAVTHVTLDIDKTESTNEFDYTDQNGVITYAPKDNHVFSKVSQGTTDIWES
FT                   SDDVFGTLVRTKTTKGVKFLVVLLTNNMFTLFHLDGNEWKNITSDRHDVTMLKFLGEND
FT                   AEITSSDYSVSIVDLSFTYIFNSGVKCKKIMLADDEVWNHTDDAKFSDIKSFSLGLASN
FT                   SFFVKNQSDQVKKIEKEAEIPEPEAPEETKPATPPVTTPETKPVTPPKAPEPKAPEAPP
FT                   VTEPTPVAKPVTKPVISLKAPTPEPESVVTPVARPFALDIEKTESTSQYNYTEHNGVVT
FT                   YSVKSWHGFNKITQGRTVIWESTDLCGILVRTKLFSNNERFLAMILYNNTFKLFSQSDR
FT                   DTTWKDITNTRLDVTKLKFLSHNDRGLRNVDFTVSLVDFFYSFNFRNIVKCRKVMYANQ
FT                   DVWIHTGYRDFSEISTFYFGIISNRFFVRNKYGRFMKLEKKLEVSRTAVPTQQPAEPTK
FT                   QQTAETEQQQPAEPAEPAEPTQQATSTQQSTEAEDSAQAESAETDTSAQPAKPNQPA"
FT   CDS_pept        complement(207923..210118)
FT                   /locus_tag="TA15625"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.482 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15625"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74104"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL2"
FT                   /protein_id="CAI74104.1"
FT                   /translation="MDAYKGLTGLTQEQQQMVTAVVDAYKQLKNIYDGMINLTKLITKA
FT                   GTLKTTAQGHSGTELQPALSAPASELATLAGLLSNAADGLSTDLALQSLAGSLKEAAKK
FT                   DTGVPDTSLHTKATELSSKQDYDNKAKPVIVAFDNVKQKYDELIKAAIANNKLSLVQDV
FT                   EKAFENLKTHYDGMMPFTKIKYYSEKISSGAETLRGGRGDADTIVKYFDSMEYAYNKLN
FT                   SEEKKKVKTQFDPLKEEYYLMLKFTKATKLRVLAGAEESEGLLALADTLYKAAKQLNSA
FT                   VHTDTTDAAKVLQQKAGKNQDTPGTLRYLAKELKSAALGLYNALKKAGTVNGKREALLL
FT                   EKVVGYSESAEGLRKALADLSSNPTQHLQGVKRNYGHVKNKFAAVKRLKDSAYKNFQTQ
FT                   YQAVEAAWNNFNDVYKPEGLLKDAVGTNEQDSEKLRPKLKALGEHHEVTDPEELKRKAS
FT                   AVKQQYDIVKDLFDLVKAQAATYNADPAKTVPYGRVVKAWDDFDKVYKANLKGLANALT
FT                   TAVGENDRAADSLQKTLKELKDNGGDEKAQDVIKKFNAVAAAYDKVKELETTYKNIVAT
FT                   QTHYDNVVSKFTELQEDKKLKDAADTLSGQAGTLSGNANTLHGELQKLGTDTAAQAARD
FT                   KVNKLKNAASKSGDGEDQKGLEQLLGDLNGASGPAVVAKAKLVKDKFADDFAGTTVQKA
FT                   YNAVKDDPTASGNAGFTAVRDAFTELQTEYNKTKQPY"
FT   CDS_pept        complement(join(210361..211275,211337..211369))
FT                   /locus_tag="TA15620"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15620"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74105"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL1"
FT                   /protein_id="CAI74105.1"
FT                   /translation="MVVKWLVRYRVLVIQAGSSSGEGLRGKADALYQAANNLYSAVHTA
FT                   GNAAAAKVLKYKAGAEPTKGLRKLAKELHSAAQALATAAKGDDGKAAENLATAVGANET
FT                   DGNLRQKLRELAEASSDLSNKAQAVKTAYEGSGDTGVKQKFQLVQTKKTEYDKNDTAKA
FT                   KYQAVEKAWTAFNAVYNPEAQLKDAVGADDTGPDGEPTTLRQALYQLGSAKPLSSGLST
FT                   KAQNVKNKYGSDWGGVKQKYNNVVKQADEYEKGGDTIKGKYDTLKDAWKTFNNPYREAI
FT                   YIIVNLQVNLLPLETLISKTIPHLVVNSRKKPTN"
FT   CDS_pept        complement(join(211456..212096,212148..213098,
FT                   213277..213327,213439..213541))
FT                   /locus_tag="TA15615"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.481 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15615"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74106"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFL0"
FT                   /protein_id="CAI74106.1"
FT                   /translation="MNKRKLDKSNLIKKLKIIKSNNINPTNINNNINNKLSNEFQGALK
FT                   FIPQQLLVNCYKINIENIIFKNKFINFKITHKNSSIHENINKINKINNFNNLNKNVNNL
FT                   ANKNNFLKNLDNDRLKILLPNTLILKKKFDNSYPILSIDFGNRIGLSFNYFNEIELFNI
FT                   KFTNYQQTTQEIIKIINYIKYKFIIHQIFILLGFPFIPNLYHTEWDVLGNIIERDVERD
FT                   IVERDVESDVLGNRKYVYTDLRLLYQILFTLDFGLYLAYYVNTVTGSPVTGSGPTGTPT
FT                   GKRANNTFSTMGKGANFTAIECTMGKGANSMPMECTSERELTTAMECTTKDIGAVGAST
FT                   VTDVTENFITKCIYCKLFGNKKCIFGGNCTSEHFTTYQISLFNFPNTVLGQADSNGPKV
FT                   SSSTTGTIGASTVTPGKRANYTFNTLGKGANFTAMECTPGKGANFMGMECTPGKRDNNC
FT                   TPGRRANDTFNTMGKGANFMGTECTMGKRANFMGTECTMGKRANFMGTECITSKGDPFR
FT                   GGRGPDTVTGNKDNKSSINIYKNLMNIKENFIILPNKNNIFNNTRSNNILLYQNIKNKL
FT                   IKSIQ"
FT   CDS_pept        join(213707..213900,214036..214144,214266..214649)
FT                   /locus_tag="TA15610"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.39 - hypothetical protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15610 by TMHMM2.0 at aa 40-62 and 72-91"
FT                   /db_xref="EnsemblGenomes-Gn:TA15610"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74107"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK9"
FT                   /protein_id="CAI74107.1"
FT                   /translation="MNLNNEKLDINDKDWPIFERHLTKWITDNSRNLTTEETKYFKNAT
FT                   FISITTGISSGYITHTIFNKLNVIPNIISRRLISIFTGLYTSAFTLNKLRKKIYLKLLD
FT                   SNGPAGNASRKILKSTKELNLTNDISPIYLPNYQNKLNNRNLQDNTYTNSNNNRNSRSM
FT                   SSDRSNDGVVGDKGDNTSDRIRLDNTSDSIRLDGTGDRDRRDGNDYFIEYENKYKTWDD
FT                   IRNQSN"
FT   misc_feature    join(213824..213892,214055..214114)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15610 by TMHMM2.0 at aa 40-62 and 72-91"
FT   CDS_pept        complement(215484..216041)
FT                   /locus_tag="TA15600"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein, conserved, pfl0490C"
FT                   /db_xref="EnsemblGenomes-Gn:TA15600"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74108"
FT                   /db_xref="GOA:Q4UFK8"
FT                   /db_xref="InterPro:IPR010591"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK8"
FT                   /protein_id="CAI74108.1"
FT                   /translation="MLLSGIRYSLNNIKLNDIMKLQLLKKLSSKDIIEIWKSKNNEKIY
FT                   STVMNSEKYMKIKTNSKICKNFIIPIKFNENYYNIFLQFNEKIILFTSLDYIHKFGIKN
FT                   TNPIIYMTFYDELVKTHDLILLRTNILNNHLNKLQVINLIENTLKFYLDFNLFQWVKLF
FT                   NLNPKQFNYKQYLNQNKHIFNI"
FT   CDS_pept        complement(216574..217206)
FT                   /locus_tag="TA15595"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.480 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15595"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74109"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK7"
FT                   /protein_id="CAI74109.1"
FT                   /translation="MDLEMMKGMYCNLEYQQKKIWETYEEILNTINLQEQIKQLQIQNQ
FT                   QLINNNKQLIKELNEKNLEINKLNDEIINLQNQLENNNEQLIKELNEKNKEINEKNEEI
FT                   KELNEKLEIIKYAGNIILITHNKHLKNLLYTINKIIYTIEFNIPNTNTNNNNTNKNIIN
FT                   NIINNNIINNNNKIDIVVEKNNIEMLIEINYKFVKLSLEIMKLLSKN"
FT   CDS_pept        complement(217303..222231)
FT                   /locus_tag="TA15590"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.479 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15590"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74110"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK6"
FT                   /protein_id="CAI74110.1"
FT                   /translation="MKELKVLEDIIGLKFQYYNTINLNSSVTVTGPPDSNGPGTTGTNS
FT                   TRDINTLNNTNNTKDINTSNNFSEENSTIQIAAPKVGTTEDTKGSTTTTNEDIGTVGPD
FT                   TVMGVIILNKYNIIIIYNKNEIKFYNINNIINTLQFNNLLFKLYFNNIINIITPVTVLA
FT                   PTATDVPGTKDTTMGKGANDTFTTLGKGANFTAMECTSEKNSNEIAVVTKTGESGTFSV
FT                   DTNSKATEDIEVDPLGAAVGASTVTEDNILIELEEELILYNIKKLKIILIYKKIKKKLY
FT                   KYKLINNLLIIIYENKLKIYKINQLIFFHQFNFNITFLSNFFQNYFILIDQFNHLYYLE
FT                   ISSVAVLGQADSNGTTASNGTTASNGPEVSNTNSTEDSNSSTGTNTNTTSSTIGPSTVT
FT                   EENSNTRFAAPGKGANFTATECTTGKGANSTAMECTPGKGANSTAMECTTEKIPNEIAV
FT                   VTKTGESDTFSELAPIGADGDRVVYIEEDEVVGASTVMVKLMEIELKNYENYKIISLYI
FT                   YNNNIIISLYNNIDFLLLITKLSNNQLIILYYSFNELFIEYNNMEGNLGGNFEENSVNL
FT                   ENSENLVNSENLVNSDVDNLEINYFLFEKWDILLIYSNKSISTLLITNNINLINYNTTP
FT                   GKGANFTATECTSGKGANFTATECTSGKGANFTATECTSGKGANFTATECTGEKNLNEI
FT                   AVVTKTGDSGTFSEDINTRELGAATEETGTVGPSTVTDTVTEEYIIIKLYEGYNIESIE
FT                   YEDYIKLILLYTNYENEIYRKNSLADTPTIKNPNVIFTLQNSNSLSIYFIDIYFGYNFT
FT                   EHVLRPVTVSPVTVLGQAESNGLTDSIPPPNSTTTLGASTVTEEKIPNEIAVVTKTGES
FT                   DTFSKDIISKDIKDSKGTDGTTGRGPHTVTEEKLKYLYKNNVYKENIKLYESLLNILYN
FT                   FDINTENFDNFDSLDSTVENIENTVENVEIMESVEISVENISLNKINEYIIIIKNLLNI
FT                   QNNFNYILENNVTNNTFDTPGKGANNTFNTPGKRANSTAMECTPGKGANFTLMECTPGK
FT                   GANSMGMECTKGKGANFTGTECTTGKGANDTFGTTVKGTPLGRLLVGEPHSVTEELKKL
FT                   VNKNINIKLEINEIKKLEEIIFYINQQLKFLYKKLYNIPLRCLVQTNSTTNKGKGANDT
FT                   FSTLGKGANSMPMECIIGKGANSMPMECIIGKGANSMPMECTGEKNLNEIAAVTNSRES
FT                   STFTKDISKTPSGGVGEEVGTVGPGCRGTDTVTEELNEKLYNLINDIKLLYNKPLKINN
FT                   NIKLYKFITLFNDSVTVLAPTNSTPVPGSTNSTKDPTGAVGPSTVTEENSINNFAAPKV
FT                   GTTVLTGPLGTKDTKDPTGPSTVTKGKGANDTFTTPGKGANFTAMECTPGKGANSTAME
FT                   CTSEKISNEIAVVTKTGESSTFSLDSKDTKGEGAGEVDPFGDYGTDCRGPDTVTENIFG
FT                   NMELNKELNNPILFNTQITQTKQLNNISIFSTFNNYQSLYDLANQFNTGTGTNTGFSNT
FT                   NTGFSNTSTGFTGGFGNTVGNTSTGFTGGFGNTGNTSNSGFTGFTGGFSNTKETPFGVK
FT                   ESPFGIKESPFGIKESPFGTTGTTSKEVPFGTTGTTTNGVVSRGPDTVTENIWTGIRKY
FT                   DPLN"
FT   CDS_pept        complement(join(222315..223904,224297..224524))
FT                   /locus_tag="TA15585"
FT                   /product="NADPH dependent oxidoreductase, putative"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:TA15585"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74111"
FT                   /db_xref="GOA:Q4UFK5"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK5"
FT                   /protein_id="CAI74111.1"
FT                   /translation="MRYVKFGIIGTGPSGLYLGKYLSKNIKNCKIDFFEKSKQLLGLFK
FT                   NGVAPDKINIKNNSYQLLINHHYRFFTNIHIGKDLKLEKLLEYYNAIFICCGCEDCNEY
FT                   QILNEQIGVFNSLNLIHFYNHFPINNTIYHNLPIFHINKYNTTTEENYIAAPKVSTTEG
FT                   KGANSTLTECTSGKGANFTATECTGEKNLNEIAAVTKTRESSTFSLDSKDTNSKGITTV
FT                   GTTSTTTIGPTTVTEENNIAAPKVLTGPEGTRFESHSSNSTTESTSTVGASTVTEKNPT
FT                   KLAAPIITPVSTVTIEEYMEYLIGLKKVNISIIGNGNVSLDIIRMLTKSEEELENLEIN
FT                   PKFKYFIKNLNINKITIFGRNSLINSKFTNNELQLIFNNNFHIQHNLQDNLINLINNLE
FT                   NNIKNRKIIKKLKLFNSINNLNTIDQNLEDLENNNLDLKKNKCIIDFKFNTKIIKIINN
FT                   NNIINSILYTHTQENPNTQFAANNSTIENLIAATRENPIGQFAALEENLNAATVENPST
FT                   HIAAVKKLDSNILIKCIGYNNKSNVELIKLIDNKRIFGNGWIINNCKGDLSNIILNSIQ
FT                   LSNQIKIIFKQFHYFNNDILNYFKLHHFI"
FT   CDS_pept        complement(join(224757..229977,230690..231186))
FT                   /locus_tag="TA15580"
FT                   /product="hypothetical protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15580 by TMHMM2.0 at aa 292-314 and 409-431"
FT                   /db_xref="EnsemblGenomes-Gn:TA15580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74112"
FT                   /db_xref="GOA:Q4UFK4"
FT                   /db_xref="InterPro:IPR022233"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK4"
FT                   /protein_id="CAI74112.1"
FT                   /translation="MVTKCTSGKGANFMVTKCTTGKGANFTAMKCTTKDIGTPGKGASG
FT                   TFGPSTVTEEKKIKKFIKCKYININNKNNNVNGNEVELLTEKPYLYIYLMKNIENEITN
FT                   EEFNKFLNKRLNNKFNEEFLIIILMENINNKFYNKIKNHLHKLHLHNRIIKLFLTSRIL
FT                   LLFTPRKGANSTATKFIIGPSTVTGEKIPNEIAAVTRSGESSTFSEDTNDKVIKDIEDI
FT                   NTRGLSTVTEETGTKEAPLGAGSKDSEESGTVGASTVTDTVMEKKIFDYIKLYEDWLNI
FT                   FYKLKLLMDYLIFYEILFYNPIFSSVTVSSTTATTTTEDTKNTTGSKDIEDIGTIGAST
FT                   VTEENSTILAAPNVPTVTKDIDTLILRINTIINNIINNNSIKNLTNYEIKKFILYKQLL
FT                   IIKYNLNNKIIYLITLFLFNFIFFLLNNFIPNNFIFNFINNFIPTITTVPTVPTVPTVP
FT                   TVTSVPSVPNNIQLNGINDIVLENLNNNNIIIILFEIIIFINHYINSSVTVTGPPNNTT
FT                   TTGKGANFTATECTMGTPGKGANFTAMECTTGKGANSMGTKCTSEKIPNTIAAVTNSRE
FT                   SDTFDELDTLTDNILILNILKQYNINIHTSTKDTIGTKDTIGTKGTIGTGTKGARDTTT
FT                   TTGTGTTGIEEDKYIINTYKYISFIYLLLYKFLSYNNIITSITGSGLTDTEDTTDTEDT
FT                   TDTEDTELDSIVEPDTVTEEKNPNKIAVVTKSGESGTFSVDIKDTNTKGEGVNTKDTKD
FT                   TEETPFEVDEDTVDDIKEDEFINYINNIYNIIIQLSFNIQFLQSNTSVTVTGPPNSTST
FT                   PGKRANDTFSTMGKGANFTLMECIPGKGANSTGTKCTTGKGANSTLMECTSEKILNEIA
FT                   VVTKTGESSTFTKDITGKVIKDSKDTVEISKTPSGGVGEEVGCLEPHSVMEEIIKLEKK
FT                   LYIELNNINNYKNNIINNCIKYFILSNLINYKDLFLNFTYIDSNYLYNSFYYKFITSVT
FT                   VSGTTDTIPPPKDTIGTEEPDTTEENSTTQFAATKVADGIKGSTTRDSDVITTVGASTV
FT                   MEDNITEFEDNISISTSDTIEDTIDTINTSGNIIEEKNINEIAAVTRSGGSSTFSEGVR
FT                   TEDIRDTEETPFGAVDVGTGAVGASTVTEDTVMEELDKLDEIGIDMKIYNCDEYEHIFN
FT                   KKNYNINNEEIILHKFCKNFLHILFIKPVTVTGPPNSTTPGKGANSTGTECTPGKGANF
FT                   TAMECTTGKGANSMPMECTTEKIPNEIAVVTKTGESGNNSKDTNTMETPFGDKEASFGA
FT                   AVGPVTVTGDTIKELLMKIILKGIIIKEIIIINIDNKIKEINIPIKNKLINQKNNLDNE
FT                   NLNNLFINEIKLPKFKNKLLLCLYIISNDIISNNIKLFNIQLFQQKLNKLSNYKKINEI
FT                   NEKNEKNEELLEKNVKNEELLEMLEMSEELLEKKVINNEKLYIKNYEIILTEIFDVELF
FT                   DEIINLCINFKHLIKINKILVNNKILSTNNLLLNFNSSYKINIHQIIKLLDNSSGTVLG
FT                   HTASNAPTASNGTEVSTTEDTGITTVDSTTNSNSTTNTKLISTIGASTLTEDNIPTHFT
FT                   PGKGANFTATECTPGKGANSTAIECTIGASTVTEEKIPNEIAVVTKTGESDTFSMDTKG
FT                   VGEGSERTPFGGTAGLSEDTSVGGPDPDSEEKIEIKVYYKMYRKFKSSLEELSEELIYK
FT                   IYLNRINNTFTISRNYNSGTNLYISNSIKHFINNIKIIQPVTVLGQADTIHPLNRAVTK
FT                   DTLRASTVTKGKRANFMPIECTKGNIDTSINSIKDIKGIKGIIENNNIRMEYIMNIPYY
FT                   GYINKYMKINIRIRLNKDMKISYKIEKNENWLIEGLILNNIKLSKNTFFNINFILIPIK
FT                   LGHLYLPNINFNLNLNLPKHQITIFPQHSLI"
FT   misc_feature    complement(join(229182..229250,229533..229601))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15580 by TMHMM2.0 at aa 292-314 and 409-431"
FT   CDS_pept        join(232617..232823,233027..233374)
FT                   /locus_tag="TA15573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15573"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74113"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK3"
FT                   /protein_id="CAI74113.1"
FT                   /translation="MYYGPEIPEELWIKPQKPIGFFGKNNCIQLFLYGACSSSSNNHYL
FT                   VISLRSSLTPERGLLSYTVIYLTVNPLWGYCLTKHRNGCIVSPEGKYMKSRRAIVIRAR
FT                   RRKYLKTIYYFVRRKYKEYIKNSRNISELMYWKYKLDSLPKDSSSTKFHHYCPISGTLR
FT                   CLQQLYPQRGFFSYIAPPGLP"
FT   CDS_pept        complement(233994..234593)
FT                   /locus_tag="TA15570"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.475 - score = 16.68"
FT                   /note="Signal peptide predicted for TA15570 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.956
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA15570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74114"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK2"
FT                   /protein_id="CAI74114.1"
FT                   /translation="MKFVILALLALASGLHAAKLDLKPLGFVLFGKHGEGTTATVAAGK
FT                   CPLGTLPDTVFLHKTFEKAGHFFTWVRPVHGKVDEVACGSHAVWKAAAGEVLLDLHFVG
FT                   NKESEKFVHLELFHPAVGSHHLFLKFAADGTAAGVLGMAAFVVAAHGLVEGLPAFDGLP
FT                   AHPLVHALAAHAAHAKHAGASAKDGLGAHGAALVAA"
FT   misc_feature    complement(234543..234593)
FT                   /note="Signal peptide predicted for TA15570 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.956
FT                   between residues 17 and 18"
FT   CDS_pept        complement(join(235315..235691,235743..235853,
FT                   235887..235959))
FT                   /locus_tag="TA15565"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.474 - score = 11.38"
FT                   /db_xref="EnsemblGenomes-Gn:TA15565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74115"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK1"
FT                   /protein_id="CAI74115.1"
FT                   /translation="MLKYSNYKGYPGIYNNGAIVYDINEYMEKLIKYILENKLENYFLF
FT                   HDLNGFYCLSDPYFVTKELIEKKILMIYFGKFEVEFGPFTNGIDHIGNFTLYELFVEIV
FT                   PPNTSKCSGVKCLMDYYHLDNDMIYFVGDGNNDIEIMQMLNNSFAVLNAPDRVKQFAKY
FT                   ILPKTHYNNAVQFLFNLIYQYIL"
FT   CDS_pept        complement(236431..237183)
FT                   /locus_tag="TA15560"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.473 - score = 13.66"
FT                   /db_xref="EnsemblGenomes-Gn:TA15560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74116"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFK0"
FT                   /protein_id="CAI74116.1"
FT                   /translation="MELDISKLDRLEKLNCCKHYWSNVPMEIYISNEENKLLTIRDNNI
FT                   IIWQSNDNYCKFLYCYHNSKQITLLQLIILFSNNKHKRLYFSKVNSSVTVTGPTDSTPV
FT                   PGTVSTTVTKDTNTNTNNSTEDTNTNEVHFGDKEAPFGAVGEETTGTVGASTVTGKWIQ
FT                   IDNDILYNEINKLSEILPRNESEMERWTLNSNIENFIPKMKPKYFAVDLDRTFLIHNSK
FT                   KMIENIKSFEYLRNNNFIPFFCTGTALR"
FT   CDS_pept        complement(join(237369..238120,238292..239051))
FT                   /locus_tag="TA15555"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.472 - score = 53.84"
FT                   /db_xref="EnsemblGenomes-Gn:TA15555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74117"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ9"
FT                   /protein_id="CAI74117.1"
FT                   /translation="MMKIWKLIIFIIGSINCIDPIDIDLLQAVNMPGVKSTLVTFHTIQ
FT                   YFILAPLDTHFINSVRHGDTMLFQRNNTSCLKIVTTNNGTHSFIYIRIITQSLSDLYFR
FT                   FYLPIHGPPVLGRMAPALTTVNTLLRLLANSHPSLNPRGFNMFDNSDPIDEDEGEDSDS
FT                   DGDDDDGDDGDEGGDGGDNGGGGFGGGDGGNSDEGGDDGNGGGGDEILGPAAIGAVDIA
FT                   LGEMNQEGIQGMIGGLQEFVPNIPEQEGNSPNESEGDEVNQGEGEEEDINYEMVQHEGE
FT                   GLDDSGDNEQDLGMDLSQYAGYFRISTLPINEQMEQDIDQKILEDMEEIDLQIQQELGQ
FT                   GMGQMGEGIDQFGQGIDQFGQGIEQSGDGIDQFGGLAPNLSELLDAFLDNLIQQQLNPE
FT                   TMDPELAGYTQSLGPELAGLMDPVGSDPVGPGTLEQVESSGNVDTPGLMDPIVPNIIEQ
FT                   LESTGTKINEPLEQMSPELVEVEMESEVESEGHYDLYDEDKTDTE"
FT   CDS_pept        complement(join(240036..241210,241442..241909,
FT                   242195..242399))
FT                   /locus_tag="TA15545"
FT                   /product="protein phosphatase 2c, putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="PF00481 Protein phosphatase 2C, signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:TA15545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74118"
FT                   /db_xref="GOA:Q4UFJ8"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ8"
FT                   /protein_id="CAI74118.1"
FT                   /translation="MRLSYNFIRGLLLLKMGAHLSSPKTEKVSTSGGNFKLDSTVFGAT
FT                   SMQGWRISMEDAHLTIPSYINNTDYLTTMVASTVTEINMNIDELPISIGSIYGVFDGHG
FT                   GNCVSRWVSENFSNVFTKEFRDVRRRYLDGTLVPKHDSDSCIESKLVAEALQNSFLKVD
FT                   QHLATPEVDTQLQLISNRKNDDLDSNNLFKVLLPDKLNNRQHAIDIIQQLTSFDTHSYD
FT                   NKQNDELNKYDSIPYYKDEDVDEDIINNELGINTKNLDNFEGSIGGTASTVTVSSTTTT
FT                   DTTVESGTIMEDTTTPSTTTTTTPNTVVGTTDKDMNNITINLLQKEKEDLYAMGCGATS
FT                   VVVVVLEDPYPCVIVANAGDSRCVLSRNKLAVPLSIDHKPTDELELCRIRRAGGNVING
FT                   RVDGNLNLSRSLGDLSFKMDQSLDQREQKIISFPDVQIIKLTRDDEFLVLACDGIWDCK
FT                   SNQQVVDFIHTKLQYYLKLYDKHDHTIKHFKRNDLNKHEKSASSGSGGDKGVGEKSTSG
FT                   IGMVSDVSSSIEGLGTGKGAVGSVLSGVPSTVTEELEKNEIIDRMGSNEKKREILEKIC
FT                   EELCDLCLSNNPSESEGIGCDNMTVIIVLFNQQLYNKIH"
FT   CDS_pept        243145..244146
FT                   /locus_tag="TA15540"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.41 - signal peptide, transmembrane"
FT                   /note="transmembrane protein, putative"
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA15540 by TMHMM2.0 at aa 13-30, 43-65, 126-143, 153-175,
FT                   278-300 and 310-332"
FT                   /note="Signal anchor predicted for TA15540 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.989) with cleavage site probability 0.002
FT                   between residues 30 and 31"
FT                   /db_xref="EnsemblGenomes-Gn:TA15540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74119"
FT                   /db_xref="GOA:Q4UFJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ7"
FT                   /protein_id="CAI74119.1"
FT                   /translation="MFKCLKKYYKYDLISCIIFSIILLYYLIFCDQTKSIDLLTNKIIF
FT                   LHYFINPIKIFFYLIILPIITFNSSVTVTGPTASTAVTGINNITTVTKDISVSSTVRAS
FT                   TVTGIWNYKTILKYEFNKKLKILIKFNGILVFLTIILTTNNSLNYLLNYIISCFLYTCI
FT                   SLGTFIHFFFLPNSVTVTGPPNSTTNSTKDSTKGTKYITLGKGVNDTFDTPGKGANSTL
FT                   MECTMGKGANSMVTECTTGKGANFTAMECITGNTVDGEDDEDTSVVVGPNSVLEKLIII
FT                   KFIMLLIGNCFGNYLLLLDWYQLFARFPITNFIGLTIGHFLSSLISNFILLK"
FT   misc_feature    243145..243234
FT                   /note="Signal anchor predicted for TA15540 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.989) with cleavage site probability 0.002
FT                   between residues 30 and 31"
FT   misc_feature    join(243181..243234,243271..243339,243520..243573,
FT                   243601..243669,243976..244044,244072..244140)
FT                   /note="6 probable transmembrane helices predicted for
FT                   TA15540 by TMHMM2.0 at aa 13-30, 43-65, 126-143, 153-175,
FT                   278-300 and 310-332"
FT   CDS_pept        244364..246031
FT                   /locus_tag="TA15535"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.42 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74120"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ6"
FT                   /protein_id="CAI74120.1"
FT                   /translation="MAEVLVNTVGYDDSDLSDYENNFNINNNLIYQNFKSNYKFNYNQK
FT                   SPRFGIDNINTNNKVNSINNEEEFGNGNVLEFGKKLERISYRNSLDTIDSINNNENVFK
FT                   WWCDENDYSDDFSDDSFFSPVTVSSNTATPGKGTNTLTTTNTKDTNIIGANTVTEENNT
FT                   TNFAAPKVGTGTLGNPATNSTEDITVGASTVTEDNSGWKSWTNGTNQLQELKSKILNKL
FT                   LNNIKPVTVSGAQGKGADSTAMECTMGKGANSMVTECTTTVGASTVMEELKYYKNMNKI
FT                   LIEKLIYIINNNNKLEYNINNNYVTLIQNHLIKTQSFLNSITGTTNNLTTTEGTSTVGP
FT                   SSVTEENSTTKIAAPNLHTGPEGTGFETQSITTTTEVTNTNTTLNEDTNTVTTTEEGAI
FT                   VGASTVTGDTVMKIKELELNNKELEEKIKIIEESKNNLEEDFKKTLTYMKLMKDRLKLF
FT                   KQNNTQITTTNSTNNFTTSTNNFTTNTLNTHNSLNTLNTLNTTTNMNNMNKRNKLRRNN
FT                   SSVRFKEMSELYVVPRSLSETKPIINNNKFNFFKNLFK"
FT   CDS_pept        246417..247427
FT                   /locus_tag="TA15530"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase,
FT                   putative"
FT                   /EC_number="1.2.1.12"
FT                   /note="chr2.C.cand.43 - glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TA15530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74121"
FT                   /db_xref="GOA:Q4UFJ5"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ5"
FT                   /protein_id="CAI74121.1"
FT                   /translation="MKIRIGINGYGRIGRSVHRASLERENIEIVHINDPLMTPEYIKYL
FT                   LKYDTIQGKLPYELETLDNNLILNGQTVRLSFEREPDLIPWGNSSVDIVLECTGQFKSN
FT                   EKASLHLKSGAKLVIISAITTDTPIYVYGINHTSYNKSVRVMSNASCTTNCLAPVVKVL
FT                   HENFGIVEGLMTSVWPNMARQNIVDGTTRDFKRSGRCAITNIAPLTTPAADAIGEIIPS
FT                   LKGKLKSMTFFVPTHAVAVVDLTVKLSKPTKYENIVKVIKEAADGNLKGILGYTEDEVV
FT                   SSDFMHESLSSIFDINAGIALNDTFVKLISWYHNEWGYSNRLLDLSNYVYKQFNS"
FT   CDS_pept        248012..250699
FT                   /locus_tag="TA15525"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="chr2.C.cand.44 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74122"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ4"
FT                   /protein_id="CAI74122.1"
FT                   /translation="MFHQVFQSSYPKYFAILKENKPILLMKSNLLSPWYNITNLRYDIE
FT                   KLLFIDSNDRDYNYTECIIELYELILVIEFGFNCKNIWFNDKLYWSNTNPQEFPKFLLF
FT                   DLVNNIFLLFYNSELVNISGTHKKFIHRFQLRNDYINQINQKLIKRKFNNIKQIKQNVI
FT                   CPKPIKFISNTESICDTESVSCDTESRQYNKESGYNKELGHCNKELGYNKYYVDEIGLI
FT                   NSIVNRKIIIKIDVINESYINIINQFYEYFNLTTSDTTIDTLNNLSTLYSCKISSLSRD
FT                   SKSVISSLSRGTRPRNGIIINGYILIINNYNCYYNFKNVICNEISYYKRILYKSQSKYP
FT                   ESLIFYKKHNITLIKFDDKFILHILKYGIWTEKSYVIPPIRLYRENNLGELLPLTTEQY
FT                   DIHLNIFGTTQLVYSVNQINTVMLMLGDELVWKRKKTSRNKLEYIRKLIYNLMDNSFTI
FT                   VTDITLRCIKKHNRWYNKFHELTYLTHFTDDSGELTIIDREKLNITYNSRHKYLFNYET
FT                   INCAQISHYDTVIWSKTNENYPKCMELKIMSKCKKFILQFNNKFKVYTITHGMANGMGN
FT                   FTAMECIRGKGANFMGTECIRGKGANFMPMECTMGKGANSTAMECTPGKGANFMPMECT
FT                   SSKDTNGMSVVEIKLPEIELYTCDKNGNYIKLLNEDYNINLSIFKDYKFIYSPKFNIKI
FT                   FSLKLKIYHKNLMESCDSGLMGPTETRNLESYENTHVEPCKTSVLESCNMRFLEPRDNR
FT                   QSEIKIFGPYEKNILYVIYSEIRELQIIFEDQILLFKYTNHWNEKVYKIPKELKFYTRD
FT                   QFGDILLTPENYRVELRDMRRFKYIFDNFKCDQVCHNNEIVWKSDGTKNVNSIVYFRKY
FT                   KIIINLGIKNLYYKLNSKGHWIQY"
FT   CDS_pept        251648..254353
FT                   /locus_tag="TA15520"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="chr2.C.cand.45 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15520"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74123"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ3"
FT                   /protein_id="CAI74123.1"
FT                   /translation="MNIKQHPDIGTNIEKSSDSRTNNTEHPDSGVSEKNLIPIILDISI
FT                   EGSSDRIDYLEHRDGGTYSCNSRYGISTIIDSGVDEFSKPEIIYKAKNENEYAYAVQVE
FT                   NITPESKNIILRLNGSFIKLTKKNDRISNRITEENIDSTEENIDSTEENNNSMMDEKKN
FT                   WIRSDRITLDIKENDHNNNYQIIGKNSTIFNSVFKDVDIPDHDCYTNYVAINGNLFNRI
FT                   IEGNDLVIWESNDPLECIKEVSLYIKNNIKYLAFLSNNFNYFLYKWDNNLWNNLTNDFN
FT                   SKLVTVDPVVGLGGGTSDLEVDKISLSEEKGNLEEDKISLEVDKISLGLQKIDLEDEKI
FT                   DLEDEKIDLGDEKDNLEDKLINLRELKFYFNNDELKRIEELPGSYSISLYCLRYCVEFY
FT                   FPKFNLNPNEILADVFIYNLLDNNMYLRLRNRNIIPINTYNIKLCIDSPVTVLGQTEST
FT                   PPKGAVTVDTSTLRPSTVTKGKRANSMPMECTGGKILNEIAVVTKTKESGTFVDTVDTT
FT                   GKGANSMGTECTSTTSSITEENSDIEDLDTVVLDTVTETNTDIELEYIINSLKIAKNLE
FT                   NEDDPTNYVTTPEDPLNYVTTQENTFNSLEDSLNSLENSLNTFENSLNSLANYVNTPKN
FT                   TINHVNPLGNPLNSVNSVNSLGNPLNPSNPLQNPLDPLNTINELEDPINISIDINNINS
FT                   TREYKIYIKNELKEIKPYRNYSFDKVMESDGRVQEIIWSCEDPEETVKHLTYFNGVIEK
FT                   YLLMFINKKKYLLFRYVIWENKWTDVTNTSVNLSELKFFTKGEFVTGELVTEGELVTRE
FT                   LDYRIFTFGYNFEIAFKTPCHKVTYYNAVLWSNEETDCKKIHKIVIKPIVNRLHIFFMN
FT                   NKIRRFNVTNNYINFISEDDCIFYKNNLFK"
FT   CDS_pept        complement(join(254720..254842,255050..255233,
FT                   255472..255583,255646..255756,256041..256392))
FT                   /locus_tag="TA15515"
FT                   /product="serine/threonine protein phosphatase pp2a
FT                   catalytic subunit, putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="protein phosphatase pp2a"
FT                   /db_xref="EnsemblGenomes-Gn:TA15515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74124"
FT                   /db_xref="GOA:Q4UFJ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ2"
FT                   /protein_id="CAI74124.1"
FT                   /translation="MQTTVDYYLNQVEINDLDNIINNALNCEFVSESEVVKLCEKAKEI
FT                   LIDESNILFIKAPVTVVGDIHGQLYDLKELFRIAGSAPNTNFLFLGDYVDRGYYSVESV
FT                   ILIVSLKVRYKHRVFIIRGNHECRQITQVYGFYDECLRKYGNSYIWKCFTDLFDFLPLA
FT                   ALIENKIFCPHAGLSPSIDSLDHIRKLDRIQEIPHEGAMCDLLWSDPEERTGWGLSPRG
FT                   AGFTFGYDITKAFNQNNGLDLIARAHQLTMEGYQWSQDKNVVTIFSAPNYCYRCGNQGA
FT                   ILEIDENLNFTL"
FT   CDS_pept        256650..257168
FT                   /locus_tag="TA15510"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.46 - hypothetical protein, conserved,
FT                   pf11_0393"
FT                   /db_xref="EnsemblGenomes-Gn:TA15510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74125"
FT                   /db_xref="GOA:Q4UFJ1"
FT                   /db_xref="InterPro:IPR015221"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ1"
FT                   /protein_id="CAI74125.1"
FT                   /translation="MDDEIEDVNIIVNLEFSGGLDSLVIDQEKELTLKIFSKNINLGQL
FT                   ICYIRNYIIGTKKDFFSYIITNTTGTNYTNSTTGTTNTNTNTRESGTNTRGLGTSEGAV
FT                   TEDSNEDIIRIECNLKKYNGILNINEKCKIRPGVLVLVNNTDWELLNKENTILKNHDLI
FT                   SFISTLHGG"
FT   CDS_pept        257376..257729
FT                   /locus_tag="TA15505"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15505 by TMHMM2.0 at aa 29-51 and 61-83"
FT                   /note="Signal anchor predicted for TA15505 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.046, signal anchor
FT                   probability 0.918) with cleavage site probability 0.013
FT                   between residues 46 and 47"
FT                   /db_xref="EnsemblGenomes-Gn:TA15505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74126"
FT                   /db_xref="GOA:Q4UFJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFJ0"
FT                   /protein_id="CAI74126.1"
FT                   /translation="MLILKSFKRPKGGGPCPLINNPVKKWLKYLSIFHIILLVMTCVSI
FT                   SFPFIHDLHCSILFNSLANLIASAICSTLMATYYIIVSNKDLGNILLLTNSATNIPPKG
FT                   AINTNKVDNVNNV"
FT   misc_feature    257376..257513
FT                   /note="Signal anchor predicted for TA15505 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.046, signal anchor
FT                   probability 0.918) with cleavage site probability 0.013
FT                   between residues 46 and 47"
FT   misc_feature    join(257460..257528,257556..257624)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15505 by TMHMM2.0 at aa 29-51 and 61-83"
FT   CDS_pept        join(257935..258190,258400..261068)
FT                   /locus_tag="TA15500"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="transmembrane"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15500 by TMHMM2.0 at aa 53-75 and 931-953"
FT                   /db_xref="EnsemblGenomes-Gn:TA15500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74127"
FT                   /db_xref="GOA:Q4UFI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI9"
FT                   /protein_id="CAI74127.1"
FT                   /translation="MFRVVKSIFRGSKVYIGWGIYTFTNSSFKIYKALNDEFQVEPDCL
FT                   QTKARVFYISGFIVICLHIFVAGTVLGQAVPPKGVPLVIYKFLKRIIISKTIKGSRLKL
FT                   KAEELQIAAKALQDKATNEKVNIHTQAGTLASSAQTLAENTPPQAFVNADTVIDKFDEL
FT                   EDAYNQLSTSSPVDQAKVEKEFNTVKHIYDTMINVKKAKKLQEQVGTQDGKGGSDQKIW
FT                   YYANELYGKANILAGAEKLKAPEAQDGEDPTKELKHLAEKLRDAVGQNDNSGLQKALSE
FT                   LSTARESNPKDLIPMAKDVIDKYNSVKEAYEKVKAQASEYTKALTKTGETSKYTNVKSA
FT                   FQALESAYNLGKCKDITPIFDKEYIDIQTSIVSDRLTSKATEIESKAQALRTTAERQST
FT                   TELADNRNNDINSTTNKLGSELPTKATTLKSKAEKLYNAAQRLEETAEDPSPLADLKNH
FT                   AEELATAAKKDTTSDGLFYAAQALESGGGDSLEDKATKVITKFDKVQRAYTALMTKAKQ
FT                   IGKQGHSEVNSVENEYTELKEHYDGMLNLTKLSKMAKDLTGTLQGPATTLASSVKELRD
FT                   NTDGNDYPKAQTVIQNYEKVESAYTSLGDKQSVKDKFEALKTLYDKIFKFTKVKYYSEQ
FT                   LEGAADPSGDAEKVITFFNSVVVAYNALGETEQKHVKDQFTELQTEYSNGIYKYKFHIL
FT                   TIPFMVTNWLNFLRYVFMGSWGVYHEKVCKGTGNEQPGRTGCPKPEDSATETVNSIKLE
FT                   LTNSTSDITHKIILNGTGSSGTVSTSKAITLASGGDVTLTINLPGGEIKLSKLTISGTN
FT                   LTIQGGTSRVSVTKKSNPWVTGTPVKLHSSNGATLTGTTLTINKQDPGGKEATITGSPS
FT                   GGNVELNYSTGSGTIEISGTAITALEGKFIPDELHDKHKEQKCCIYSKQYTWQDSANTY
FT                   VVWWNIFNILMPLQICLAAIFIYSLNNREYHSYLLSCSSSNAAG"
FT   misc_feature    join(258091..258159,260934..261002)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15500 by TMHMM2.0 at aa 53-75 and 931-953"
FT   CDS_pept        261580..261939
FT                   /locus_tag="TA15490"
FT                   /product="hypothetical protein"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA15490 by TMHMM2.0 at aa 7-29, 33-51 and 72-94"
FT                   /note="GPI-Anchor Signal predicted for TA15490 by DGPI
FT                   v2.04 with cleavage site probability 2.4940002 near 97"
FT                   /db_xref="EnsemblGenomes-Gn:TA15490"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74128"
FT                   /db_xref="GOA:Q4UFI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI8"
FT                   /protein_id="CAI74128.1"
FT                   /translation="MLISKEPIMLNLTSQAISISLAVAVITVNSNQLLFLLVWVPTPSL
FT                   IVLVIIKILQEVQTPMLFTPISNALTVVCILSRILSQLNLLIIVVMAFVYNSSSISDMF
FT                   RGYIHILFALYRLCN"
FT   misc_feature    join(261598..261666,261676..261732,261793..261861)
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA15490 by TMHMM2.0 at aa 7-29, 33-51 and 72-94"
FT   misc_feature    261868..261873
FT                   /note="GPI-Anchor Signal predicted for TA15490 by DGPI
FT                   v2.04 with cleavage site probability 2.4940002 near 97"
FT   CDS_pept        complement(join(261969..265229,265392..266774))
FT                   /locus_tag="TA15485"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.466 - hypothetical protein, transmembrane"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15485 by TMHMM2.0 at aa 95-117 and 170-187"
FT                   /db_xref="EnsemblGenomes-Gn:TA15485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74129"
FT                   /db_xref="GOA:Q4UFI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI7"
FT                   /protein_id="CAI74129.1"
FT                   /translation="MLWFSISSEDQIQGMATNLKAANTNGTLSGPAGGLNTAATELKSD
FT                   LSVANAQAFKKANWDSHYGNLVTKDTNANGENLYTGSKDFKTPRKHKFNWIIIPSIVTQ
FT                   WLNFLTYVILLFVYITSLPSMLMGNLVDLIQKLTADNKTDLQLDHSQEQNAGENAKLGK
FT                   LILMKRWKFWCIIIPSIMTMWSVWSPKTNFVYHGDRNPKNGFGGWKQYASKHVPKESSQ
FT                   ECNTDAEANAVVHAWIWHFFDILIPLKIALAIVFIYSLHYKESHSYLLSCFVAQTNEDK
FT                   ATTIDKDKVKIETGTVKDGNCTETAPTTFTTTGGSDAPNILGVCSSTTVATLTTQIESA
FT                   KLNTTNLTLTLKTQGATITVDGDAEGDSSNGPYTLAGGNLSVSNITLNGDDFPYRLTNI
FT                   GTLTASLQLSSGTVTIKQDTLITLKLKVANSAQLTVNGANGKTLTGPPFPFSLGAYKVT
FT                   NNEFLFRYACRCIHILSALHTRYQILKHGEDNPNMFRFGVLPGPFGVDAYGTTRNTSLT
FT                   FNVTLNNSTTGFQSSGTITITVGAASLKALESPSNVTITLSDGGTIKKYDDPEKPPTPE
FT                   NLKDFKIDETLTKDTKLYILATGTISNPPGLNGSEVTIKATVDVTSSGQPLGDQALTLS
FT                   PDPDNDPSSEGLGGSITPEGTNNSGPVSISGSSTIKLTGTALESLKSLTENAVTLTGTG
FT                   GSNFRSSASITVTSTDGNVNFKQLPVSGKLEISKISGSIKKLDEKGKPIELQTTTQLTV
FT                   GDKLSLDANGEITQPDSARGTNVKLSGTIVVTNKQQQQIGSTLTFSGGPNRTGVGESLS
FT                   LETNGTIKSDGSKIEIDQNAYSTITAASDTSSSFFTIGASQSSAKLYLHNTTINATGGL
FT                   KAVATIKATKHGGAEHNGPITSINEGTLRKGAQLQINTQLEAGDILTLSGSANPDVTIE
FT                   GTIMVTSPGSLGESITLAGLLDGTLTLANGSSNIDVSIGGESLNAKDPKDLAIKGINIT
FT                   CGGLSGTATMEITSDEHDLTTITDPVTINITKLTKDGAKLKTGTGLQSNDTLNLEGTAT
FT                   AGDKSLTLTGKITITNGGNLSSGLRFSGDVTSSGSLTFEDATDGSGVTVTGTLTLSSAT
FT                   LTALQNSNFSLASDNKRALTYKPDLVTKSKISVGTSATGKVKLSGLSLIPVCITNASTG
FT                   NGFEATANLSLTHTKTSATALKDTGEHNINLTTIATTNLNSAKAEITKGPKDKVASLPA
FT                   GADILEKETDLVPGDTLTLTITPQGSGTTTTLTGKITVTSPGTLTGPLNLKGGLETSNV
FT                   SLGGKGTLTSTAGANITNPKYDHMEFHVNHQDTLCCYWGGSHSFGINTTITQASLNLTD
FT                   LTGSHTLKLQNGDGAVQEVKYTVPEEQKDTINSIKGQASDVKINLKLTLAEVTLTQTST
FT                   RSTLKATGTITTTKTVTPTGGQTTLEQNLKKDHDLTFTSNSGLTQTGLPKGTVIIGPRG
FT                   QHQTLKLTAEPDTDGKPTELTLELKAGTKDILTLSNGSTLNLSGGINGTLTYTDSSGNI
FT                   LIATSINSDTFDQNDFNGTYKIQWLGR"
FT   misc_feature    complement(join(266214..266267,266424..266492))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15485 by TMHMM2.0 at aa 95-117 and 170-187"
FT   CDS_pept        complement(266861..267535)
FT                   /locus_tag="TA15480"
FT                   /product="hypothetical protein"
FT                   /note="signal peptide, transmembrane"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15480 by TMHMM2.0 at aa 7-29, 44-66, 129-151 and 171-193"
FT                   /db_xref="EnsemblGenomes-Gn:TA15480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74130"
FT                   /db_xref="GOA:Q4UFI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI6"
FT                   /protein_id="CAI74130.1"
FT                   /translation="MNCKRYCFLATNLLFATLFLFLFGFTFEGCNNSFATFLSRKLYEY
FT                   VLYLYNNDTFALFLTLFSYLGQFLAKMLFYKGLPSKFYLHCYPLLGDNSLESVLGPLPN
FT                   STVMAFKRFVAWFYKLYWTLLKRPLSYFYVFGFFGVMVSVRLLLLTLLSLTLLFAVKYF
FT                   KNLLKHLGFNLALPLVLLPSYLFVLLVYYWAYESFFTPLHLAGSLVLVGSLSYNKFKKS
FT                   RR"
FT   misc_feature    complement(join(266957..267025,267083..267151,
FT                   267338..267406,267449..267517))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15480 by TMHMM2.0 at aa 7-29, 44-66, 129-151 and 171-193"
FT   CDS_pept        complement(join(267931..268266,268374..268468,
FT                   268570..268906,268985..269219,269319..269608,
FT                   269639..269778,269857..270693,270804..271484,
FT                   271617..272210,272265..272759,272906..275692,
FT                   275726..276578))
FT                   /locus_tag="TA15475"
FT                   /product="guanylyl cyclase, putative"
FT                   /EC_number="4.6.1.2"
FT                   /note="all_bases.cand.478 -guanylyl cyclase"
FT                   /note="20 probable transmembrane helices predicted for
FT                   TA15475 by TMHMM2.0 at aa 122-144, 148-170, 351-373,
FT                   393-415, 1141-1163, 1173-1195, 1226-1248, 1263-1285,
FT                   1290-1312, 1327-1349, 1457-1479, 1489-1511, 1518-1537,
FT                   1552-1574, 1587-1609, 2125-2147, 2160-2182, 2197-2219,
FT                   2252-2274 and 2284-2301"
FT                   /db_xref="EnsemblGenomes-Gn:TA15475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74131"
FT                   /db_xref="GOA:Q4UFI5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI5"
FT                   /protein_id="CAI74131.1"
FT                   /translation="MDDSSIKRFKSQNVSYSFPESKTDSKETFNSYKKLPFSNKQNKNR
FT                   DDYTGLNDVRKRPETFDKAHSLYLGTKIQPAWETRTLKINPVTSDDLSRFLGNEHHTQR
FT                   WSIISQIMFILLYNLRRLPFLWSIFIFLCQVIAPFILPYGVPRTPWYSSAVPLFFSLFM
FT                   SIFVNVLEFKKRYNLGRFLDNKKCVLLNDGKLSSVRSGDVAVGNILKLSCDEQVPADCV
FT                   VLYTSNPDGALYLDACYLDGQTDLKTKYSIKDFKIESSIRSYNNLKGNIICDKPCPDMN
FT                   KFSGLLKIKGYPRPCNITVDNFIMKGSILRNTSYVYAVVVYTGPDTKASQNFLRILKPI
FT                   KIGCLEQTINGISIFLGLIYVTCLTTSIIVRYVTVLKGVGKFSKNLQSPVNSLLFIIFR
FT                   FVVLYSPIIPTTLPAIMDLLRLLYSPFYNTYSESIIKNLNKKAPNEVTGGTWTLNSGLC
FT                   EELGLVDFIFTDKTGTLTTNNLSITLVTILSKSFTPKQLIHSYQPSHGSFNSNSTNGHS
FT                   PERVNGKVTRENTEESEHFMRLLCICNPCLNMDSEDSYNSYSSSYKSNYSRAYSFKLSH
FT                   FKTKSFDRFHIDGSEEQFDQNSNSVNLEDQFDQNSSNIADNSIEIEEEEEEDDDEVENL
FT                   PMYKKTKSKAHFGTVSYINDENISKELFNLSNRESIKLEERKYLTCISKEDECMVNLAN
FT                   DCGYFVSNRTRDKIAVNCNGKYVNYEILAVNEFTSTRKRMSVLVTNVQNNENLLYIKGE
FT                   AHSMLSIINDQNTKVAIESRLKKNSIFGYRVIICGYRSLTSTEVLEYESSVLMNREGLD
FT                   ELCTRFERDVNYLGIIMFRDEIHRNIVKTIDLLMDSGIRIWVLTGDNKEATIQTCYLTK
FT                   LLVVPTNIFIIQIKDLLSDMITPKRMSDSLGSETDTVTDKIDMLVDTIYNKYILERNNT
FT                   NDQLCLIIESEDLEIIMQSNKGQQIFMNMACSSDVVIGCLLTPIQKGQLVQMVKTKMIP
FT                   TPITLSIGDGINDIQMLQQSHLSICILNTASDDTSGNKKNMQFGGPSNSFNAHNNVRPD
FT                   KKNDGADKDYSHDSVDKNDTAESSETTSNNRNHDSKDLNLEKSIYSDNLEGNSEKLVIN
FT                   NDIVGYCDFCVDSFSNIRELLFKQGTRMLKSTSLIIYFTIYKGLIFILPIFYYQIFTNW
FT                   VGLDLYGSLITILYHLIFTFIPLIMFILFYQDISYEIYNHISILYTISRRRMYLNINNS
FT                   LYWMLEGILGSFVNYLPLHLLVISNDNIYKSEVISNRTFGLLISVSSIIIFNTKLLINY
FT                   TPNTKLFRFISVVYYLVSAPLYLGIIYFSSRRSLRLSSYQILRIVPFYILIPVWITFTV
FT                   ILNILSNLLQLYILPNLIKHIKLYIINNNNTINFKNIKSTFNFKNINIKNLMPVSRPFK
FT                   VKNIHGVTSKFESGVTENNINKLINIYTLRFKDIQLESDYRLDKNKKHYYENGHWYKII
FT                   FILLFLYYLSSFVVEYLVQKRWFKTPVVYCIVPTLLLEIVLIICIIISFNQRLFIKFIN
FT                   HILYSLVTFMIILHVSNRFLLKSTSWLHTVLFPIFTFVILRIPFIISVGLNLIFSINTL
FT                   VSINSTNIHTLPLFVGINIFVGFVGYDLEYKSRSNFIMEFSVLNYRQKQSELLNTMLPK
FT                   IVVSKMINAKLNENGIPIGFEAERHENVTVIFADVYNFQELIATIEPHRLVEILDTLFL
FT                   SFDRCSKEFNAIKIETVSETYLTSMGLNTSASSQTNSLGLTSESSENGQSKTKKSRSTL
FT                   GRKSRRSKDIAIDTIINRFDSYVQAASSSLDMSIAMLQVATTIKLNNNESIGVKIGINS
FT                   GYVISGLVGSKKPQYALFGDTVNTASRMKMTGEVGKIHISESTYELVKNDKTLEFINRE
FT                   IEVKGKGVMNTYLLEKALGTSYPNFTNSNNNLHEVDIYYNMLNKKNYSASAYGDGSSAS
FT                   GETIENVPLSSRELNGPEVSLSDEEINRIKNRRTNINRAVGNEDDLYDNLYDYNTLNTS
FT                   YSSFTVGSHKRKCFKFKRDPSFMSKSTSMRLTRRFASRLSTKHHSSFSKSRFSMRSSKN
FT                   TASIGSSSIVSSLTTPKDRKRKSDQFYQIKEGDEIHMKKNESILLKFNDKLQEDRYRNN
FT                   FYNNVNNISINENALFIFLITFIVQSIININVPRIYVQDNSKLIVYLNYILYWTVRCFF
FT                   ILMSFILWMLFHYNFFIQNKEDNKKIKICTFFVNLLFVSATCIFALSNSWSIKRTEHID
FT                   YNLWLNSDSVEFYFYLILLHHSTGMLFQNCLLIDSLFLVLSMTFISSSVQNNENTVTAL
FT                   FTIPICILFNLLSAHCKESIDRKKYYTNEKAYMIETRINQILGEMLPKSILEEFKLERL
FT                   KMCYIHEHMSFLFSDIVGFTKWAESVDPSEVIALLQKLFANFDRNTTNFNLYKLCTIGD
FT                   AYVAISEPKVIDNQDMRIKDLENILLMAYSMIHIIDETSKIFNIPDLKMRIGLHYGSCI
FT                   GGVIGSGRLRYDVWGTDVYTANMIESNGVPGEVCVSEKFRDIISQHFPNRFKFEHHKDI
FT                   NIIDKTIKSFIIRNKAKEGLQKTYFSHLNFADVGNV"
FT   misc_feature    complement(join(268994..269047,269075..269143,
FT                   269339..269407,269450..269518,269555..269608,
FT                   269639..269653,271387..271455,271624..271692,
FT                   271735..271794,271813..271881,271909..271977,
FT                   272353..272421,272464..272532,272545..272613,
FT                   272656..272724,272961..273029,273057..273125,
FT                   275301..275369,275427..275495,276069..276137,
FT                   276147..276215))
FT                   /note="20 probable transmembrane helices predicted for
FT                   TA15475 by TMHMM2.0 at aa 122-144, 148-170, 351-373,
FT                   393-415, 1141-1163, 1173-1195, 1226-1248, 1263-1285,
FT                   1290-1312, 1327-1349, 1457-1479, 1489-1511, 1518-1537,
FT                   1552-1574, 1587-1609, 2125-2147, 2160-2182, 2197-2219,
FT                   2252-2274 and 2284-2301"
FT   CDS_pept        join(277362..277559,277631..277825,277891..278319,
FT                   278350..278493)
FT                   /locus_tag="TA15470"
FT                   /product="hypothetical protein, conserved"
FT                   /note="small overlap at the 3' end with gene TA15465"
FT                   /db_xref="EnsemblGenomes-Gn:TA15470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74132"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI4"
FT                   /protein_id="CAI74132.1"
FT                   /translation="MLSQIYDYVISFVTRTSQAQRILLDLDLVDIIFSLLKDLEPVSYK
FT                   VHDPKVLAEFQSHCGQNLNPYIFSEIQSGSKEHERIADLVMKNLEIDPKYRHLVLDSVV
FT                   QMCKFYSDLKKFDETCLVEISEKNHGKHFEKIWKVLENRKPPKSLHVSKSDDANSWGCL
FT                   GFQMPLTDFRKTGLLGLLSLAYMVETYPESSKKALELSRREQNWFPFTLTSINVTSWVL
FT                   DFYNEGKLNCFSYNNDSEPLETFYTLHSYFFLNFVKFFLNSNLSNDIFNFNKISKEYKA
FT                   ELSNKFKKMVNENKSLNLHGSNLLKLLKEELNVLELYVTR"
FT   CDS_pept        complement(join(278483..278957,278996..279102,
FT                   279139..279391,279425..279507,279629..279739))
FT                   /locus_tag="TA15465"
FT                   /product="hypothetical protein"
FT                   /note="small overlap at the 3' end with gene TA15470"
FT                   /db_xref="EnsemblGenomes-Gn:TA15465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74133"
FT                   /db_xref="GOA:Q4UFI3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR028884"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI3"
FT                   /protein_id="CAI74133.1"
FT                   /translation="MESDEGYIYKSPSVVWLQKDLLLYGSGTVLYVFDYKLIDDDLVVV
FT                   GFDNKIFTVYDSFFKVLLTGKFNKKISFIALFKGNAIICDFFGDVSILKLSLDSTKSSK
FT                   NRDSDTQLNQEKTIEASESATRDKLTSGSGDVIIPFSHYSTITSSLIYNDLLFTGNKDG
FT                   KIFVNSLSNLHEIKDIYLSHKICLDTREDLDLLLSLSIDDSIRFWDIKTGLEVHKITIE
FT                   NTKCLSYFLKSSGNLIILLCLDEILVIKFSFSKLELLGFQMYKLSFTAQMCSFIGDTLY
FT                   LIDNYSSLYKVDNISKVCTDNKVKDNKIVIPDDSAILDNVVCIYKGDNKCNKINIKKNV
FT                   NV"
FT   CDS_pept        join(279928..280031,280061..280100,280144..280251,
FT                   280281..280325,280356..280439,280470..280524,
FT                   280556..280860)
FT                   /locus_tag="TA15460"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.1354 - hypothetical protein, signal
FT                   peptide, transmembrane"
FT                   /note="1 probable transmembrane helix predicted for TA15460
FT                   by TMHMM2.0 at aa 152-174"
FT                   /db_xref="EnsemblGenomes-Gn:TA15460"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74134"
FT                   /db_xref="GOA:Q4UFI2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI2"
FT                   /protein_id="CAI74134.1"
FT                   /translation="MSIVNNFKNIDYKYCNLAVLSAFALFQSSRCFFERSSDNIIGSYV
FT                   SQKNQSDNGSLSTDNYRDLKLKRLDSYGFWAILEDRSRKEYIYMKSKNLKEGMNKFLSL
FT                   KEFKDKPYLLKKKLLGLLSNPFKEAQTSEWIYTKTSKTTFPSNQGPNTAGIATLTVFLL
FT                   GFLCTMLFGVFKSVDVIKTLACVNFIKTCCKENNKVTKLIGKDLSIKSVEGKLTSNYFN
FT                   GDVLVSGDDKKQLLLVTPTDNEIL"
FT   misc_feature    280573..280641
FT                   /note="1 probable transmembrane helix predicted for TA15460
FT                   by TMHMM2.0 at aa 152-174"
FT   CDS_pept        complement(join(280944..281366,281398..281469,
FT                   281500..281647,281678..282034,282065..282137,
FT                   282169..282505,282540..282904,282938..283220))
FT                   /locus_tag="TA15455"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.cand.476 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74135"
FT                   /db_xref="GOA:Q4UFI1"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040155"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI1"
FT                   /protein_id="CAI74135.1"
FT                   /translation="MKSSSQEARSISEDRVKQILEIYGTKAWDKLSTEISKNGLKVPGN
FT                   PPKLPVYDICKLGRELMESLSRKYVTIACKNDSEERWLHISAQDPFIYKEGKKSSTFSD
FT                   KIDSMVVLIHNNCVFNWKMFSELMNLVKSEKLRVKSSCIDLIYSAFMEVLPGRKLRYIN
FT                   EVNKEVIDFLGYKLHPFSKNLNSWDTLDLDVVSLLLTITFEDYLKGIYSTFIQELSDVM
FT                   NRGVDFLQKKASNLALQMLIQKPEQEEILLDLIISRLSHKDNKMSSYVFKMLDTLLLNH
FT                   EKMKGVVVKGILTKVKSLLPKLQSELIKGTPGIKESGRRRKRRKLTINNECILILKSIY
FT                   RCILYFSKLHYTKSDHSIVNVILKDAIDILLLFIRQNSTNDNKNNLKDATKTARVPNVL
FT                   LCKYEECDRIIKILLLFINKLLNYYKNTDDYDQKKSLFNSGIIENLYELSYKTKSRSIT
FT                   ISLLVLMYHICPNSDEYYKLLYNNAFNIRLYESTSVHKFLTLIQQILEGKNEKNNILIR
FT                   KLLQVTLCNCNNNINSEIINTVLNNTNNDNFWELKLQKLSYNPFIISTLERKYNKDDEN
FT                   YNLYNELSVFSSALQLDYTLEKYWRNRQSCKLHQKPFQLYYQSKFNLQNIKEDYHSSDD
FT                   ISVTDDLTELDEDESSDDLSDEDITEENDTDSHDFTDTDDDLTDEVDDHE"
FT   CDS_pept        283517..285085
FT                   /locus_tag="TA15450"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.52 - hypothetical protein, signal
FT                   peptide"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA15450 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.676, signal anchor
FT                   probability 0.000) with cleavage site probability 0.375
FT                   between residues 21 and 22"
FT                   /note="GPI-Anchor Signal predicted for TA15450 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA15450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74136"
FT                   /db_xref="GOA:Q4UFI0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFI0"
FT                   /protein_id="CAI74136.1"
FT                   /translation="MKILLINYLSFITVISRVTIAYNCKIIDGVCNLRRTLINLKRSEN
FT                   KTLMPYKKYNLSFIGLNNNFRNNVLVKKYICNGLYSLEQAQEPSQIGSTSEISKEEYDI
FT                   FPDITPIENTGETLVFSDFSDLYKDLTIPVKSDQSPDKTETTSEGFDKFTDDELEREFI
FT                   LEESVYSLSKRLFVKKLFKKLPQIVDTKPFLVRSKAYVKGKVGSKCDLSMFDSNKVKTA
FT                   DIKEKPFEDIKSILPGVFTGLHTLKHTKKRIIRELKVKLDLYVKAITSQLKNITNFYGQ
FT                   LLKYIHPFQYTMLKTCLHELYSTGKSKISFDKLMDELELAKKQIIFRGSDINKQIGNIK
FT                   KCRHAFNFVKENIFELDSLYSSFQNLYDHYKQYSTVLTGLPLVDIEKPIISIIGHVNVG
FT                   KTTLFNKLSRGLILTDLKDHVEIISDSLGLRWSNLKNNFKKLNKEGKVADYKFTTRGIN
FT                   LSILTYKVNNFIYEGQVIDTPGLLWRQGHTNYNPYEKLTVSSYLNYYFLVFCLERFTFR
FT                   SYILF"
FT   misc_feature    283517..283579
FT                   /note="Signal peptide predicted for TA15450 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.676, signal anchor
FT                   probability 0.000) with cleavage site probability 0.375
FT                   between residues 21 and 22"
FT   misc_feature    285582..287339
FT                   /note="Possible centromeric region"
FT   CDS_pept        complement(288091..289464)
FT                   /locus_tag="TA15445"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.460 - transmembrane protein"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA15445 by TMHMM2.0 at aa 15-34, 92-111, 121-140, 147-169,
FT                   184-203, 233-255, 307-326, 347-369 and 379-401"
FT                   /db_xref="EnsemblGenomes-Gn:TA15445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74137"
FT                   /db_xref="GOA:Q4UFH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH9"
FT                   /protein_id="CAI74137.1"
FT                   /translation="MASAEAGNKCDGKKIAAYALVGFSVLLTLRVGMNGAPFCMKRFKI
FT                   PEHLFSLYVSRVHNCMELGCSAGVTAGTIYNIKYGGEYKQKCEKVSIGINLLFFLVNVV
FT                   LLIVFVTGGEEGHLTDFYWTLALSAFIYGMNLTFIIKLAGDCIVYYLATLHVSGIFISL
FT                   YHFIFLKLFGNRRKFNTDYLIIMWQIILSIIITAATASVWTKAYTNGNGNDKCGENGSS
FT                   QKNGNGGSAEVAISPMIMCVFAQCVVYIFYPAIAPGLLVDFRHVNKIDQALLIIAPIPS
FT                   ITFAVLDAAKQDKYTPKNEWTGGKEAWHGTLIFIPIMIICGYLFIKALHYPHSGISLAI
FT                   INNPRMVGFLTILFYMSHMILLAVGFPGVEKNSGSAKDYLPTINTFMTTIFMVLLIFFG
FT                   EGYVNEFKKHDRSYWPTQGLSTKRAFGFWFDKAIQNAFKNFLLIFTRDLRRDLMSALD"
FT   misc_feature    complement(join(288262..288330,288358..288426,
FT                   288487..288546,288700..288768,288856..288915,
FT                   288958..289026,289045..289104,289132..289191,
FT                   289363..289422))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA15445 by TMHMM2.0 at aa 15-34, 92-111, 121-140, 147-169,
FT                   184-203, 233-255, 307-326, 347-369 and 379-401"
FT   CDS_pept        complement(289931..291127)
FT                   /locus_tag="TA15435"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.459 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74138"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH8"
FT                   /protein_id="CAI74138.1"
FT                   /translation="MGKTKTPLCGFRRRNKQKESFENNNMENTNQENDDELYVGNENTN
FT                   YDNNNNYYAQNNNENNENNNNEENYGNNDDQMLEGEFTENPLNLENEEFDYNGNGNETG
FT                   DNEDSETLNELLDKMENEDVDLENIKNLTLTMDNNSELKNLQSFVSNKLTELLKKTSLG
FT                   EKCINSLAPLCTGPESGPLDKLLSLGNGCLHNNQNPLNNEEFQVPEKEEYRDPPTLPSG
FT                   IKFVDDFNKLLDSWADQPSQGNNYTANLFKIFNLSALLKHLGDPRYVEILNKLGVNNLL
FT                   NYPDNNKKWDQILLNCENSDNGNMEYVKHPLPDLPNPKAISNCNTKLVDLPELDNNNVD
FT                   EHAFKLYWAYTNTWLNKMFGPSLRNSHKFVQPTKNWYMNMERASQLFFLRLSKTLCST"
FT   CDS_pept        complement(join(291715..291858,291891..291945,
FT                   292015..292175,292281..292367,292407..292523,
FT                   292562..292723))
FT                   /locus_tag="TA15430"
FT                   /product="subunit of proteaseome activator complex,
FT                   putative"
FT                   /note="PF02252 Proteasome activator pa28 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TA15430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74139"
FT                   /db_xref="GOA:Q4UFH7"
FT                   /db_xref="InterPro:IPR003186"
FT                   /db_xref="InterPro:IPR009077"
FT                   /db_xref="InterPro:IPR036252"
FT                   /db_xref="InterPro:IPR036997"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH7"
FT                   /protein_id="CAI74139.1"
FT                   /translation="MEKKLNGISVDKIDPFDPEVKDKYQLFKEEITRSALYSLRERIPK
FT                   KILYFNSLVAQNSKNGCTFSSVDLDQESYRCLVNHDVDSKRAKRTHDQTGDVFLPSHKQ
FT                   IFAELEKIKLEASELIEIISNIKLWIQLNVPRIEDGNNFGVGIQEEVIQELTRVEDTAF
FT                   NLYDAIVKYYMARAKLSTKVIKYPHVDDYGEAIRELDEKEWIHIKITRVDMRNNYSMLY
FT                   DLLCKVFYHIHTHYIYPSK"
FT   CDS_pept        complement(join(292903..293501,293680..293739,
FT                   293772..294003,294107..294190,294233..294346,
FT                   294431..294703,294815..294979,295011..295181))
FT                   /locus_tag="TA15425"
FT                   /product="CTP synthase, putative"
FT                   /EC_number="6.3.4.2"
FT                   /note="1 probable transmembrane helix predicted for TA15425
FT                   by TMHMM2.0 at aa 5-27"
FT                   /db_xref="EnsemblGenomes-Gn:TA15425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74140"
FT                   /db_xref="GOA:Q4UFH6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH6"
FT                   /protein_id="CAI74140.1"
FT                   /translation="MKYVVVIGGIMSGIGKGTLLSSIGVVLRSRNISMSAVKIDPYLNL
FT                   DAGTLSPNEHGEVYVLDDGGEADLDLGNYERFLNLKLTRSHSLTSGKVYSRVFDKERRG
FT                   DYLGKTVQVVPHIVQEVIEWIEEASRKNVDRKGWRDPEICLLEIGGTVGDIESEVYVET
FT                   IRQLKLKLGNENVCLCHLSYVPIVGRQDEQKSKPTQHSVKALSQRGLQPDMIFCRCMNE
FT                   LTNSTKEKIAFFTQVKFKNVISVHNTSDLYRVPLMLDEQHVAESILELLNFTPNKVDPM
FT                   PIEYSLTHWSRFCENPENETVTVGIVGKYSASTDSYLSVLNALKHSSLECNLKLNIKWV
FT                   DYSKFEDYDSEKFKSHFKDLDGVLIPGGFGTRGFMEKKMAVRYCRLNKVPFLGICLALQ
FT                   LTVVDVAEEFEPKACHGEDSKTEEKYHVVTLMPEFSGKDKKGGTMRLGALETKLVKGTL
FT                   IYSLYDKKDTIVERHRHRYQVNPAYEERLTNHGVVFSGRDPTQGRVSVVELKNHPFFLC
FT                   TQFHPEYKSTPITPSPPYLGFILACKNRLNQRLEKNNGKLLPGSSYYH"
FT   misc_feature    complement(295101..295169)
FT                   /note="1 probable transmembrane helix predicted for TA15425
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(join(295558..295940,296003..296548,
FT                   296643..296715,296768..296856,296907..296954,
FT                   297043..297097))
FT                   /locus_tag="TA15420"
FT                   /product="DNA primase small subunit, putative"
FT                   /EC_number="2.7.7.-"
FT                   /note="chr2.cand.454 - DNA primase small subunit"
FT                   /note="chr2.cand.455 - score = 10.85"
FT                   /db_xref="EnsemblGenomes-Gn:TA15420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74141"
FT                   /db_xref="GOA:Q4UFH5"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH5"
FT                   /protein_id="CAI74141.1"
FT                   /translation="MPIQADSVVTESNLRFYYKNFCPIKDLVRWIGYEDPSILKRREIS
FT                   LTLHRGDTTNATEIYLRWQTFESFESVFETLCNSDSVPFKFDIGAIYSNKISLMQLSGD
FT                   FRPVEREIVFDIDMDDYDEFRTCCSDKKVCNKCWRYIKIAVELITITLKEDFGFVNVLW
FT                   VYSGRRGIHCWVCDKTARQLPTEGRISIIEYLNLISDGFAKKVNLYAIDKHPLVLRAFH
FT                   ICYRNFKHLLAEQNFFSHKTHMKTLLDYVPERHSNVKRSINNCIENSQKRYNSVDFFNS
FT                   ICDMLNLTRPEDYVGKVEAGDFPGFFMEIIIAFSYPRLDVNVTKDMGHLLKSPFCVHAK
FT                   TGTFTISSSNINNLGLGRICVPLDHENLDKFNPESVPTIGITMLYHSTTHISYTFFT"
FT   tRNA            297169..297240
FT   CDS_pept        complement(join(297331..297482,297534..297592,
FT                   297660..297748,297830..297892,297947..298186))
FT                   /locus_tag="TA15415"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.453 - hypothetical protein, low similarity
FT                   to ss-binding protein"
FT                   /note="Signal peptide predicted for TA15415 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996, signal anchor
FT                   probability 0.000) with cleavage site probability 0.427
FT                   between residues 18 and 19"
FT                   /db_xref="EnsemblGenomes-Gn:TA15415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74142"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH4"
FT                   /protein_id="CAI74142.1"
FT                   /translation="MILLSLFLSFCCCITLRTSPYSNNLFFIKSNLPLKYSNRIQKLYD
FT                   YDETFSDIVDNFDPGEDSQPYQDEGFQEKEPVRDHLDLSANSVTICGRIGFIAEPKRMR
FT                   TGLVSTEWHKVMLYGIRNVDYVYSRARVGDKALVIGRLRYYQPQNLETNGVNRTKIAEV
FT                   YVNSSRGGHTFILMPKISTNLDNNFISANHQIYPNNF"
FT   misc_feature    complement(298133..298186)
FT                   /note="Signal peptide predicted for TA15415 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996, signal anchor
FT                   probability 0.000) with cleavage site probability 0.427
FT                   between residues 18 and 19"
FT   CDS_pept        join(298611..298859,298918..299085,299159..299450,
FT                   299485..299588)
FT                   /locus_tag="TA15410"
FT                   /product="adp-ribosylation factor, putative"
FT                   /note="chr2.C.cand.53 - PF00025 ADP-ribosylation factor
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:TA15410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74143"
FT                   /db_xref="GOA:Q4UFH3"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH3"
FT                   /protein_id="CAI74143.1"
FT                   /translation="MEFKFFIKTFPFNVLRFSGKLFQSSLRLFFLIFKYIFRSTTDLYA
FT                   NILDSLKRPCENILILGPRNSGKSSLLYRIKLSEFISTSATGSSIEEELYLCRFCLVSS
FT                   AICGHPKLQEYDKVKVRLYELGYNDPISTYQQQIQICNKIIYVVDSFGDFRYSEINKEI
FT                   LTMISEHSYHHNLPKYVIFLAKNVLLKLSHYVQDIFGGMNYNSIRKALEIPEQLNNRLV
FT                   STYPLLNTFISYVHRSSITGEGVFESLSFLLFDNGENNKNEKNDLIVL"
FT   CDS_pept        join(300095..300109,300168..300398)
FT                   /locus_tag="TA15405"
FT                   /product="hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA15405
FT                   by TMHMM2.0 at aa 58-80"
FT                   /db_xref="EnsemblGenomes-Gn:TA15405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74144"
FT                   /db_xref="GOA:Q4UFH2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH2"
FT                   /protein_id="CAI74144.1"
FT                   /translation="METKKKFSSPTALAVSPPKLTFHRRIARGAFGVVYLVSDDTGTQF
FT                   AVKRSKKLLFHKQSIIYLVIYHLSCSLVLPFYSLVT"
FT   misc_feature    300324..300392
FT                   /note="1 probable transmembrane helix predicted for TA15405
FT                   by TMHMM2.0 at aa 58-80"
FT   CDS_pept        300593..300955
FT                   /locus_tag="TA15400"
FT                   /product="hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA15405
FT                   by TMHMM2.0"
FT                   /db_xref="EnsemblGenomes-Gn:TA15400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74145"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH1"
FT                   /protein_id="CAI74145.1"
FT                   /translation="MIKCEMNKNFNSINQTDYQTNSQTNYQTTYQNIIRYTFSDCPCPI
FT                   NQTQYTNLNNQPNSIIQLSCVNQPGTNNQLSGVNPGLGIYTDLCNKLIYILRYIMETIN
FT                   CLETFVLVLKKYMIED"
FT   CDS_pept        join(302062..302120,302156..302198,302286..302929,
FT                   302997..303312,303392..303958,304034..304141)
FT                   /locus_tag="TA15395"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.54 - myb/SANT DNA binding motifs"
FT                   /note="DNA-binding protein, putative"
FT                   /note="1 probable transmembrane helix predicted for TA15395
FT                   by TMHMM2.0 at aa 7-29"
FT                   /db_xref="EnsemblGenomes-Gn:TA15395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74146"
FT                   /db_xref="GOA:Q4UFH0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFH0"
FT                   /protein_id="CAI74146.1"
FT                   /translation="MESTSFSISIIFLHFLNIFKIYFLMFVLHIFKASEISQLVGKDGT
FT                   RPSSNLDSCRLHSFYSNLPLYRKKYDWNIPKWTESDLVKLHKLVRTTVIFHLSHKIDEL
FT                   TDKLTYIENKKVSDILNLLTSRLLYLIYLNFDFSILARNLANLVRSDKYNEFLNGLHHS
FT                   SVYKVFENIYLPNRPKFQGIDLSVFWDSIASSFNSDLKGTMATKLSTDCCIKFINSTSS
FT                   GVLLTDVSPSDFQRIEQFLTQTHNSNKIAIYIIPLFLQLYNCVTCVYRHVENSVYLGVS
FT                   VYQYMKVFLHRARTRNWSSREDSILLDLVSSTTCPSDSSQTSGRISIPWRKISSKIPGK
FT                   NPEQCRLRYRQISNRKVSDSPFMKKDLFRLKILMSAFGRNWSRISELMPGRSARQCRDK
FT                   VLECTRYTKDNAIESLEYFRNLLTEYSSVESSEYIPNVSLERPMFVSRYWKHFDWLGIH
FT                   LFKVLALTRNEHLLQILHEFYFSDEINRRINLSFKPDRAQYVTECTGVQIFAVSNFLQH
FT                   IAAQQDDTNYEKVINITQSIVKLMLKRSAKGEQLNFENFDEPKEFEHLKKSLLNILKTL
FT                   WP"
FT   misc_feature    join(302080..302120,302156..302183)
FT                   /note="1 probable transmembrane helix predicted for TA15395
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(join(304303..304547,304675..304988,
FT                   305059..305161,305191..305260,305586..305780))
FT                   /locus_tag="TA15390"
FT                   /product="hypothetical protein, conserved"
FT                   /note="1 probable transmembrane helix predicted for TA15390
FT                   by TMHMM2.0 at aa 209-231"
FT                   /db_xref="EnsemblGenomes-Gn:TA15390"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74147"
FT                   /db_xref="GOA:Q4UFG9"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG9"
FT                   /protein_id="CAI74147.1"
FT                   /translation="MKVEPGDPVILFSGPNNIYLTQIPKEDHKIPNKQSEANIKNKRLI
FT                   HNKKGIFDLASCIGKFYGQKYRADISLIILLLDLIPGKRVLECGTGSGSLSYALASAVS
FT                   PNGHVFTFDFHQQRIQYSLDLFEKTKISDMITVTEADAYSDKAFLVSGSTHSITEHSID
FT                   SVFLDVPSPWNCINNVTHVIKVRYGACSNCTSLTTSNIILSTSISIFITSILSTLTILI
FT                   INILSVILLSSGSVIRTFEVLTKPWGISFSNPDDTDSDDEGSDLTSIHMINKDVNDSGE
FT                   ILGKYVNYQLPQFNHTGYITVATSNIY"
FT   misc_feature    complement(join(304537..304547,304675..304732))
FT                   /note="1 probable transmembrane helix predicted for TA15390
FT                   by TMHMM2.0 at aa 209-231"
FT   CDS_pept        join(305886..305931,306034..306168,306282..306380,
FT                   306428..306482,306516..306649,306796..306899,
FT                   306930..307019)
FT                   /locus_tag="TA15380"
FT                   /product="CDP-diacylglycerol-inositol
FT                   3-phosphatidyltransferase, putative"
FT                   /EC_number="2.7.8.11"
FT                   /note="chr2.C.cand.55 - PF01066 CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15380 by TMHMM2.0 at aa 20-42, 91-113, 140-162 and
FT                   182-201"
FT                   /db_xref="EnsemblGenomes-Gn:TA15380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74148"
FT                   /db_xref="GOA:Q4UFG8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG8"
FT                   /protein_id="CAI74148.1"
FT                   /translation="MEAKRPRLLNKPNFITSFRVVLFCTSFLYYKTKPLYFLGFYVSSV
FT                   LLDMVDGEVARKYGEATIFGAMFDSLFDRMTTAFLYMHLSMKYPRYFLFFYFVLVWDVV
FT                   GHWAHNYVCCLLGNTNHKKIDGFFLLKMYYEKRRMFLLPRLYPVIYNKTNINVRFLTYG
FT                   SLPLAAFKAVSPLFSSSTHLSYTFTIVIFTNTAQFFYASKRLSIYEVEQFDLKAGAR"
FT   misc_feature    join(306045..306113,306371..306380,306428..306482,
FT                   306516..306519,306598..306649,306796..306812,
FT                   306870..306899,306930..306959)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA15380 by TMHMM2.0 at aa 20-42, 91-113, 140-162 and
FT                   182-201"
FT   CDS_pept        join(307330..307468,307682..307804,307884..308146,
FT                   308241..308429,308548..308600,308690..308747,
FT                   308813..308887)
FT                   /locus_tag="TA15375"
FT                   /product="SNAP protein, putative"
FT                   /note="chr2.C.cand.56 -snap protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74149"
FT                   /db_xref="GOA:Q4UFG7"
FT                   /db_xref="InterPro:IPR000744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG7"
FT                   /protein_id="CAI74149.1"
FT                   /translation="MSTAEDLEKQAKKHTRKFLFNLLGDSSEEAQELYNQAGNKYKQLH
FT                   QWKDACRCYYEAAKLSEKNNDDIFLATNLVELSNCMKKMNPTSNDFVDPLLRATEVYSN
FT                   QGRFSQTGRILKNLAENFEEKLDYESAMKFYKKSAESYELDEYGKVSGSQVLLKYADLA
FT                   SSITDSYEECIQIYEEEGQKNLKNDLLKFGVKDLLFKAGVLRVLSADATDARIAFGKYC
FT                   SWDRKFGKTREGKLLSSLIEAFEAGDFSKLQDELNVFESLGRLDNWKIKVLCKLKEKME
FT                   GASTPSGPVNDSDHVDLT"
FT   CDS_pept        join(308985..309013,309090..309120,309234..309538,
FT                   309670..310213,310368..310520)
FT                   /locus_tag="TA15370"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.57 - WW, FF domains"
FT                   /db_xref="EnsemblGenomes-Gn:TA15370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74150"
FT                   /db_xref="GOA:Q4UFG6"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="InterPro:IPR039726"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG6"
FT                   /protein_id="CAI74150.1"
FT                   /translation="MEGNTITTKSIYFNFPKNIYTKKSQWEKPNELKTEKELIIEAKTK
FT                   WRTFATAEGKVFYYNSETKESVWEVPEEVKNLLGEDNLLDTVQDNTKAAFLTFLEGFNF
FT                   TQKTTWENALKLLEADPKWPVFSILSKGDKKQLFSEFCSQIHRRKQEEQRKKKGMLEEV
FT                   MTRELLAWDELSYSTVYADIAKHFHTAEWWDWGDELTRDSIFQEFMEREEVRLKKKRKE
FT                   SKIAAMDTLIDLMTKDYSQELTPWETAKTKYLGFQGLYNIDVLNSHKYVFKEVFVEKFK
FT                   EAQRTSFRLQRKIRQRFLTFLQMMVEKGEINENTKFSDFISNHSTEAVYVDLVGQPGST
FT                   PIDLFTEIQQSLV"
FT   CDS_pept        join(311568..311900,312062..312153,312301..312445,
FT                   312550..313380)
FT                   /locus_tag="TA15365"
FT                   /product="CTP:phosphorylcholine cytidylyltransferase,
FT                   putative"
FT                   /EC_number="2.7.7.15"
FT                   /note="chr2.C.cand.58 - Cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TA15365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74151"
FT                   /db_xref="GOA:Q4UFG5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG5"
FT                   /protein_id="CAI74151.1"
FT                   /translation="MLHLGQMRHLEQAKKMFKNVYLIAGVTEDDETIRYKSHIVNSMVE
FT                   RAEMLRHIKWVDEVIAPCPWIITPEFFHKNKLDFVAHDDIPYSAVQKVSENKTKHCEDI
FT                   YKWLKDEGKFKATYRTEGISTTECIIKILQNYEDFIDKFLKNGLKPSELNIPITTGKSI
FT                   LLKKTILTLLDKLSTQLTQLTLTNEPLGAGFNDRIDLVISNLFKGVAIWLNKHSIILED
FT                   FKEIPYVPSHETVYSKSVSLEPVESIPKPNLPSANYKEDEEVVVYTYGVFDLLHYGHAR
FT                   HFEYVKKMFSRVRLIVGVLTDEDTVTCKGRLIQPLHIRAATLEHIKWVDEILSPCPLEL
FT                   TQEFLNKHRIDYVCYNDDPMINTESPLWCSLNKLGRVIYVPKTVSMCTTSLMLNILKNY
FT                   DIYLKRSLDRGVCRRELKLGYAKERSLMVKSSIKNFQKKLNDEITQLTLMDKHIVSMVF
FT                   RYGACTHH"
FT   CDS_pept        complement(join(314180..314387,314561..314662,
FT                   314738..314880,314977..315180))
FT                   /locus_tag="TA15360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74152"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG4"
FT                   /protein_id="CAI74152.1"
FT                   /translation="MDSCKSAKLVDSFDNSFYSEKNLYKKDQNLSNSLGDNLVYELKQL
FT                   DSTLDDLFLTTNQQLNTHYSIHKFRLKVSRRISSFSSILKSLSRQCESLSNSQQRVKLF
FT                   TLHQFYNDRLMKHKNRLSEWWSRNERRYHDLYLSSFVSHMKNSDKLKVEAYEASDFSDN
FT                   GDSESDEGFITKKLKDTRNMMISQINQMDAAEPSLLKSSQYITQQVYILNCIHNI"
FT   CDS_pept        complement(315989..316210)
FT                   /locus_tag="TA15355"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.452 - score = 6.55"
FT                   /db_xref="EnsemblGenomes-Gn:TA15355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74153"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG3"
FT                   /protein_id="CAI74153.1"
FT                   /translation="MKKSKENEELWEERKKLVNEILKDYTSNVNECLKIKVNSTHSINT
FT                   IIVNSKGILNFFQDFYELFHQNSSNAIT"
FT   CDS_pept        complement(join(316449..316643,316824..316907,
FT                   316940..317029))
FT                   /locus_tag="TA15350"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.451 - score = 12.14"
FT                   /db_xref="EnsemblGenomes-Gn:TA15350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74154"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG2"
FT                   /protein_id="CAI74154.1"
FT                   /translation="MYGENVPRFYDNVTCRQFNMLGDYIRCYEKINLNYLLNDNSTAGD
FT                   DNKHQIPDESTQPCLEKRMVNYYDNVVLSSKLKLAEEKIEQLKEQARKASEDFHSMELI
FT                   MKQTYYNDLKLSQVSYGT"
FT   CDS_pept        complement(join(317104..317318,317381..317919,
FT                   318033..318220,318299..318493,318538..318650,
FT                   318685..318766,318809..318959,319021..319250,
FT                   319282..319317))
FT                   /locus_tag="TA15345"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.450 - score = 34.02"
FT                   /note="1 probable transmembrane helix predicted for TA15345
FT                   by TMHMM2.0 at aa 512-534"
FT                   /db_xref="EnsemblGenomes-Gn:TA15345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74155"
FT                   /db_xref="GOA:Q4UFG1"
FT                   /db_xref="InterPro:IPR024943"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG1"
FT                   /protein_id="CAI74155.1"
FT                   /translation="MKQIILLISINKSLQREGASPETLDDVNSLIDYVVHSKQTNVNRT
FT                   KPLKDVVRKKIEVPPTVLHKDENVVSYPFQIPPRYIRYIQTRVSVPGIKISENTVIHYN
FT                   LYKEDRVFIETFNSRSSDLQISTVSHLYNLGQLISNEFLIIMDILEKTASQCNANKPFS
FT                   YEFGLLMARENGVSVPAYILREVHTVSLHHSLKDILYTRFAHWVRRRNEFGLPLIRHLW
FT                   PQTCPNDTSPLALFRPRAKDKMLLRRSRRTQAENIQYLYHLIDGFKRVLKILSKMRQRD
FT                   EKKLILAELDIVLFDQRRNELVDPTYTCPFWNCILDIKKSKAVKRRKTNSICSDEGIPG
FT                   RDMKLDYVERTVLGENVLDLPEPESYKTMRLTRRLGRGGRIWIDRFHINHNTSNSLNNS
FT                   NSHTTTKDTNTNNTKESGTNANASETSDNTNTTADNTENAQMDKELKIKKEPVEQESDK
FT                   EGVEDEVAINNNLDRALNLSNFDNFNIYSNETVLDTRPPFANPYEAGHVYNTLVLYYYH
FT                   LICLLFLLTLVILVIYVMCRIIDVFDTWIHKEAVPGAELAGQHERAGLIKVISSAPQNN
FT                   SIHSFA"
FT   misc_feature    complement(join(317251..317318,317381))
FT                   /note="1 probable transmembrane helix predicted for TA15345
FT                   by TMHMM2.0 at aa 512-534"
FT   CDS_pept        319965..320282
FT                   /locus_tag="TA15340"
FT                   /product="hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA15340
FT                   by TMHMM2.0 at aa 15-36"
FT                   /note="Signal anchor predicted for TA15340 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.721) with cleavage site probability 0.001
FT                   between residues 31 and 32"
FT                   /db_xref="EnsemblGenomes-Gn:TA15340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74156"
FT                   /db_xref="GOA:Q4UFG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFG0"
FT                   /protein_id="CAI74156.1"
FT                   /translation="MCFDLFRDSSEDTELIVLVVPLGLFLPLQIPRLIFWKNTAMIATQ
FT                   DKPENTHRYFIIISNSYFRFIFRVFSCNFQLSKSQFSINLISENFPQKNSSLLIQFMSY
FT                   N"
FT   misc_feature    319965..320057
FT                   /note="Signal anchor predicted for TA15340 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.721) with cleavage site probability 0.001
FT                   between residues 31 and 32"
FT   misc_feature    320007..320072
FT                   /note="1 probable transmembrane helix predicted for TA15340
FT                   by TMHMM2.0 at aa 15-36"
FT   CDS_pept        join(320764..321178,321285..321419,321451..321587,
FT                   321636..321732,321854..321909,321939..322100,
FT                   322215..322332,322362..322449,322490..322559,
FT                   322691..322892,323024..323206,323293..323366)
FT                   /locus_tag="TA15335"
FT                   /product="ubiquitin carboxyl-terminal hydrolase, putative"
FT                   /note="all_bases.cand.1290 - ubiquitin carboxyl-terminal
FT                   hydrolase, zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:TA15335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74157"
FT                   /db_xref="GOA:Q4UFF9"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR033809"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF9"
FT                   /protein_id="CAI74157.1"
FT                   /translation="MVGRPKKSGGKRSKSSSPVPKSNPRAGRSPKLKPVKETPPKVEES
FT                   TRTRSSRTSKRSLSSSKSSVSPSKSPSKSPPKRAKSSSKSPSRPKKGQKVNDESVLSHN
FT                   NDKNLDETLTIAQCDEPLSSQNESSVPQVPVPPKVKVLNCPYLGTINRHLLDFDFEKVC
FT                   SITLSNVHVYACLVCGKYFQGRGKNTYCYTHALEECHYLFMNLEDCRVYCIPENYPVDD
FT                   ASLDDIKHFLKPVYTKKDVQTLSTQVIYGKALDGTDFIPGCIGLNNLKNTDYFNVIIQL
FT                   ICVVEPLRNLFLVFDVNRVQPPDPVIITLSQLIRKIFNVKNFKGIVSPHEFVQSVGIVT
FT                   NGLYKIGVQSDPVSLLSWLLARIHQKLHNRNTKESVVTKTFGGELLIKTLKKTRWETER
FT                   QPFRMLSLTVPEAPIFKDSMDSNAIPQAQIFELLSKYDGVTETVNANGDVCTYKLSKLP
FT                   KYLILIIKRFTKNNFFLEKNPTIVSFPMKNLDLKDYVTEEIKDSVTRYDLYCNICHEGK
FT                   PTGGIFKVHVYHAPSGNWFQMEDLLVTSILPQQVALTESYVQVYKRQDLTTVPEEEVDM
FT                   FS"
FT   CDS_pept        join(323527..323625,323792..323939,324080..325083)
FT                   /locus_tag="TA15330"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.61 - rna binding protein"
FT                   /note="SR protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74158"
FT                   /db_xref="GOA:Q4UFF8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF8"
FT                   /protein_id="CAI74158.1"
FT                   /translation="MELDENEDFDLYEGLENFEDSSNSGADYTAPKDELYEKEDLSAED
FT                   DDLQLVVNDDDLVSKGAPIQAQTAPKKTTKHPLLNRKHRNFYVGAPTSGEVSTLPMGNI
FT                   EFFVLVKNLPVWIDNSGLRTYVEGITGDVVYCKVLYNFYNGSPLGVGFVEFSQISSCTA
FT                   FLKHKSQIGSEPMTVDVFSQLKSCEKYRDGIVSEPFTKSVCRHFSQPYSSTNFNAVSQQ
FT                   DLVEIEFERQQEELAKTGEYELVSKTFPWFNFDLVSMMGNSRRLSAKDSQPEPSNHLKA
FT                   FSKNTKLDPFSNKLTLLNLNPIVLPSIPPPTLSHTKPLSQSVIPMSKNVDKRSPSQKTT
FT                   KTPTNSSVSSEIPKDKKRDRNKYEKTDERSKKRKTKDRGELREKSRNRSRSRERSKQSK
FT                   RKSPDRVSGRKSTPKRR"
FT   CDS_pept        join(325167..325313,325340..327658)
FT                   /locus_tag="TA15325"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA15325
FT                   by TMHMM2.0 at aa 785-807"
FT                   /db_xref="EnsemblGenomes-Gn:TA15325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74159"
FT                   /db_xref="GOA:Q4UFF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF7"
FT                   /protein_id="CAI74159.1"
FT                   /translation="MYKLVLFMPTDSQTIPLKYSRRPMTLKKLPVLNPPVNLVLLRRLI
FT                   SNKVDKATTLAQKAGLLHTAAEKIVQASQQQGTPLATLQGQAGLLKTAAGNESSGSGLF
FT                   TTAEELLEQATQLGQPAHEQADGVIDAFDKVDKQYEALMGKAKESGLTSDPKVTAVIKA
FT                   YHGVKNTYYQMLIGYRFRYLIGTGGDEKILHKANELYGAADSLAKNLQSDQEPKKTLKE
FT                   LANNLANATNDTAGLQQALSELKGAQDDQIATKALAVITKFKEVKNAYDKVKEKEKEYN
FT                   RLAGPEYSPVKDAFKALEEKFGVLKKSIVNVLKLRVQELSALAQALNQKASTLSTSDIS
FT                   ELRDQATQLANAASQSTGLHAKAAALVEAINNGEAATESRAGGVITQFGAVRTAYDALA
FT                   GQPTYSSVVEKIKQGQPLSDGDELKVKKVDDAYTALKTLYDKILNFTKTTKVKAAAGTG
FT                   TSDGKLRDLADKLYKTASALNTAVTNFDDSSGDAAKVLQAKAGTSQSSPGTLRKLAADL
FT                   HDKADALKNAVTSASPAVNDANAAQQLATAVGDSETAPGISLRKALAQLATAQAGDLTT
FT                   PAKAVTDAYKKDDSDGVKDKFEEVKKKESTYNANPATKAAYEAVVAAMNAFDAVYRPEE
FT                   LLMEAIAEEGTQGDNLAKALNDLSSLYAEKGTPNLLPSKATAVKKAFVDGFGPTVNARF
FT                   NAVVAQANAYEQGTTIKSEKYAQLLEAWTNFNNKYYEVISFYKYHIIILSSIIIQWSYW
FT                   SPKTVFAGDGMGGWKKYEYGFGTPKQLVNNSFWHAFDILIVLKISLAVIFICCLHYRDS
FT                   SLSRSIVNH"
FT   misc_feature    327545..327613
FT                   /note="1 probable transmembrane helix predicted for TA15325
FT                   by TMHMM2.0 at aa 785-807"
FT   CDS_pept        join(327688..327724,327736..328919)
FT                   /locus_tag="TA15320"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA15320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74160"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF6"
FT                   /protein_id="CAI74160.1"
FT                   /translation="MCTWVTGDTITKSGGALDDKGECQDCTTECDTTNSIKLQDALNLS
FT                   VAGDAVTLNGTSVGTPKFESNATITITSESVDFTELTENVTIKISTGGTIKNSDGNLTI
FT                   GNRISKGEVLKLDATGEITEPESAKGKAVNLKGTIVVTSTGQAIGSTLTISGGPSSGVG
FT                   GSLTLTSGAGNVTIQNVSNLKITSTALTSLKGATGTLKIGTGSPDTPVKYKIFTSNTII
FT                   LGLNTLSSITANADGAKVTLKGVPTSQITIAPNGTTTDGINATLNDITFTKDDNGFTSL
FT                   KGDGATLTLAQTFTGAKIIKSGGQLTKDTHLTEGTELKLECTTSTSGTTITITNIKVTS
FT                   HGKSLNGADTYNLIGGITGTLSITAGGGGVTGNLTITGIGYDSYEIHDKHQKDLCCYYG
FT                   KVYKWTQ"
FT   CDS_pept        complement(329081..329518)
FT                   /locus_tag="TA15315"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15315 by TMHMM2.0 at aa 50-72 and 93-115"
FT                   /db_xref="EnsemblGenomes-Gn:TA15315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74161"
FT                   /db_xref="GOA:Q4UFF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF5"
FT                   /protein_id="CAI74161.1"
FT                   /translation="MLIKYAQEYSPKTEYQGGAMLIKYAQEYSPKTEYQGGTGFVGWTS
FT                   EGPGFYHAFDIFLVIKISLAYIFIYSIHYRDSFMCSAIINQPKMSTALSIIFYMCHEIL
FT                   IGLMVTPLMVVSVRLLLLYLSRPLIPPASWIGNRTSSRVAM"
FT   misc_feature    complement(join(329174..329242,329303..329371))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15315 by TMHMM2.0 at aa 50-72 and 93-115"
FT   CDS_pept        329875..330693
FT                   /locus_tag="TA15310"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.C.cand.63 - score = 25.02"
FT                   /note="1 probable transmembrane helix predicted for TA15310
FT                   by TMHMM2.0 at aa 249-271"
FT                   /db_xref="EnsemblGenomes-Gn:TA15310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74162"
FT                   /db_xref="GOA:Q4UFF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF4"
FT                   /protein_id="CAI74162.1"
FT                   /translation="MLNVTKANQLNAQASGMLIDAGTLYTQANLLAGKAKGQTALDDEA
FT                   LKQKAGETPNDGLRGLAKTLYDSAKALQDAVSAGAGDGDEKAAENLATAVGQTESTGIR
FT                   NALKLLAEEQTTSQLSKKAQDVRDAYEKGTNGVKPKFEAVKGKKETYKSAGKESEYQAV
FT                   VEAWEAFNALYDADLKKLAKELNGAANTLSGSPTVTTAQNFKEEYDAFKLKGKSTITIT
FT                   GVGNSDKKNITITNLPNINDTFKPRQIKFWVIIFPSIVSQWLNLITYVIL"
FT   misc_feature    330619..330687
FT                   /note="1 probable transmembrane helix predicted for TA15310
FT                   by TMHMM2.0 at aa 249-271"
FT   CDS_pept        331395..333110
FT                   /locus_tag="TA15305"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="chr2.C.cand.64 - signal peptide"
FT                   /note="Signal peptide predicted for TA15305 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997, signal anchor
FT                   probability 0.002) with cleavage site probability 0.635
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA15305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74163"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF3"
FT                   /protein_id="CAI74163.1"
FT                   /translation="MRISSTTKWILLCLIIAQLCGAEGNGNSEDSPSNQAEQSQSADLS
FT                   SEQTTENNVEDVPKNSVDTHGHSPQDTQQSESENPSELQPTNNNEKLEEPSQGLEPTNT
FT                   PDVVATIFYVPIILTPVKLDLGIKRDTKDFNYRSTAVQCMYTPKSGRIFSEVIISDPYG
FT                   FSLVIWKPKSQSEYSYEVSVYTIKDTIILSVKISMLNGTKKVFGRPFIHSNWQDITFPL
FT                   GVKLLTTKQDGTKVELGPSDYILNTHCGHSFSYTFHLYPHPKCTEIKHENKTVWSYRSH
FT                   YIISNGIPISGSYPTCILYTISYNLNHFLCKHYKKDSEIHNFRLWFSDGFYIDSSLENG
FT                   QWKQKFHLYKTLSLPIASETDNEISLDVTLDKSTDQFDYEYYNCPNSGYSVFKIFTAKK
FT                   GYKFASVTEQNLVIWNNSNDQSEFSTKVVAQTSIKFIEADKQVTIHTNKDNKIFYKLRE
FT                   DGKWIDSKEKYRKNKLKLITLNEDGSTSEDDTSKFDIGYDFSIVNYIFKSGAKCIEVKC
FT                   DDIVVWKYDSSQGESHYPQKVSFNTITGNIRILLNNRLYFYSLQGLEWNMVLQI"
FT   misc_feature    331395..331460
FT                   /note="Signal peptide predicted for TA15305 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997, signal anchor
FT                   probability 0.002) with cleavage site probability 0.635
FT                   between residues 22 and 23"
FT   CDS_pept        join(333694..333787,333882..334181,334211..334366,
FT                   334398..335149,335219..335634,335665..336037)
FT                   /locus_tag="TA15300"
FT                   /product="hypothetical protein, conserved"
FT                   /note="PF01535 PPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:TA15300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74164"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF2"
FT                   /protein_id="CAI74164.1"
FT                   /translation="MKIPSLLKRPTSSIPLPYEKILNDRFNFKIPSSDSSSNSQFLAVK
FT                   SIFGDLTTRTSSNKQDLPQNPFSNSSYRLKNDINFGNNWIHEKTNPENQTSDDFQRTSG
FT                   QIRPTIDSNHQLTDFSTVSGSTKCATKDSPISPFKHISKISKDVPNLDDLKPPLTDIFE
FT                   DLTVDSSETTFDQAISADSSGVFDVNGRYSSLEIYKNESVDSIVSRGIDVPEKLNLLIK
FT                   ERALRGLSDECLEILSEIKKLKIPLSIETYNNCLISCMKTNNAKLSRYLFLCLRSDLLT
FT                   PDLRTYTLMIKTHVNAGDISSAFSLYRKMENEGTKADLVVFSVLIDCLVRDRQIKNAWS
FT                   LFNYMRTWRLIDPDEVLFTIMIKSCSYSKEAEKALNLYQEMLTMNKFPTIYTYIELINC
FT                   LSNRKEYFHQCFQFYNQIKAQEYPINSHIILLLLQSCCTVGNVRKAKELILESRALGIK
FT                   PTLEMYNVYIKTLAAQMKLSKLTENEKINNINKTWSIVQSLLPLYRCNNSLNNENDGNK
FT                   DIAMEDGDKRKLVRLLNSVILVYENGGYYEYAMDVLNCFQVFNLTPDYMTYFILLRMVG
FT                   PKMKDPGRFFTLWSQAKTKIEPQKTLLCMALDMAILSRSAKRTLEILNDMYNAKVFPTP
FT                   ALMKKLYESGKKITQIHLMINNLVTLQRKITYQEKLNDNKILQTYVDEFELNKAITPNI
FT                   KI"
FT   CDS_pept        336327..337289
FT                   /locus_tag="TA15295"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.67 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74165"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF1"
FT                   /protein_id="CAI74165.1"
FT                   /translation="MSGLKVQILKGFNTYSDDLINKKNTNLNARRQFNTNISDLDDLTG
FT                   TRVRSNVFAVYQPRRKENTDFGGFNKKNKGSKEIVEKQEIEEKKIIEPEIVQQDEVDIT
FT                   SFLFENEPNKDTNEVTNEDKNDVTNEVTNEVINEVEVEDKKEQFTISEPLLAISDGEVK
FT                   GVEINDNSVIDMRNIDGYSDTDDSTIMDGHGLVENKKTKKDDLGEKFDKFMEMMKQRFD
FT                   KDEMRERHEQNMEKMKEGFNTLISKMGMKKSGEGRDRKLSRSSSGSSNDRSKNWGSGIS
FT                   RENLNKMGGKLFSSGVNEYVKNDVKKRCCLKLMKPKMGF"
FT   CDS_pept        337616..338284
FT                   /locus_tag="TA15290"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.68 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74166"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFF0"
FT                   /protein_id="CAI74166.1"
FT                   /translation="MDFNESFGPEIVKQFSAFGLWNNGNSLVFHHRGSTFHRLSLGRSF
FT                   NNSHLYLSLEETIFALLRTDFVLVDNDTKDFVTPESLIHSLENDHRVGDLLRVHVYLAF
FT                   QRLGKCPRPLIEFSDFTIKFPNIDPFLKLPSFPKKRDKVELHSLLEVFKKNLTSQNFDF
FT                   KTSIPFPSFTVDGLEVFTVMPDSAACDILDTLTAFNCIIAISNLESVYFLEISPLQINI
FT                   "
FT   CDS_pept        complement(338434..339294)
FT                   /locus_tag="TA15285"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.448 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA15285 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.912, signal anchor
FT                   probability 0.000) with cleavage site probability 0.880
FT                   between residues 15 and 16"
FT                   /db_xref="EnsemblGenomes-Gn:TA15285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74167"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE9"
FT                   /protein_id="CAI74167.1"
FT                   /translation="MRIICILIFVDIISCFNPNSVDYKVVKFRVYSKNPDYDRKLREQR
FT                   RSKRLKHALPLEDMKLDMMNQSLISGAKRMQKRIFGPRLSQVPGDGGEIPDLAKSTDKY
FT                   NHVKEYYSSYSTTYFKKNALTNSTEGTTGSTTNTTDSTSTNNTNSTTNNNNTMDNYGEF
FT                   FNDEEKTIKKILKDPNATFGEFEGQKPAIEKPFYKKFEGFQPESKYKIATMKRTLAAYK
FT                   QDFEEEFEGTQNYCGLRYEAVFSHASPENVEMLRQMEIEVKQGGLSPNNPILEVDVNVD
FT                   DQIDD"
FT   misc_feature    complement(339250..339294)
FT                   /note="Signal peptide predicted for TA15285 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.912, signal anchor
FT                   probability 0.000) with cleavage site probability 0.880
FT                   between residues 15 and 16"
FT   CDS_pept        complement(join(339368..339853,339885..339995))
FT                   /locus_tag="TA15270"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein, conserved, mal13p1.159"
FT                   /db_xref="EnsemblGenomes-Gn:TA15270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74168"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE8"
FT                   /protein_id="CAI74168.1"
FT                   /translation="MHSANCDCKAEHELATTFVCLREYLDLPSIRVFNSTTDPNLGRIV
FT                   FKPYDERLSPPEILSDPVETELLFTVPFSQPCDVHNFLAVNESEAALELKIFANRPDFD
FT                   FSDVEATVPTLTLNLPPDFHGSFIHNLNSVKFKGVQDLALHFLSNKGPVKLRYIGLRGR
FT                   PLQPVKGVVDVTYEVTPTADFNESLSEIKNFKIIE"
FT   CDS_pept        341038..342780
FT                   /locus_tag="TA15265"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.69 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="1 probable transmembrane helix predicted for TA15265
FT                   by TMHMM2.0 at aa 12-29"
FT                   /note="Signal peptide predicted for TA15265 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.952, signal anchor
FT                   probability 0.047) with cleavage site probability 0.555
FT                   between residues 34 and 35"
FT                   /db_xref="EnsemblGenomes-Gn:TA15265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74169"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE7"
FT                   /protein_id="CAI74169.1"
FT                   /translation="MISLKKLSKSLVLAARVLTPLVLLLLFWFSNVLKLNELSVSRFIY
FT                   NGICNNESMDGLGRIVCPSVPLEDELLVLKGKDAREVGEMSLPVVISTTKQTDNVVINS
FT                   DSSTPSSLYLILKMCSEYRAREKKHKIRLLDDLCPIISESLDNSDLIQLSGKNSQINQY
FT                   GREIVLWSSVSSLLRSLPYSGKLKHVKLLSNSLNKNEIMYKVLNSVSSYQDHITTTNNI
FT                   NTNSFNTCNSIKDEDTKSKNKPGCGRRNMSSGLNLLVTSGILSSSDDPFRLLVETAFPT
FT                   LIAESFGTIQESIHRLFLSFPEASASLLHMRKIGFEGINFSSLEPEIDRFTFLSVFLSA
FT                   LQLLLTYSFDNFKLYDGIVESSYSDMTNHWDKPNNQMNNSKDEKFHNSKGKKMNKSLLN
FT                   EFDDLDSRIFVDFITHRLGSFFINLEVKKRLFTIGNLGTKFTAKFLHNLILTNLTQPNL
FT                   VKGSGTELMKCKLRESLTALGKFISFDFNNDGEVSFEEFTKGSIDMNDFVNDVISAVDT
FT                   YGKSGLEKDPELQFVHLLNSQNTLYDKIIDEFIISDTDKNDSLSLDEFLELNLSTSIIS
FT                   NIQA"
FT   misc_feature    341038..341139
FT                   /note="Signal peptide predicted for TA15265 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.952, signal anchor
FT                   probability 0.047) with cleavage site probability 0.555
FT                   between residues 34 and 35"
FT   misc_feature    341071..341124
FT                   /note="1 probable transmembrane helix predicted for TA15265
FT                   by TMHMM2.0 at aa 12-29"
FT   CDS_pept        join(343138..343544,343595..343658)
FT                   /locus_tag="TA15260"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.70 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE6"
FT                   /protein_id="CAI74170.1"
FT                   /translation="MRENPSPNYSYMSSQSPQNQAQSQRFPQLVRQLPTQNQSEGISPG
FT                   FQTPEIKSQQSFDHIPNLKREYGSQSSNFSTIPEPSEFKNQFNDRPVKINSEHVDSILD
FT                   QNFSILTTINDSDSLDDSEVMSLVLNYSYFLVNITRLHQNLIFLARISDQQN"
FT   CDS_pept        complement(join(343717..344590,344634..345370))
FT                   /locus_tag="TA15255"
FT                   /product="farnesyltransferase beta subunit, putative"
FT                   /EC_number="2.5.1.-"
FT                   /note="chr2.cand.447 - farnesyltransferase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TA15255"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74171"
FT                   /db_xref="GOA:Q4UFE5"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE5"
FT                   /protein_id="CAI74171.1"
FT                   /translation="MDYLRDKSLKRLDDFLEKLNNFILNEESDNDNQLSQHNIGEYVSY
FT                   LIVKYVVSICNDEDFEPNSNISDGKIEESYESQKLVEFDCNDIYSSRMALVLKNLASSN
FT                   ISLETFFCHKSKFYHYTTSTAVDNTDTSVENVVYSKKEVFGLLKFCHCKLAIDLIGDVP
FT                   VSDKGVGINYLKHGEFILKRFSFLLNSVCPLKPELHINFIESHLSKDSEVLKVIDLGYL
FT                   DSSRPWIIYWSLHSLLLLQHDIQPYILPDQFCVKCSRSLNSIMKCWDSEFGGFGGGEYQ
FT                   RGHVATTYSALCVLKMFDSVHMVDRELLHSFLMDMKSADGSFSATYGGECDVRSTYCAI
FT                   ASACIAGILTEKIVENTLEYIISCQTYEGGLSAEPYLEAHAGYTYCGLASINIITSSFN
FT                   KITSDMIKNVKNKLDLKRAYDWCINRLTAQFGFQGRPHKLVDSCYSFWVGASLLIIEQL
FT                   FKHLHNTTYSQSDNRFNEDRKLHEELVKCYILVISQTSKGLRDKPGKPPDLYHTCYSLS
FT                   YFNLIEKNLTHDILLNLTT"
FT   CDS_pept        345563..347830
FT                   /locus_tag="TA15250"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.71 - hypothetical protein, PF03133
FT                   Tubulin-tyrosine ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:TA15250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74172"
FT                   /db_xref="GOA:Q4UFE4"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE4"
FT                   /protein_id="CAI74172.1"
FT                   /translation="MNFFHDSGDLKSGENVRNNLQPSYTSSGFFQEDRLINFKTKLTDL
FT                   TDDISRDSALRAESREFEPVSLQSQNADSEALNCIKEILDLLYKICEGPNDKIDPLKNS
FT                   NKLGESVKLGNFRECCRNKNENNLNKLLSLRLNQISKLKEHCINGDFELSRKTDTQRTP
FT                   KVKSLNGRGYLSKPVINVSESRSDFWLLTLCSKSLRWKSSNDNIGDIYWLGYSVTSKQL
FT                   GEIISNNKRIFHSKIAVNRFPGIQEITKKGNFYHLLEVYSTHKLLNFTQNTATDTANNS
FT                   FNNANYLADDTNVRYWPRNFMLPDNLNKVLKLVEKNVPLIFKPSNGSMGQGVRVVTVPE
FT                   DINEEMLVDYTAQEYVSIPLLIKGKKFDIRLYLLLIATKCDNTNSPGIKGFIFKNSLVR
FT                   FCTENYEYPSVNNSNNSFMHLTNYNINKANVTKYHRGDPDDQNNSKRPLKPFLKTLELE
FT                   GYNTENIWSQITNISSITIQTIYPDIYLNTRISKVDNFQIFGLDVMIDVYGRVWLLEVN
FT                   CCPSLKTSYFDGKEFREDAVDLMIKVPLITEALKIVNITLNGYSGHDNNFYSKFEDWDE
FT                   ISISEFRPELTLIMQLFKRAKGEILEKKYITKREWNQFCKLSGITEIITVITINTQNTI
FT                   GNIDNNDNIEDMVKKSKIEGKKELNKMFGEVVKDSQGVCFADFAVLLGRCSKIIEKWIN
FT                   ISDSETISTICKRNNFLNPLEIFRWSISKPHNSINYPETYVFSKFLHFLNDTLSLSLSK
FT                   LV"
FT   CDS_pept        348115..350490
FT                   /locus_tag="TA15245"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.72 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15245"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74173"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE3"
FT                   /protein_id="CAI74173.1"
FT                   /translation="MKPSTSKSASSALKDAPDDISEEDLKLIRHLTWLYGGYQMRSRNT
FT                   RKPYDENKNFQHHHTNTATKNGSSALNSSKSSVVRSKNLNRRNRTSNSSNTRDNNNSSV
FT                   TSVEEGIGDRMRTLRSSLNRRLRHDYEIDVNDHRKPSWPDNFALSDKVDYFISNKIADT
FT                   TEFRNKEPNTLSICGQFALQNHEAMVADTDRVHYYRAAIFWTGHSTVSDNTMDNTVKNI
FT                   TSKHLISTVDLVNTEGSTTTSTTSDDNSQIDDNETVFVDTSYESLDLNSFTTTTNSSDI
FT                   TNTVENTGKSLESDVSNLNLIHTNNNNRKEYYCSGKRILEIGTGPMCVLAMNALKAGAR
FT                   YVDALEVSVHASRLAGKLMAAYGFDNVIRVFNTHSKLFVFDQNEYFGEDCRFGEDLLLP
FT                   STPPYDMIISEILGDFASQEGVADVFLDLQRRILFENKRFINSVKSIPSKVSTLFVPSF
FT                   FPDSSNIINKSSSDSEMTIFSPSKKMLQSVGMRIDNLPACDEWLPLEHLNLEEWMLPQM
FT                   CQHYLNLFTVSTYGNLAGLLVGIDVEIRPGEHFGTRYGQCESWYTNFLLLDKEYTVFKG
FT                   DLVLVNSIANLTNYTKANCDNGKIQVSRPSYSFKIYILSPINILCSSTNTLDNSTDISS
FT                   FDLHEESIYNLDTHFAHSVDTNNSVESVVTGLSFENTYENNTFNSNNNTMSVKLICNEL
FT                   KRISYEINDCTTVCSKKLNENQEFSTTACTLPEDILKEHEFVRVRGEVYRVMDTPPTIH
FT                   INYLEQTSTIYYDTPCSKRKMHTDPPKRYQKIKLKPKI"
FT   CDS_pept        complement(join(350866..351259,351296..351350,
FT                   351386..351521,351553..351582))
FT                   /locus_tag="TA15240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74174"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE2"
FT                   /protein_id="CAI74174.1"
FT                   /translation="MYVKSEYVNEFVDHLYNFSSDDSVLLVSEGVSLYLLTDLDVYPKW
FT                   NCKILRESHRRRKIHGPCDYPSIESQMQSKRWNVKMVCYNEFYNMNTSEEEKKRIIVIL
FT                   HVDNVFQELEDFKYMRELGASFSHFMLGLLYKDFNKLPNVVDLFIVKENYDYNSKDPYF
FT                   VPFGVNFDPETEIDFQYFKTTCFDKILLDDPGSETIEYNTN"
FT   CDS_pept        complement(351786..352166)
FT                   /locus_tag="TA15235"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.445 - score = 6.38"
FT                   /note="1 probable transmembrane helix predicted for TA15235
FT                   by TMHMM2.0 at aa 10-32"
FT                   /db_xref="EnsemblGenomes-Gn:TA15235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74175"
FT                   /db_xref="GOA:Q4UFE1"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016651"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE1"
FT                   /protein_id="CAI74175.1"
FT                   /translation="MSLFINFRSLRISQIFLIFVSFLPINLNLVHVVRVNAFRLVLDKF
FT                   IESFPDQTVQFVNLGAGFDTISFYALKKYPNVICFDTDFDDQMKTKSKIVYENDCFKQL
FT                   LPDLKLENGFITSNRYKIVSTS"
FT   misc_feature    complement(352071..352139)
FT                   /note="1 probable transmembrane helix predicted for TA15235
FT                   by TMHMM2.0 at aa 10-32"
FT   CDS_pept        complement(join(352573..353360,353597..354481,
FT                   354613..354622))
FT                   /locus_tag="TA15230"
FT                   /product="nucleolar, RNA-binding protein, putative"
FT                   /note="RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74176"
FT                   /db_xref="GOA:Q4UFE0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFE0"
FT                   /protein_id="CAI74176.1"
FT                   /translation="MSQESGEIYTDSSSTSSDDDSISELLPIKNPKHDPNDVKDERSSE
FT                   SPNKLTKSKGSEPAAKEVSKAVDKLIERNLEIDDSSDDEDSEDELEVKSELFGDLGSKV
FT                   KETVSSNTKSVSNSQETNEKSQTPKRKRNKSKTTTTDTSKNVKEEQKAEEQKKEESEPK
FT                   PKKPRKPKTKTEKSVEVKEEMKKLSNEQVFKSLKDKIDDIPLGELKSKLLTDSSSESSD
FT                   SPLSEESDESDDESPITEPQTTNRHDGDEDVSDDNYLVEEPKKRKSEEINGFKSGEQFI
FT                   NKERLKKTFKTKLDIPEGCEIYCGNLPVESTEEELREFFEECGKITRVNKLNGKGIAFI
FT                   TFANEESAKKALDYNNSPYKGQNLSINITVKKGPKSQKFGSNRRTNFHSSGSNSGNFGS
FT                   NSGTFGTSGPSGSRSAPTEATNEICIRNLNFNSSEEGLRELFSECGQVTRCYVPKFQDT
FT                   GKPMGIGFISFTTVEAAKRAVEYDNTDIDGRTVSIQFALPRGGRSSRGRATKGRFTTGM
FT                   NKSSTFSRSFGQNKPNRDDNLNGTINPSSEQDNKPKSIIFDDD"
FT   CDS_pept        complement(356010..356636)
FT                   /locus_tag="TA15225"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.442 - hypothetical protein, conserved,
FT                   pfe1175W"
FT                   /db_xref="EnsemblGenomes-Gn:TA15225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74177"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD9"
FT                   /protein_id="CAI74177.1"
FT                   /translation="MDYKNSTSGTYYSLEVLTEIFKNEDVSLTIQSYPEEVTRRADDEI
FT                   QMLLQNFARVSKKYENTRMFDEHNTQLLFKYKLLSDYYALMYIYASKNLHSYKAYRRNL
FT                   IDEIAANYNGYYDFIPESVINNLSDVELSHIRERCAKIRSSLRIVDDGKFSLIAILKDI
FT                   VCDDICVPNSTNLKFYQKNTQMVVPSHMVEILKPCQWIKILKVNI"
FT   CDS_pept        complement(join(356966..357235,357376..357597))
FT                   /locus_tag="TA15215"
FT                   /product="ATP synthase subunit C, mitochondrial, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="chr2.cand.441 - ATP synthase subunit C, signal
FT                   peptide, mitochondrial"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15215 by TMHMM2.0 at aa 93-115 and 135-157"
FT                   /note="GPI-Anchor Signal predicted for TA15215 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA15215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74178"
FT                   /db_xref="GOA:Q4UFD8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD8"
FT                   /protein_id="CAI74178.1"
FT                   /translation="MSPLINGLGRSLVLRGGISAFSGLRGLSQVPSAHTTVKGVIKHVN
FT                   SPLRTQNFKRLSVFEPTLRHNYALNFNKTGSLGSLTPYNNKFGVRYDGGVATLGAAVAL
FT                   MSVGGVAQGIGNLFAALVSGTARNPSIKEDLFTYTLIGMGFLEFLAIVCILMGAIMLYS
FT                   "
FT   misc_feature    complement(join(356987..357055,357113..357181))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15215 by TMHMM2.0 at aa 93-115 and 135-157"
FT   CDS_pept        358212..358778
FT                   /locus_tag="TA15210"
FT                   /product="60S ribosomal subunit protein L18, putative"
FT                   /note="chr2.C.cand.74 - 60S ribosomal subunit protein l18b"
FT                   /db_xref="EnsemblGenomes-Gn:TA15210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74179"
FT                   /db_xref="GOA:Q4UFD7"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD7"
FT                   /protein_id="CAI74179.1"
FT                   /translation="MSKKMNSSLKPSLGQNLVQYHIVGRAAPTKKNPNPNTYRMSIFAK
FT                   NSVLAKSRFWYFMKRLNKAKRSGGEILACNRLNEPKKGQAKNFGLLLRYKSRTGTHNMY
FT                   KEYRDLTRTGAVSQMYGDMAGRHRARASCIQIIRVAELSDSDCKKSKVTQMHGKKLKFP
FT                   ILKPMPHVERKDRKLFSTKRPSLSL"
FT   CDS_pept        complement(join(359799..364795,364870..364879))
FT                   /locus_tag="TA15205"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="htsf20p3-like"
FT                   /db_xref="EnsemblGenomes-Gn:TA15205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74180"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD6"
FT                   /protein_id="CAI74180.1"
FT                   /translation="MSNRLTGTGTSAGQASKSSKPESQPKSSSSATDQSSSGTGETQEG
FT                   QSTTPVSEVISPTVAKQTETIKSTEDASAKASVTVISPTNRPRPKKTPEVATGHRTAIT
FT                   LNIGEKASNSAIDFKEDYQKNVTVFSAKEKYAFNKIVKIDKSETVIWEAKNETEYFHKV
FT                   YVDGLGTFSKTKNMSLHLCNGTFKHLNGSDSGPWSESPAVVDLDVRISNSNIQVDYFQK
FT                   DNYRIYVAKPGYTIRKVMKSKKCSSDCCCSGLVIWEADKEHALKVVLMGSKKEPKHLAV
FT                   LMKSGELTLLFKSGKGEPWEDITSSKNNITDLKMYAMAEGESVELHKGHYSITLFNEFY
FT                   GYLFYEGVGCVKVTHNGKNIWDLREERDFGCLKGVFLDLKSNKFNVMNDNDRCWVCEKV
FT                   RKVNPVTLDVSSKASTDDFDFTVDHNRNINVYTSKGNAMFYQVVKRGGTICCGSRCCGS
FT                   ETVIWETEDPQRYASKVFADIDRENVSIYLLNGDILHFSEGGRNKPWKKSDNKIILDVS
FT                   KTSSTIGYDFVHHGETRTFTTKPGYQFKTVMLSSSWTWLVCGSSCCKSGCLSDDIFWES
FT                   EKDDEWSNMVTVYGVESSVKNINIFLNNNKVKHFHKMVLWWSCETSIVLNIDVNTDNSL
FT                   FEYRSTRNFGHFNPKANLTITMIVKSTLKIWTAKPEDHGLKAVLMGSGKDEKFLSILLQ
FT                   SGNFVLLWKSGQGQPWKDITQEKSDFSGINMYSLEEGTSNYHELTNTDYDPIIFESRYG
FT                   YEFKEGVKCVKITYNDKPMWNHTEDAEFGYLKGLYLDLPKDQFSVTNLKDQTKELIKPI
FT                   TTVSLDIDKKESTDQYYYLKDGDCEKYSAKSGYVFNKIVDGIKDIWKTTDGIYGTLVRT
FT                   KSKDDGKYLAILMTNNMFKLLKEEDNKWKDITSQRSDITKLTFLGDKDTKLKASDYMVT
FT                   IVDYSYQFMFKGAVSCKKIMYGDDEVWKPSDDKNFSEIRKFQLGLISNSFFVINNKSEL
FT                   KKLEFKPSSVTEAVITQVSVAKPAVITVTLDINATQSTNEFDFADHNGVVTFTPKDNHL
FT                   FSKVSQGTTDIWESKTDVNGTLVRTKVSKDIKYLVVLMTNNMFTLFNLEGGEWKDITSK
FT                   RHDVTMLKFLGEGDTELSKTDYTVSIVDLSFTYIFNAGIKCKKIKLGEEEVWKHSDDSN
FT                   FADIKSFSLGLASNSFFVKNQSDEVKKIEEKAETETPEAKAPEAKVPEAEEPEAKAPKD
FT                   EAETPATTPEAKTAAPVTTPEEKTTVTYVTLDISKTQSTDEFDFNDESGIVTYSTKSGN
FT                   VFSKVSHGTKVVWKSKNNICSTLVRSKTKDNVKYLVVLLTNNMFKLFHEFDVKWTDITY
FT                   KRHNVTKLKFLGDKDTELKSSDYTVSIVDLSYQFKFNTGVKCKKITYNNNPIWTHTDDS
FT                   NFSEIKSLSLDLPKNMFFVTNYSDQNKELDIKVTLDIENTKSTSQFDYSDHNGIVTYSV
FT                   KSDHVFNKVSQGSRSIWEYKDLYGRLVRTKLFSNNERFLAIIFYNNTFNLFRQSEEDKT
FT                   WEDITNTRRDVTKLKFLSHNDHEIAKTDYTVTIVDFFYRFKFKYVVKCVKITYNNKILW
FT                   NHTDDPNYSDITTFYLGIISNRFFVKSMYGPFKKLPETTQQQPESTEESTEAEEPDETS
FT                   EAGEAAESKHPEVPNSSEQSTPLTSSASSS"
FT   CDS_pept        join(365404..365406,365478..365829,365977..366290)
FT                   /locus_tag="TA15200"
FT                   /product="60S ribosomal subunit protein L18, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74181"
FT                   /db_xref="GOA:Q4UFD5"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UFD5"
FT                   /protein_id="CAI74181.1"
FT                   /translation="MGIDLVKAGRVKKPGRKALVSKNPYLRLLVKLFKFLARRTDFPFN
FT                   KIVLKRLLMPRRYKAPLSLSKLSKHMESRPNNTAVVIGTVTSTESLGMIPSTTVTLVLV
FT                   TYANYLYYNTTNTNIYNNELDDERMDVVPKLSVCALRVTETARKRILASGGEVLTFDQL
FT                   VARSPIGGKCTLLRGETKAREAVKHFRNEVKGNPKPYVRSKGRKFEKARGRRHSRAFKA
FT                   "
FT   CDS_pept        complement(join(366344..366577,366664..366858,
FT                   367017..367394))
FT                   /locus_tag="TA15195"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.439 - hypothetical protein"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="1 probable transmembrane helix predicted for TA15195
FT                   by TMHMM2.0 at aa 217-239"
FT                   /note="Signal peptide predicted for TA15195 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.910, signal anchor
FT                   probability 0.000) with cleavage site probability 0.477
FT                   between residues 15 and 16"
FT                   /db_xref="EnsemblGenomes-Gn:TA15195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74182"
FT                   /db_xref="GOA:Q4UFD4"
FT                   /db_xref="InterPro:IPR005691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD4"
FT                   /protein_id="CAI74182.1"
FT                   /translation="MVYIIALFMLVCCNCVKYMEGSFLPLNQSLRPIHKMSFLYYSQKN
FT                   MLKLNKTQIFAPLKKEYNTPSTVSKLFSDYQRNLPKNQEKRSYKEVFKDAIGVFRVKTK
FT                   VTPLVSLISVSGYLIPFMVATRNYEPLLLSLSLPKFVDDIVTSMSSLHKFISSVPNLME
FT                   LIHLCINKVFISKNELVQNHFIKFNYTQGHILSLYGNLLCHIYSDFISSLGQGFLGSVI
FT                   GYTMLLSTFTPLLYCMFCALMGTYSQLPLVSQAAQVSVGSDKSYPM"
FT   misc_feature    complement(366434..366502)
FT                   /note="1 probable transmembrane helix predicted for TA15195
FT                   by TMHMM2.0 at aa 217-239"
FT   misc_feature    complement(367350..367394)
FT                   /note="Signal peptide predicted for TA15195 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.910, signal anchor
FT                   probability 0.000) with cleavage site probability 0.477
FT                   between residues 15 and 16"
FT   CDS_pept        complement(join(367439..367545,367614..367731,
FT                   367955..367994,368028..368088,368172..368495,
FT                   368801..368819))
FT                   /locus_tag="TA15190"
FT                   /product="small GTP-binding protein, Rab family, putative"
FT                   /note="chr2.cand.438 - rab"
FT                   /db_xref="EnsemblGenomes-Gn:TA15190"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74183"
FT                   /db_xref="GOA:Q4UFD3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD3"
FT                   /protein_id="CAI74183.1"
FT                   /translation="MTNSDGMTSVSNQRNKIVLLGEQSAGKTSIVTRFVYDHYIPAYAA
FT                   TIGIDFLSKVVTVNQKTMRLQLWDTAGQERFRSLMPSYIRDSSSAIVVYDITNRESFDR
FT                   TRQWIKDIKDMRGDKAVIVVVGNKTDLLDKRTVSFEEGQSLANEMNCFFRETSAKNGDN
FT                   VQELFTLVATELLKTIEPEPVSDKLVDIDLKPSAPSESTSCAGRSAASFTSLSKVCYRN
FT                   "
FT   CDS_pept        complement(join(368956..369131,369247..369932,
FT                   369969..370282))
FT                   /locus_tag="TA15185"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.437 - hypothetical protein,
FT                   conserved,mal6p1.300, PF01171 PP-loop family UPF0021"
FT                   /db_xref="EnsemblGenomes-Gn:TA15185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74184"
FT                   /db_xref="GOA:Q4UFD2"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR020554"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD2"
FT                   /protein_id="CAI74184.1"
FT                   /translation="MVKCEYCFEGSAVLRRSFSGLPSCKTCFIESFENDIYEYIMSEKL
FT                   ISDGDSVCIGVSGGKDSSVLAHVLSKIKEKYKMDWNLYLLGVDEGIKGYRDDSLKVVKS
FT                   IFKDRFGFSMDQVVKLIGKRGNCTVCGSFRRQMLEIGARIFGANVLCTGHNADDMAETV
FT                   LLNLFRGDLLKLTNSNITTYSINSVGELNGFKEDLDNQIDGKNVNLEIKSKLNQSTNNK
FT                   LRKIKRVKPLKYSFEKEIVLYARYLSLDYFSTECIYSPEAYRGHMRSFIKNLELINPKI
FT                   ILNIIKSGDNFHSEHTSNGEAPERNFCQICGIDSINNICKPCKIVQQLHNLEGLNGNNM
FT                   MSDTNEFCDSGTANIVSGVDLESGIEMGKKAGKSNYINNNIRKGVKLRYDG"
FT   CDS_pept        complement(371425..382566)
FT                   /locus_tag="TA15180"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.436 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74185"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD1"
FT                   /protein_id="CAI74185.1"
FT                   /translation="MLEYIVNGLIRVFGRELIEAWIPLDHVCVTSLTDPEIHLVDISIP
FT                   EIVFENYSSPFSLVSSNIRRIVVKADWSALFRGGKSGKIRVDVEGIDLVVRAKRLDEFD
FT                   PKLCLTLLNNKKKSNLNKWLKFSKLNSTADKTAKIVNCLSVRAKDVKITFVDDVIYKTP
FT                   FSVVIRADLVTGGYVDPKTPLMNDFEREGYLKHLLMCLFFNSKGVQIDFNLYSHLITSK
FT                   HRNINTNGLDVENNTKFATSNFGTDESEDGSHFSDDLFSSEVSDDEFERVQLEDFLQVK
FT                   KSDFCNFCSQNTRKIIKKPIKKCEMRYLDLLNTPHRRFRLTSKTGIYVGISVKVWNFNS
FT                   IFFVERISYEPMKKIKLFLCSNEDAEQEYYAQLFDGSVKYKKLKLNLCSEFVHMLHDFI
FT                   RFVKILSAFKHGATASSCKIPSLQNAIKYCKILEKVNPTNEEISFLNKFELETSIGIII
FT                   RLRNFTSKRSQNNSHSQTPNTNGTNEDTGADDLNTVTELEKIKIEKIFKEEKYDDEFKR
FT                   NFINMEADKYGSNYFNFNHLLHSGKGLGLKPESTNNDHWFLGLMSFGIIAPNLSVNIIP
FT                   ISTLFDTNINPDETPNVNPNTRVYNTNPSLNTNVNPNSNPNSKSIMCIMAELSTFYFNI
FT                   VQISDRRSSIKIFLSKPLCLLARVETELKKYSISCDVVFGKVFDERIVAGPMTLLEDFQ
FT                   SFFHNFGSDNVNQFRLENVFDSVIGVGIEAYNNFVKKNLVNMGRFFLIGNTALELYNAV
FT                   ETNLTTRVTKELLSFELFLHRSFITSSYRINYPFKNYSKEMVELIDKFINSMDENVKSL
FT                   VLMIREKLCTKNRNLVNFTGMDMKLLCLFGNSDKIHKNAKHLSQYNQQIVTNWSYQHSI
FT                   HYYYPNTTNTNTTNTITTTEGNGMEENVRMLVKNNVDECYMVDMDKYCDWFNNAKSDLF
FT                   CIDSLGYMSNKCLEVSLESINVLVDSYTFSKKIAIQNIKIQNNTVNSINNIDGVNRVEP
FT                   ISVDNMKEELLSVKEFSIHLIKENGVFLVNLNKVKVNSNLLQLIPLTQYIDQLIIKCNG
FT                   IKELVDRLKECTCFPQSMSYFEIKPKFTPHDFFNFDPEKEKLRLELEKTVFILMTCYCT
FT                   PVFESELIKFYSDWDIKLILTLYDFTLLLVKNSTILYSLMIYTLNFDLFIAQERLDVKV
FT                   NLGGSNLLTYNYMINGGPDLGTEGYEILMGCKMEDLQNNEITCKSVENGQISLRIKKNP
FT                   NFKVMLELRSLYLKYDQLLINYIFEQYNNLEINKGNNTKVNCLENLEVFVSTTGVCVYL
FT                   DNFGITLDIYCRLNKTDLNIYLDVTRLSFGLLLSNYLRFLTLSLIDLQLSLENYSLFNP
FT                   NQEDTINQNPNSEIILKLTQIAIWYHLNSTTNTGTGTDTVTKDSDGTTIGVNEVFNSIS
FT                   ELFNEYWFSHVTRCLLPTCNDDDLLVPIFYTKMSSFSRLKPVLNREYISQYLVHYASGN
FT                   PQLSELLSSSNLNQLIQKFIESVQIIENSDNLQINSSLKASKIGTVIHAKGDIKVGEFL
FT                   FNLDLKMVEELNSYIKLINQSVNNIQHYIQVNSNPAVVKKQSEKSDKLTVLAEIQLNLM
FT                   CNITSLSCDYSLNIHSKFLPKTTNTAMVNKADRDRFRILKVYPQNKLMASFTYSLKALV
FT                   QYNLDEDQIYSISRHGKEFEIDSETLDLVSHQYYTFDGDLILTLYNSIFLLDLYTNHPK
FT                   NLINQSSESGNKLNRSSSIELFDDPKDKFELIKILNVSINEKRIIFVKNGPKCLCQVSL
FT                   LNFQVLDCFGKYVFDNVYETRTKASQIYDINEELLGKQKGQVLLTFSKNTKSNQLNIVI
FT                   DNTLTEIHPDFINILILLFLSFNNSDFKSTKLEKEPKHLDPTIKFTITLNMYELWLFPN
FT                   INYYTNNTVENSIVTSENLDSNTNYENVLPKILKRINNVDNENGIHLRSYDDRMHVICL
FT                   LFSGTISNNNYYKAMIRHFSLSLGAVLLVENNHKLLVDQNDGLIIAKVNDPCNRFLLEL
FT                   KNFLIKFKLNSETNFDKNLLVQSELENIKVCTSLQDLVRLYFLKDYLIPNYITQILTNT
FT                   TTDTNTEDTSDITGASDTVNTSDDSDVNNVENILDRMGIDEKIGVNRSVVLFEKLDKLY
FT                   HLSQKKFCINVLVREFKVIMPTGPNSLILGLVINDFILDILNPKTNTSSDSPNFTLSFL
FT                   FNLSLLNNKFNTNVYLLQNTQFKLTLITNTLNTDSQVTEDTLNVNSVEMLPTELSINIQ
FT                   LGIVMLDFNNNMSRLIKYFITTLKRIKEIEKSIESSRITVYNELDYEICVFSGNVKREL
FT                   DYFTVEKDASVNLFNREFTLLINNKNGIFSNCDVLLGYIDNNLLYGNTNNVTDFINLHT
FT                   YSTNQTDTKSNNKRRITISYTHIPSSKFIGNSILNNITNTHTNTNNTLNTTGIGNMNIM
FT                   DMENNYMYLGRYEGNESVLKLPNVGGVILIHQINDKVIVSTNVRIENLTDILITISQYN
FT                   TNSVNPVNSVSRQSKALEKVDDILLEKYTSVGVPISWYNSRQLPIITYSGSNNDNLGFG
FT                   MLKSVLNNPIFTPSGSKMRHEEVLRFRNGISLICTCTSQPVNDTNELDSVKYIIRIEPM
FT                   LSIVNKLPFDLIVQISTSKQSSYKYTTTHENTDSISLIQNSGGMKLLNPNQSWGIPIQN
FT                   NKFYLKLTLKGCSLILNTVSKPSINQYREELLEYKSDMFEVNLPNTGSFVTSKSLSFSS
FT                   GPIFETTFTHFEPLLSQSYRKNKEVFYQIVKKNYVSLSLNRNKVTFFWPYIFENFTSHF
FT                   LCLNGYLIPPNFKFYTTSKEANNSKLRAYCKMNNLDDKSLNYLPTNQVEKLDFSSTTSN
FT                   RPPINLQILNTIAMDKSLVNVTNNTSNIGDNPEDMEKDNIVTRQYETTSLESLQTFNSV
FT                   GESDTASRESSETASENDVIYKKKNDEKGFVEKECISLGCSVRVLGLTKLDTRVVVFHN
FT                   YYTFVNKLPYDIVLKTAINQETIIKANEQVSVNTFYKDLKMDIIHKSTKLTCNLTLTPH
FT                   KIPLNLQIKPNNTNTSPLSNLIKNSDNNTTNTNAVESLDGLILDVNIVVGKFEYGLPCK
FT                   FNGLYYIISVATNTTYQLFNLTSFKLYIIDPNHNITNTNTNTKDSTNTKDNTGNSSNCM
FT                   VDGVGNVYEWDKITVLERLKLTPYVLYKTDDRRLGFTVNLNVGWKIYNIDTLKSIKSYT
FT                   FDKLSTETVNSDLTLYITCVMKSDGTRVICFVDDYLLLCKLLQRVELLQVKRINSVWSR
FT                   IILTFTTPRITTTMSSKKKMVLAAHVNNLNFTVSLWKGGFNTNSPSQLNTPLGTPKQTL
FT                   DKFNTNNSGYNSIDNVDMENRENDWVIDVGLSIKGCHIDHFVQGFIPVIMKAITNRHSV
FT                   QESFLAFRMTCTLFSTTIQTFDRIYVKLSPVSLNVEMRVIEQIVDYFETITSAYSNTPG
FT                   DKLDNNEVSGCPIPCYSDRKRTFGKKYFKMLRIEPITVILAIRTSDVKLSRQSLQLLDA
FT                   LPLDTPSVCVHFFAEEVTQTVATFEELAGVLRNSYFKQLIRQSLPSAWLSNSFAVLHGV
FT                   LKGFVYLFSQPFSGCKKFKNSFEGFLIGINNGLKYFVLFVVGGAAQSMGHLLNIFYKIL
FT                   GKKNVKPVGILDGLWLGLNSLVLDIIYNPWNRFFSEFHVGFGLKRFLRNTFNGLRCLLS
FT                   PVTAFVNLLVSVVDGLSNVLLGDFEQFTHLYETDQLKDIETSSGPTVPHTEKKEFFQKF
FT                   KTIRSSIRII"
FT   CDS_pept        complement(382940..384091)
FT                   /locus_tag="TA15175"
FT                   /product="hypothetical protein, conserved"
FT                   /note="zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74186"
FT                   /db_xref="GOA:Q4UFD0"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFD0"
FT                   /protein_id="CAI74186.1"
FT                   /translation="MNNKTIHVNDSMGVGLGRTLVEMENEHVCLSGRRLEEFRTRHCPF
FT                   YLRQMCVNSSRCDMSHSETWPRRNPAHFRYDYKLCPNIQFFRNGNKMQLQGKCSYGRRC
FT                   KFSHSKEEQLYHPDLYKTRYCVNYPNCKGYYCPFAHSKEELRTINRYSNYTQNGIHNTS
FT                   DKFNGNCTSYKITRGEFSLVCYPTNYITNYVVENEVKELSIVEKVDGLVLEKETDTNST
FT                   CSNLDGESTIFSTNSSPSPQMSSNSSPVQLSNNLTPSPQSNNSSPSPQESPKLTREPGD
FT                   LTRDLGDFSSDLTHLSPELRELSNDLQMSGLEEEDYNWFEDVIKSGLSLLDEEEKQQKT
FT                   MGEKRCQICSGCLEKQKSSEATLESDHFSKQYQDIFKLWDKEF"
FT   CDS_pept        complement(384335..384583)
FT                   /locus_tag="TA15170"
FT                   /product="hypothetical protein"
FT                   /note="zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74187"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC9"
FT                   /protein_id="CAI74187.1"
FT                   /translation="MMTDLEILKISGIGRFRSNSRGNHKTLNKTFCYEPKLNFNNKNNT
FT                   TLYNETNIENSFINSDVNKHSKTLWDTTTGNTLTPNN"
FT   CDS_pept        complement(join(385943..386463,386704..387140,
FT                   387269..387444,387638..387690,387787..388306,
FT                   388375..388437))
FT                   /locus_tag="TA15165"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.434 - score = 22.10"
FT                   /db_xref="EnsemblGenomes-Gn:TA15165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC8"
FT                   /protein_id="CAI74188.1"
FT                   /translation="MEFTAKQLLDELINKIEKTQHESNYSILSPENLLNPNLYFSKNTV
FT                   QSRNLQESKSSEHYKNTDEFRNTEKSGNSEEFGNIEELHDNSVLFDFTINNKCSKHTNN
FT                   STNTISNILDRKNKINKKRILIRGYEKVVMKKNDMLSVKKDICNLLFSHFPKYLNSSFR
FT                   FKVGELCYLKWYDELCLVIINYASQKLLISSDNDFDDNYDNYDQDKNTQDRRNIWLYDI
FT                   NEEVFLDYDNHNLYSKLNELKPINILLDNNFTYNFTHNFKDFKDKHSIRYYFIPMYYVS
FT                   FPGYKRRCSKLFRFWVQEKDLIKFKSIRFLSHNKDVIKSSIVKSSIKSSVKSTAIKSIV
FT                   KSPVIENTGKSSRNKDKSKTNKKKNIEITNNCSYIITRTRGDKLWNKRKILPINEYVYD
FT                   VIHNLYHHDLVSGRYITNNEFFCNNGYIPWIIPKSVRKVVIRHHRLITTNKITIRQTIK
FT                   YRKSIHLIIQNFKFLLLIISKLSNPYYSTIRNNTRSNNLEIEIIDQLGIISLYMINYLE
FT                   TLNGNIFTKFNEIYINNFYWLDILLLWIDHFFLNNCCYTLYEYNQLLYLTKLYNNNTLS
FT                   QLLSNIFSHQIIN"
FT   CDS_pept        388644..389735
FT                   /locus_tag="TA15160"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.79 - score = 13.12"
FT                   /db_xref="EnsemblGenomes-Gn:TA15160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74189"
FT                   /db_xref="GOA:Q4UFC7"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC7"
FT                   /protein_id="CAI74189.1"
FT                   /translation="MGMDENTHKRLISRNISNTNQQHYSNTNQHYCTNSNSSENFQDTN
FT                   RKKNINLKQIKNITTNCAKSITNKLITFSNSLTQNNNYSNNKYINSQSNPYSVTNPYYN
FT                   QSTTQGYSHSTHQSTSYGTSQSSQRVGSPMGSGPGYGVNTIPGSGYGHGYGTVPGYGSG
FT                   NGVEYVYGNNKPNTVYSINNIINRIVNNEDIIRTHRELVIIIEYCLSYKDFLVEINIEK
FT                   DRFGAPTMESINNFSIINHKICDKILDYIRNRKDCCIFVVKFITWKMRCTKKPEEVILS
FT                   LELLFNCLHKFGGYFLILFTKSLMKTLRKLLFITNFKSSITSNVKKKITKILGIHNGAC
FT                   SSSSNITTYLAPKGVPLTPKGSI"
FT   CDS_pept        390118..391194
FT                   /locus_tag="TA15155"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.80 - score = 27.35"
FT                   /db_xref="EnsemblGenomes-Gn:TA15155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74190"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC6"
FT                   /protein_id="CAI74190.1"
FT                   /translation="MRLRGIKFPNISEQDKLLNIPHISNTSNMVTPVTGSGPTSTNTTH
FT                   TTTYTHPSYTNPSTTNTMTTGMMDDRIIGLEELDELLYNINNNNYTNEYINNIRNKLII
FT                   SINILSNKSTLNNYQSQLLDKILKLNDSLLLLSNSTVTVTGTTDTEGTEVTKDTHTKGT
FT                   SSMGTKSTSNMGIGSFMSIGSDEIGEMRKTSSGGFVGGPDTVTGNTVMDMENNMLELDE
FT                   IFNFINFNEKNEQLIDEDDEDEEEEELINNFINLSTPKQIISTSVTELGPTESTNTTGT
FT                   VVPGSSFTEDIGTTGPSTVTEGKGPTGTDETPFEGGRDTNTVTEDTTKDEKKKNISELV
FT                   SELDNLEMDFGHMSMNNF"
FT   CDS_pept        391394..391615
FT                   /locus_tag="TA15150"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.81 - score = 6.80"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15150 by TMHMM2.0 at aa 21-43 and 48-70"
FT                   /note="Signal anchor predicted for TA15150 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.829) with cleavage site probability 0.000
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA15150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74191"
FT                   /db_xref="GOA:Q4UFC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC5"
FT                   /protein_id="CAI74191.1"
FT                   /translation="MVNILEFEEFITRALGFTKTSEFNLSSYVGGLGFGTGLSLVFTKA
FT                   LRTIFVLASGGLLIILVSITLHIISKKY"
FT   misc_feature    391394..391441
FT                   /note="Signal anchor predicted for TA15150 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.829) with cleavage site probability 0.000
FT                   between residues 16 and 17"
FT   misc_feature    join(391454..391522,391535..391603)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15150 by TMHMM2.0 at aa 21-43 and 48-70"
FT   CDS_pept        complement(join(392090..392823,392898..393576))
FT                   /locus_tag="TA15145"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.433 - transmembrane"
FT                   /note="membrane protein, putative"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA15145 by TMHMM2.0 at aa 133-155, 243-265, 280-302,
FT                   309-331 and 367-389"
FT                   /db_xref="EnsemblGenomes-Gn:TA15145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74192"
FT                   /db_xref="GOA:Q4UFC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC4"
FT                   /protein_id="CAI74192.1"
FT                   /translation="MDVEKGYYTELSSFEMSNSFRKNDSNKNPKSNKRPTDRPTDRRPK
FT                   ERPTHVTDDRPTDLPYDRLDDRPTDTVDNTQDDRLDGSEEFIDTMNEIYSLDKGKTKLY
FT                   KEFFKLYTDPDESNIEVDNFEPGQTRRKIFLWLLIIILISNPILGGYNLHHFTNYYNNF
FT                   NQSQLIDIFNPKINNSNKKWYQFSFTVTGPTKSTEVTGNKDTTTGKGTVGPSTVTEGKG
FT                   ANSTDELMEFKRVCDVMSMKICRYSFYEVFGEIIFGIFSLLLMSLCKLPCNNGNSIRFM
FT                   MPILFILYMLIYRILAFYILIITIKITFYSIITMKPQIINWIPYYITYFLSIHNINPYK
FT                   DLSILKQIYKLDEFGIKILWLFCLENVYITFSESMELFMVFIKLIFSLIRKILKYNELN
FT                   FYSNNESGFKFFKCFSRDTFYSSDPHEKYIHSLYNYASDIGTYLKNINVDDYTQGLDDL
FT                   TNKFKNRQINNQ"
FT   misc_feature    complement(join(392336..392404,392510..392578,
FT                   392597..392665,392708..392776,393112..393180))
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA15145 by TMHMM2.0 at aa 133-155, 243-265, 280-302,
FT                   309-331 and 367-389"
FT   CDS_pept        394105..394857
FT                   /locus_tag="TA15140"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.82 - score = 15.65"
FT                   /db_xref="EnsemblGenomes-Gn:TA15140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74193"
FT                   /db_xref="GOA:Q4UFC3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC3"
FT                   /protein_id="CAI74193.1"
FT                   /translation="MKEVNREIGKLDSIDSIGIATIENARCPEHYELPIQYFCLTCNVH
FT                   CFCSECALSSHSGCEVLTLKEAYNTVVNTYINKWISQISTKSENLQVSFKKVLEDKRDQ
FT                   WTLKLQDLINNSKQMHNKINDDLELIKNRMSEWVANNNKEIQNELETYTEEIDKIVQEY
FT                   EEMIEKLRTERNNKNLTEILQFYNENCEYLRQIILGDTPRDVEYFVKNAPKHIRDRINI
FT                   SNNTFKEMTNKLTELQQNIRNCHAIEKY"
FT   CDS_pept        join(394893..395121,395169..395248,395281..395362,
FT                   395529..395664,395724..395832)
FT                   /locus_tag="TA15135"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.83 - score = 21.23"
FT                   /db_xref="EnsemblGenomes-Gn:TA15135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74194"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC2"
FT                   /protein_id="CAI74194.1"
FT                   /translation="MNNKHLNRVIKNEIKKNIKSNERVVKGIKREFDDEKRDFKVKQEY
FT                   YDEKREFKDIKREFKDEKYNKEVYELEDSKLIEKEKPNFEPSGLLAIETNNRNGIQLKY
FT                   VVPEESIKPDLSWRLYIFKSNDKEPPKVIKIDEKEYYLIGKDHRIVDINLFHPSISKQH
FT                   AVIQYRHIEDQILPYLIDLNSTNGTYINDMKLESSKYYELRYFLLIIS"
FT   CDS_pept        complement(join(395899..396051,396214..396480))
FT                   /locus_tag="TA15130"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.432 - score = 7.52"
FT                   /db_xref="EnsemblGenomes-Gn:TA15130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74195"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC1"
FT                   /protein_id="CAI74195.1"
FT                   /translation="MLTTNKEIIKLILYNFILDPMIKWDNIQNKITLKLTNHINIFTTS
FT                   STTNSSTVSIKDPYSTSNMKNIIGNNMEYKTGNGGLEVIYINEKVYSSISYSSNTTTDT
FT                   RGTGNKDITKVSSVSGTVGPSTVTDEYQCIYNILN"
FT   CDS_pept        complement(396787..404127)
FT                   /locus_tag="TA15125"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein, PI3Kc Phosphoinositide
FT                   3-kinase, catalytic domain"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA15125 by TMHMM2.0 at aa 198-220, 506-528, 678-700,
FT                   768-790 and 957-979"
FT                   /db_xref="EnsemblGenomes-Gn:TA15125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74196"
FT                   /db_xref="GOA:Q4UFC0"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFC0"
FT                   /protein_id="CAI74196.1"
FT                   /translation="MCNINVNKYYNNYIKENNIKLYNKLINRNLDNCENNLIDENKLIN
FT                   EDLDINKLIRIKLKRKLQNSEKLENFENYGHSDKNSVNYENLENSDNFVNSDNYDKNLD
FT                   KKDINVYLINLNKLLLKYNIIIEETLESNIWKLLINNKNLLNNNFKIIYYYNLYKKINK
FT                   INKINLLNNNLNNLLNDENKFNINIKYNFTFSKYFHGFYLHFFLNFSILSLPLLPFYTN
FT                   NTNGSNFSEENLSTKIAAPKVPNNTTNNMVDSIDVDKKFLDINVFDKFILKYYFNINLQ
FT                   NNEINENNLENGINLENSENSENKILDNKFEYLIYDKTFILININKFNIKNYYNININL
FT                   LYNDFLLIENYLKYLYICNFITLHTNRLENNGLEEVTGEKKVARKNELDTDGIKYDIIN
FT                   IMKICKELNINNFLYDINSFNILFNYINSSVTVTGPTSTNTTGTKNSKDITGKAATGIG
FT                   TKCTTKDIGTVGASTVTELNIRKILKNNNYYKIINGNYIEIIDNNKFLFQLLILLYINP
FT                   NYNLNFILYLIHNNSTTIKGKGANDTFSTPGKGANFTVTECTSEKNPNEIAVVTKTGES
FT                   TTFSKDTNTVDGKGIKGTVGPSTVTELNINENNIIIYLKIFEKIYNEKYGYFFHYYFNK
FT                   ILSIINNINNIKDNMRNYIKNIINKFKLNFNNIDNNYYNKKTFLLYILQIFYPSVTVSG
FT                   TTARVVPVTKDTTTKGGSGTNSKDTNKGFKSTAGASTVTEINLIKNKKLIEIYEYCYKV
FT                   LLYYLNNLSYNIDDIILLTINIIIYIFTNTNIILHYHINLNTNIKDINTDTITEENIIA
FT                   APVEKNIVAPVEKNIVAPVEKNIVAPVEKNIVAPVENSITKFAGNEKVNNIDVKELCII
FT                   IIEKYLMNNMNKKITLYTIYKLMKEYDIKNIEIGEMKYIRNKKMEKIIYNNINKLSNYD
FT                   FRYFVLYLIQNINNNCNRKKLYQLLDLALIYIPSLLKFIIIFILNDFIYSVTVSGTTGS
FT                   ITPPKGAVTKVTKDIGTVGASTVTDTVTYKINELVMKLNNILLYNIKNNEKDYLSLEIL
FT                   YYLLDYINNSVTVTGPPDSTTNNIPGKRDNSMVTECTTKDTNTEESSTVAVGPDTVTGK
FT                   IKTYKEIMKKMNLEYLYKCSYYIKSYTRTIYIINQIITMNIINFNLYYNYLLDINFKYP
FT                   IQQQSYQPNEPCQIGDCHPCQPGDCQIGSNCHESMEDIIEILSLSYLNLNNDIIYNYLN
FT                   NFNTYNLSKWNLQYPNTVSPVTVTGPPDSNPPPKGANSMGMECINTNSTKDTKETPFGA
FT                   GVGASTVTVEENIKLLYISIRENNINNYINYIQNLSTFNIINFIKSYYSVTESGPTEST
FT                   LIPVTTNITTPKGDNSTITLNTPYNLNTTLDTLNNLTTTLNTVNSVNTVNRLDSLNTVN
FT                   NIDWTKHRNGHCNGILNEIINRSKKLNNNNIKLIYEIYKEYDEINSINYILRIFNMKIY
FT                   NNIIYNELNDYKSLYKFIYNNLLHKLQFSNQFLYFKLFHNFINQSYLNYYYILLDIYSV
FT                   TGSSVTVLGPTDNIPPPKGADTKVNTNTMSTVGTGVEGTDAVGESTVTDTVLEEEIDIK
FT                   LLLMKYYCNLDNNLQYVIINNVLRLLNCNNNYKLYYLYSDYLYQLIINKLINSQSINLI
FT                   SNTMSGSSTTNITNTKDITNTTNSTTKDTNTTEGNTKCTMGTGAVVPSTVTEDNILNNI
FT                   QINTILQSIKENFNEKEKNEKNKEKENLNEKKYINGIDGIIGINNLYDYSNLLLHTLNI
FT                   HFLTLLYYSNTVTGTTVTNSTGISSNGVNKDTNTKVTEGVSGSGPSTVTDDTVTHKYSI
FT                   ENIMIRIIYILIRYSSEGNIELERGIILKEELVIFLYKRMYIIFNHFMDKIPIIFYYIV
FT                   INQLIGSTVHKLLSNLSIIILNKLLYKFTNIILWYITYFKFSKNNILNNIFNHIINFNN
FT                   GACSNNTILTTNIPSSTNISTSTISGTIGASTVTKGKRFNTIEKGVKEKINNLIIKYNI
FT                   LYNELYKLSLNNCKQNDEIKYLNNLKNFFKHLNTNSTNSNSLSTNSTYNSTYSRSNSSS
FT                   SDVDEGIILPNYEILLFNNIYNNIMKEYIINISNDIITLKSKQKPKIITFITCFSPSVT
FT                   VSSSTGKGANITNTNTLTTTTIGASTVTKGKGTNKEVSDNILKNRSYILKNELKGDLRK
FT                   DLRSMDSIKYVNKLLEYKFQYKLRVFNVVIISEIIGLIQFLPNLITLKTLYNDIEHNNS
FT                   IQNPITNGNIDMKKLIMLYIKYVNSKHYHNSFYIYNIILQLLYSPITPVTESDPPDNIH
FT                   HPNSTIPPPNSTTIGKGANSKVMECIKGNSSNMGNMGIGSEGDGNVGASTVTNNKYYNS
FT                   LMNYIIKKEKEIEYNKLYEMSNKFNLSCSIWNIFGYIIGLGDRHTENILIDIKNGDLIH
FT                   VDYDCLFDKGLKLLIPELVPFRLTPILLHNLGIHNGACTHH"
FT   misc_feature    complement(join(401191..401259,401758..401826,
FT                   402028..402096,402544..402612,403468..403536))
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA15125 by TMHMM2.0 at aa 198-220, 506-528, 678-700,
FT                   768-790 and 957-979"
FT   CDS_pept        join(404320..404709,404818..405546)
FT                   /locus_tag="TA15120"
FT                   /product="chromatin assembly protein, putative"
FT                   /note="all_bases.cand.1308 - similar to chromosome assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15120"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74197"
FT                   /db_xref="GOA:Q4UFB9"
FT                   /db_xref="InterPro:IPR006818"
FT                   /db_xref="InterPro:IPR036747"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB9"
FT                   /protein_id="CAI74197.1"
FT                   /translation="MSLINVTNIKIGNNVCNIKLPLIFQIEFECLEHLKHDVEWKVIYI
FT                   TSDGSGYINNTNNSNNTTDNSINNLTHMTDSTNNSTNNTTDGAEEKEYLISNNKGEIIL
FT                   DAVCLGPLYKGILEFEFRVNPPNFHRLNPECILGMQAILISGNYCEQEFIRIGYYTNNV
FT                   YDEESLVENPPDLPILDKIVRCIIDQPRVTRFPIKWDNDYLVDFEGNNLNFIIQTDSDN
FT                   SVTVSNTTEDITSPTTSNSNNTEVDTTSNNTEDTTSPTNSNNNSSNSSSELTTSSNSNE
FT                   VDTTSHTTEDSTNSSGTSEDSSTVGPSTVTEEENINTIAAVTTTRESGTFSEDTNTDTI
FT                   TEVDPFRAGREPDPVTDDMELYENKKRKLSHL"
FT   CDS_pept        complement(405559..407643)
FT                   /locus_tag="TA15110"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74198"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB8"
FT                   /protein_id="CAI74198.1"
FT                   /translation="MYKSLKRLDYPRHLAFLNEKKLILVRKLTKSDPWEDITNTRYDIS
FT                   KLIFFDPELNEFKPEYKLDLLNLIIEIKLEEFCEKLEYYGMKIYNYKSYMEHGYPEILL
FT                   FDILKNTFTLEFLNEKKIKLHIPKVVTPVTQVIPTQVDKINRTITRSLKRHIESNNVAN
FT                   TKIRKLNEQIDEQINERIEVPMELNMELDDIELNTKKYEIKILNQCYWYKFNKNNCNYI
FT                   KVLGKKLWKRKNSEVLKSFYYYKFKKILILEFDTNFILFQLNSKEEYGSQEYGSKEQYG
FT                   TQEHYRTEKHYGKQEDYWIQENYEIPPIKLYELDESGNISKMTPNQYTVNLILFDGIQI
FT                   LYKIMSKCPMIKYNNKILWKRQNLKESVKLLLYNLINGNIIIETNIMLFRNENWIKKLP
FT                   NFKIFSEDEVGNIIPTPLDKWTLEITESKYIFNFHNSNCCLVKYFENIIWKNDYPRKII
FT                   DSRKMINDPRKMNDYPRKMIFKIRSKILIVEFENYFDICSFNQDNWIKKQINIPPIHLY
FT                   KLNSEDNIINLSREDYEVELINTRFMTILFSINMNIKCVRIFYKKTIVWSSDSNNYPYY
FT                   IIYSQCNNKLYITFDKEIIVYKYKSRNWYEKIYKIPPIELYTEINGKIILLDYNNYKIY
FT                   LKDINKNICYYYIINEKCTEIKFNNKLVWKFNDKYPKSITYNNNININLGNKIIKITEN
FT                   "
FT   CDS_pept        complement(join(407852..408056,408170..408256,
FT                   408287..408467,408543..408732))
FT                   /locus_tag="TA15105"
FT                   /product="cytochrome C-type heme lyase, putative"
FT                   /EC_number="4.4.1.17"
FT                   /note="chr2.cand.429 - score = 10.05 PF01265 cytochrome
FT                   c/c1 heme lyase"
FT                   /db_xref="EnsemblGenomes-Gn:TA15105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74199"
FT                   /db_xref="GOA:Q4UFB7"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB7"
FT                   /protein_id="CAI74199.1"
FT                   /translation="MPMIYNLFNKLKDLENENTHENSFCPVVNEDNNIPNLPNEPINGI
FT                   NLDTKREKSSIPRAGHDQILIFGVIDWIYPSPMQFYNALVMKNKDDGNSNYMSEAVKAH
FT                   NEVNELSWKKILKWEKLHQKECKNPKLRRFVGKYNNPSPKSFFIRLFTRFEKPFDRHDW
FT                   YIDRCGKEIRYILDYYDDPKSQNYLQVFVDVRPALDNFTNFFDRIKFTFLTLFKFIQ"
FT   CDS_pept        408933..409517
FT                   /locus_tag="TA15100"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.85 - score = 18.79"
FT                   /db_xref="EnsemblGenomes-Gn:TA15100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74200"
FT                   /db_xref="GOA:Q4UFB6"
FT                   /db_xref="InterPro:IPR009360"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR037200"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB6"
FT                   /protein_id="CAI74200.1"
FT                   /translation="MARNSEKANAMLNKWLRIKSGLEQEQTLIRPRHTAEVTNLKEAEK
FT                   WRSATIKEIMFNINKIQDASLGEFVVRDLNDEINRLIGIRKHWDDRIIELGGTDYRRLS
FT                   ANLESNYGSELKGGGTGYKYFGAAKNLPGVRELFEKQQKEVEQSLKDVSRAELYQMINP
FT                   DYYGFKDELDEDLLIQEYNKEQELLTNSNVI"
FT   CDS_pept        complement(409569..410723)
FT                   /locus_tag="TA15095"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.428 - score = 39.12"
FT                   /db_xref="EnsemblGenomes-Gn:TA15095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74201"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB5"
FT                   /protein_id="CAI74201.1"
FT                   /translation="MLIISRIKNKAIAFHTAAKKLQQEAKSALEGTPLKKLQTAANHEM
FT                   TTLVQTADGLKKEAEKLDKATDSDIVKKYLAVARYYKALADKKEFTEALTDPSSKDTVE
FT                   KVTKKFDALQKSYENVLKLRVQELAKKSETLKNVADTLGTQVAELSTQATQLATAASNG
FT                   SHGLKEKAADLVNAIKTDSQIVTNAIDVIKQFEAVTDKYEELTTAADSGGHKDKPAVKA
FT                   VDTAYTDLNKHYDTILNVKKATTLKGEVGNGSDDKILKKAKDLYTKASLLAGAPGLSSQ
FT                   PEDTQKAELKKLAEALKTAVGASVAEGLQGALNQLKSATNDALIVEKALEVIKHYGLVK
FT                   DAYDAVKAKETQYTTALKGTGGKDETDKYTDVTSGFLALQFCPP"
FT   CDS_pept        join(411068..411081,411128..412205)
FT                   /locus_tag="TA15090"
FT                   /product="Tpr-related protein family member, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA15090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74202"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB4"
FT                   /protein_id="CAI74202.1"
FT                   /translation="MFRLLLEEHLTETRDYDIQGTAAPQTLKTKATEVQSAANTLQSAA
FT                   QSAGAGAVNTAASTLATKAGELNTAANNISGGGLEALRVQAQALATAAGSSTNNKGLYA
FT                   AANDLAGAPDVGKAIAVITAFKNVTAKYNDLSTHPTYKQNKPSQGSTPGEETPQGKVNA
FT                   VETAWTHVKEHFQALCMALIKEFANQVATNATQLAGGTGNHDHATNVINCFDVVVRAYN
FT                   ELSNPDNMDMALEIQTQAASISSNAADSTTLSTPANHLNSAAETLSGEKTVANAQAFKN
FT                   EYDAFKDIANSTIEITTVSSNNKNIEVTNLPHINDTFTPRKYKFFWIIVPSPLCGQTGH
FT                   QLNSYSTHKVIWILVAGYLTKNT"
FT   CDS_pept        complement(join(412326..414151,414283..415081))
FT                   /locus_tag="TA15085"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.427 - score = 63.23"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15085 by TMHMM2.0 at aa 785-807 and 843-862"
FT                   /db_xref="EnsemblGenomes-Gn:TA15085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74203"
FT                   /db_xref="GOA:Q4UFV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV5"
FT                   /protein_id="CAI74203.1"
FT                   /translation="MEQAYNYTQDITVVRARGLKNKAEDIQEKSGTLKTTATDQSTTEL
FT                   STIKSNDIKGQTEKGEQLTDKANQLKGAANILYSAANTLATTQDSNLTALKTDAQKLRD
FT                   AAKKEPTNNNDLYKAANELATGSIGLEQKATNVIDKFDDVTTKYKTLMAAATGLTLTSD
FT                   QKQLVKAVDDAYNQLKGIYDGMLNLTKLKNNATALKEAAKSLPALEGPATQLESNVTNL
FT                   RDGTGSGTDYDRAQTVKSQYEKVVTEFNALPDKTSAQTQFWALKVIDVGNNENAAKVLK
FT                   AKAGAPTDANKLRKLAEALYEAAAALRGVAGNVDGGAAQALANAVGAGESGGSFREKLK
FT                   ELHEALPGADLTDKAKAVKDHYKIVKEKFEAVVKQNTANEYTSYEALYQEVVQAWTAFD
FT                   KVYNADLQQLAKDLKNQVGTKEGSNIGDQKMWYHAHQLHGKADTLSRQVSGRPDLTGPL
FT                   EDLKNAIGTNEEAFGTLQQSLNELKGSAAVQDLKSKSIDVINAYTNVKYAFVEVKNLES
FT                   KYIDALKADGSNQQLYTNVGDEFNNLKTKYDGAISGKDPYFWKKWIIKYQSIVCQWLNF
FT                   LTYVLLWIVYDSGTGTDPGPKGCEGQATASTETPQTINSVKLALTPASSEITHTITINP
FT                   GGTDGELTYKSDPITLGSGNGTLTINLPGGEIKLKDLTINSNTLTINNTGSKVSVTKGD
FT                   EKINLQSANLTSSGNQLTITKQDTNGQDEATITSSDGTSVALDYKNGTGSITIDGNAIS
FT                   DLRKYEPKYSPQYYDTSVYAFKKWTDYDAGKFYLFLSILIVIKITLAAIFICSLHYRDS
FT                   SISLAIVNQPKMSTFLSILFYMCHESQWDQVTLFMVAVRLSLLYLYFPLVTEQLYQYLY
FT                   GSL"
FT   misc_feature    complement(join(412365..412424,412530..412598))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15085 by TMHMM2.0 at aa 785-807 and 843-862"
FT   CDS_pept        complement(join(415099..415581,415734..415757))
FT                   /locus_tag="TA15080"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="1 probable transmembrane helix predicted for TA15080
FT                   by TMHMM2.0 at aa 148-167"
FT                   /db_xref="EnsemblGenomes-Gn:TA15080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74204"
FT                   /db_xref="GOA:Q4UFV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV4"
FT                   /protein_id="CAI74204.1"
FT                   /translation="MYLDIVINAGTLSSEASSLASKLGTADQATQTAITAAKKLVEALQ
FT                   KAASKAGPSDKGLKELLGDLSTASDDVVAKAKGVLAKYKEVESAYDAVKADNTANTKNE
FT                   FNQVQTAFNELQKATYEGTDPNKNEAKPEDRRSKFYWIIVPSMVTQWLNFLTYVILLIV
FT                   YVIGW"
FT   misc_feature    complement(415105..415164)
FT                   /note="1 probable transmembrane helix predicted for TA15080
FT                   by TMHMM2.0 at aa 148-167"
FT   CDS_pept        complement(join(415799..415926,415975..416316,
FT                   416365..416545,416641..416740,416776..416909,
FT                   416999..417052))
FT                   /locus_tag="TA15075"
FT                   /product="phosphatidylinositol/phosphatidylcholine transfer
FT                   protein, putative"
FT                   /note="chr2.cand.426 -
FT                   phosphatidylinositol/phosphatidylcholine transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74205"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV3"
FT                   /protein_id="CAI74205.1"
FT                   /translation="MVSFSLRNSKNKNAATQLTPNELIGFVYALESDQKIMLKEVKLRF
FT                   LEETSENTDLFDDLFFVKFLRARQFDLNKTVIMLNKYFAWRKQVNLTKVLKMNLTNIRD
FT                   TLKMYYPHAFHGIDKLGRPINIERMGQSDITKLINVINHEHLTFYYIQRFEYLIHIVLP
FT                   SCSLFCNKNVEQILTLVDLKGFQMNQINSKFRCFLSAMSSLTQNYYPETLGKLIFVNAS
FT                   PVFTAIWSVISTLVDKKTLSKISVVSAKTDLKSKILEIVDEDQLPQFLGGTRSDENWCT
FT                   TPFGPWNDESILHKLKQRTYIQEDLYNLEYL"
FT   CDS_pept        417503..417748
FT                   /locus_tag="TA15070"
FT                   /product="hypothetical protein"
FT                   /note="very hypothetical protein, but gene in this region
FT                   somewhere"
FT                   /db_xref="EnsemblGenomes-Gn:TA15070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74206"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV2"
FT                   /protein_id="CAI74206.1"
FT                   /translation="MNYKSLAPKRLIKKFCCWHFTRKAHDSLQSSECSDLLRITTGRFL
FT                   SRPERQPGKFKSSPLYHTYHISALKSGAYTISQIYT"
FT   CDS_pept        complement(join(417880..418634,418788..418794))
FT                   /locus_tag="TA15065"
FT                   /product="ribosomal protein S2, putative"
FT                   /note="chr2.cand.425 - ribosomal protein s2"
FT                   /db_xref="EnsemblGenomes-Gn:TA15065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74207"
FT                   /db_xref="GOA:Q4UFV1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV1"
FT                   /protein_id="CAI74207.1"
FT                   /translation="MAERGGFGSGFGRGRGRRSNRNKPMEDDFKSWVPVTKLGRLVHAG
FT                   LITSMEQIYLHSIPVKEFQIVDYFFQPERSEHKLVDDVVKIVPVQKQTNAGQRTRFKAF
FT                   VAVGDCNGHVGLGSKCAKEVATAIRGAIISAKLSLVPVRMGYWGNMIGDPHTVPMKVSG
FT                   KCGSVRVRLVPAPRGTQIVGAPTTKKLLQFAGIKDCFSTSKGSTKTRGNFLKAVFAALK
FT                   STYGYLTPDLWDKTELQPSIYEEFSSFLLTK"
FT   CDS_pept        join(419226..419435,419548..419762,419828..420237,
FT                   420288..421054)
FT                   /locus_tag="TA15055"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.87 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="Signal peptide predicted for TA15055 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.902, signal anchor
FT                   probability 0.000) with cleavage site probability 0.732
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA15055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74208"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV0"
FT                   /protein_id="CAI74208.1"
FT                   /translation="MKLLIFLYLKLLILIECRKVFDIDDEYLSNNLIKDDQSSFILYRL
FT                   TLSDVPSFTNAEDFKVDLLASQFIIMIPSHLIFYPEFNVSLLSANKKLSTWYFTHLYNY
FT                   LYNNCLTLIYYCLGKYLLEFPKSLTLLHRFLRLDNLSIDSAGDQPNEGLRGKAGTLYDR
FT                   ANALYGAIPGAESAPGKQEAKALKDAVGAGELSGLTQALANLAGANAGNLPTLAKDAKD
FT                   KYNDVKSKFEAVQKQKAEGKYTEYQDEYGKVEKAWNAFNNLYKEALKAEISTSILIKEL
FT                   QTAAKALQNKANSDGNLDTLKGHAGQLATNAGLLASSPSSSTATNVIENYDSLETEYNG
FT                   LNTEKDKVSKEFEAVKHIYNRMLNIKKAGKLKDQVGDGNDEKIWKKAKELYTRADNLAN
FT                   ASGLQPSDPPEQKELKEELKGLATALATAVGKDDTAEDSLQKALKELKDHNGDSTPEQK
FT                   GELVRKAKEVIKHYDAVKEAYENVKAKQTQYTTALSDGEKTKYTEVESKFTQLQQAYDE
FT                   GKCKDITPIYDKESIR"
FT   misc_feature    419226..419276
FT                   /note="Signal peptide predicted for TA15055 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.902, signal anchor
FT                   probability 0.000) with cleavage site probability 0.732
FT                   between residues 17 and 18"
FT   CDS_pept        complement(421117..422664)
FT                   /locus_tag="TA15050"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.424 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74209"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU9"
FT                   /protein_id="CAI74209.1"
FT                   /translation="MVQSNIVPDGFKTKATKLGTTAGNQSKSEVASTQDTDLDKQNNAQ
FT                   SGLANKSGELAAKALALYDAAKTLETAATTDTALKPLKDTAGALKNAAGTSGGTSGLFK
FT                   AAEELAKQAGSPAEDQANQVINAFEEVEKHYLALMKQAGDSKLTEHPEVIQVVKAYHLV
FT                   KNTYYQMLIGYRIRYLIGNGSDGILQKASDLHTKASNLANAPGLSPQDDPQKDLKEQLK
FT                   GLANELKNATDNNAGLQQALNQLKTAEGDTNIVENATKVIEKYKKVKEAYEKIKAKDSD
FT                   YTKLAARVEYGPVTTAFNALDKKFEALKKSYENVLILRVQELSNLAQALSTKASDLKAV
FT                   SGLTKEANALAEAASKDPSEGLAQKAKALVGAINGPGDTTSPATEVITAFDKVTKAYDD
FT                   LANKNEYKQKLNSALAKQGQVLVGDELKVKEVGVAYANLKAVYDKILYFTKIKHYAKQM
FT                   ESKVQSITSPATAKEVKTVIAKLKSINSLLPADPKFTVQNDIESIKNAVYGAQFEEK"
FT   CDS_pept        complement(join(422852..423022,423088..423194,
FT                   423357..423381))
FT                   /locus_tag="TA15045"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.423 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74210"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU8"
FT                   /protein_id="CAI74210.1"
FT                   /translation="MASSEINVNEVEGTHFTKEEVKNLINKFKNEQYHKNEQLSSLLKN
FT                   MNDTIDRNSLYQIFKTGNRITFKEFEEFLTHLNLNQNKINTQELYHNLLQQYSLE"
FT   CDS_pept        join(423731..423794,423871..423993,424066..424127,
FT                   424159..424281,424311..424486,424534..424639)
FT                   /locus_tag="TA15040"
FT                   /product="hypothetical protein, conserved"
FT                   /note="PF01529 DHHC zinc finger domain"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal anchor predicted for TA15040 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.003, signal anchor
FT                   probability 0.601) with cleavage site probability 0.001
FT                   between residues 26 and 27"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15040 by TMHMM2.0 at aa 78-100 and 120-142"
FT                   /db_xref="EnsemblGenomes-Gn:TA15040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74211"
FT                   /db_xref="GOA:Q4UFU7"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU7"
FT                   /protein_id="CAI74211.1"
FT                   /translation="MVYNFVCVIFTFGGSDNVDILLEEIGEYKDYFEFCDKCNSSRPIG
FT                   SHHCRRCKKCILKMDHHCVWITNCVGLCNQKYFIQFLVYMELMCIFNLLLIVGNIMDLL
FT                   DKNDNLDSYIFKRDALYFIFINFLISVIFFLFVCIILIGQICSIIKGNSKIDELKKIKF
FT                   KRITVKENLKIIFGNSFAQILLPVKNKMYKYNDELKFETIIDMINNKHLEITTP"
FT   misc_feature    join(424110..424127,424159..424209,424267..424281,
FT                   424311..424364)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA15040 by TMHMM2.0 at aa 78-100 and 120-142"
FT   CDS_pept        join(424709..429625,429700..429813,429910..430036,
FT                   430106..430601,430652..431258,431336..431411,
FT                   431456..431673)
FT                   /locus_tag="TA15035"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.88 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15035"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74212"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU6"
FT                   /protein_id="CAI74212.1"
FT                   /translation="MASYTSVSTATQNSASCTLNPTNGFNSMTGPSELVLYLCRNSFKY
FT                   LYNTLIDNRFNEKILNQILNDEFIINNAVSRFLQFFTTNSTQLDNSNLNKADSNAEIGI
FT                   LIKNKILNELLISNEFGGSVSEVEKLDNILKVYKLTLFNRTNYVEFDRNLPLSYEKDKS
FT                   LLIFDDPKLINEVKHVIRHEILSYLECLNFMFNYTLEHDCKVINNIVSNFEDFRSKLFG
FT                   IYNESQHSSDLVRSALLLNLINLHYVSNVYTSNHIDLYQKRFEMVTNTSSNSENSASGI
FT                   SKSLQDVLLALYSFFDSTSGRNFDSSFKLTYEIESIESFKNRIHSVIFGIISDYSRRVN
FT                   TNIVNVILLKVFEKECMKSPKNDLVNVIKSKLKRHISFGILSSREAGGYIPLYILRNDF
FT                   FKRLLSDDMDLNIHIINNFILKNYPISLLSDLINTHFNSIQLGLKFNYCIEKGTLGDKG
FT                   LIDIYNSVLLLFKNDRELDFITSTLSSAVSKSESIDKVTNLINFLTNMLILNKNFLRKL
FT                   KPFTVELKFNISNVEFDSPELILLEILLKLYTNNSDVDLINWILRFFYARFLTIESLVL
FT                   RICNTSQVDRDGQKLSQREVNFAFRKILYEIIIHMKLDNSNVEIYLVLLDSFYKLCSSL
FT                   GKGKSKSNSGSNLDRIDQEVLTRMYRFILNSQNLSNLLTFITLVRTNCNELATDFIMLL
FT                   INNRNYDNLVQTLRCNTLYNFDTNQLIVYNASSRSRKLLNSWKSTVQFDETIKNCPVEI
FT                   SLRLFDIVLEITSKDEKMLSFYVKNCFKSLLVSGTHSNRDLLDLFKSLKVLSINYPQAF
FT                   NVLGLLYELSYRYNYNSSLLILSSDNFRNFSSTDNTLFINKNLSDNMESSNLELKGLNK
FT                   DLMMYLLNLIVVADGDCDLTLYKLLKYLVYNTYFGFKYNIVNNEIIVSYDKIENVSEVP
FT                   ENINFSNIEELCNNILIKFINDQSRITVNKLKTLYNILSIMSSQQVVTEYINLILNKLI
FT                   NYCITSFEVTSDSGINSLLEDDFTKLMVKIAQLLVQKIYIFAMSYFDKVNLVGSVIQLG
FT                   NFIVTTKSSDTFTSQLNKINLNPQFNKTNLNPQFNKDIENIMRKVLSLYFVLTTKGSET
FT                   TEDTFTLFCLYNLVKIIKCSLVLNINEWRLLLLRLSINKYKDKLYLKYLFKLYNILKVS
FT                   HNTSDNMEGHTNNFSGQNTRNNLEGQQEGRIFETCSVLEVDKLEKEVIDNYHSQELNTD
FT                   MIIFLYNLSTKIGEEYLNKVIDKVIEHINKFSDIETMDNGEINQDDTSQDRVVLKNNFI
FT                   MVREAKNLVKCENLKLFYIFYNEFERFGEKCFKEINRMVNEVIYYLTSDKTIKNSKYYI
FT                   HFFKYLVRFKNHNQILKVINNIDQLNYYFYLIFLYSLANTGENNAFGCVKLMTNTERAK
FT                   TSDLDILLKNVLCNRVKYIVNYTGESVVLYNELLLIMNLVMLCNDVESVGVVVEDLYNF
FT                   ILGKSSDKVIFLKIVNNFINLLFRFWFDIKTLKMQVVTLINVSSIWAGASGEVAKSMVD
FT                   VTSGYCTNNMYNGHECNDHGNHLNTNNKVNGFIANGVETVRQVNNNKEGVEFPTHFPEI
FT                   VRPESLGLNLYNVFFNWNEKIKLSNLDMFLHHFDAMYSENTDNQEQDKIKLLKIISEKL
FT                   KILINNIVSNRLLHSQNFIMLYCHDDDDFFDKLDQLLGPESSVPLIQIVKLINVDINEI
FT                   LINYITNKKKFIYSYFDLSIYQFDNNEILLTYEWNEFKSRLVKYVEDKEIVKTLLSSDL
FT                   VDFTRLLLDNVNFHVVYIFDNYNDIIQNKLLINILKLHEYVYDGINNVLNQLTNKLIVV
FT                   LIGKYEIPINYQYNIPIIKLYYKYPSKSFLTNYIHQYYNKKISLGFIKYIVSILYSYYN
FT                   NDIHSLLLYTSILYKIYNTIPNTTSVRNNKTLGIKLTSNQDLYNSIDKFIHNIIVNYKT
FT                   RFISHITSGYPYSCTDSSINVTSNDTSQRSLDEKSDADDECYIVSNGISKSSLDHSQNG
FT                   TNNTLSSDNLLKGNKSELNLLCKIILISSYISSIYNINVVSQYNKRYKQVTSVNSVSSN
FT                   TTSHTFTLKYLMAILQLILILLDIKIKITNQFIHNNLFWLIEEGYIYIINSSNNNNIRI
FT                   DKGKSGLIFNNIIKNEAEGSVNSNKDESNLILLNGNLKLYLNVSFTHFYTFQVSNEHIF
FT                   QLFKEVNFDPKMLNL"
FT   CDS_pept        join(431751..431897,431930..432068,432098..432414)
FT                   /locus_tag="TA15030"
FT                   /product="ribosomal protein l7/l12,
FT                   mitochondrial/apicoplast, putative"
FT                   /note="chr2.C.cand.88 - mitochondrial/apicoplast ribosomal
FT                   protein l7/l12"
FT                   /db_xref="EnsemblGenomes-Gn:TA15030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74213"
FT                   /db_xref="GOA:Q4UFU5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU5"
FT                   /protein_id="CAI74213.1"
FT                   /translation="MFLNRLLIFKTINNLNRRNFTTFDVFKKLQDSNTDNGKVDEETRK
FT                   PSLKVIKLVDEILNLTLIEVADLCNLCQDKLSTKNIGNRLPFPHPNSFFQYNGFVGGNM
FT                   NFTPPPPSPSPTNTSDSTPKEANASPKEEVVKEKAPLKRTIKLVGFDKEKKIDVIKTIR
FT                   TILNISLRESKELIESYPKVIKKSTFPQLTKLYTIDN"
FT   CDS_pept        432645..433166
FT                   /locus_tag="TA15025"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.89 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74214"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU4"
FT                   /protein_id="CAI74214.1"
FT                   /translation="MILEENCVFSLDLVEKLNKYFNSYYKHLFSKIVPISVQFNPSSSH
FT                   FRIEEPKKTSVKGVLDEEKRFNVTEKIVELHSLLCVYKNDKNAHRNLLIFPIHCNSKVI
FT                   SNDLINILQLTTENTDFKDDFGEIPRKYGFLNELQNSLDFNNRLFISVFYENNKFTLYE
FT                   LNFNSILNFL"
FT   CDS_pept        join(433250..433740,433777..434682,434852..434889,
FT                   435020..435954)
FT                   /locus_tag="TA15020"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.90 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA15020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74215"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU3"
FT                   /protein_id="CAI74215.1"
FT                   /translation="MICENCDEEIGEAVTCPICGVIQNITETQVDVFSGFYSKSQRISQ
FT                   PAPLHTETTIPTILQTGPTPSDAVDTIDSKIKGRICELQELLKNIVKILIIKYNVTYRV
FT                   ELYAKNHWKSFLTRFITNLNSVVDVTSSPDNSGKVVDETMSIKCLDERLVMEIICKSLN
FT                   KLIIYNRLLYINFNKNPNSQPNYLDDIEDCNGLNNSKVDILCRKIMKYLRLPSICLIVL
FT                   DKLIGCVLEAELNLSDEILSCALVLIVCRLLWPIYHIQPPAHNTTKSNTENRGNISNEK
FT                   DDVINDSDNRILKYVLDKYREKDMNSFMSSILYRYTNNYYLQFKLSSLKHLFNSHNTTL
FT                   NLLGFKFQDNSNNSITNEESEDGVDELIDKLKRGLMTNNEIYYVITSLFRNYPNFSGFS
FT                   FEKLLEFTHFAFTNRDQKRQTFKSIQKILNTNQYNIYNTINLNAVLSKGDNTENNKNNA
FT                   NQGVKANLWVACNIRFNFEGELVGTDANKLRKLAGELYTKANALADKVSAEDSDGQAAK
FT                   NLADEVGQNEQSGLTQALKDLAGATDLELTNKVQAVKDKYKIVKEKYEAVQTQNREGAY
FT                   KDKGKEEYDKVVASWNDFNNVYKEFDKYISGGHERRRFSEAPMYDVDNTNPGERVKLKA
FT                   EDLRDVAKLLQAQVGEQTSGGKIWNQANQLHGAAHALIEQVSTKPDLTGPLDVLKKAIG
FT                   ENDSAADSLQKALSELSSAKENEVVEKALVVIEKYNKVKDAYDKVTEKSDAYTKALSDE
FT                   QNKYTEVTSQFEALQTAFNAGKCKAISPIYDKPMIG"
FT   CDS_pept        complement(join(436106..437542,437602..437763,
FT                   437836..438702))
FT                   /locus_tag="TA15015"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="small overlap at the 5' end with gene TA15010"
FT                   /db_xref="EnsemblGenomes-Gn:TA15015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74216"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU2"
FT                   /protein_id="CAI74216.1"
FT                   /translation="MFWCNVWHSRTLYDKANTLSTTGPNELSTQANALKEAASQPSDKS
FT                   CLKEKAGELAKTTTDESKAKDVIEKFEAVRTAYDLLMAAATSHKTNPAVKAVITADADL
FT                   KKHYDTILNVTKATTLKGEADTIKGEAGTLHTNSTSLATAVQGNSATSDEALKQKAGNE
FT                   STKGTLRNLAKELYTKAQALATAVKSGDGNKAQDLANAVSSDEEKGIRKELKALADAQP
FT                   DELTDKASAVKQQYNEVKEKFAEVKKQESKYAGSAKPKYDKVVAAWDAFNKVYDADLKG
FT                   LASTLATADLITRAQDVIDKFNSVDAAYKAVNALATTYKVFASSQYPGVDSKFQDLQTK
FT                   FNQISKLVLFLMDSRIKTSEIKSKASALSSNADTQSTIELASTQNTDLNEGNNTAQDEL
FT                   PGKATQLKTNAETLSGVAQQLATAGSPLSPLNETAGALKTAAGTEGSGGGLAKKAEDLA
FT                   TKAGSDASSQADKVIEAFENVEAKYLALMKQAKQSEITNDPAVIEVVKAYHAVKTTYYQ
FT                   MLIGYRFRYLIGDGLSDNKILHKASDLHTKASNLAGATGLRDETHKELRDLAEKLRDAV
FT                   GNTGQGLQLALSALKSANTDALIVEKALAVIEKYNAVKEAYDKVKAREKDYNKHAAGQY
FT                   TLVKSAFTQLEEKFETLKKSYENVLRLRVQELATLAQALSGKASALPGAVGELQNEARA
FT                   LASAASKDTGKSGLKEKAEALRDAINSGTGAVGTQATEVIKQFEDVAEKYNDLKKAAND
FT                   NNKQDEPVVKEVDGAYTNLKKVYDPILNFTKIKYYSNEVETRARQITSSGTPPSEVKPL
FT                   IDKLKSVYS"
FT   CDS_pept        join(438679..438687,438736..439512,439565..439992,
FT                   440030..440750)
FT                   /locus_tag="TA15010"
FT                   /product="hypothetical protein"
FT                   /note="small overlap at the 5' end with gene TA15015"
FT                   /db_xref="EnsemblGenomes-Gn:TA15010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74217"
FT                   /db_xref="InterPro:IPR011714"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFU1"
FT                   /protein_id="CAI74217.1"
FT                   /translation="MPDDLLILQPEINEKATQLQNLAKELKTASGDGNVGTAAGDLASN
FT                   AQTLHGAASQLPATDGLTDLKDKATELATAAKKDTTSAGQDKESLYATATALQSDATDP
FT                   ANAIAVIEAFKKVKTAYEKLAAHPKYSTNKPSPGQTPDPNTAKRKVKAVETAWNGVKTE
FT                   FENLCKALIKHYSDEVNTQATQLKNDPTVENARAFKEEYDTFKDVKSTIEIKPGDSGTK
FT                   KTIEVTNLPHINDTFKPRQKKFIWIIIPSILTQWLNFLTYKLAVYPQKLKAEANGLSGK
FT                   AGTLSTRSSTLETALGSNEAAKKLAEGLKEAASNSVSGKGLKELLGDLNKASGITNIHD
FT                   KAKLVLAKYNEVVNAYNSVKGDTTATGKAVEFATVKSAFNQLQKAAYEGTIDDPSEGKA
FT                   DDKRYNGKAEELKTKAQLLHDAANAIFEAAKDGSPLTELRTPAGQLKEAAKSSSGQDDL
FT                   YNAAKALESGGSVDEHKANDVIAKFDAVKSAYTTLSSKTEYKDVIEDNSSLPQEQQQKV
FT                   KAVDTAYKDLKGIYYQMLNLSKLHKAAEKLRAAAQAASGLNTLEDLKNAADNLKTNVTT
FT                   LRDQTAGNAYDNAKNVEDKFNDVKSAFNKLTADENKVQDTFNALKGVYDHIGSTTFLDL
FT                   LIPNLNNNS"
FT   CDS_pept        440812..441330
FT                   /locus_tag="TA14995"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14995"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74218"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFW3"
FT                   /protein_id="CAI74218.1"
FT                   /translation="MKNPIDLLCLQTPEEARLSKILESYKRNLAEKMMSYAYSKLIFSD
FT                   YYLIKLNNMKKKYDEMSTTSKTIKHLLMIDPLERILKEDLEYFVISLVLLIIYYNNLNE
FT                   AKRLLNYDIMKDIRCEIFKKQGFNFTLYLNDLETFIIERGSLLEPRVKRALSNGVKHIN
FT                   ICNTKIPLA"
FT   CDS_pept        complement(join(441402..442600,442698..445108,
FT                   445220..445292,445360..445534))
FT                   /locus_tag="TA14990"
FT                   /product="cation transporting ATPase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="chr2.cand.419 - hypothetical membrane protein,
FT                   similarity to ATPases"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA14990 by TMHMM2.0 at aa 69-91, 101-123, 420-442, 446-468,
FT                   1082-1104, 1109-1131, 1161-1183, 1213-1235 and 1248-1267"
FT                   /db_xref="EnsemblGenomes-Gn:TA14990"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74219"
FT                   /db_xref="GOA:Q4UFW2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFW2"
FT                   /protein_id="CAI74219.1"
FT                   /translation="MKGLEEKINDNEWLLYNLERPATLKDRMTFYTHTRFNRRPYKSIR
FT                   CISNKGGTLPKLFLYNGLVNSKYNFFTFVPLVLYSQFRVFINLFYLSMCLSQLIPILRV
FT                   ESPIVHLFPLSLVVAVCMIKEGIEDYKRHVRDREHNTQKFSVYQKDEYIDVSAERLKLG
FT                   QLITLKQGQRVPADLLLLKTSDPNGASFVRTDQLDGETDWKLKRAVATTQAMSNLKDIL
FT                   GLYSVATVEEPRDDFYNFTGKICFYHTTKAVDQSDQLENGENLVNLKENPKVDQETNDE
FT                   INNTPEDTVVNNLENMSNEFLKKDVPGNISGDNIFERSRIDSTFNECNIEDSIASSKMN
FT                   RTLRSKSFRKSKSSDMEKKIEGKKIVESLNVDNIVWMNSIVASGTIHGLTIYIGKDARA
FT                   CLNSKRAKIKYGLFEKELNRLFIVLILIMLVMCVLMLSPSGFMSMWYVTFLKYLLLFST
FT                   IVPLSLRISLEIAKYVYNRGIVMDKKIPNTMPRTTMIPEELGRINYLLTDKTGTLTQNV
FT                   ISLEKLYITRGYYTNEDVEIIKDKISNTPNTSTPSNASSSSSANTMLCEGSELVIINNN
FT                   KLNDNLENRLYLSLLSLAVCHNVRPVPESDTAPDSSDQLNNDIDINTGLDNNGKEYNIV
FT                   DSLPNSNIDSIVDSVMESVMEDEFESDMDFQGSSPDEIALVRFANQCNVKLVERDDYKM
FT                   VLMVNGSPLNLRILFMIPFSSETKRMGIIVEDESGHKHFFLKGAEVVVIPMLLPRGSVW
FT                   LSEECDNLARMGLRTLVFAYRSISDSEYSNFVQKYNEANLSLYDRVKKIRKVTGTLEHG
FT                   MLLVGLTGVRDKLQRNVGSTLESLKNADIKIWMLTGDKIDTAKCVAISSGMIQRNNSIF
FT                   QISVDKLKQITPDSGGAALVVGSGPPISELIEYINNFNTDENNEIDAITMFNSYLNSVM
FT                   KVITYELNTFIMGPVNKTLLILDSFVINISINNCFIGDNAEYNSAFKALKRLFIKSLLL
FT                   ANNILFCRCTPQMKADIVKLLKSENKIVCSIGDGDNDVPMISEANVGIGIVGKEGLQAS
FT                   LSSDYSLVEFSHIKRLLLWHGRNSYKRSSTMSNFLIHRGVIISVMQAIFSTIYYFMPIA
FT                   FFQGWLLVGFTSYYNMIPIFCLVLDEEISEEDVMLFPELYVELKKGRELNIKTFLIWIW
FT                   ISIFQGAILMVGAIILFENSLVSLISIGCTSLFLLEILNLISELHHWHRLTIIGLVCTC
FT                   IVYFYSLLVFRNNFDMEFIARKSFFWKVIAISMLGWLPIYFIKFLTKLLKPPQYIKLIV
FT                   T"
FT   misc_feature    complement(join(441459..441518,441555..441623,
FT                   441711..441779,441867..441935,441948..442016,
FT                   443953..444021,444031..444099,444988..445056,
FT                   445084..445108,445220..445263))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA14990 by TMHMM2.0 at aa 69-91, 101-123, 420-442, 446-468,
FT                   1082-1104, 1109-1131, 1161-1183, 1213-1235 and 1248-1267"
FT   CDS_pept        join(446213..446644,446794..447023,447129..447198,
FT                   447267..447631,447794..447836,447914..448316,
FT                   448404..449156,449332..449508,449641..450149)
FT                   /locus_tag="TA14985"
FT                   /product="topoisomerase IV subunit A, putative"
FT                   /EC_number="5.99.1.-"
FT                   /EC_number="5.99.1.3"
FT                   /note="chr2.C.cand.95 - PF00521 DNA gyrase/topoisomerase
FT                   IV, subunit A"
FT                   /note="Signal peptide predicted for TA14985 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.722, signal anchor
FT                   probability 0.000) with cleavage site probability 0.263
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA14985"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74220"
FT                   /db_xref="GOA:Q4UFW1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFW1"
FT                   /protein_id="CAI74220.1"
FT                   /translation="MTHLLPCFITLLYYTLNNGVDSFIVNKFNKFSDFNNFSITYGNYG
FT                   NNLGILGDTVDSVNSLKSTRNDVNSLNLVSDDAELGNSSTGVALLENYDEKESLEYLKL
FT                   NDYMCSSFLKYALSIILGRALPDSRDGLKVVHRRIIWAMHMLKLDPNGQYRKCAKVVGD
FT                   VLGNYHPHGDKSVYDALCRLSQDFIMKVPLIDGHGNFGSNNDPPAAMRYTECRLTNFSK
FT                   TVMLNDINFNTIDYTPNFDNTNIEPMVLPCRLPNILINGSSGIAVGLATNIPPHNPAEI
FT                   INATIQYIKYILYIDIIHRSHLKTDATVDDVNGDKSAEVVNEVLGPDFPTGGVIRTTRE
FT                   AMRKIYESGKGTVLIQSRFVFEEKLRISIVINQIPYNTRINDIIENINRNIKNNNIIGV
FT                   NDVKDESDRNGTRIVVELKRNISSVIEIQEIMTKLERLTEYNYNCNFITLDQDRPIRFS
FT                   LSSILKIWLNFRLEVLKRKYKHLLLKFKKNLDIINAYITVYLNINTIINSFQNHHKGVY
FT                   KLLKEEFKLNDDQMKSVMRLTLRQLNQLNIENLNEKSAEYTKQIEFYENILKNDNNLYS
FT                   EIISDLTELREHFKNIKRNTLIIYTDEPNSFENTIEGEGAEGNTDGKVGSVVESDDNII
FT                   IYNRLGRISKIKLDKKFYKSNKNKTLNTPNPVHTHSTSPDESQDKAETPSVKKSAKKSL
FT                   NKIDETEALEVGYCSNNNSNKIMMIMKNGRIFHVNSSKLKLCKKGYDIFKYLGINNDQL
FT                   IEYVTSTGKNIGDIIMVGYGSGVMSVFNAKKLNFKLSKTRLNLKLNLKDKEIRFFFNCT
FT                   LDHILQNPFLFICTKRGYCIKINLKNIIEKFDKKKNLRLIRMYKGDELASSCLTNDQGH
FT                   ILILTSKGNSNHHNNCIGRYKLINVSDIKLQRIKGKGYNILRNKQKLIKKAESEDSEAN
FT                   LENVVTCTNVDNIKEKKNILLISKGGVLSKKSLHLKPGLRHHKTKRLWNNIPNNDRLIY
FT                   SKLL"
FT   misc_feature    446213..446278
FT                   /note="Signal peptide predicted for TA14985 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.722, signal anchor
FT                   probability 0.000) with cleavage site probability 0.263
FT                   between residues 22 and 23"
FT   CDS_pept        complement(join(450305..450631,450794..451765))
FT                   /locus_tag="TA14980"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.418 - transmembrane"
FT                   /note="membrane protein, putative"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14980 by TMHMM2.0 at aa 283-305 and 379-401"
FT                   /db_xref="EnsemblGenomes-Gn:TA14980"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74221"
FT                   /db_xref="GOA:Q4UFW0"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="InterPro:IPR040202"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFW0"
FT                   /protein_id="CAI74221.1"
FT                   /translation="MLEELNLNDELKSLKISNSNSFLPSASDSKAATSNDTLDSLNGAD
FT                   INNTAAHINTNIKLGDINTVSGGVDDDVLLTGYNIFVKLEKPIPDTVSYTDLTNPTDPA
FT                   NTHDMVDMDNSVNGHNTVNSVEADSTIDAVDENNTVEKVENEKKSGWLMSSIKRTPKAH
FT                   YVKNLKDLKKGKKNELQLFHPKNRSLSSQSSTVSTHTNNTHLTNNSHKFQKLYCQTCNK
FT                   HNPLSINKLNNYNAINPYVNKYLSCSPILNDGYSNDFVWDNNERNTRTKFDTENINNWL
FT                   KTILNIIVTFILIYILIVIFIILRKDIINHINNNKTVVHNKSQVCFNEYTKNKCNVIKI
FT                   PAMESKCKEWELCMKKDSLVYEDVSSISVEIIGSLINKLISQLDLKAILFLIIIILLVI
FT                   IIKIKNRPKPDNQNHKMLNKYYVPNYKNFYPYT"
FT   misc_feature    complement(join(450401..450469,450851..450919))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14980 by TMHMM2.0 at aa 283-305 and 379-401"
FT   CDS_pept        join(451978..452100,452229..452642,452757..453086,
FT                   453151..453477,453587..453730)
FT                   /locus_tag="TA14975"
FT                   /product="26S proteasome non-ATPase regulatory subunit 12,
FT                   putative"
FT                   /note="chr2.C.cand.96 - PF01399 PCI domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA14975"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74222"
FT                   /db_xref="GOA:Q4UFV9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV9"
FT                   /protein_id="CAI74222.1"
FT                   /translation="MMDDESYGIIDKDSYYKDPPREEDLSELVNNTLESVKPRLPKTYD
FT                   EEVLKELLLELMLVEKKCRQKFDGESNSSICKFILTVLYDFNDFNNMFYYLVLLCKKRG
FT                   QLKTTIVSMVDLAEHWLDTIPSLEVRLELFNTLDKITLGKIYLEKQRAQIIFKLAKLKE
FT                   DEGNIKESASILQNIEVETYGSLNKLEKIRYILEQMRVNLLNGDYIRFFMTSKKITESV
FT                   LDNYVPEKLQFYDFMIQYYHHDFDIENITKSLYTIYSTKKKLFLESTNSTDDSPGNIDK
FT                   QYYEDYLTVLEKLLLYLILLSLNEENITYMKKVNEDEKKFMKQLLTISPFFQQFLNNFL
FT                   IQHQLDSDLVEKINSLLDERCSKLLYDRIIQHNVKIISKYYNKITLERLSTLLNIDSEK
FT                   LENEISNMVEMGIIEAKINRITGIIKFQKKLQTEIILNNWVNNITK"
FT   CDS_pept        join(454242..454257,454292..454375,454469..454553,
FT                   454621..454903)
FT                   /locus_tag="TA14970"
FT                   /product="translation initiation factor eif-1A, putative"
FT                   /note="chr2.C.cand.98 - translation initiation factor
FT                   eif-1a"
FT                   /db_xref="EnsemblGenomes-Gn:TA14970"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74223"
FT                   /db_xref="GOA:Q4UFV8"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV8"
FT                   /protein_id="CAI74223.1"
FT                   /translation="MPKNKGKGGKNRRRGKNDNEGEKRELVFKMEDQEYAQVLRMLGNG
FT                   RLEAYCFDGTKRLCHIRGKMRKRVWVNAGDIILVSLRDFQDSKADVIAKYTAEEARTLK
FT                   AYGELPEATKINETDVYDDEGDNCIDFQDVSSESEAEDESQDESDFDIDDL"
FT   CDS_pept        complement(join(455241..455455,455557..455667,
FT                   455717..455816,455960..456078,456158..456371,
FT                   456503..456733))
FT                   /locus_tag="TA14965"
FT                   /product="DNA-directed RNA polymerases I and III, 40 kDa
FT                   polypeptide, putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="chr2.cand.417 - PF01000 RNA polymerase Rpb3/RpoA
FT                   insert domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA14965"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74224"
FT                   /db_xref="GOA:Q4UFV7"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR033901"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV7"
FT                   /protein_id="CAI74224.1"
FT                   /translation="MPNRVFLEPSGIKPCYEESDGDNIPILEKVKNLQIKFLKKTPEFS
FT                   VVEIAGLDVSFANALRRILISEVPTLAVETVQIYQNTGVVQDELLAHRLGLIPFSIDPD
FT                   LFNFKSSSKNNHCFADCEEINDKNSVCFKLKVKYNKFDQSEYLSIYSNDLKWVPLSNNQ
FT                   EIMFKDNPPKPVYGDILITKLGPGQEIDLNMYLEKGIGKVHSKWSPVSTAVYKFMPKIV
FT                   YNVDILLEFSADHKLTATEKKNLPKICPMNVFSYSKGEVNIENPLNCTSCRRCLELYPK
FT                   KIIISKLTNHIICTFQYFNHFSVSIESSGSVTSYDLLLVSLYDSCSNR"
FT   CDS_pept        join(458320..458540,458658..458891,458918..459028,
FT                   459157..459226,459388..459561,459686..459934)
FT                   /locus_tag="TA14960"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.99 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14960"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74225"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFV6"
FT                   /protein_id="CAI74225.1"
FT                   /translation="MNERVWEDPDDAESPPLEEPGWLKKRRLILKEGDSDPNLSVSGSL
FT                   TRVKPSAFKTGSRFKITPIKPSKDSFKFSGGVSGIGFDEEFRFMSVLCHKEKGLQLYTV
FT                   GDKERFKIKSKKTLFFDNFLIRDFAFKDNNLLLIGKNKKLLKYDLKSGLGQNIFNVIIP
FT                   RTESALKQIFTSNHSNYYAMTCANTGTILLCDFKDNLLVHNFKMNSECVMYEFDIRGGK
FT                   CRRKFKDPNSVHVTAFSAFNSNRNSYFATGTKSGYVNLYHTNSDKPFKVLDNLTTEITS
FT                   LKLSEEFGLFSSVHKKNSVRLVYNDNYNVVANWPNNTSNLGRITALEYCQPLNTIVLGT
FT                   RSGRIHFHTIKK"
FT   CDS_pept        460695..478121
FT                   /locus_tag="TA14955"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.101 - hypothetical protein, signal
FT                   peptide"
FT                   /note="hypothetical protein, signal peptide"
FT                   /note="Signal peptide predicted for TA14955 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.980
FT                   between residues 19 and 20"
FT                   /db_xref="EnsemblGenomes-Gn:TA14955"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74226"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB3"
FT                   /protein_id="CAI74226.1"
FT                   /translation="MAFLRELLLLLAFASYVQGSEVELDLSNASRDNFDVVEFETGPAS
FT                   VTRITPKLGVHVNRITDTLDGVWSPLSKDFSVKSFEIHQRSGHNSIGHLALFEKNVTSP
FT                   SGPQEDDNSHQNLGESLSEKVVYSNLYFTKRDRGWFPLTKYHFDVLKDDMESLDAILDL
FT                   HNFSDSLVSVSHLEDKVTRELLLARRLSRVTRVNHNGDLVWSSAGTELFKSAFLSYNTM
FT                   NSLVLVKMTLTTPNATYNPLDEKSSRYYLDRTLYFYKNKSLVWKTVNQTFYEETLELLR
FT                   IQFAYFSRRFHKLTLDVLPMLDGSDSDNPLYFDFRVEKKEYRGVKVAMVSPLGEATLTL
FT                   VKSGDSLLWVSENDRTYCRDVHLYHLGDSSTLVDLCLASNPSDTCQYKFFKLESGHWGS
FT                   LSQDNYKHLLNNDEISVVLELNNTDLFFCSKAVYKRNGVPITHITANDGYYFDKVKELE
FT                   LELWNSTRFLKCKKVFHVNLNNFNFISLLVEDPLNNTSHLLYYQKISQPNKDSTNEGVW
FT                   MPITEAVHSSLMHSLLMKISFDFDLTEFISDMRSKHSVPFDLDSFPETNLDRTNKNYSL
FT                   SLFRHNNVPMVRVYPAFTSHLANFREGSNVIWSSKPNRKLFFLEFNYAEQPSMVLLLFS
FT                   DENDVLRTSYYSRVNGKWISVTIDELQNFFGKVSTVQDQKFFTLDIGKLLPSNKYTYQI
FT                   DHLATPPSCLVEPSYGHKIDKLVDGAETIWSFNSFPKDASTPYGRIGNDDYTRGYEDLV
FT                   YATFVPYDDPKFVTTVTLSQSHHLYLNHYLKQDDGVWKSVNTSEYFEELEEYSAEYYQG
FT                   EEIVDLSDVFMGERRDYYEFVDSSYYGMDHYGVLKFTDKVERLSIYVNGVHLYKLPKAT
FT                   YLKELTFFPSNQPKVISLEYQSSNNDSNFLYFSQSDFTDADPFVKILNQYVQVDEHEYT
FT                   KQFEKLLMLNKYTSLDLATYYKMVEDFEETNSDERDLVSYMHEKLNNTQTNNGKAVESP
FT                   LKHSVYNYLGVNLVVAEVNPYYVLRGVNDGIDIVTAYNFYPSTKIYFTVNNEYFLSIYY
FT                   RDANSQDLKMLNYEKWNRRWTHKIICFHRALQVLINFASKPVSVDMFHLRCGHELKLVT
FT                   SQSFSGFFTNTLSSKPGYQIKLIYYNSVPIYNADNGLSKKIGPEDSLENVIEITFFPLL
FT                   RPKVLRISSNTNSTIINKYYKITNLLDTDSAKPSTTSIITSLNVFDYYSLLESFGRMYE
FT                   FLVDITELHTTDDYRLSNHTVSNTSYLILTPNKGKNLVLLTQGRNVIWEAQDELVNYLI
FT                   LYPQHKPFLALIYYNKSDREGVYHYRYMSSVNKWVKTSEDYALDKFRLRKENLMPMTLD
FT                   LSTLPNKNLEEKDYMSNLHLNLCRKKIYGLVFTIVKPSFSTYIVAVKHNGKILFDINAD
FT                   QNSHSDHSNRILSAVYAFKDDPKILALNYVKNFVPSQAYFRKNDEGVWEEISSTEYGKF
FT                   LFLLKRFTMNPVVLDIDNPNPHFFTTYFDRSNKNFTMTRITPMDNYKISKVVRSNSSNA
FT                   KDPFKDLKLFDSDQNPVQPVEEIFAVQDKTVFYVEYTDGSPSLMRIYYSTDMMFQVQKA
FT                   YFVLEEGVYKPTTEENFNRLMSLAKIAGTQVKYNLDPYYRVGSPVYDNDGYEETVETVY
FT                   NEKIDVVYPNSEVNISPIMFKEANVWEAHPHYQTLSIVSYPSKDPNQMMVNFKDLLKSV
FT                   VYSQYYKKAKESGPSEKVVWKSSILYSNAVFDKNVKSVDYDLSDTKVHTSLTVFTFERE
FT                   GLYTTVVLPNKGTRVTSISMQNRKIWTPNQGNSTSPSEELVKFYFTPSIDPRVLVVYYR
FT                   DSDGYVRLKDFARELTSLEWKESYSKFMSYYLDMLDSSLSLNLNSFDKSNFIFSNYYRY
FT                   GFKFVLLYPLLSTNVTKVFSKPADSASDLTDSDLIWMSEPNMECFSLNFAPPEDPKVLL
FT                   LSYSESSLMKSVLYYKDSEKGWTLDSNNTHHQFVNRLLALENSFVYRLEDANSSLPSEF
FT                   YTYEYTDAFGVRFGVCTPKSGKNLVSVTYNSMVVYEVKKGERILDVLSTQPNNPDHVIL
FT                   MLDTNVTDPESSKPTIIYKYMKRVLSWNEVGKTEFMESLMTNLSSDFFPLSLSSKDLHN
FT                   RVLARLSVETSHDAFLDKVNELSTPSDYEHFTLDLANYKDNHRLSVKDYVESTVPRTVL
FT                   RVKRNYLLTRLVHSDQLVWTSDNSSTPSDRFVTHVYFAPTEDPKVLTLFFRDCGNGVYS
FT                   RRFFKENGWTEFNGLCTNLTNDSKLFTMLNKFVLDIHTDSMRYSNSFFKKELVYEANTY
FT                   FMKISPKENVDVVKLMCKELQIWDKGEYDNFKSVLVYPINTPKFAKLYLGTNNGSHFFY
FT                   FSKTNDFWAAQTEPEYKYSLKRYLSHSSDDFEPVDLSNTKNYINQTKKLNAFYVNLHKL
FT                   AFTSVSPRFEYKISKVLFSPSQSVGDSDLNDFDFGPFNFDNHEKTQAGDVGDSDLKVLF
FT                   EPTSNEDIRLVSFAPENDPKFVSITYTSTSNLIIPRTSPKLQESPYSPNQSPETVSDPT
FT                   PTSSVSFSGDYAYLTGVPGYLPNYDGMEMSSPFYLSVNTNHYYLNEGVWTITDDATFKS
FT                   LCLKWADEQFERKQPFDLDLDDLELNKENYDSADEELSGVYFTKFTPKAGFEFSHLRQY
FT                   DKVIYRQKSFPIISLSVFPRNKPRFVKISHKMSPSLVNNYFFVSFYPYGLSQRDYPTFK
FT                   KALLDYINSPDYSPPAEVSKALLSETALTSTQLVKVGEFTTDPQNSTLVLYGKKLDLLY
FT                   YVDYNNDSKSGYRLSDGTKSDEIPNVVTTYSGKLYALNYYLVSPNQGYEFTKLYDKGDI
FT                   VFDLGEDRVLKSLLLVPKTNPTHILVHYTSDQRFNFFELYHKQEKWVPSYHSLLKYKMK
FT                   NITKYHLSPFSDFEYPLSQPLKEPKALDPNSTKPALPASPGLSTVEPEKTPADKKEDHP
FT                   SFFSLKTVPTSKFMLHGNVKMLSDLEDKLEYKYDLLKNVALPQDSNNLQTGLSDLGFKF
FT                   YIEDEKQYRLVFVDEPNHNITKLSVNGEVLLDLTNSKPYTTTSKEFSYDIESRGFTREN
FT                   FEVYEGKFEDKEYVVVKVTQGTLSKVLEGESEVWDSKGKLVERFAYYPTFEPDHLLVSY
FT                   KVQLENGESVTNYEYMHKVSNKWVEMDQESQLQLDADLKSNLFSSNPQETKPKLLKGVL
FT                   LMPSKDPVKLHVWYTENNFDKFVSFSRSLGKWTHSTLVFNDLVSVKLKFVTAQLRADTV
FT                   VFTGTQIPTLSEEASSSKSRKIMFESVSVNKHFLVEQPEKDNFLYLPLNNFLITNVSYG
FT                   KHSFFKNADPQTDAANTKKVFAVYLTVENQKGQFYGKVNKLTVIFQDLLANVHVQSWFR
FT                   DSTNKWSRFTLPDKEVSALKELLKDAKSRHSQKTKIDATAKSFTNFLTLTEKEQGTKGS
FT                   LKLSGRVLVPDTPPAFFNYDLTTDEMDVYVSSLKTRFYSYAKDDAWNSFKVLAVKEGYE
FT                   VTVLKTSDRVIYSTSTNEKHKSKAQYDRIIAVYISPSTKPDSVCLYLSDRFGAKKLVFF
FT                   RKGSSDQSKGADEWSESTLLSSQFNSIKFKLDEALSRSTSLRLECFDYSKVLYYGGSFI
FT                   SHSQLTRSEYFVNTDSEVRNTPFKGFYSIVSEEENYIMLIPIKTNKISHIKYSTETLFS
FT                   LESQFHTVRALMLTPRLNPDSLIVYYNDDENNDYYSTFTKLVTKTPTTSAQSNSPTSST
FT                   AHKLFGNPNKTWQQKQFMFFSSFGTIKKIHWNLETFENNNPALVSFSSRQRTGSSHYNL
FT                   ALTLTGVYTPEDGVSKEFVFFFDPNHKDSAYVFEGERVVEHKGAFDVVFKNSQSMNYLH
FT                   VKSSPSYKVKSVMMDSQVLMDLDGTSDFDSLTLTPALNPSTILITAVDSISSLFYYFVN
FT                   KENTWHTMGSDMTKYIKMKVLLHNASEEISQSHSHVDDLAESEVKRPTPVKEHKFEFNL
FT                   SSYDALSEVYTLKKDSLSGHEFMLGRTKADSNVEKILDSNLLVWNNLGNSRVVRFGFSP
FT                   LKDPNLLCVGYMFNDKEVYDFFHKTGGVWQPYSSLNNVPSLLTHISNLDLVNFVLDLSA
FT                   VDEASEHYKLTKNKYNSLEIVTGNVSEGSVLASVVDKDLNVLPNFKILALKVQRFVYSQ
FT                   PENPTYFGLYFTENSKEGYELYNKQNGKWSLYFGMSEDRRLLLKELLASKDVDQFKSES
FT                   KLFTPENEFYYNTRHSNNVSNKHYDVERQTSEYLDYVLVKVHKNQRLLKVLNNNLTVWV
FT                   PKDAMTEVSRFMYYPPDNPIYFSIAYRTPSSKEDYFEYFYRSENKWYPYSEPMNIPQTL
FT                   KRPLYFHKDSTSTGSSKVVFDLTLDLTSDFYKYRYDRHLTLYKNLLFETFVPKPEYEVS
FT                   EVASSFKVIYSKLEDENITRISFYPSNDPKLLLVEVKTESSSGTQKTLVRKFVLKDTWV
FT                   VNDDEFDNRALSYLNSEQKAVSLDLRQLTKENTTFDDFLVVKESLNGTFETLVVTPILG
FT                   KRIVSIFDGPESVWSSDQASVDSCYLFPLESPELLSVLSTDLAIKYYSKLSGKWLEVSS
FT                   ASFDYLSSFYSGTPNVVELSHLSKFEPTSSFTDFNYLSPFNSHNVSSLETKTRYNFLKT
FT                   GLLKYNSLVFGVASLVPRKFESDESASSQTPQVLALTYLGEPLFRLNNDQKFLDLIFYP
FT                   LEKPSVVGFSFLQEGKHMQKFFLRSASEKHEWYEVDSLHFDNLFSLLSSHKLFNPGPAD
FT                   TLQQFQFDLHCEKSGDGFVLTKLSPKDHYHSVYVSETHRLSEIKDNGVSVYQVPETDFV
FT                   YNLYYNLDPENTHLTLSYISSSLEFPPDSLGYLYFEKKNEEWVKSYSFTTKLLDLDQML
FT                   SSAQVPSTPAKQPTPMESNEFVYDMNKDKDSTANFELKVETMQGVKLATVLPRTNKKLV
FT                   HLLDSEVKVWSSGPDDKCKRVLYAPFEQPKAAGVVYFTGEQETVKYFLKNPDGTWKETS
FT                   PDQFIKVLIPEIVGKNNSVKVSLDFSNLANQVVSNLEKYKNIPQPTLTKTLGSNLLEED
FT                   ISSFMVYSVPSELEVTNLYDREDLVYSSSMQVIKTLHLYANKNDMYLRVTTDFLDHKTS
FT                   HYFHTTLRYENQSSTLPASPPNSLPATSHSSNLPTKSVGCEKFTFDLSASNKTNKFFTL
FT                   YHGKYFGHDEVSVKVHSDYVLSRLVDGKTLVWEQTGHVFLVNFGYMPEKNPSHLCLGLY
FT                   CAKGHRLWYTFYFKKGGKWHLYTLDDKLPDQLLELSELIESKTFFVFDLSAHSNSTEDY
FT                   DVIESQHHGQKCKVVSLNKNRLLFDIRDGKEIIWSFENKKFAISFSFMPPENPNQLLVS
FT                   YFSQNDMIVESFEKIDGKWMLTDNDSTLLSLPASPPNSLPATSHSSNLPTKSVGCEKFT
FT                   FDLSASNKTNKFFTLYHGKYFGHDEVSVKVHSDYVLSRLVDGKTLVWEQTGHVFLVNFG
FT                   YMPEKNPSHLCLGLYCAKGHRLWYTFYFKKGGKWHLYTLDDKLPDQISELAKNLFLEYG
FT                   TDDLEQYRNQKEKQKPALVRGKWQKIEKEEFYNNFLHVSIIKEYVTFDISLIPDVGQYE
FT                   VKEGFEFGHPIRISNPMPSLHVGIVSHGNKPVWQSNSINEHVKSIITVHENEYKYLLNS
FT                   NTKLIQLYIKDRDKISAKYFKKLDNDDWAEIMEKEYANLYDKLCRDFKSLNEELKFVEH
FT                   ESDKLDSDAETVASTTHLCPSPDDLLVTVSYTDKKSGTLTTSQLKLNDSHKNLFVYTVD
FT                   ELQTVYVPILRNSVKKLRLDDFPFYEEDEASPDLLAFMTKLNTDGTLQRVILFFKHNYQ
FT                   LVHEAFVLDKGNWVSFSLLPDEESYLADLVLNATEQMKFL"
FT   misc_feature    460695..460751
FT                   /note="Signal peptide predicted for TA14955 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.980
FT                   between residues 19 and 20"
FT   CDS_pept        join(478628..479963,480000..480322)
FT                   /locus_tag="TA14950"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.102 - transmembrane"
FT                   /note="membrane protein, putative"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14950 by TMHMM2.0 at aa 21-38, 73-90, 97-119, 129-148,
FT                   155-177, 192-214, 334-353, 368-390, 403-425 and 468-490"
FT                   /db_xref="EnsemblGenomes-Gn:TA14950"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74227"
FT                   /db_xref="GOA:Q4UFB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB2"
FT                   /protein_id="CAI74227.1"
FT                   /translation="MGLSGLYYRLKKVMARNKQNSKKMLTMFIVGLTILQPYRTACSGS
FT                   RFAIRRFGVPVNLSSIYVSKFHTSMDTFNMIAIIFVNLYMWAFGSTHYELNVILSVFTK
FT                   FIVFLLNICHLLSYMIKRRGGMLTLYYWISILCSIAYGANRAFSACIGVEFLAFFVCGL
FT                   QFAGIQMVLFQSIFLAITKPIANFDVDYWLIPTEILLSTTISAISLFLWTTSFAKTQMC
FT                   KIFTFFKWYKTDPAPKNIISESYDTKLVSTKGILELKTENLKTSENTSCELRQSSDFNS
FT                   NSFEETDQTEPNLINVTINESPNLLMNSKGFIDNKKISKISTIFRSIIRAKSPILMSGF
FT                   GTSLCFSFYPAVAPYKLTTLEIAHIIDLSVLVSAGISATIISLLCLLGFGPNKKWKGND
FT                   YFWNYFHFLLIPYFLIILCFLISMHYPNSRFSKAVRNPVILALLTDGFAGVGLQEDKKN
FT                   GTVSTFNTMFSFILLFASIFWGSGYIKIYNVYEQDRKNWPTKDMSGIRWFKSIFFWFYK
FT                   SFEGGSSNFKHMLTTDLMRDINSVIEPQASKSIWS"
FT   misc_feature    join(478688..478741,478844..478897,478916..478984,
FT                   479012..479071,479090..479158,479201..479269,
FT                   479627..479686,479729..479797,479834..479902,
FT                   480065..480133)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14950 by TMHMM2.0 at aa 21-38, 73-90, 97-119, 129-148,
FT                   155-177, 192-214, 334-353, 368-390, 403-425 and 468-490"
FT   CDS_pept        480869..482779
FT                   /locus_tag="TA14945"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.103 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="Signal peptide predicted for TA14945 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.941, signal anchor
FT                   probability 0.004) with cleavage site probability 0.495
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA14945"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74228"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB1"
FT                   /protein_id="CAI74228.1"
FT                   /translation="MNKIRLQVILLFCANLLVNCNDTAKDENRPKEEVNFSFDLHNLKL
FT                   SENYNLSHRKKEYLSIGAMVPVQNKRMTKLLCNGEIILKFNPDEKVNLVTFIPRLMPTM
FT                   CSVTYVKGSTVCVKRFCKSDNWVQVTNEDYKLQALEMAKKKPEMIFDLSNIEFDKIHLD
FT                   EETKGDLTFYSFSPKKNVTIKTIADGVNVIWHSNDETHVIDGFFSIQTQPKLLSFMIKN
FT                   KGFVDLKFFSAHEDIYSEISIAEYTFTLKNFAYSTREDLTLNLDSQEYSTFKISSSIVD
FT                   GVSFIDSFLKDPSKKVERVVAKEHTLWYRDENETFIKASYTISPDPRLYKLVLCATRGS
FT                   AKIYHNLYFIYKSGIMFKLPEKDYKKELKKVVYPRESFEEFDIKTLAEKKATQPYTSIA
FT                   YFPPEDKGLKIVKYENQQIWVSTGKDIVKSVFYFRNEEKHMVQLSCRDGENVTRTHHFQ
FT                   DSNSYFNIKSDDKSWLWISTPEFYKSIGLRQVIKTHTYLDIGLRADTGAYEHKFGRVGN
FT                   VMVQTFVPYSSFEVSSVLDCNREMWKNELRERLAALALYGDHKEFERKSKEETKNQGED
FT                   STDVNPFRNSLSKSFRLAEIFIKGPKKVERQFLELKNNDWVKIKEEEFVKIYKTLETPD
FT                   G"
FT   misc_feature    480869..480928
FT                   /note="Signal peptide predicted for TA14945 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.941, signal anchor
FT                   probability 0.004) with cleavage site probability 0.495
FT                   between residues 20 and 21"
FT   CDS_pept        join(483065..483145,483215..483355,483473..483607,
FT                   483680..483775,483827..483915,483945..484092,
FT                   484123..484356)
FT                   /locus_tag="TA14940"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.cand.1326 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14940"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74229"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFB0"
FT                   /protein_id="CAI74229.1"
FT                   /translation="MERLFHPQSQLLDLLSQNSPKNEKESTLFHNLDKASDDQFKTKLR
FT                   LDQSENHTLGVVCLPDNTQGLKFASFNPLDPSSTFDDESIIWKSSLIDNTLSRQFRSKK
FT                   CQIDTDCYFMVVEHKVDNTFLVSPVSNYFIFDSYVPPKSSESQPSKVDNIQERLKKMTR
FT                   ASDEDRPKADDKQLPKKRKLSDIDKTNLGWDYENEELSDDENTYLNNRTTYTEDDPFYD
FT                   KNLTSYGESVKSMLILQKEQEVDEELKEYSDDEDSSSQVSVSSKVRVETSKSTQPKELT
FT                   FEDKVLLFLSDNNNKVTVKVIRSHIN"
FT   CDS_pept        484707..485045
FT                   /locus_tag="TA14935"
FT                   /product="mitochondrial ribosomal protein S14 precursor,
FT                   putative"
FT                   /note="chr2.C.cand.106 - mitochondrial ribosomal protein
FT                   s14 precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14935"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74230"
FT                   /db_xref="GOA:Q4UFA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA9"
FT                   /protein_id="CAI74230.1"
FT                   /translation="MAARNPGPVILDPPVGFPPFKNWVQRDHISRRLFRESEVNTRVYK
FT                   YVYKNFGLKGHIPIDNKVGLYRIRLRCIGGGYGRGIFRFTRMSKLAFLQVAREGWLKNF
FT                   GYRPDLFR"
FT   CDS_pept        complement(join(485111..485289,485344..485411,
FT                   485483..486228))
FT                   /locus_tag="TA14930"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.415 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14930"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74231"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA8"
FT                   /protein_id="CAI74231.1"
FT                   /translation="MDDRIVVFYHQQWLPDLEGNDTFQDVGMVSVSTCREVEVVLEPQV
FT                   LVLCLLRKLRKVKIIFKPCIYDRFYDGVLPAALVNKVKYIQKEPQEFNDMSSNACTDNS
FT                   VGNKNEDNESESDYGVVRNEDLVSYFVTLVNLNNNVNCTELESEFSLYDVPILSINRDN
FT                   LYLKSEVVIPSYIYTHLRYAIMYLIWLHPLISHYTREVVLNSEPFPFSWYSFLRKKSQV
FT                   KNECGNFGYSTLENTLRDLRFFLQGISKINWFEGCIFSNLSVLFSLPCQDLEDIVILHK
FT                   EFADLKTYCIRMNARYEVVSLKPPFLSGDKVSASHFKKNSKLFNHLLNI"
FT   CDS_pept        complement(join(486279..486348,486411..486486,
FT                   486555..486582,486616..486846))
FT                   /locus_tag="TA14925"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.414 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14925"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74232"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA7"
FT                   /protein_id="CAI74232.1"
FT                   /translation="MNIYGQYFDLTMDFSFSFKRIGTVFLWLTFLASKFSKSHFCPENI
FT                   CKLCCKPTQSGCVNGFVQNYNQALTSVSLACQDCNCSNPQIGCGWAGRRFKRVECNSCS
FT                   TLNSLIEINPELPVAGCGKSIIDGALVYTS"
FT   CDS_pept        487582..489627
FT                   /locus_tag="TA14920"
FT                   /product="heat shock protein HSP70 homologue, putative"
FT                   /note="chr2.C.cand.107 - organellar heat shock protein,
FT                   hsp70"
FT                   /db_xref="EnsemblGenomes-Gn:TA14920"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74233"
FT                   /db_xref="GOA:Q4UFA6"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA6"
FT                   /protein_id="CAI74233.1"
FT                   /translation="MKSLSRLYSIFHSSRCSLELSNKLSTISGITTMLDSLRIGSRRGI
FT                   FTTSGRFAKVQGDVVGIDLGTTNSCVAIMEGSTPKVIENAEGARTTPSIVAFTDDGQRL
FT                   VGVVAKRQAVTNPENTVFATKRFIGRKFDDPETKKEQSTLPYKIVRSSNNDAWIEAQNK
FT                   QYSPSQIGAYILAKMKETAESYLGRTVSKAVITVPAYFNDSQRQATKDAGKIAGLEVLR
FT                   IINEPTAAALAFGMDKNDGKTIAVYDLGGGTFDVSILEILGGVFEVKATNGNTSLGGED
FT                   FDQRILNYLVEEFKKSNGIDLKKDKLALQRLRESSESAKIELSTKTQTEINLPFITADQ
FT                   SGPKHLLIKLSRSKLEQLTSELLEGTVDPCKKCLKDAGVNASELNDVILVGGMTRMPKV
FT                   TEVVKNIFGKEPSKAVNPDEAVAMGAAIQAGVLKGEIKDLLLLDVCPLSLGIETLGGVF
FT                   TRLINRNTTIPTKKSQIFSTAADNQTQVGIKVYQGERGMAADNQLLGQFDLVGIPPAPR
FT                   GVPQIEVTFDVDANGIMNISAVDKSTGKRQEITIQSSGGLSEEEVEKMVKEASNYKEQD
FT                   ERRKELVDVRNESESLLYSVEKQLTDLKDKVSSSELDQLRTLSTSLKEVLSSDDVSAIK
FT                   DKHKQLQELSWKVSQAAYSKSNTGATSANTSENTNTSNEENDTHNK"
FT   CDS_pept        complement(489700..491271)
FT                   /locus_tag="TA14915"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.413 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14915"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74234"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA5"
FT                   /protein_id="CAI74234.1"
FT                   /translation="MRLNVFNSKLRSISVFKNLLKLNSKNNNYVKNNYTFKFKKGYMYN
FT                   KYFGKNPEQTQAYINEKVKNLIGSDVKMLDSCKTLLNFNLNYKFVQLIEANIHFYTNNN
FT                   NLYYLLKYLLIYQTTPDPGNIVDNYETIMTVIDKICYNFDEINNKFEILGLLCDFEIVH
FT                   GDFTHLVHNFIADPANIKVLENNIYNVLRYFNLCNKVSCNDYTDTIINTLIANGSHRTY
FT                   KIRELLIIFKSLLDYGYFSNLSCVDYFNFVLSSIGSRFNSRDSFEFVKFFEILAPYSYY
FT                   PYLNCLDFLDNEKILQEFSNNTHLIDTRNLINICSIYLCYLKNHETLSKFINLSLVQIF
FT                   NHYNGVIHNLSLFQVVDRENSLPGSSIRCVSEPTTQSSVDLDVECLSGDELLKLTRRMC
FT                   KFFYDCKELLDHLTYPNLLEINRFLSNYESTVHFLSTPYDKLSDSYTLFGKHKPIKNKD
FT                   KVLLLDDMVGNYVLMRNKERGVGPNDVNGMSKLHTEVKNVLSGLNFHNLSNEVTIGPYK
FT                   TDILIC"
FT   CDS_pept        complement(491316..491669)
FT                   /locus_tag="TA14910"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.412 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14910"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74235"
FT                   /db_xref="GOA:Q4UFA4"
FT                   /db_xref="InterPro:IPR005341"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA4"
FT                   /protein_id="CAI74235.1"
FT                   /translation="MVPIRPLGRVITQFIFVVSGSVIKATYNAYRQSLSNGGGVLNGRI
FT                   SKIMSKEEAAKILGFNSYDNLKLKQIQEAHKRLKNINSPSGSFQGSPYLIQRIDAANII
FT                   LTNHCKSNRSSNM"
FT   CDS_pept        join(492253..492320,492398..492552,492585..492745,
FT                   492776..492874,492910..493090,493120..493332,
FT                   493405..493814)
FT                   /locus_tag="TA14905"
FT                   /product="eukaryotic peptide chain release factor,
FT                   putative"
FT                   /note="chr2.C.cand.109 - eukaryotic peptide chain release
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:TA14905"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74236"
FT                   /db_xref="GOA:Q4UFA3"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA3"
FT                   /protein_id="CAI74236.1"
FT                   /translation="MSDTNIEQWKIKRLIQKLESAKGNGTSMISLIIRPKDDVNRISKM
FT                   LSDEYGTASNIKSRVNRLSVLSAITSTMQRLKLYRNTPPNGLVVYCGTVITDDGKEKKV
FT                   SIDFEPFKPINTSLYLCDNKFHVESLNELLESDDKFGFIVMDGNGALYGTIQGSTKEVL
FT                   HSFTVDLPKKHGRGGQSALRFARLRMEKRHNYIRKVAETAVNMFITNDKVNVTGLILAG
FT                   NADFKNDLANSDIFDQRLSSKVLKIVDVCYGGENGFQQAIELSSECLSNVKFIHEKKLI
FT                   KRFFDEIAHDTGKYVYGVYDTINALENGMIEVLIIYEQLEIMRVLVKNPSTNTESVLLL
FT                   NQEQERDEANFKDNNVDLEVLDKIPLIEWIINNYHNYGSTLDFVTNKSQEGSQFQSGFG
FT                   GIGGILRYKMEAGYETNDDNDDDDDDSFM"
FT   CDS_pept        complement(join(493920..493964,493994..494069,
FT                   494100..494281,494310..494387,494451..494637,
FT                   494695..499052))
FT                   /locus_tag="TA14900"
FT                   /product="CPSF (cleavage and polyadenylation specific
FT                   factor), subunit A, putative"
FT                   /note="all_bases.C.cand.493 - PF03178 CPSF A subunit
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:TA14900"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74237"
FT                   /db_xref="GOA:Q4UFA2"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA2"
FT                   /protein_id="CAI74237.1"
FT                   /translation="MTFGYETLVDSGEGDFVCLGNFQSPNSKDILLVKENKLLLYTFSD
FT                   SFTDVLDNFDPKSLKSLNQEKIIKLVQEYKFPSSITSCSVLKQLLYFPNLHDCNSVGCL
FT                   KGEDEDSKGSDKNEYLDGIIILSEGDVMIYYFNILNCEFKLLFQFDGQEEEVDEVLDTN
FT                   YEYTDMLVVYHKDWVIDNKLANDDKIYIKNYLIIYTHKQFELKFLLLNSYFHYKSSLEE
FT                   LNSPKNKTNESPKGKDSGRRNSNEQENEKYKSPYLILSNYIKMDLKEKFNLNKNSLVKA
FT                   ISFIDNYHTPILGVLTTNYPEYISNHNVTHEVQEVGSLQHENQLENCISVINSLFILNI
FT                   DLVLININILNRMDDIPMNTVYLRGLVYNNFIGFIMCNNDLIYWFNMFSSHFYYQFMNF
FT                   YSLDVKPRQGSHIIDNRKMNLELYDYRLQTTRFKSGGFDVLLFPEKNNGDPAYLGKFEY
FT                   SDDIVDIKWEKLDQLNNEEPFYVNDFDIWFIDENNMLVVNTNNINLLQSTILTRGVELE
FT                   DARLVNLETIKSLGFIKHLNYYHFNPNKLTDGDQENRNQIHPNTDHFCLNTNNVSEDER
FT                   CYMIGIRNDKNIVKLSSKKMLYLKVYIKADGKFTINRNKMCNNNRLVEAKDNRLKIRNM
FT                   GTEEVLNDELTNKVKTVKFVDEFIAVLYNNDQLHKYHVNEFEGQNANKQSKSVKSKKSV
FT                   SNLSKVETGVKMFNTLELKNNAYLTYLTFNNYLYLYNLNSNFVVLKLTNLLQLNNTIMP
FT                   DVYNYDAMIHGESEDEMSGGNFENTRSMETNNNESSRNLNSSRTKSKLEIEEEIVSSYM
FT                   IFKEEEVYMMLLVTGYPLYIYKFVDVSKKLRRKFCYFKLVKHNQIVPFPSLLLNHDDVV
FT                   YKLKPKVEEVINDNNQIYAYPLLEVDSDSSLSICDDSDEETNGKSVPNSEFINNMFRDR
FT                   FREFYKKNPLLNLTSKNSKLYIHKVSLINPTNLASESENERSSLRYLFKNNYLFCAENN
FT                   KLYIYDTRESQIECYFKTKYSNLNFNDFNIHILNAEINGGNEVKSKELDVVIDDREDAE
FT                   KLGGSGEELVENYIYRVVKTDKISNMNLLTVSNYYYVYKNNNVRRYTNLNEKQRFSNGV
FT                   MNTYTGVIDYSGELGRLISIVVEVGENVLNNLYNMLNVRNKLQNFHKNNDNIVKDKKNF
FT                   INKQLKLFIQYYQHLKGKQNGDGAEASEDFDANSLVQEDYIIILFISNNDVKIISYYKL
FT                   ESFEKVLSLNFGLIKTHEYLLAGTCTNLGEYVESKSNLIVLDFMSIKNVGEGNYSTVYS
FT                   ADSVTITDVVGDVFRNVNPMKLYLKRTFLYPITFISTLNNKTSIINDLIKNKEINLQIL
FT                   EEEEQEDDTGAAEGKGVKRKLDNRTGAGVDSSLRNNDSKTNNSDNAPSLSHDENNLIIH
FT                   SVGSNIYIHELKGKNIIKGAFNDLYTTISAVSIFNNFLLIGDVLKGLSLFMYIYNKNND
FT                   NKNIIKISSTDPKINLPILSCAPLIEENLTFMASDNNQHLLQFIHYNLYNTNKDKLMLV
FT                   SGTRLNNNITQLLSTNQKNILFGVSSSGCIYRIIMKNDKVFNLIKKMEALITKETQLTL
FT                   TSDLYHLQLNSIKNTTLSLDSIKEVFHENSEYHRTFLGKLNLNQRTSLYDLLNFLHHQL
FT                   FSM"
FT   CDS_pept        500033..501613
FT                   /locus_tag="TA14885"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.110 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14885"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74238"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA1"
FT                   /protein_id="CAI74238.1"
FT                   /translation="MNNNHTNNTMLTSSINEKLERYTTICTEYSFVNESLLNKNIDLSL
FT                   LSKDHLLLLLNFINTISKETLPVKCILLTLKTILKSVKCELVEICHVEDSNLIINYMMK
FT                   EGMLHKKEMNFTPAGAFNTVLNTGLMLKIDNCANDPRFQPEYDQHTDIQTNNIILIPLN
FT                   DIYQNIWGILSITNIVTDSNSEMAELTEVITSESALEDEAQNSCKIFDVNYNGSVSVSS
FT                   DLESGNPLIIMDENLVYIYELCYISGIFINNIIKKLELEISRDKTNSLLTLMHSLFSDQ
FT                   LGIQSCIIALTTHAKKLIQAENCTVYLVDRIHNQVYSISSNTSEQIVKSLNDANILSLC
FT                   VNTTNIIIYNTSYSCNNASNNMYSNNKNNIIIINNGDGVKIYNCGQQMDSGSLKNLYSD
FT                   LGNSVYSEQLLEQNSFQALVEDYNTIRNGIWIPIKNDNDKVLAIIEVINKQAQELLHFT
FT                   EEDLNLLELFAVIVAPQFEKSEFSILSSVNKSTEAGLAFENIDSKYLNNVKNFIEQSII
FT                   EEDDNNLID"
FT   CDS_pept        complement(join(501775..502013,502052..502252,
FT                   502311..503985))
FT                   /locus_tag="TA14880"
FT                   /product="asparaginyl-trna synthetase, putative"
FT                   /EC_number="6.1.1.22"
FT                   /note="chr2.cand.410 - PF00152 tRNA synthetases class II
FT                   (D, K and N)"
FT                   /db_xref="EnsemblGenomes-Gn:TA14880"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74239"
FT                   /db_xref="GOA:Q4UFA0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UFA0"
FT                   /protein_id="CAI74239.1"
FT                   /translation="MAPTPGLPSSDLLKKAQEMAGRLTVSDSTKVTKISSLLSSLRRNP
FT                   FDSRYESVSDNINKAINNCSTTKVPSTLTFQQLDLILSKKTLDYKNSDEHTDTKSSECP
FT                   EVKNVQVSNTGGTSGDQSFENFENELELEQKFSKEKCLVKVFGWCKSMRSQDGGRLLFV
FT                   IVNDGSCKPNLQIVVHNDSKGYKEALKCKSGTSIQANGFLVNRVTQPKPAKEVSKENDS
FT                   ELQGEDRDYELLEDVSNRYELHITSDDSNYIQVLGLTNCPGTYPIAKKDLTMEFLRENA
FT                   HLRPRTYLISAVMRIRSSLSIAIHLFFQSKNFHYLNSPVITTADCEGAGELFQVTTMFE
FT                   NVKNVKELVNKMYSKDTQPEVPNNSLNPDSKPSNDAENNCGGKPEDSSGFNGTETKDSD
FT                   SKVNEPVDTTVDKTNAVNTDYKLLYKAVDFKKDFFKKKSFLTCSGQLSAENYCCSMGSV
FT                   YTFGPTFRAENSHTNRHLSEFWMIEPEMTLVDLPGLMELTEEFIKFLVNYILKHNYDDL
FT                   VFFNNTVDKELLSRLYNIVNKEFVHLSYTGVIDILQEYIKQNPEQPFEYNDVHWGIDLQ
FT                   SEHERFISEKVFNGPVIIYNYPKQIKAFYMRRNDDDKTVAAMDLIIPKIGELIGGSQRE
FT                   ERFDYLEKSIKENKLNMQDYWWYLDLRRYGTIVHSGFGLGFERLIMMVTGVQNIKDVIP
FT                   FPRYSGHSLF"
FT   CDS_pept        join(504299..504383,504502..504541,504605..504683,
FT                   504720..505166)
FT                   /locus_tag="TA14875"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.111 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14875"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74240"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF99"
FT                   /protein_id="CAI74240.1"
FT                   /translation="MATTSEDQAVVDFLTSSRDKISDFIKIHDSDPRLKDLLNTSREIM
FT                   ECVNDVSNFLNPCFSPNSEVSIKKYEDCVFINRDVGSENEIAELLQQIQNESSEFLTFL
FT                   ENLHVTFNSLNLVLNPSDSSSDSGSNTLSKSRILELYNENKKLANEIDRLNTEIIANDS
FT                   KLSELESTKKLCEKELLMYDKLLKSSQDLNNREAQEKLMIYDKLLKYLEPNSV"
FT   CDS_pept        complement(join(505174..505531,505570..505882,
FT                   505938..506184))
FT                   /locus_tag="TA14870"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.409 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14870"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF98"
FT                   /protein_id="CAI74241.1"
FT                   /translation="MGVETQEKFNIDFIKKFIGPNNKENTKQNTKNNEQNGLISGADDL
FT                   KFDDLKLDYDSNDLSTLESKVDVYLSKIKELDTSLNEDDNKYEALNEKVREFVSIEKLH
FT                   RCGSDNRHIYFAGIPLSHSLEVLKGLRIQKEQQERINQLESKVNDLNDEITELNEEKQL
FT                   HFYKFEKSIHKALNMGLAIQNMLLFFDRYDKVRMKIFILKLRAGNYQSIKLNLRRLEKY
FT                   KITAFTNSINKIMKFKLKYYINLLKAKEPFEKPKYKFEPAKLKKTPRVKTPKVDPDVNV
FT                   GVDVETNLLNRLEKLLVQEINTLM"
FT   CDS_pept        complement(join(506364..506469,506499..506653,
FT                   506732..507513,507545..507941))
FT                   /locus_tag="TA14865"
FT                   /product="hypothetical protein, conserved"
FT                   /note="ankyrin repeat protein, putative"
FT                   /note="chr2.cand.408 - PF00023 Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:TA14865"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74242"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF97"
FT                   /protein_id="CAI74242.1"
FT                   /translation="MVKSDEENGPPDQLDDDVEWDDEFMYLLRVNDLESAKQVLEKRLV
FT                   KDLNYTNEDGNTALHYVCANDLEEAAIFLLRECKVNYTVNNKCGNSPLHWIVQNKALKT
FT                   LKVLLWHDYEVHKNELNYSKYTHNFTFKDSKFKLSKETLEHYNIKDYPEDYSRINEIDI
FT                   TKENQFGKTVLSEAFRSENLELLQLILEHPISAILDQKAENTTEEDNETESVDYVIHEF
FT                   QFINKGTLSQGEAENLKYEGKMQENDKFSTKSENNVNDADLGDNKASLKVKIKEMCIKD
FT                   DKILDAENSELDSSGLIIWESSVIASFWLSMLAGSNNYSGLNVLELGSGCGLVGISFKV
FT                   ACQYYKQPIKLTLTDYSDKTVENLKYNVELNGLKEDVWVSQLNWNLYDKMPDNELYDLI
FT                   IASDLIYDVKLVECLANVINKVLTPKGTFLYTYKISRNGSTDFINRLSEFGFQIEIQHV
FT                   PKVCQQNPFVNKNKVTNWKQC"
FT   CDS_pept        join(508415..508501,508545..509058,509108..509215,
FT                   509279..509458,509505..509641)
FT                   /locus_tag="TA14860"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.112 - score = 39.77hypothetical protein,
FT                   conserved, pfe0995C"
FT                   /db_xref="EnsemblGenomes-Gn:TA14860"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74243"
FT                   /db_xref="InterPro:IPR000949"
FT                   /db_xref="InterPro:IPR031724"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF96"
FT                   /protein_id="CAI74243.1"
FT                   /translation="MSNNFEEDIAESETSLQNFSDDDLSHLKQDFNNDNLNKELSEEEL
FT                   SDKEQLSESAMNPDESTQSRFDSEEHRLENEKLTSDNELLDSESKTENSQVKFENEEDK
FT                   FDGEYKPDDEQMRGEKRLLESKEDASTSFNKHVELDSAENKEKSPVKIVTDEKKKKKPT
FT                   TEGSNFQTKINVGYNHQVPFTPAFFLDHSYNNNNNGYKKEWARLMYSPYQMEKIRRRKL
FT                   KEGLYDSVIKNEFELAEFIQMCAKNWKNNPGWHPFSPEFAYKILHFADYDPNKALKYMN
FT                   DNNFNFTCNFKLLNSCICDPPIRRYDNKWKPKDRRGQVPTNPYPPPVTLRGYLLRRHTV
FT                   K"
FT   CDS_pept        complement(join(509790..510031,510082..510227,
FT                   510304..510440,510561..510584))
FT                   /locus_tag="TA14855"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.407 - PF02338 OTU-like cysteine protease,
FT                   not good gene model"
FT                   /note="OTU-like cysteine protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14855"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74244"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF95"
FT                   /protein_id="CAI74244.1"
FT                   /translation="MNFYKDEQIFLIFIFNFFVEVDVGKQEYEQLQDKLKELGLKIHDI
FT                   QPDGNCLFKSIEHQLKYYSENGYNLPKYNYMELRRLIVDHLKSNQNEYESFLAVNNTSD
FT                   SPSINYLTYCENMLKDGEWGSELEIIVLTKLLNCNIKIHNSYNTIEYNSPNNSGATLNI
FT                   SYHKHQYLLGEHYNSIIPI"
FT   CDS_pept        join(510699..510811,510843..511408,511467..511529,
FT                   511561..511760)
FT                   /locus_tag="TA14850"
FT                   /product="dolichol phosphate mannose synthase, putative"
FT                   /EC_number="2.4.1.83"
FT                   /note="PF00535 Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14850"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74245"
FT                   /db_xref="GOA:Q4UF94"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF94"
FT                   /protein_id="CAI74245.1"
FT                   /translation="MEKELNRLEDLSIIVSTYNEKDNIAFLVYLIHYYLKPLNINYEIV
FT                   VVDDNSPDGTASVVEKLQELFTNEFLVKYNFPHIPMFDKHDVHDFENSFESFNSSEDTK
FT                   GKRKLLGRKGSKKDELASKNVERTMKLVKRMKKLGLGSSYVSGLSHCKYDFVLILDADL
FT                   SHHPMYIPSMLRLQKEKDLDVVSCSRYRSEGGASGWPLQRIFISKTLNYLCKLFFRPKV
FT                   TDLTGSFRLYRKDVLSKVINTVHSKGFLFQVEMILKCEKVLNAKVDEIPIVFIERIYGK
FT                   SKFGKTSKIQLFIGLTEIFRGLVGLSKLLWEF"
FT   CDS_pept        512869..513597
FT                   /locus_tag="TA14845"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.114 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14845"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74246"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF93"
FT                   /protein_id="CAI74246.1"
FT                   /translation="MLYNNYKLLLKKYNELNEEKMSYVEGLKEYRSRLDNSNHLLRLQR
FT                   NIILSNQQYNTSSFKQLEADLRNNELQLRNLESDLKSKEQQLQSLESELQARELDLNNK
FT                   QLELENRQSDLETRQSNLEVRESELRTKELELNEKELQLNNLLANNAAVDFSNSSSTPV
FT                   SSDDSDLFPSNSLESQQASPNSQPNEQSKTLHDTNAVGKVEVSEDNTSKGEPILVRPMD
FT                   KLDVVNNDIINSLYIKVSYF"
FT   CDS_pept        complement(join(514435..514646,514759..515119,
FT                   515242..515478,515506..516561))
FT                   /locus_tag="TA14840"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.406 - TpR-like protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14840 by TMHMM2.0 at aa 21-43 and 591-613"
FT                   /db_xref="EnsemblGenomes-Gn:TA14840"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74247"
FT                   /db_xref="GOA:Q4UF92"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF92"
FT                   /protein_id="CAI74247.1"
FT                   /translation="MAEECPFCEGQQGEYPNLGNCGLLMAAYILAGLAMMLNIRLSYSS
FT                   APYALIRFQLPENLFSVFVRRMASALELWCLPSMLLGNIIDLLQKLVEGGHQVRALIEK
FT                   AGEIQTKAGTLSSTATSQASGVGGVNTVASSLAANAQALNTAATQLPTADGLTELQEQA
FT                   TALATAAKGSDGGEDKDSLHHHAGELQSDQTNVDKAIAVIDAFKKVAEAYEKLSKQTTY
FT                   QSNKPTAEEAKQPSSLPPAKEKVNKVEEAWEGVNTQFGTLCKALFKYYADQINTRATSI
FT                   TNVDTARAFKEKYDQFGKIYDSIPDDTADKSTVQNQWTELKNVIIGEMKLWKFYWIIGP
FT                   SIATQWLNFLTYYTNMLWGNLMEIGLKSYYLHEGYKKWNDGKYKPLKGGNLYKSTDSSA
FT                   ITDEDLIPAREDKFKVIIVPSIVSQWLNFLTYANQLFTDATSLETALSGAENAKAKAQA
FT                   LVTALKQAASNTSPKGLKDLLDELSGLTGFTQIFAQAQKVQQQYETVEREYNNVKNDGK
FT                   AKAESKFKDVTNAFEALQTEYTNAVSPDKFNWIIGLKTYYKIQNYEKDKGANGENLKDT
FT                   SGDFKTPRLAKLYTIIVPSIIAQWFNFLNYVILLFVYRGGGDTGR"
FT   misc_feature    complement(join(514462..514530,516433..516501))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14840 by TMHMM2.0 at aa 21-43 and 591-613"
FT   CDS_pept        complement(516786..518138)
FT                   /locus_tag="TA14835"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.405 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14835"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74248"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF91"
FT                   /protein_id="CAI74248.1"
FT                   /translation="MVGSSDTLPDLKHVDVTDVTNEVKNNEKSENNEVMNEVNELYNEL
FT                   EELYDSLTNNCVLRSNTECVGNNTPMGSEFPLSNNFNSCLKPDDRINELYFNKLNEKNK
FT                   LIYCNNKLNEIKSLLEGENEPEQVVKKNGVAWEIDDNYLKQFELKMNIKNQEDLINCRL
FT                   NNINHNKLVLSDYYKLHQMSKNNPTPDLHPPSKQNSIVVNDVRDNNLIQTNIKRLNTAP
FT                   NFINTVPVPLKHPNLTPVNTAKNNTTPIIVNQPQNPNHKLTNGLIVRNKLNNLTVLNRV
FT                   NNDNMVYVRGNIRYKPNQPPYINCNLQFHPPVSNNLSADKVLNRKESVDTKHSNNLDSQ
FT                   HVTTPDSEHEMPNCSDYYKFNTIDDLIKYENDQYYGNSMGPLPVINDHNEGKLSNDKKV
FT                   KMCKHRKKRKRHSIHCKYYKGGSSISTDTSIENDEIRANGEVFYNTRVIYT"
FT   CDS_pept        join(518552..518657,518708..519032,519104..519380,
FT                   519454..520683,520761..521000,521105..521270,
FT                   521341..521459,521510..521641,521719..521904,
FT                   521938..522027)
FT                   /locus_tag="TA14830"
FT                   /product="G-beta protein, transducin-like, putative"
FT                   /note="chr2.C.cand.115 - G-beta protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14830"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74249"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF90"
FT                   /protein_id="CAI74249.1"
FT                   /translation="MVKSYLRYIKEDSFGIFSSPYCKSIEFFGPDHILTSTIDYVYLYN
FT                   YKLNEVKTKFLPKPDNNYNISTVTTFQLVKHHPSVNRFSRNFNDSSSHGHTSDEINYVF
FT                   VGYYDGLIRRFCINSKINDGNPVNDDHILIGHKSRITVLKDTGNMIFSGSNDNNLFVWD
FT                   VYNCQLLYKLLGHTNPIVNVLPISEDHVVTTCNNVMKVWDLHNQSPINTTIEPLLLYNK
FT                   AIYFNVGFILKPILKMLFISFTNNNVIKCCKINESNEVELLFSVKTKYTNDKCVSVDYM
FT                   EFGETVLLLVVFQKCIYVYKLLNSNEMTQKRKKRIRRLKQNIKAKINKLLKILRMVNHN
FT                   TTYEEDNESDDLNSLKSKYNHLKNLLSNNLSGDKGMTNDDTQDNNVDSETNNQTDNTSE
FT                   PVDTTMADEEVDEEGVAEEDYYKLLHIHNIKETVKSIKVNNRSIITLNTNNTVSLSRVS
FT                   LEDDVVTVDLLYEMNMYHLNNINLVRISSNNKILLTFSNDKLILWNINTNNIIKTLNLT
FT                   NINSSSNTSCIRPATSETSTDHDDGMELSNGAILENCTIINVIFINNENLLVVTSDNML
FT                   YKFNINTMLASMLNLKMDEDFISMLGTNNTIKNVYIHNDELVLIYKYNFIVKYKNDFQY
FT                   VNLQHQIHHSLIDAMHKYMYLSVDNNVVIYYYDTMRKHLMLYGHSLLVTSLDATSDVQM
FT                   LATSSLDKTIKLWSIKYGNILKTITNTSLITQVKFINMTHYLIFVNANMVLKIYDCDRH
FT                   LMITEINDFNLTINNIALTDYNQYLFLTSNNSSCIIKYKLSDDIIYVEEETEKIENIKT
FT                   FGNLNYNLNLLEEETTENGISQNNINIGGITYEGMGYNTNIMLYNVLNNINHNLMEFIT
FT                   NLLEHSDSVDCYMLNAEILLYVSIVILQINLKYYLLNNINVYKLKKLVNKKMNSYQDLI
FT                   LYNKSGLQHIKNIITNNEKEIKKRLI"
FT   CDS_pept        join(522433..522537,522598..522861,522921..523628,
FT                   523661..524172,524254..524560,524690..524891,
FT                   525012..525145)
FT                   /locus_tag="TA14825"
FT                   /product="MDR-family, ABC transporter, putative"
FT                   /note="chr2.C.cand.116 - ABC transporter"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA14825 by TMHMM2.0 at aa 54-76, 96-113, 173-195, 199-221
FT                   and 320-342"
FT                   /db_xref="EnsemblGenomes-Gn:TA14825"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74250"
FT                   /db_xref="GOA:Q4UF89"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF89"
FT                   /protein_id="CAI74250.1"
FT                   /translation="MGQCVLGHGRNRQSSHQPITVDILENKATKADILKLVKPLFWPEK
FT                   TDLTSRPHIFLRFLIVLSLFSLFIGKSLSILAPMYVGWTLDQLVLRNTRETITNMFLYF
FT                   LLLFSSICFDELRNFTYRYVQFICINDLSLKLYEHVHSLNYHWFTTSRAGQIVRSIYRG
FT                   CESMRELSQFGIITLVPTILESIVIIIVFFTVYKNIFLGMILFFGLTIYFTLTILVTNW
FT                   RMKTREAQNDKDNDMHSIANDSVNNFESVKLFTNEKFELTKYAKAVGMYELFNYKVLNS
FT                   LSLINVGQDLVVQTTTFLCLLMGILQILKDKTKIGTFTVILTYLFRIFKPLYILGTVYS
FT                   TIIKGIVGIQDAANLLKIESTVQDSPDCVELDLNTEHDPIIEFRNVTFSYVTDNCPMDN
FT                   LILKKVSFSLCKNRSLAIVGPTGTGKTTIFRLLCRLYDPLMGEVMVNGRSVKEYSQRSL
FT                   RSKLGVVSQDTILFHDSIRNNVRYAKPDATDDEIFDALKKAEFYDRVMQFPDKLDTLVG
FT                   DRGIKLSGGEKQRVSIARCFLKNPPIIILDEATSSLDSKTESQIQNTINSLVNKKTTIT
FT                   IAHRLSTIINADTILVLYKGEIIEQGRHQELLKLNGFYKSLWDVQRKKQSEIFDQDNKS
FT                   AGNSQEKDEIVLLKAEESVEGQKSDENTKETSKSVYEGNSEKENFKLDPSFIDKRDSFN
FT                   RYFNKRHLEIVKLLVKYGANVYSPAKNGMTCLHFAAQKGHLEVLKFVRF"
FT   misc_feature    join(522652..522720,522778..522831,523068..523136,
FT                   523146..523214,523509..523577)
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA14825 by TMHMM2.0 at aa 54-76, 96-113, 173-195, 199-221
FT                   and 320-342"
FT   CDS_pept        join(525904..526011,526058..526195,526228..526346,
FT                   526378..526678,526730..526777)
FT                   /locus_tag="TA14820"
FT                   /product="initiation factor 4E, putative"
FT                   /note="all_bases.cand.1338 - PF01652 Eukaryotic initiation
FT                   factor 4E"
FT                   /db_xref="EnsemblGenomes-Gn:TA14820"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74251"
FT                   /db_xref="GOA:Q4UF88"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF88"
FT                   /protein_id="CAI74251.1"
FT                   /translation="MAESASVAVNGTKKCPSLTFNKNTEDHAKLSELFESTTINLDTPL
FT                   SLKNKWVIWEQIVKMPEHSQNDYKEHTKPLVSFDSVQAFWNLWFNIPQPSELATNKRLA
FT                   RECSDGSEHFVDAIMVFRDGVQPMWEDPLNKDGGHFDYRFRPTDVQQLTVDEYWNNIIL
FT                   GLVGSTIPLCEFINGVRLVDKLSSRFPVLRIEVWFKNLGEANDPTQLMKSVGSCMARKL
FT                   DGSVGTIPKGDLKWH"
FT   CDS_pept        join(526814..526917,526951..527054,527147..527231,
FT                   527267..527339,527369..527435,527465..527507,
FT                   527537..527633,527663..527779,527812..527896,
FT                   527965..528048,528078..528175)
FT                   /locus_tag="TA14815"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.118 - WD40 G-beta protein"
FT                   /note="G-beta protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14815"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74252"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF87"
FT                   /protein_id="CAI74252.1"
FT                   /translation="MNTCFFKSDKDLNCLAFHPTLDLLVSGSINGHLDIFKFDEIGGEL
FT                   VKESSNSTTHSSSVRISKFSPDGTEIMSASSDKTVSLTDFHSNKVKWTGKGHKNPVNCA
FT                   CYIKESILASGDDEGEIRIWDTRAKSSCIGKINEFSDCVTDLMVGRDSNELIATCADQI
FT                   GCFDHRKFKLKALSDNTDHEFLAMTLVKKGKKVICGTSTGSICFFTYGFWGDLNDIIPV
FT                   NKETVNGIVKVTEDLVCTCGDDGEIYVVQLFPNKVLGKLKDFKNLDVKVRSTDSLTINH
FT                   NNTLLGFLANFEYVFLTSTDEANRLLSNDQPDFFDEI"
FT   CDS_pept        complement(join(528205..529226,529288..529687))
FT                   /locus_tag="TA14810"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.404 - transmembrane"
FT                   /note="membrane protein, putative"
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA14810 by TMHMM2.0 at aa 37-56, 66-88, 124-143, 153-172,
FT                   185-207, 238-260, 320-342 and 418-437"
FT                   /db_xref="EnsemblGenomes-Gn:TA14810"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74253"
FT                   /db_xref="GOA:Q4UF86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF86"
FT                   /protein_id="CAI74253.1"
FT                   /translation="MLSRIRLRKTNDERERKSKESEKGGYVYRKNINDKHSIVFFFLGM
FT                   AMNLNLDTSLLTERIFEVENFTNITIFLYFSVVVIVCILYMFSIKPQFWQLVAGAWVLA
FT                   ASRTCQVVLSMFAHGKSGRNLFLLFYSINGTYVISLYFLNESYLHFNNGGVFFSILASL
FT                   LQIICGVVIGDDTSRQVRRTLIICQTAYLLETLIASVWITIVFIEHHSDEEELKKQAKI
FT                   QEGGQKYEQAMKKFKYIPYYISKFFVSFFACIFRVIFHPVLIPYMMDVSNVNKLLASIV
FT                   FTFSEFLGRLVTFQVDEYIDPSKKSQSMSDDLFLFRQDLHLYLLFCYQCFVCTLAVYSS
FT                   WFQKYGISRNPYFVTFITMTSGLVTGYNNNRAASGSQAVLQYYSKSKDNSNTKPKEPSS
FT                   DSNKITPDIASDTSNVNDIITLLSYSSFLVACLISYYIQHAIIRRKETLEFILLSHRKY
FT                   MDKESVRILATKLNL"
FT   misc_feature    complement(join(528316..528375,528601..528669,
FT                   528847..528915,529006..529074,529111..529170,
FT                   529198..529226,529288..529318,529424..529492,
FT                   529520..529579))
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA14810 by TMHMM2.0 at aa 37-56, 66-88, 124-143, 153-172,
FT                   185-207, 238-260, 320-342 and 418-437"
FT   CDS_pept        complement(join(530047..530343,530380..530497,
FT                   530588..532621,532672..532888,532977..533037))
FT                   /locus_tag="TA14805"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.403 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14805"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74254"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR016528"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF85"
FT                   /protein_id="CAI74254.1"
FT                   /translation="MTNLRHLVFLEKKLVSVENKDGTNLMIGSIVDVAGDDYFMFLLES
FT                   SGIVWMCYKPWVKFDDTTHLRFVNFKTFEFEATNLFYCPLKKVLVVIGREQECDSMLKF
FT                   NSYDLSMFNDTYDQAPQFIQSTPLFPNLNEFRPDNVIKVSISDCCSTIAVSTEFSGIYM
FT                   YRNYITHSDDQKLWIIPPNKVFKMCAKNIHILDLEGSQYLFVTTDFEVVSYNLSDNKVV
FT                   YVESSDVKYEASCKLKQNLVGVYVPGRILIYHILQGMVKHIETNTNDIDSTNSGIDNIK
FT                   LHCYNEYVVNCNVDNIFDNNNIILINLYSYLLDISFIAYSYYIPRLIHIVQFMNNLYLF
FT                   TTNSNLNNPSGVFSSVLIFELKNKKLYNRVDILIKKRLFDWAIKLLKFENRSTNEIEQI
FT                   YKIYADWLYMKNKYSESICYYSKCNNTIEPCYVIQRFLMLNTKTYLYTYLYNYLYHIKT
FT                   NEKASIDNNYYILTILLLQSLNNNDTQMLEDEPKSQGNEGQELVVENELHRFLSKFSNI
FT                   YKKSIKESIIQCRYINKYEFACEIAKHQDDEEEYLNILIEDLNQFDKAFELLQSASHYV
FT                   KYNIIIKHSKLLLNYDSSKLLKLIDDIVNDNQREPNQVQENPNNNDKSSNCQLNNGFDI
FT                   NSVLNLFILENDFLTKLMGLVKDNSSLLLYTIKLNILLQQYNKYKQSYNSQDDGCSNSE
FT                   NDTSHNNVDKSALVEDSILKLLNSSSNYHTELIGLVLCLLYKYKRGSIVISIKMRYYNL
FT                   PLILLDNEDDIISLLDYVYNNYIVIKKLLYNVQKLLKFQNIIKIFNNYQSIQFQYLNDY
FT                   IRGEFKKINDTINEYNNDIMQDKLEYMNMKKNLVDLNTNYIIINNINCSSCGLHLEYPS
FT                   IHFYCKHSYHIYCVTQDNTCPKCTYNIPVRFNLIKLL"
FT   CDS_pept        complement(join(533239..533409,533473..533612,
FT                   533645..533654))
FT                   /locus_tag="TA14800"
FT                   /product="small nuclear ribonucleoprotein, putative"
FT                   /note="chr2.cand.402 -small nuclear ribonucleoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14800"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74255"
FT                   /db_xref="GOA:Q4UF84"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027248"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF84"
FT                   /protein_id="CAI74255.1"
FT                   /translation="MSTKMKQDTTSMELDNKDNPVGPLSILEECVRENCQVLINCRNNR
FT                   KILARVKAFDRHCNMILTDVREMWTVRGKGTGKKKLETKDRFITRLFLRGDSVIVVLKN
FT                   PK"
FT   CDS_pept        join(534136..534532,534570..534796,534830..534925,
FT                   534958..535152,535188..535251,535291..535462,
FT                   535494..535557,535595..535747)
FT                   /locus_tag="TA14795"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /note="chr2.C.cand.119 - ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14795"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74256"
FT                   /db_xref="GOA:Q4UF83"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF83"
FT                   /protein_id="CAI74256.1"
FT                   /translation="MSSDSDPELELEKYKSRLMSSINRKMTVTIDQDDEKDSDSPTFED
FT                   LGVCVELCRACKELGWKTPTKIQIEAIPIALSGKDIIGLAETGSGKTAAFTIPILQKLL
FT                   EKPQRLFSLILAPTRELSLQIKEQLISLEIGLDVCLILGGLDMVSQALQLSKKPHIIVG
FT                   SPGRIADHLQNTKGFSLETIKYLVLDEADKLLSADFDDSLNKIIISLPKDKVTYLYSAT
FT                   MTSKITKLQKVTLMKPIQINVNTKYHTNELLIQKYLLIPLKFKYTYLACILWKYSTSTI
FT                   MVFCNTCLTSQKVTLFLQNLSFKSVCLHGKLSQIQRLNSLNSFKTGLFNILVVTDVGSR
FT                   GIDIPFVDLVINFDVPNTSKDYIHRVGRTARAGKSGISLTLITQYDIEAFQRIEYALNK
FT                   KLEEYKDISEEEVYSKYDECCNSLRNEEMDHKKKFQLIKTNKKNQKYNKSKFKLLR"
FT   CDS_pept        complement(535845..537260)
FT                   /locus_tag="TA14790"
FT                   /product="camp-dependent protein kinase, beta-catalytic
FT                   subunit, putative"
FT                   /EC_number="2.7.1.37"
FT                   /note="chr2.cand.401 - camp-dependent protein kinase,
FT                   beta-catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TA14790"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74257"
FT                   /db_xref="GOA:Q4UF82"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF82"
FT                   /protein_id="CAI74257.1"
FT                   /translation="MYSINEVRTSSNCKSCLKTKTSMNSIVSDTQCNNGFNNIGCKSNV
FT                   SSSSKGITKCNVKVLKRFLNYQRSNTADSSSYNRLNNLGACSGELKQENSYRHYPTFKD
FT                   KQTLFNNCKRNDFEIGKTIGTGSYATVCIAKYTPNNRYFELTRYLYPNFRERGSVDSAY
FT                   TAYSGLSSGQEYYNNQVHDTETKEKIVSLKILSKDKIIEKRQLEHVKNEKNILSSLKHP
FT                   FIVEYLGSFQDPLNLYFVLEFVPGGELFTYLRRMRNFPLEYTRFYSSQVLLALDYLHMN
FT                   KLVYRDLKPENILLDVMGYIRIVDFGFAKRLDKGRTYTVCGTCDYLAPEIFLKKGHDFM
FT                   ADFYSFGVFLYELLIGIPPFYANTPQKTYKLALNNEVKFSRKISEPSRDIIRKLLQVEP
FT                   SKRLGNDVREVYFHPFFEGIDFNMLLAKRIKAPIVPTVSGQDDVSNFIKYPESWDQYKN
FT                   EVTKEQQQLFQFF"
FT   CDS_pept        join(538635..538651,538684..538746,538779..538855,
FT                   538901..538932,538969..539019)
FT                   /locus_tag="TA14780"
FT                   /product="hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA14780
FT                   by TMHMM2.0 at aa 49-71"
FT                   /note="Signal anchor predicted for TA14780 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.986) with cleavage site probability 0.000
FT                   between residues 20 and 21"
FT                   /db_xref="EnsemblGenomes-Gn:TA14780"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74258"
FT                   /db_xref="GOA:Q4UF81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF81"
FT                   /protein_id="CAI74258.1"
FT                   /translation="MEQNQGYWPRLCYSSQASSGWQLEQSRFQCQQHARPQTQGSGGFL
FT                   SSQLIFSGFIISCIVITLGIMFFQGGRNPDFNVE"
FT   misc_feature    538635..538694
FT                   /note="Signal anchor predicted for TA14780 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.986) with cleavage site probability 0.000
FT                   between residues 20 and 21"
FT   misc_feature    join(538843..538855,538901..538932,538969..538992)
FT                   /note="1 probable transmembrane helix predicted for TA14780
FT                   by TMHMM2.0 at aa 49-71"
FT   CDS_pept        join(539373..539503,539535..539716,539757..539867,
FT                   539905..539969,540037..540376,540406..540494,
FT                   540533..540610,540652..541167)
FT                   /locus_tag="TA14775"
FT                   /product="glycerol kinase, putative"
FT                   /EC_number="2.7.1.30"
FT                   /note="chr2.C.cand.122 - glycerol kinase, PF00370 FGGY
FT                   family of carbohydrate kinases, N-terminal domain, PF02782
FT                   FGGY family of carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA14775"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74259"
FT                   /db_xref="GOA:Q4UF80"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF80"
FT                   /protein_id="CAI74259.1"
FT                   /translation="MDTVKVIASIDQGTQSTRCTLYDSSMNILASSKSKHTQYHPKSGW
FT                   CEHDANEIMDSVYNTMNECIRKLKEKVSNFLLVGVGVTNQRETVVVWDKDTGKPLHNAI
FT                   VWLDIRAGTEANKMVELYGSDRHFYHINGLLISSYFSAFKLKWMSNNLDWFDKRVREES
FT                   NLTGEFLTDITNASRTFLMDINTENWSTEMLKYFRFYLKNCRIFGLTGNLLPKIRPNCS
FT                   DFGTINNEKVPGFKGVKILGSAGDQQASCIGQGLFENLATKCTFGTGAFILTNTGSKKV
FT                   MSTGGLLCTPCYKLSPTTPTVFALEGSIAIAGAGITWLQDMGLLSDPSEISEILRKIKS
FT                   SDGVVFAPAFSGLFAPRWRNDARGSIMGMTQHTERGHIVRAYCESIGLQLYEIIHSFLS
FT                   DTGLLSIPYINVDGGLSQNSELVQLISDLTNTRLERPENPEITSLGAGLLAGLEAKLWN
FT                   DLTEVKKITNGSNKTVWEPTMSPEQRMTIIKYWNLGIERSLSWRL"
FT   CDS_pept        complement(join(541241..542770,542837..542962,
FT                   543025..543372,543426..543796,543836..544163))
FT                   /locus_tag="TA14770"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.400 - hypothetical protein, conserved,
FT                   mal13p1.260"
FT                   /db_xref="EnsemblGenomes-Gn:TA14770"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74260"
FT                   /db_xref="InterPro:IPR022086"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF79"
FT                   /protein_id="CAI74260.1"
FT                   /translation="MVDVDPKESKENDNVKSDYESDKNKLGSSEGPNLSFYECPTAAAS
FT                   IQGFGEGSGYNSNSLDSDQEYNCYETVGKSDLLQLSTEGGSVSLSQYTKATGGYFAGYR
FT                   AVLYQDENSFNYNQSDSFSVNYTQVNTENLPMVEQTNHFANPGFVSSNFIVENSSPAPQ
FT                   PTVTSVRSENFVERNEFPQGSNSLSPLANTVVQNSMLPAVMESSGTSANYSLAVGGASS
FT                   GVSYVPEGFDTITVPRYRPVEVVDRTVEVPVIHHIDTFVPKKEIQEVESYVKKPYTKYL
FT                   DKVVEVPQVHYSDKIVEVPEYHEITKTVPKLEVKEKTNYVPKVEVKVVPKYVEVPVVKI
FT                   VDKYEEYEEVEEVVKHVEKVEVVEVPREVVKHVVKPVRKIVEKEKIVPVYEHRDVPVEK
FT                   IKYVPKVETIEHIREVPRVVDVPVPYNVPKHQYVDQPYLVPKYRDVPVAVPVCKTVKPV
FT                   YEYKGPTNYVDVPVHKPYFVIHDHLNFKPVGAFNGKNEGSFTVGNNGSFVTGTNTNNGF
FT                   NSENTFTPNSNPGHFPNGSFNVTDNLNENFGNSGLLGESVSYKVVGMSKVDLDKMNSEE
FT                   KKMAQVKLDEALNNPNFQVYKNSLKTSNPFDTTNNNFNAPNFTFNPPPNFKFTPNTPNG
FT                   AFNNSWQQQPNTAGPTFSNTWNQVPNTNPGMANNGTTQNNNPTTFEVPKNNNFDDSKNP
FT                   NLGPNWNKFGSFGNRNDSTNWSKWSPEFGSRYPSSSWNKWNNSNLSGNFFENNLNNKYK
FT                   FDGNYSSSNLFNWTDKLFQFFKGSKSPENSFNSNGNLQNANDLKLSNNSPTSTRDKPVN
FT                   GAHVFPGTGSTRNVWNRANYNLVQESFRNWKVPNMHLDLERNTPTNRLLFKDSKDNYHM
FT                   SSGSGSVGHRALKGSNPYPASESNTPKVH"
FT   CDS_pept        join(545584..546030,546091..546201)
FT                   /locus_tag="TA14765"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.123 - signal peptide"
FT                   /note="hypothetical protein, signal peptide"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA14765 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.943, signal anchor
FT                   probability 0.014) with cleavage site probability 0.920
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA14765"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF78"
FT                   /protein_id="CAI74261.1"
FT                   /translation="MKNHYTLSLYYIFSLFLIESVFANPHLDISANHHLNSHSMIRNHT
FT                   QSLPLSRTFNDVSKRKHNLSSKVNLHPAVADSLSTEIPHALDNFQIYYPKEPMKQENKV
FT                   DEEQRIPLILGSIGNSVYSDSHPSLELFPGSLSDLVGQATNYISEVFSGMNKSLHQFFD
FT                   RIDENLKKSNGSHVMEIGDVLF"
FT   misc_feature    545584..545652
FT                   /note="Signal peptide predicted for TA14765 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.943, signal anchor
FT                   probability 0.014) with cleavage site probability 0.920
FT                   between residues 23 and 24"
FT   CDS_pept        join(546334..546412,546470..546596,546627..546819)
FT                   /locus_tag="TA14760"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.cand.1344 - hypothetical protein,
FT                   conserved, mal6p1.224"
FT                   /db_xref="EnsemblGenomes-Gn:TA14760"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74262"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF77"
FT                   /protein_id="CAI74262.1"
FT                   /translation="MLNLLPLRNAANSLLYGKTGLQRIRVGKQAKVIEVDTSSIDEIYS
FT                   HSRDDVTLHNNFVPLKHKNFMEYKLVAYHLIEAFENPERSFKTTLGGIAFFDKLKNLYS
FT                   KKMLQTELDALLNTKQTSTSFPIQGKNI"
FT   CDS_pept        complement(546909..548762)
FT                   /locus_tag="TA14755"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.399 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14755"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74263"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF76"
FT                   /protein_id="CAI74263.1"
FT                   /translation="MGFLNGSRAVSFNQLVKMIKGISRRKDSTIWNKENPKIISKIAEL
FT                   VPSMTYLMKEHPQHIPVILYHLSGLTTKLQNNQVQKCVNRFPEKTDSYSCKKCKGLCNE
FT                   VYGNFVPQITENLPKIGPKGLSHLLSVYSSCRNPKISTVVPELLLRMSYFIYSSIKSQT
FT                   SLGDLDEIDGLLTDFSGLFKFKALSDLSEDDYLNDFIRLIDSPCIDPDSRDSLVKQSKY
FT                   YLPVNLMDVCTTLESLNSGTLNYSLHNFKGFENPLKDLVLELSFRFLYHSRFTNLSKGC
FT                   SGIRLEENTELDTICRLIGQFKNLGYRSENIVPVLVELLTNKLEYLQFRDLGTLLDALS
FT                   FYSKVYNLGPEAVDFSKIASQVNELVLSDKYFTIRSLSTFINAISKINENCGMNLEDYR
FT                   NFLKILNLGFKTYVSNWPETLNKSESLSSIAIFTKNVNDYETLNLVSEVLLKGFIPFNK
FT                   TGLYDFNVILEVLIREVKNFSFYQKINQDSYDFNQDAFGGFGTEYSKIFKASGQLNTTK
FT                   VFSAICLVITKCSFHFCTILSENQSLFRTDLRELCYFCRILSKFCKLELIENEFLSDCL
FT                   NSISKFATHLEAFFTRNHKDLSDLDHDNISEFLSEYHNLIH"
FT   CDS_pept        complement(join(548893..549147,549429..549737))
FT                   /locus_tag="TA14750"
FT                   /product="60S ribosomal protein L17, putative"
FT                   /note="chr2.cand.398 - 60S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:TA14750"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74264"
FT                   /db_xref="GOA:Q4UF75"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UF75"
FT                   /protein_id="CAI74264.1"
FT                   /translation="MVKYSREPSNLTRSAKAYGAYLRVHFKNTYETATAIKGMLVKDAK
FT                   RYLNDVIDRKRCVPFRKFRGGVGRCAQAKAFKHTQGRWPEKSCKFLLDLLKNLESNAEV
FT                   KGLEQSKLRLEHVQVNRAPVGRRRSYRAHGRIIPFLSHPCHVELIAVEDEDHVPRHTPT
FT                   EKKVVKMNKRELARMRLRTGRALS"
FT   CDS_pept        550668..551840
FT                   /locus_tag="TA14745"
FT                   /note="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.124 - hypothetical protein, low
FT                   similarity with mal13p1.259, membrane"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA14745 by TMHMM2.0 at aa 46-68, 81-103, 123-145, 312-334
FT                   and 360-379"
FT                   /note="GPI-Anchor Signal predicted for TA14745 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA14745"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74265"
FT                   /db_xref="GOA:Q4UF74"
FT                   /db_xref="InterPro:IPR022127"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF74"
FT                   /protein_id="CAI74265.1"
FT                   /translation="MGEINKIAPSLIESAPAQANVANNLLNLANNSPSTGTVPNEVCTL
FT                   IPGLFGIGIQFVLCIISVLILLLKYYFEFPRRPKKVFFMDFVQLMCGSSTVHLLNIISS
FT                   ILINKIRLGGDGSFVQDECNMYFMTTVFDATIGVYIEYRIVRYLAIKKAASNYLKNNRK
FT                   SKFTPTSQELADAKKFAINSLNSAHPGLLMGTSSISTAASINPMLEFGKFNHNELGEHN
FT                   LGVDSREIFMESKRNVGKDLEALDSRRTSTNDQFLHDLDDNIGNEGNEDDLLIDDSLPN
FT                   PSFYSNYFLYNINSLYARFNKWSNKKNNKEFLLNLYTWLIIVSGLKCISIVLFTLFSYQ
FT                   INLVTSYILHPFNDTHRLKLIFVMIVSPLFLNVFQYYVTDSIIKIKIPLS"
FT   misc_feature    join(550803..550871,550908..550976,551034..551102,
FT                   551601..551669,551745..551804)
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA14745 by TMHMM2.0 at aa 46-68, 81-103, 123-145, 312-334
FT                   and 360-379"
FT   CDS_pept        complement(551973..552830)
FT                   /locus_tag="TA14740"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.397 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14740"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74266"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF73"
FT                   /protein_id="CAI74266.1"
FT                   /translation="MAGKKLECDQYTAMIGLMNLSNDHLGEDIRNMDLTLIKELLMNKV
FT                   LNFNNHLRQICYWTEVSSSNEKKRSLTQKFTDLFQTNSQPKVNGESSENTKGTQDPSTK
FT                   QSNLISRLKNLNRNEFFVYSTSLSFNPNIKCGSDLLNPSNGGGIVFTITAKMPLDEKQR
FT                   KLYLQILLRYLGKNSVLLQVKSENSTSLDKILSNTNVVHEDPTTDGSAVLKPIPKYFDE
FT                   DYSDEDSNDNKCSNESVPNNYSFFRHSSYLLSKYANSKLVVKEEDDKFVTQRLLQVKLQ
FT                   RRKR"
FT   CDS_pept        complement(join(553191..553345,553454..553564,
FT                   553704..553808,554009..554087))
FT                   /locus_tag="TA14735"
FT                   /product="calmodulin, putative"
FT                   /note="all_bases.C.cand.479 - calmodulin"
FT                   /db_xref="EnsemblGenomes-Gn:TA14735"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74267"
FT                   /db_xref="GOA:Q4UF72"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR039030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF72"
FT                   /protein_id="CAI74267.1"
FT                   /translation="MADQLSEEQIAEFKEAFSLFDKDGDGSITTKELGTIMRSLGQNPT
FT                   EAELQDMINEIDTNSSGAIDFPEFLILMARKMKECDTEEELIQAFKVFDRDGNGFISAQ
FT                   ELRHVMTNLGERLTDEEVDEMLREADVDGDGKINYEEFVKLMVSK"
FT   CDS_pept        join(555135..555232,555372..555519,555589..557118)
FT                   /locus_tag="TA14720"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.125 - PF02121 Phosphatidylinositol
FT                   transfer protein, PF00169 PH domain"
FT                   /note="Phosphatidylinositol transfer protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14720"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74268"
FT                   /db_xref="GOA:Q4UF71"
FT                   /db_xref="InterPro:IPR001666"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF71"
FT                   /protein_id="CAI74268.1"
FT                   /translation="MEGGSGLEIFRNEKFKSNDTIGYYTEKRYHLAKWNLFPKLFTRYY
FT                   NEVFPTAEFSLQTDHIESLNISENVLNLNVQDLNKRQNYEPKYDITRIKLGNLFPIKND
FT                   WYKSPESSGTVSYKLLRLNIPYFGLLSSKIESYIVNFFHESLIYYTCMGLCSFELWNKL
FT                   SLENLRITEVDCYHKLNEAFKNQYSKKLDKSLKLEPVNVQKGTKIIIPKEISLTSNDIV
FT                   AYPEPDSLEPESQSTPTDQNEVEDGTKLSLDEVKSDLVSDETPVHLLDNETAPSLASDS
FT                   DHVVPLSETRTTSLDDKLMLVEQLDELTPTNIELAGPIPVVSFDDSEFKDAVENFEDLE
FT                   DYDPEDYVSKSISSSLSQVLKISTPLFPKHSSSSDSNFVKSLSCDQATQTSDATESKPD
FT                   ESVDKTDELSKESEVISVELPPPKPSLETTTKKIISTLDDTSHTKESDKKPETPEDTLM
FT                   YDIPITFTGYLYKLGRGFSSWSWNMRYIIVCGFNFYYFDRKNDTRPKDTINLKNSRISW
FT                   TGTHMSRPFVFSVTTQDKIVYYWSADEEETVKRWILLLQVLCEESPPYIVKQLAYELTF
FT                   HQNSTEGITNSIAKL"
FT   CDS_pept        complement(join(557267..557326,557356..557775))
FT                   /locus_tag="TA14715"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.478 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14715"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74269"
FT                   /db_xref="InterPro:IPR008584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF70"
FT                   /protein_id="CAI74269.1"
FT                   /translation="MVVIGLFVKAELENASEVKVGPDHVWSLNLKESDGFEKRDNVTLS
FT                   ATELADTGNSRNSVNLCVNFKESRRKATITLRNVKDVTRDFFPYNNDYSCLVAFDCRGV
FT                   DIMSWNPNGGYSVVCDSGNVIDDVTFEDGSWVGYDEKSGNCVSVLNLEYELKVIP"
FT   CDS_pept        complement(join(557829..558067,558097..558517,
FT                   558583..559082,559131..559298,559393..559579))
FT                   /locus_tag="TA14710"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.477 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14710"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74270"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF69"
FT                   /protein_id="CAI74270.1"
FT                   /translation="MDSDIVEAVTWLASEFAELADLIEDPFPEEHNDYKVVPISKISTE
FT                   TVPSWNSVKLPSDEIALSTNVPKFLVNEAINNKIHVGSSDLLGLEVEAFTIFLEESNKY
FT                   KSKMVKKLVARGKIKSNGQLELEHVHRMRSGESHLTRVYNVGSTNAIFAMICRYSKKYH
FT                   DASTNILNMAVRESLKEAIEKGIDILAYPTSIEEDVVYPDFQYLDTLLRTLRRWLELPE
FT                   VSSKISKIYLISHTPAESYYSDDSTASSIGAYNCMEVIGNKNDSSKDLLNLLRRYFPRT
FT                   NYEELLSADLATTGNVNGEIVSEERNIRISEGFSTNSSKAVLSKPVINLAESLRVSNDS
FT                   DSTQKESEYSYYLKLYYSISKLPVYTKLRDSRFVEWQRTDPQKRPVLIINTKNYEISNP
FT                   EYSLCYILGCVKAFIHHKFVIVVLHLDHSIINSTSLLNLLSNLCRIFGKERTKNIAAIY
FT                   FHKCSWALRSYLFFTSALLPTEVWDATVFVDSYREVSHLGLDPSLF"
FT   CDS_pept        join(560109..560284,560318..560530,560560..560748,
FT                   560779..560820,560850..560906,560936..561023)
FT                   /locus_tag="TA14705"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.cand.1347 - signal peptide, low sim. to
FT                   ribosome recycling factor"
FT                   /note="hypothetical protein, signal peptide"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14705 by TMHMM2.0 at aa 4-23 and 30-52"
FT                   /db_xref="EnsemblGenomes-Gn:TA14705"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74271"
FT                   /db_xref="GOA:Q4UF68"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF68"
FT                   /protein_id="CAI74271.1"
FT                   /translation="MLYTTFLIFILHNHLSMFIFIGFNTKLTQFFLYLNFFSTFYICYL
FT                   SFFTLNIPNVTSFRFHTNYRNIAKLNQFHVFGSKKKGSRLVEDEADTAISMVVLERLHT
FT                   ECETKLKSIEDQVKSELAKICEHKAAPSLIGHILIQTETGRKQLRYLASIVNKGNFELE
FT                   VTPFSMENLYGIFSTLSNELTGYNVKLMPSFVSIVIPQMGSDMKKKSQENVKRIMNMGM
FT                   EQIRLARQNSMKSLKNMESGLSQDMLFKQKVF"
FT   misc_feature    join(560118..560177,560196..560264)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14705 by TMHMM2.0 at aa 4-23 and 30-52"
FT   CDS_pept        complement(join(561134..561306,561402..561559,
FT                   561701..561851,561930..562014))
FT                   /locus_tag="TA14700"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14700"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74272"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF67"
FT                   /protein_id="CAI74272.1"
FT                   /translation="MAQFSWKVIDSKPATLHSSIESLEKCNNDISLCLHSSSHKTRILS
FT                   QLETFLHSIREISQDPSFKQYIEPLPSLEFLKTTYNDDFEGVWISCGDIVPLDSLGYLT
FT                   TGDYQGLVSLRVTLKVLTFIPKLDVIIVKTENLPEIKQENNEYSLVCNGRTVSENSLLT
FT                   LQLTSVTVLKRNKWLNLSAKIHNVT"
FT   CDS_pept        join(562213..562333,562368..562569,562599..562890,
FT                   562936..563009,563039..563236,563265..563395,
FT                   563451..563551,563581..563660,563693..563820,
FT                   563885..563976,564016..564249)
FT                   /locus_tag="TA14695"
FT                   /product="nucleolar GTPase, putative"
FT                   /note="all_bases.cand.1348 - score = 61.69 PF01926 Gtpase
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:TA14695"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74273"
FT                   /db_xref="GOA:Q4UF66"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012971"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR024929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF66"
FT                   /protein_id="CAI74273.1"
FT                   /translation="MKSSKKNRRMKRSKSQPFPAFKSSTATTNPFRAPPKGLKEGQYRT
FT                   KGTIKRLNMYKQKPNFSKMNAKNLDPARINPDRRWFGNTRVLTQEQMTNFRNELGSVKD
FT                   DPRTHIIKRSKLPMSLLTDTNIKIDNSKILSIESLEDTFGRKSKRKRPKLQVSTIEELV
FT                   SDVNSRVYDRDKDMSLSIIGDNLTDETPNVIFKKGTSKRIWGELYKVIDCSDVVVQVID
FT                   ARDPMGTRCLRLENYMKKHKSGKVLILLMNKCDLVPSWVTAAWIKHLNRTITTVAFHAS
FT                   VKNPFGKNTLIQLLKQYSQIFKDRKHFSVGFIGYPNVGKSSVINTLKGNRSCKTAPVPG
FT                   ETRVWQYVCLTKRIHLIDCPGVTPFEEGDDTDKVLKGAIRVERIPDPENYINKVIELVK
FT                   KDGLVRRYGIKDFNEDNFLELVATKFGKFKKGKVPDISIAARIVLYDFQRGRLPFYCEP
FT                   PKEESQLDPTEDIKKHLEEIENLCVQQTTEIEPEDVENICNLKESSEDIDYNKEEEREE
FT                   DQNIETSDKSQGKSCPHNTPTQIPNLDYNSFLT"
FT   CDS_pept        join(564287..564347,564380..564558,564588..564764)
FT                   /locus_tag="TA14690"
FT                   /product="acyl carrier protein, apicoplast, putative"
FT                   /note="all_bases.cand.1349 - acyl carrier protein, signal
FT                   sequence, apicoplast, PF00550 Phosphopantetheine attachment
FT                   site"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA14690 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974, signal anchor
FT                   probability 0.006) with cleavage site probability 0.912
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA14690"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74274"
FT                   /db_xref="GOA:Q4UF65"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF65"
FT                   /protein_id="CAI74274.1"
FT                   /translation="MIINLIKHLFHATLVLLLIPGIDSFVLSGKSFHISPINRINKTKF
FT                   TLLSTSDTLNTITDLVALRFNKKKEDIDPNSDFYKEFGADTLDRVELLILLEDEFDLNI
FT                   PDNHFRTLRSIKDISRYIDGKLQSKGRLNLTLPE"
FT   misc_feature    564287..564358
FT                   /note="Signal peptide predicted for TA14690 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974, signal anchor
FT                   probability 0.006) with cleavage site probability 0.912
FT                   between residues 24 and 25"
FT   CDS_pept        564796..566151
FT                   /locus_tag="TA14685"
FT                   /product="actin-related protein, putative"
FT                   /note="chr2.C.cand.131 - PF00022 actin"
FT                   /db_xref="EnsemblGenomes-Gn:TA14685"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74275"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF64"
FT                   /protein_id="CAI74275.1"
FT                   /translation="MPVVSIQSGGDDVSAIVVDPGFESMRVGNCQEDFPREYIPSLVYR
FT                   DFDQPASSRESWNILSPVKVRPFAEMRRLLHVNRDNNLDLDPFVFERLLRFAIEGHDLF
FT                   LDIEDNGKSVNKIGGLGLDPSIHPILVVEPTAESKQFRDSSLEVIFEQIGACASYLAKR
FT                   AALTAFSVGRSSALIVDVGAGGCTVSPVHEGISLQSTIQDSLIGGNTLDLQLANYLFND
FT                   NHNMFEPSSDPYKEYLRLQMAKELREKFCFYDNVTEDTNAADSASNSQSNQENSVNAGK
FT                   SSVNHVQHSQKESQKDPKKFRDKNMTYNLPDGTVVNMEKYVNSIPELLFNPSGSTISEF
FT                   NNFKGIVTMINDCIFESDVDIRRELLSSIVIAGGYTLTHGIIPRLNGDLLKSPIGSIAK
FT                   FKLVHSSSYLEKRFSTWLGGSILASLGRFQQLWISKSEYQEHGTIIAYRRCH"
FT   CDS_pept        complement(566479..576060)
FT                   /locus_tag="TA14680"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.392 - signal peptide, hypothetical
FT                   protein"
FT                   /note="1 probable transmembrane helix predicted for TA14680
FT                   by TMHMM2.0 at aa 5-27"
FT                   /db_xref="EnsemblGenomes-Gn:TA14680"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74276"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF63"
FT                   /protein_id="CAI74276.1"
FT                   /translation="MNVTSLVSVLLVVVALVVLVVALGFFFTKKEKAGAEEGEGTKEVP
FT                   STAGGPGVPGVPGAQNVLNVVTYLRDDKVEELKSMPNSQLFDARAKQDYKFGDVTVAVA
FT                   VAEVENYPGYTKFTHTLPNPFKPEYLMFDSFVRHDSFEDPVVSLTAYWWFNSLLFLTFK
FT                   TLNEAGSSAKYYHFTGLLSESGLVWSKFVVDPTRLLDPGVLGAKLDELNAALGNAVVMN
FT                   LDEFVEGASGTYTTELSGFVTTFTLTKASFTKDGFYKVTHKLLNQVSEGSKAFKLKRLE
FT                   FSGSELSDVTLPNKPVLYALVYWWYNMPLLVEFDLQGGTREYLTYNFETNNWLNDTVTT
FT                   VRTKLNKLKDNVGVPLVLDLSKRHGREDVTYTTNEVLVRVSVNDNSNAGFAKYTHRFAT
FT                   GKSHFVGSFLNAGTTQMGLPVVRLNELSVYFSDDVPLLLEMNLALSGGSANKLVYYTSN
FT                   GFGFWTKSVLGPDLRTPAALLKKLVADNKKLVADNDKYVVDVSAKNNYLSLGKLLTVTK
FT                   VSDQSHFQDYELFLHKDKNNAPFKFEKLSVAGKDVKSEGVVLQSGATAATVYWFLDKPL
FT                   VVKLEGTLPATPPPRTSSSEAEQQSQVPQQDSRQSAQSRVQNASFTNYYAYNGESGLWK
FT                   RTELDSAARTDTNAGLKKLLDDSRASLGSVTVNVGHSAGTYKSGPVTVVVTSEPFDTKK
FT                   ETLYDKMVHELSSPFTLGNLKSFDFVLSLKQNKANSNGQLEDFLLKDLVLKKVEVYVYK
FT                   YVPLALRLVLKNGTMHYFSNTVDNSTWVLFTPTANKSVLSTLHDVRAKLNKVSTLDVCR
FT                   KLAGGADTTYELAKDVGDERVQVTLSPVEVSNPGLTGLVHKFPSDVKLSSMTCNGELLT
FT                   GLDYDSVRNVYVYNRGEVPVVVKTNSDPKFFRSDGTGLLTLHPLPQGVNDLNAEQVVTL
FT                   LNQVSEDLGPVFELNLQTKTSYTAGGAAVTVTPKPLNDDWNLYTHSAPENVQKFTVSKF
FT                   LKGTEDATGLPHSSSFSSVVVGLKGDVPHVLALKTVNNPRYVWYVFNKYTWLLDFESDE
FT                   LLEDSELLAYMLDVEDGLDNEYDFELSPGLHSDSFALDYHDLYLDLESYKYLSYVPFSN
FT                   KFPFLVNSLMYDSVLLEVPELNTKHLKWLSAYTLWKVPVVFNAFTHDNKHLFYENTFEG
FT                   SWKRFELADLSEEKLNAKLKEVKDRASGNFSPELTMQTSYVKYGFAVDVTPSNVNGDSG
FT                   FKKYVHKLPRLAGQTQDKAFKVPFLTYNYVPLNAVMPKGTMTQVEVYQNGDGVPLGVYL
FT                   LATQAAAASDSGGASTTTSKQTHNYFFNTSGEWVAHDNTDAALDVNVLKTKLTEANKLL
FT                   GFYVDVDLARKLPYVFSKDVKVNPASGSTDQGTTEKKAVDFLVSFNPKPFYKYTTYTHV
FT                   PQVRVGTDPVKTQDFVPFVASFKQTGKLLKGFELSKVVKFTVYWLDDAFPLFVHVTTSN
FT                   SNKYYGRKEDDDWVLLKTSTNALDDVGLYWLLTMARKNFAYGADVELSGGLAEGYWERY
FT                   FTNGLAMKVVDQGLVGTAFKSYLHTSASVLSPTFKLQNFNLWGNFVYKVPNLGFTHYVR
FT                   VFTDLQNFPLLVEVGSSLYNSRNGPLRHYYFNYFPDPNFGWLVHMVLESKARLNLDGLL
FT                   KLLQPLANHSANVHSLSLDMKGRYDSKTGRSVDVTKTNTTPVSEFEVWTHTLADQSLKT
FT                   LLLNHNGKLVALVNKVLKFKLAKVYWLKGVPVHVELEYDGQKENSEKVKDRLHYFWTDG
FT                   GVWNNSLGSLVTKDTLVSGLNDKLLSYYTLNVTLDLGKRLKSLVTGWPTDLPLVEYKHE
FT                   NFDLPVEMVGYRLFSSDTGFKLDKVKNHGFDFTWWNLPLPSNNVYRVVVYSADYFYSPV
FT                   FLELLSKSTGSGDNNMLEHYHYYYATSSGNWVFLDTNEKKLDLGHLRLKLESFQNPLPV
FT                   LLDLGKKNGTYGLNELVVKKTMLHSTNAYAKYVHKLTNGESFLTAKWVFGGLVLSKLPL
FT                   VRANSVAVYYYQDLVPLLVEVVGDGLVRHFSVDSKGVWLPDNVSPTAVLSYLDYLVHDL
FT                   KLFGNSTDEWVPLLHNKFLQEFEFVPEPLAPAVELGRSTDGATPVSAASQSTTGATGTQ
FT                   VPTSAVSTTQVSLGTVVETRAGVLSTVTSQERQQTSNVESTGQVAQVAAALSGSGLQDK
FT                   VVAQAVVGGSDSTQSTAPGTPRAEAEAEAAPAVPTVKASAGADGVSGSSNSVLPLSTAA
FT                   PTRKPRRAFRLVPLDFDKLFFAYVTLGKLVVVNRFEYVPYGYNFSRHSLLGFKSFFDKF
FT                   FLNDRMYSVSYDPTLTLEKRKVKSLGFYSWADNPLLLKLGFDNKKPKFFSFNKTAHTWN
FT                   AHEVVNLDEELEDLNNSWNDAFVFELSKPLKVEYKYYNNSAYRTSVASTSDDAPFYSVE
FT                   YKTYRYKPAKSSFADDVYTLLKFKVAKLRLNGVDLSVDGLPLDMSFYMLKVYSSKSLGK
FT                   PLVLVLSDYKAEASGTASTTVTDSTVLNTHYHYHLNAEGSWTFFVSENDTTLNNKLVEL
FT                   ERLFAVPKALDLAVVTGDATSVWYKTKHEDFTVDRVYFHQLQPRAQQASGTDESSSVPQ
FT                   FKVVDPLVGLPVKTELPGSGLFLNVPLASYRVPVGPELDSGFELFLHHKPYFLHSVAST
FT                   PQQPARSSSQGDGAAQPAGGASAAGSDAGVGAEVGGGAGAGASGQTAPVQPVQSPAGVV
FT                   KFQKFLLNELLLSGFRLDFSEPFNALEDGYAGLTVYYQKNATVPFMFALFAPLENSGSV
FT                   DKASYHVWVYRELKWVKTTELEEFHKLMRSVELRLDLTEFVELLPKFWQLLTKFSNESK
FT                   ALLTNPFWLDLKQDDRVTYGDVVVTRDADVLPEFNLVKVTFTPSLNMGDSNAANFTLQN
FT                   VTTFGNKYAGFKFPLRGVVRVNVYFRNEPDRYAKFPALMEFVQKAPESGVNKLNHNFYG
FT                   YQGGNEWKFLFNSVNKLEEHEVSDLVSYLLYQYYRVSRLRENALLLDLDTKFSHLSWGR
FT                   FVDSVEFRHDPTANAPLSPVPEGFLLYRHSMATENTTFTLPFFKLQGHVKETGFKLPFA
FT                   EYFVYYKVGEYVPFVFVLAQADSLKKKAEHHWYFVKKDGFVKFKFAEDVDPDNKDSKTK
FT                   VSDKFKELLNAAPTPLNEQDSLKALPTGTTVTYPTFPATDSGVLSKPTNGVLSRTGSQS
FT                   RPKRQDPSGQFDVGSGGDGWF"
FT   misc_feature    complement(575980..576048)
FT                   /note="1 probable transmembrane helix predicted for TA14680
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(576682..577734)
FT                   /locus_tag="TA14675"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.391 - signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="Signal peptide predicted for TA14675 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987, signal anchor
FT                   probability 0.000) with cleavage site probability 0.876
FT                   between residues 18 and 19"
FT                   /db_xref="EnsemblGenomes-Gn:TA14675"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74277"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF62"
FT                   /protein_id="CAI74277.1"
FT                   /translation="MIVPVICVLSFYLSLCQSDNIVLDISKDVDFSRFHVEKGSNSKVT
FT                   THKYYRKSDFKITKVVDGECVIWDGGIKGEVCVSVTQHLIDNSSLNIHIKVLGLNKENI
FT                   DLYYEKRGKTWVQTDLKKSESYYHLNQFLDVKLVRFDVNSNPDRELFKVERTIKNGFIK
FT                   KVCSPKIGVSVTSVENKNEKIWGKNENSKFFQITISYIRNEAILAELAVQNNNGLEYRY
FT                   FENRNENWVEITPKSYVEKSKGNDLHFPLYDIKNLDLTKFSVEEYEVLDTNTIVYTPLI
FT                   GTTILNISEGNIPIWGTKGGNCVDKIWLYSRGGKYLTTILRVIDSNERQRLINYKRIDG
FT                   EWKLVVNEEL"
FT   misc_feature    complement(577681..577734)
FT                   /note="Signal peptide predicted for TA14675 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987, signal anchor
FT                   probability 0.000) with cleavage site probability 0.876
FT                   between residues 18 and 19"
FT   CDS_pept        578923..590685
FT                   /locus_tag="TA14665"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.133 - signal peptide, hypothetical
FT                   protein"
FT                   /note="1 probable transmembrane helix predicted for TA14665
FT                   by TMHMM2.0 at aa 7-26"
FT                   /note="Signal peptide predicted for TA14665 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.833, signal anchor
FT                   probability 0.167) with cleavage site probability 0.353
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA14665"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74278"
FT                   /db_xref="GOA:Q4UF61"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF61"
FT                   /protein_id="CAI74278.1"
FT                   /translation="MGASKLVSAVLVVAALLVFGAAMFFFFYKTDNKVEQGETPKSGAE
FT                   SPVPPSAKVLNVVTYLSNEQFNAMKSNLGESYLFDARSKSNSYQFNGVTVSVVSGELPE
FT                   YPGYTMYTHTFPTAFKGMKLVFDGTNSNEFFEDPVTRLTAYWWFNSLLFLTLTTEKAGD
FT                   APLTKYFHYTAHFGQDALRWDRFDRDPNTLLDYAVLGPKLDELNTSAGNFVALSLDEYV
FT                   EAQTGSYTTETDEVTVSFTLARRSSSQTGFVKMTHKLPAAAAAATAEQSGPPAFKPFKL
FT                   KKLLVSGTELSDLVLTRKPVLSASVFWWYNIPLVADFELQGGAHEHLTYSVDTNKWGVE
FT                   VVDKLRSKLFMLKNKLGDPLTLDLSKTADRDQTYTANGVLVRVSPAATSATGYRKFTHR
FT                   FSTGSSHLVGSFSSHGTPQLGLPVLRVNEVSAYYLSDVPLLLKMSMSSSGGMSTSYLYF
FT                   SNNGLGLWKKVVLDAELSTTAAVLKKLSEDNTALAMTDSYVFDARMKSNYLSAGKLVSV
FT                   TKGSVENLQGFTTYTHSPSVRGPFKFEKFTVAGKDVLPERDPLPGTTDATVYWYLDVPM
FT                   LLKVAGTSQPAAPAGPPPETPPSRSGDEESSSAPATDQSSGTPEKQSTPPPAPRAAPES
FT                   ARGEPFSFFYWYNADTKVWSALEEPPTTSEKLKAALDKARATLGKVTLNLGHSSGTFTS
FT                   GPVTVTVSDSASYDNDPPTSFTKRVHTLSVPFPVSLVKHYDFVLELGNVTEERYESIQA
FT                   TRDPVVPANVVVQRMEVYFYGEVPLHFFVYGVEGAPLRFSNSFKGTLWFKYLKTNVSLK
FT                   DCLLLQKVRLGHTAKMDVCKGSGKNDQLVTYDLKYLATPGSTPVSVSRSEVPNSDGVML
FT                   VQHKLPDNVSLKFSALTCGQRVLTGLNSDEFHTVMVYYKDQVPMYVKANSDPKYFAMSG
FT                   DGGLTRLLPPEGATSFTDEQVNTAVSTLSAKVGKVFDVDVSKKEGYTLDATEFLVTKSE
FT                   EAGFEKYLHKLKSSGEEQLSFTVRTFMYLERDAVVFSTSLKVSEFAVFYKGDSPLFLHL
FT                   KVDETKPRFYNYVYDSGLWLDDGVHEVFQEEDLWDRLEYLQEGLGNEFSLDLAEDLGNK
FT                   LFNVDVAEFDLVPGYKKYTYKPEVMDFPFLLKDLLLSGSPVNLPLEENHLFSLTAYTFR
FT                   KNYLFFHVVSHDKKDFFYKSDFAGGYTPVTFERYDEDSLERVLWDLKAKVADQLSLELT
FT                   KEASYPYHEFTVNVVLQNQTSFEGYKKYLHDLVEGETSVPFKLYSVKNDGYVTNVPLFN
FT                   ELVYFAYVYMYETTPLLLELHSSNKDMSSYHYYYFSNNLGNWELLENPSLGQLPSSNLK
FT                   EVLNSARDKMSKTFKVDLARKFSAKLLTSPTEHFHLNVSVMEDVREAWGFSVYSHVYSL
FT                   EKTGNVEDRLAPTAANLGATTLLEPSSDATSRSAEQETRVSTPGSLGRGAVPSTLPESL
FT                   VQTLEGAPAATVLPDQSPSQSQSALQPESTRSVNVAERVLNTYQTLKANALRGVNVMSA
FT                   ALPVVGKFTLGDTPLSGFGVDTVFKANVYWWLDQSPAFVHLCNGVNNKYYMKKGDKWAL
FT                   AKKSDVPLSRATVASMLDELKDTFVKPVELDLDKSSSYDSYVKYVSEGFTLRVVPSFTL
FT                   EGGFRGFTHFSATNHENVFKVNRLEVWGDVVLTELQDGFVRSATVFTDSDLLPLVLELE
FT                   WTKLNNSSFKSRFKYFKYSQSGSWVVHQTDNNHSRLVEAVLLALLKEVRAPFSNRVTVS
FT                   LERRENYGQDASAVVVSKDPTTTPGKWNGFHKLSHALNNPAAKMLLLKMSDRLVRAYPT
FT                   ATHVKRVDSYWYKNSLLLVKVTEAASAESAQDTVKYFKNDHKDDLLLLEGVAAGELTVG
FT                   TYSGDNVATQPSALLTQLAAHFKDEYYLDVAERTLGNKSDFLKLLPALYVVDTSVPAGY
FT                   ARYNLYLLDHVKGVKLNKLLYHGTDFSTGNFALPEDNVYSVYAFTPVGHFSPFLLELHV
FT                   RTSTKLVLYYYHLNQYGKWVKLETGGRRLTHEEFYNKLNVLFAKLGNVTVVDVSKNEGT
FT                   YYGLTRMNVTKFSFPGVRGYTKYLHKAHDNSNFTVSKFVNKGVVLQNLPVMKASQVAVY
FT                   FSLNKPLMLELKVGRRYKFFSSNANGQWFEARLPSGDLKSALDSVYDEHADVARNTADK
FT                   VSLHLNANFTRDYVLSEGKVEDFEGAVAVLEEEPEEPAAPRAPSRVDTADADGDANLST
FT                   ALSSADTAEASPSVARASVPPADQMVKTHVLNPLLYLDNDKLAYSYSSYGKTVFVNRRD
FT                   DLFHGYNVTTHKFSENAPFSLRKLVFLGREFDLGLDNLKFLSATLFSFSFKPLVLKLVQ
FT                   LDGTERFFSFTFLTQTWTALQVSDLEKDLDDLNYKENKLLMLDLAKDSNYEAGGQELNA
FT                   SKTAFTDGFSKHTTQSKRSFDARKRLKAKRDAKLQEKLKTKEKYRLDSEQKKRRLDSLK
FT                   VKLADSKARLDSLLSLWVKSDEPKAKLFKAFYEKEVAVAALEKEVKLAEAEYEEALSTD
FT                   SRETGDKNRVLAAKKQQLDAKKGELEKAKVAAADSLHTFPEPTSADKEVKTKLSEAVTA
FT                   AKALQEHVKPSTLVDAAVSAAKALKREEQATKLADLVLAANKLTSLKSDDKVAELASAL
FT                   TTLKDLVLALKEKSESGPKFDAVNTYAAELKQAVSSVTSLADKVDGSNFGGLMTAVKKL
FT                   KTSVLESSKLTEAYDAAVKFKFLCEGSEKLKEANAVLTKLPPTVDSLLALESSGSLSSS
FT                   SPDEAKLAKATTLLSNLKEAVKDKLDVVDSVSLVKGEFDKFKSDFAYDTSDKFTAALAA
FT                   FDKLQLYLSLALKLKEFVNEGGDSELEKLLNECNNATAMDLKVTNDLSAKLKEALSLAA
FT                   KLKTLDEAFKTAVDPESSADQSTSTKLKKLSDTSNAFSESLKTEALKKVESALGEVEKS
FT                   KEVESALLLLEEAAKVASSVKEMVDALEQDESKTSLEDKQAFVLKLKQGLNGFEKLWKA
FT                   YEAAKKNAKESLDDNTDKLKKAYDASKALYDKIVEALKSAEGSDKENKLNEVLDTFKQK
FT                   KADLKADDVSAGAKKQVTDKKTELTDTLKTSLKEGCNGAKKLYEKHLVLLAEAQKSYDT
FT                   AFKRYDLYDMTVHVSDDEDDGTPESSVLFGFGGLRLGGKNLSSAGLPVGNFLHTFNAYF
FT                   ANCSELPLMVQLKYSDSEDADEPVVDKMKRPPPASLLLNAELPSTATVPASQRQAQADT
FT                   GAAGTGAPTFTNAVERVSSLLRTGLVEVTPKVSMESAQVVPPATPASGSDSRSGSDAEQ
FT                   LPPPPRQPEPFSYPGHFFVLDLDLTWKPFVPEAKGSLRHKLLELKELHALDVNLDLANV
FT                   SARRMTTYALKTLNFSVRRVLYSSGYKLTRDSSKLQGSEAPTQPHLVDLSDYDQSVKFF
FT                   PPLDFKWFVHQMVPSVPADSTKTSDPLPQFNLQALSLNGSRLSLGEDASEALLGSVNSV
FT                   SALVNGNGTPLMLLAYKPVSNGNLVQHKYVSLSLKGDKYVVDDSMANFSNLLYNLEHSD
FT                   FAWTTDATFMMFTDAMQQRLNLLNAQLEPSYVVNLNATKNYKRGNVVVSVESSEAFDVK
FT                   YLSFTPGLLVEAAAEGGESSAMPSTVPAFTLEKVFSGDTKFKGLTLPFRNVLHVSVFEY
FT                   KFLRPLKESSPKEYSFFPLLLELSHRNEANRLENFYFRYLSGDKFELCFKTKLRLTAAE
FT                   VADVVKFVAHENLRRGNFTLSTLSLDFWVKSTFYTPRHFVTVEKLEKVQAALAPGAPEG
FT                   TLPSLTNAHLPDGYNVYKYTLHQNDTPYTVVSLFFWNHWKFSPNKHTFKEFYLYVRARD
FT                   NLADLLALVTPGASGAAATYEWYSLATPTPVAVLTGEVVSPTSSEHKNKLDQLLATVTA
FT                   NVDFWLQPEQLLWAFFTTQLTAKLSPVGNVQGFPVTATPN"
FT   misc_feature    578923..578988
FT                   /note="Signal peptide predicted for TA14665 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.833, signal anchor
FT                   probability 0.167) with cleavage site probability 0.353
FT                   between residues 22 and 23"
FT   misc_feature    578941..579000
FT                   /note="1 probable transmembrane helix predicted for TA14665
FT                   by TMHMM2.0 at aa 7-26"
FT   CDS_pept        complement(join(590865..591122,591177..591431))
FT                   /locus_tag="TA14660"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.390 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14660"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74279"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF60"
FT                   /protein_id="CAI74279.1"
FT                   /translation="MEKTKLSSVVVPSDVTICENLYSTGTRELTLMEKLGLLLTPNPVR
FT                   FNYTKNDRLELQSVLSKKYSDDPDYITDILLKRQKSVSKQVSAKVFSLVGFLGSSVLTL
FT                   YSLRYHSIKTKVLVTPFSSYFGYLVGQQAGNLYYGRWSEYGQERALGKLPAKRFLTQEE
FT                   IDQYSNK"
FT   CDS_pept        join(591735..591882,591941..592250,592321..592492,
FT                   592557..592710,592740..592954,593011..593132,
FT                   593201..593260,593296..593392,593459..593578,
FT                   593619..593756)
FT                   /locus_tag="TA14655"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.cand.1352 - signal peptide, transmembrane
FT                   domains"
FT                   /note="membrane protein, putative"
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA14655 by TMHMM2.0 at aa 33-51, 82-101, 108-127, 131-148,
FT                   155-177, 202-224, 236-258, 278-300, 320-351, 384-403,
FT                   447-469 and 484-506"
FT                   /db_xref="EnsemblGenomes-Gn:TA14655"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74280"
FT                   /db_xref="GOA:Q4UF59"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF59"
FT                   /protein_id="CAI74280.1"
FT                   /translation="MQINYFSMCRVGFELFVLKFVSMWFLRLYQFKYIFKQLFFALLNF
FT                   AIFAGFKIKELKVTQLSLLPYVQCLLLPLTLSSIDNFMLQNFLPLILISTFHCFWIRLN
FT                   ISNLNSPIFIVLSLFTVLRLFISIPNFGLFFLILTQCVTYLIIQLTQKRYIFSLYVLFS
FT                   QAIVFLTSIVFTKFNSILDFNKFHVFTRNVVFRNNIEALFINLFYHIVIFLLSIFVILY
FT                   LLSMEQGDKFRIMNTSFCSLVFLHSVFKLLHFLIMYKDNGLTNFNVLLSYILEYNSIIF
FT                   ILFCILTTVIIFMAIGLNLKYSNDVYRSKPKIRKWLHLLIVLFCYYSFFLHLEILLALI
FT                   FAILIVLFVFIELLRINNLLFDPIAEFFTNIYKSLGHDDEVHKFEVSTITMLSGILIPI
FT                   LFELKSDKFDWARASLGIATIGIGDSMASVVGSKYEGNRYNNKSLQGLVSFFLSCFFSL
FT                   VLTSFIQHGFLDNFKKLFYVSLFSSVFEVLYYTFNYLRNWGYNVVLVFVDRRG"
FT   misc_feature    join(591831..591882,591941..591945,592036..592095,
FT                   592114..592173,592183..592236,592325..592393,
FT                   592466..592492,592557..592598,592632..592700,
FT                   592787..592855,592913..592954,593011..593064,
FT                   593229..593260,593296..593323,593519..593578,
FT                   593619..593627,593670..593738)
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA14655 by TMHMM2.0 at aa 33-51, 82-101, 108-127, 131-148,
FT                   155-177, 202-224, 236-258, 278-300, 320-351, 384-403,
FT                   447-469 and 484-506"
FT   CDS_pept        join(594494..594949,595066..596934)
FT                   /locus_tag="TA14650"
FT                   /product="protein transport protein (SEC23 homologue),
FT                   putative"
FT                   /note="chr2.C.cand.135 - protein transport protein sec23"
FT                   /db_xref="EnsemblGenomes-Gn:TA14650"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74281"
FT                   /db_xref="GOA:Q4UF58"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037364"
FT                   /db_xref="InterPro:IPR037550"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF58"
FT                   /protein_id="CAI74281.1"
FT                   /translation="MDFADLESTTGLRFSWVVWPCSHEDAEKAEVPVGCLFTPLKQPDE
FT                   ESQKVPLVEYIPIRHKQSGIFLNPYCNIDFNTKKWMCPITKIYSPFPQFYAENISPQNL
FT                   PMELTNLTMEYIIPPNVTGGCFPPTFIFLVDVCIPQEELDQLKDSLQQVLSMLPGEFNI
FT                   GFITFGSVIKVHDLSDSEIPRCFVLRGGAEHTTEYVKRVLNIAQNNRFVQPLSACEFVI
FT                   NDFLEHLIPDSWPVPNNSRPNRCTGSALSVGLSLLECFAQGKGGRVMMFLGGACTHGPG
FT                   KIVETSLSESIRHHLDLQKESHNARLVKDAQKYYSGQANLAAGNGHAIDIFACSLDQSG
FT                   LFEMKVCCDKTGGVMVMSDSFSMSVFKDSLKSVFKRDGEGNMVGGYNARLTVFTSPELK
FT                   VCGIVGGCHSLKKKATNVSENLIGEGGTNEWNLGALDRQSTLAVFFDIDSGNNSVLTNA
FT                   MNAVGLNVGAVSMKNTTNVNKDANSLSGRQSFVQFQTVYFHPDGTKRLRVTSFSCKYGQ
FT                   PNLSDLSNAFDQEAAAVLMARYALYKISTEDPLNVLRWLDKKLISLVGRFADYQKNDVN
FT                   SFRLSSQFSIYPQFMYHLRRSHFLQTFNASPDETAFYRTILCRENVINSLIMIQPALLE
FT                   YSFESQTPQPVLLDAVSLKKNVILLLDTFFQLVIWYGETIHQWREQGFQDDPNYAHFKQ
FT                   LLQAPSDDARHILDERFPTPKFILCNQGGSQARFLLAKVNPSTTYTSGLQEFDGSTAII
FT                   NTDDVSLKTFMEHLIKLVVQS"
FT   CDS_pept        597170..599065
FT                   /locus_tag="TA14645"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.C.cand.136 - transmembrane domains"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14645 by TMHMM2.0 at aa 22-44, 153-175, 185-207, 214-236,
FT                   256-278, 408-430, 445-467, 522-544, 564-586 and 593-612"
FT                   /db_xref="EnsemblGenomes-Gn:TA14645"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74282"
FT                   /db_xref="GOA:Q4UF57"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF57"
FT                   /protein_id="CAI74282.1"
FT                   /translation="MEPNQCPHCTNGQAAPGSEDCPLLMSAYILAGLAMMLNIRLSYSS
FT                   APYALIRFKLPENLFSVFVRRMASALELWCLPSMLLGNFMEYGLKGYYQTQNYTSDFGI
FT                   GGGNLKDKEFGITTGYKVSGGESKKVEIIFTNIPNIDTLVPARLLKFTWIIFPSIVAQW
FT                   LNFLTYVILFFVYVIGGDQGHLTLFYFVIAISGFVFGINMVLVYAADWNYTPVYIVGEN
FT                   TFPIVTSFMHYISTLIFGNRRKWNSDFILVLIDIWVAIIISFVAAAVWTAAYGYYLDTQ
FT                   KENVITFHRGNTKAAGPTDLSDITIDSITITDTKGKPTATYNQGGPAPPDAPTLIITKD
FT                   GQTTATTPATFTKQEATPPAGTPNSIILKYTRPGTKGSAITITGKPDIVPFGHIFTEKF
FT                   DTSTVRWQIISPTLMVIVGMGLVYAIYPGIAPGMIVPFYLIDKIEMVLLIATFFPPVIV
FT                   ALLNRGTFGESTKAYSPKNEYQAHKFGEYEQGFGGWRSYIKHKPNQNYTDCDTSEPKTP
FT                   DIHNWFWHFFDILIVIKISLAAIFIYSLHYRDSDISRSIINQPKMSTALSIVFYMCHEI
FT                   LLALGFAGVIGNNGGTYVVLPAQYIGALFMIFLAFYSEGYIIEYKSHDPAHLPTD"
FT   misc_feature    join(597233..597301,597626..597694,597722..597790,
FT                   597809..597877,597935..598003,598391..598459,
FT                   598502..598570,598733..598801,598859..598927,
FT                   598946..599005)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14645 by TMHMM2.0 at aa 22-44, 153-175, 185-207, 214-236,
FT                   256-278, 408-430, 445-467, 522-544, 564-586 and 593-612"
FT   CDS_pept        join(599403..599469,599651..599832)
FT                   /locus_tag="TA14640"
FT                   /product="small nuclear ribonucleoprotein, putative"
FT                   /note="chr2.C.cand.137 - small nuclear ribonucleoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14640"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74283"
FT                   /db_xref="GOA:Q4UF56"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF56"
FT                   /protein_id="CAI74283.1"
FT                   /translation="MAGDSKPSGNADLRRFMEKRLDVHLNGSRHVVGVLRGYDTFMNIV
FT                   LDNALEVVGEEQVDLGVVVVRGNSILYWECLDRVNTR"
FT   CDS_pept        join(600541..600661,600704..600870,600993..601252,
FT                   601325..601545,601640..601710)
FT                   /locus_tag="TA14635"
FT                   /product="hypothetical protein"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA14635 by TMHMM2.0 at aa 62-84, 145-167 and 212-234"
FT                   /db_xref="EnsemblGenomes-Gn:TA14635"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74284"
FT                   /db_xref="GOA:Q4UF55"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF55"
FT                   /protein_id="CAI74284.2"
FT                   /translation="MLIFYQDSTLSLESTVGNVATQNTQTKTEQPKETTPKETKWPKLG
FT                   LFDRLKNRPNISLLQELLLRLELVLLLGYVFSTVVVLTSRFKTPGSDNLLKNCETVSKS
FT                   FSLLYLLVGLLREKGKPQFNSAWFSALSNDNRAHYLMYGLFFVRYPTKFVYTLPQLVTA
FT                   LLLLSSMYKSFPSVFPTLMRTNKVKELLMKVENNKYLVYKFRAYLECSLVPYLALCLFT
FT                   GRTNMVPLFLYFSFLRMKVHSNDVYLLNNFKTLHMTVSNYLSRPGVPPKLRSLYQKV"
FT   misc_feature    join(600766..600834,601137..601205,601410..601478)
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA14635 by TMHMM2.0 at aa 62-84, 145-167 and 212-234"
FT   CDS_pept        complement(join(601792..601861,601969..602097,
FT                   602197..602386,602466..602703))
FT                   /locus_tag="TA14630"
FT                   /product="hypothetical protein, conserved"
FT                   /EC_number="2.5.1.-"
FT                   /note="chr2.cand.389 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14630"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74285"
FT                   /db_xref="GOA:Q4UF54"
FT                   /db_xref="InterPro:IPR008409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF54"
FT                   /protein_id="CAI74285.1"
FT                   /translation="MNDKLIKDQLYKNNKNYDLVDSLPFVDTVSVELAPKVNDLIADEM
FT                   KLILEERNCSESELLANYLSDFTHKIVENRNILNDGDGMDFTKYDGLGDDKDLKAKMNH
FT                   LKMLMEYSQDSLINLELMDRYKESCWLNYLDSLTLLKLRLEKEKNKLDGMLEEVNKRRK
FT                   LSQIETANKLRSLYQNTQDYNHKNVELLTAIEQLQKNKHVNYDDP"
FT   CDS_pept        602978..604696
FT                   /locus_tag="TA14625"
FT                   /product="calcium-dependent protein kinase, putative"
FT                   /note="chr2.C.cand.139 - protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14625"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74286"
FT                   /db_xref="GOA:Q4UF53"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF53"
FT                   /protein_id="CAI74286.1"
FT                   /translation="MGNCCRRIDSTDFDTHKHANNNVNKKNRNSLNNEEANSTVNRNII
FT                   ANESEYIVPDISDIFYKNLSYPSKGIFTLYLTHQLDQNNTNNDVNNTPNGIDVPCNKGV
FT                   FRNVYNYPRIRDIVLSKDVWRSRIIYTNKLTNVYTIGTNAIGYGICGSVNHCVNKRTQK
FT                   VYALKSLSTLANSKRKMTSVFNELSIFTQLDHPNIAFMHEAYDDNTICHIVMEYCSGNE
FT                   LYDRLDTYKRFSESYAIKMTFQMLLTLNYLHSNGICHRDLKLENWVFYNQEIDSLLKMI
FT                   DFGFARVFEKGIPMGGMHGTVYYVDPEVIDGCYNEKCDIWSTGVIVYMMLSGSPPFNSG
FT                   SDKEILWKIKKGNLKFEGVRWNSVSELGKEFIRFLLNRNGNERPSAREALKHQWLANEY
FT                   NKYSNFTVPKELLYQIIRYSGETPLHRAVIALSVMESDRNCPKEVYRSFFSINTSKSGT
FT                   ISFSEFYNVMSTQLSLSEEDCTLVFRLIGFRNTPELNYTEFVSAVIEHYGTLDINMLSL
FT                   VYKKLDVNGRGVVDLESFKEVIGPYFGNVSSDEMFMSTDLNNDGVIDFSEVRRTK"
FT   CDS_pept        join(605092..606063,606096..606437,606592..606945)
FT                   /locus_tag="TA14620"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.140 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14620"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74287"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF52"
FT                   /protein_id="CAI74287.1"
FT                   /translation="MDLINNEVKSEDSILRGEVEIDSVNDDLNKLGHSDSYSSDTSSSV
FT                   FHKNKATSYDFAECWDNKPISQQVMDNSIYNKDLRECFENNVEQNLENEVNDNLEVGKG
FT                   EVKDNAPIYDLNFELKNDLNSMENEIIEELNNNVEMMGLMENMVNNSKFTARTRFNYDL
FT                   DDKFTLDPLLQKETFASDDNEDYIPDLEHSIDDYLLKTKRDDFDSKTDFEREVNPEIQR
FT                   ERSLSNFSNCDNVTEEFYKFELEKMSRIIKVLKEQLNLKDKEISKLEEKVQEYNEWKSE
FT                   LEPSKQASVIQCKAENDSVVALNFAKLQLQKKENETLTQRLKKMEEEHRMKDDELKSLR
FT                   ERIMENEFISNKFDRDLKSLEIDKQMLKSSIEGMEKTFRQREIQLKLNLDMEYQSQLSN
FT                   VLKEKEELISLVTEKENEIENCKQLLKTAQVEFTQLLNSIAKLKEMLMKKNQEIEMYKK
FT                   NVLKLETKLITNDKSSELRVSLENQSKMRERIRQLERKIEMINESFNVQSRLKEENLYL
FT                   RAKVDHLEKGPTSEIISQSVLQLGNQILPLSLTSFKHN"
FT   CDS_pept        complement(join(606985..607264,607320..607497,
FT                   607604..607687,607747..608023))
FT                   /locus_tag="TA14615"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.388 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14615"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74288"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF51"
FT                   /protein_id="CAI74288.1"
FT                   /translation="MALTHHGVLDTIKEKLDKLSKLDHDFLDPDQNSSLLSTFNDIFNL
FT                   TSEFIKNTSKEDSLISEFVNYRNDVFNQYNDKLQNSIQLTNGILFYQKLEKQKEFEEQA
FT                   NKNAKESLKSKQLNFSDGEFRILMSRQEIMDKLNEWKHICDLEQIEIKKLKCQIDILED
FT                   KISTNKFNSNQISYYNKLYYELLTSALKISILNVDEKSNVNLAILSESKKENEQTWHRF
FT                   SSSKDCDVATCDFLWNLIEKSLCNNGVRSSFKDPNTPKLNSIHLVSRNYN"
FT   CDS_pept        join(608318..608865,608937..609114,609181..609261,
FT                   609331..609429,609496..609577,609643..609744,
FT                   609817..610496)
FT                   /locus_tag="TA14610"
FT                   /product="GTPase activator, putative"
FT                   /note="chr2.C.cand.141 - GTPase activator, PF00566 TBC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA14610"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74289"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF50"
FT                   /protein_id="CAI74289.1"
FT                   /translation="MSGKDVEIIQKCDELTPPNSSRSQNPERLRRGLFPFKRVQTEDDT
FT                   SWFDIFGFGSRRFLNNNLSYGLTLALPQCDCRRLSANPITFNVEQAIKDNPNFKKLPKQ
FT                   VKGERCSRFNQWWLKCCQSAVLKQQGVYWNLIQLLGAKVVVNSKETSVSELVLGRRITL
FT                   AIEMDIKRTYPSLRFFTRYGRSMMRRILLAYAFFDTEVGYVQGLNFIVANLLWHSSEEQ
FT                   AFWALISMMYLYDLRCMFLPGLPGVFKRCEILEHCMIKYIPKLHDHLKSVGVHIPMIAS
FT                   DWFMTLCANSIPIKALVLSLPGLLWDCFFSEGWIAIFRFILYRLKQFEDYLVTMSDIAD
FT                   IMKVIKYGNASLTEKWRLMELIPGFGGVNRRRIELINAAYSTNVDNLTNDPNKNSNDCD
FT                   WLAIVEASLLCNFESNFIEDLELTNSEIMYHDLPVITNQVANKFGNNGVLAGKSSELSD
FT                   LDEAMKSCVSSENSIYLSEDESYNKLNTTNISSSTNAETVISEDNVPNSPNNVDDAENM
FT                   KLVEHLSKDSGIPMLSDSIKILYENSLGDIAQDLEKLAISFRSQLDAIGVSKAYHLHLK
FT                   ALQDELPNKLFHT"
FT   CDS_pept        complement(611011..612465)
FT                   /locus_tag="TA14605"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.387 - hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA14605
FT                   by TMHMM2.0 at aa 460-482"
FT                   /db_xref="EnsemblGenomes-Gn:TA14605"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74290"
FT                   /db_xref="GOA:Q4UF49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF49"
FT                   /protein_id="CAI74290.1"
FT                   /translation="MFTTGGTRLKVKADDIKNKAVTLSSTATSQSTTEITNTKGTDIQG
FT                   DTAPQGLQTKATQLQTKASSLYNAADGIVQAARDSGSPLTTLQGPAGDLKNAAKKAPPD
FT                   TDSLYYHAGQLANHTPGSGDLEPKATKVITAFDKVQGHYEALMKKASDEQKKNPLVTAV
FT                   KTKFEELKSEYDGMLNFTKLKKKAGELKDTAGNQTGTELTGKLQTPATELATRAQNLSD
FT                   AAGAVTDNTLKAQATALKDAAKGPEPDTSSLNAKASALQSTPNQYDKAKPVIIAFDTVK
FT                   QQFDELIKLAIEHGKLSLVQNVESAFKELKTHYDTMMPFTKIKYYSDQISIQAGNLRES
FT                   GGATEADKIVRYFEFMNQAYYKLTDKEEQTKVKNEFEPLKSVYDQILNVTKMKKYADEV
FT                   YIKAPQIDIGTATPSEVKTLIDTIEKIYDGADQTAQDNVKSHWEALKGVINGEMKHWKF
FT                   IWIIPPSIVTQWLNFLIYVILLVVYH"
FT   misc_feature    complement(611020..611088)
FT                   /note="1 probable transmembrane helix predicted for TA14605
FT                   by TMHMM2.0 at aa 460-482"
FT   CDS_pept        complement(join(612683..612873,612956..613183,
FT                   613348..613495))
FT                   /locus_tag="TA14600"
FT                   /product="UMP-CMP kinase, putative"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:TA14600"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74291"
FT                   /db_xref="GOA:Q4UF48"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF48"
FT                   /protein_id="CAI74291.1"
FT                   /translation="MPASGKTTISYKLEEIFGFKHISAGECLREEMDDSNSQYSSLIRS
FT                   YIDKGEIVPGHITLSLMRKKINSFGWGKTVVTIDGFPRNLDNVQCWVREMSDIVEVINL
FT                   ICFVCSEETIKDRLKHRTEEMERSDDKLSVLENRLRVFRDQTDPVVLCFNAASKCLTIN
FT                   ADAPREEVWDQVDRYIQSLGYKHVN"
FT   CDS_pept        614263..614937
FT                   /locus_tag="TA14595"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.142 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14595"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74292"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF47"
FT                   /protein_id="CAI74292.1"
FT                   /translation="MCTNLRDRFDKEIKEWDRIKLIIKINFRALEILLQKFLLFNTTHQ
FT                   SNNTNEDLTDYIFNSYTNTIEDIDVETGGKGNILEDKNDGINEKINGSAEGSVLINLLT
FT                   VNKPDVIKIYLQKQSNKMLELKCEIKKLIKSYQDKNLRKIQKIYEESQILYNQSVNTNT
FT                   KPISTEPTNVMELIKYVESHYKDIKKEINVINEFCVNLNVYPNDEDEIKKNLQFLQNLN
FT                   IV"
FT   CDS_pept        join(615139..615271,615369..615565,615728..615958,
FT                   616033..616217,616340..616673,616730..616912,
FT                   616984..617127,617195..617368,617494..617770,
FT                   617806..618122,618208..618930,618966..619091)
FT                   /locus_tag="TA14590"
FT                   /product="ubiquitin-activating enzyme E1, putative"
FT                   /note="chr2.C.cand.143 - ubiquitin-activating enzyme e1"
FT                   /db_xref="EnsemblGenomes-Gn:TA14590"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74293"
FT                   /db_xref="GOA:Q4UF46"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR032418"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR038252"
FT                   /db_xref="InterPro:IPR042063"
FT                   /db_xref="InterPro:IPR042302"
FT                   /db_xref="InterPro:IPR042449"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF46"
FT                   /protein_id="CAI74293.1"
FT                   /translation="MSFEEKIDTNLYSRQIGTFGFDMMGKLQKLNVLIIGMKSTGIEIA
FT                   KNLALMGVESIKILDNDVVQRRDLGVNYFVRASSVGKESIASACLHNLKDLNRNVDIKV
FT                   INNVNEELVVGNDVVVCCDQNVEVLKNLNRICRANSLGKRIGFIACDTFGMIGSVFVDF
FT                   GDNFISFDPTGTELKTGIIESITNDKEGLVTLITDGVIDFQTGDYVRFSEIEGMTELNN
FT                   KEPVQIKVNSKNSFLIGDLSHYTPHTSGGLVTEVRYPKRIEFRSYEDCVLNPSSTGCLY
FT                   TIDYSLVNRAEQLHWITMGYKHGSGDPKSTLTNAQMMNSNAKSCGVESVDEELFKSFFS
FT                   QVNFKVPPLASFIGGIVAHEVIKFTGKYHPINQWLYVDFSLPKEMLSGDFSGRGFDERY
FT                   FDQVSLWGSDLQNKLQNSKIFIVGAGALGCEFLKNFALLGCGSQQEGLLTITDNDRIEV
FT                   SNISRQFLFRTRHVGLSKSSVACESALEINPSIKVKPLEIRVGEETEDIFDEHFWSSLN
FT                   VVVNALDNIQARQYVDGICVWYEKPLVESGTLGTLGNVQVVVPHMTQSYSESQDPPETS
FT                   IPLCTLKHFPYQVEHTIEWARDVFEGLFTQIPLDIKKIRQNDEVNSSNIDVGVTEIPYE
FT                   RLELISKLLNCTPKNAKEQLLRISSELYNLHFVNNIQQLLNSFPKDHVLSDGQKFWSPP
FT                   KRPPTPLTFDLSDKIVQLFILSTTKIFASMMNLDLDVVESDILSLRGLRLPEFQPRVLK
FT                   LSQDKLNVEVQSDTSADSNPLLNEITNSNRTLNAVEFEKDDESNYHIEFIWSASVLRCR
FT                   NYAIKECNKMKAKLISGKIIPAIATTTAMIGGLVTIEFLKALCYRSLKISHFRNAFACL
FT                   ATPIWLQSEPLPPIPTKDKDYDPVTCGPVRALPPNFTVWNKLIVLIPNGTVKQLIDWIR
FT                   SKFNIEVIILSAGNLCIYNSFLPQHRNERLNAVITELVERLGKKKIGVRCSHLVIDASC
FT                   TDSDDVDVVIPTIKFQFR"
FT   CDS_pept        join(619146..619430,619520..619612,619762..619839,
FT                   619904..620084,620175..620274,620353..620805,
FT                   620880..620955,620984..621100,621135..621230,
FT                   621373..621446,621477..621557,621619..621772)
FT                   /locus_tag="TA14585"
FT                   /product="Tax1-binding protein TRX-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14585"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74294"
FT                   /db_xref="GOA:Q4UF45"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="InterPro:IPR026825"
FT                   /db_xref="InterPro:IPR032878"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF45"
FT                   /protein_id="CAI74294.1"
FT                   /translation="MPDTHEFIPETALSKIGEGSLEARKRGLVAIDSSVRKFIQSLNSN
FT                   SITPEERDSMLNNTVKTFLEFVKYKFLDQPDPNLRIGGLMAMACTALSLEKYLLDFCEK
FT                   FIKLVILSFYDQDNKVRYYSCEALYNIVKKCKVESISCISEIFDGICKLTCDIDEDVKY
FT                   ASQILNRLLCDTILEFEDVPLDLITDILANRILVLNPQIRQLIVIIQHFILLKENNFII
FT                   EIDMLEYLPKVFLGIANMLTDNNNKILYRDVRSSAEMCLNDFLIKFKKKYSKSNMIKED
FT                   FFKIILLNCKRSEHVIKLLNIVWIREICAIQPQIIHFKGFFLLMDFIISQLSDPSEELN
FT                   KIATEANHLLYRNVSEVKSISYIEKILKVLVDKLVDTQNEQVILSILDWFSLILQICPE
FT                   KMDPMSETLSKSVIQCFKHPQSQMIMESTLRTTFLLISLGDSHLELLAGDLLNLFKTEK
FT                   KLLEDSGREIVLNLCKQLGFERFYTIITNSMKLSTEAQEFRTELLTPEKSNLSEQLLEI
FT                   WSHNLSSALSFSLFIEKYDLAQDLLQKISGMNLKLDLLVKLDQIVQLMDTHIYSRLRLH
FT                   LLKPDVYPSLLNTLLGNSD"
FT   CDS_pept        complement(621945..622916)
FT                   /locus_tag="TA14580"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.384 - transmembrane protein"
FT                   /note="membrane protein. putative"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14580 by TMHMM2.0 at aa 218-240 and 261-283"
FT                   /db_xref="EnsemblGenomes-Gn:TA14580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74295"
FT                   /db_xref="GOA:Q4UF44"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF44"
FT                   /protein_id="CAI74295.1"
FT                   /translation="MKTPTRKELEKNLPKHVFLVLNKCLLLYTSLAKLELELFRIAGVL
FT                   VENRISNLTIFNADGHLNRFLSLKYKDCSDRRLDFKSLTELCLAKNSYIADDFDESCNT
FT                   NHTLIYYINKVNNDLFISSHKISGNSGRKGLTLVVIDNTHSHSKLLKLTPKPSFTNPNP
FT                   NWIREKSKKGKIILEYQVPEESSVTHPEVQKELCTFHGVTVSLPDLLISIRLTLLDLIV
FT                   FIFNYVYTLLLNKVCSLLKRIFSKVRLRRIKLDKELLKFALVIRLGDLFTGGMSVVHAF
FT                   GASGVQPWFLSEAEIYEVFGLKTMHIVNCINQFANTVRRCGK"
FT   misc_feature    complement(join(622068..622136,622197..622265))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14580 by TMHMM2.0 at aa 218-240 and 261-283"
FT   CDS_pept        join(623175..623401,623465..623565,623594..623804,
FT                   623875..624014,624079..624267,624298..624563)
FT                   /locus_tag="TA14575"
FT                   /product="TatD-like deoxyribonuclease, putative"
FT                   /note="chr2.C.cand.147 - PF01026 TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74296"
FT                   /db_xref="GOA:Q4UF43"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF43"
FT                   /protein_id="CAI74296.1"
FT                   /translation="MRIGPILCWLIRTPIVYTYKPYPSSIKLRANIKMEGESDNLGEVK
FT                   PKFIDIGANLTDSRYQGYYNGSLKHNPDLISVLERSKSVGMEKIIITAGCLEEVHEALD
FT                   LCNTYDKECKYLFTTVGVHPTRCNEFIKNKYNKSETEYLEALDNLITQNRNRVVAIGEL
FT                   GLDYDRLNFCNKQTQNKYFEYQLELSRRHKLPLFLHMRQATTDTMGISFISILVLNTLD
FT                   IKVLYILRRNRDKWESGVVHSFTSDLNSLETVLKEDLFIGINGCSLKTESNLQSVKHVP
FT                   LNKLLLETDSPWCGIKNTHSSSQYVKTRFNTVKRPEQMTPETVFTMRTEPCHILNVAEV
FT                   VHQLIDPNMDFIKFTNEYVPAWVYSLGNIRDYINCCF"
FT   CDS_pept        join(624934..625070,625199..625576,625607..625815,
FT                   625960..626879)
FT                   /locus_tag="TA14570"
FT                   /product="kinesin-like protein, putative"
FT                   /note="all_bases.cand.1363 - kinesin-like protein, kinesin
FT                   motor domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA14570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74297"
FT                   /db_xref="GOA:Q4UF42"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF42"
FT                   /protein_id="CAI74297.1"
FT                   /translation="MARKASEKGRIDVIVRKRPLSEQEISRGDKDIVVCNYDSAIIREF
FT                   KYKIDGTSFIEEHEFKVDRFYDEKADNELIYNEYVKPLVESAFREGKTCSCFTYGQTGS
FT                   GKTYTMIGSKIDNGNNTNNTVGDIGIYEYAANDIYEISKEPQFNGKVEVVVSFYEIYCG
FT                   KLYDLLQNRKLLESLDNGKNEVVIKDLSERVVSSKEELVDLMLEALNLRKIGQNSQNDR
FT                   SSRSHALLRIELRHLNNTIGSMLFIDLAGSERAADSVSMCRQVQIDGAGINRSLLALKE
FT                   CIRAMDLDRIHIPFRNSELTKVLRDVFMGDSRNVMIANICPSFQSCEQTLNTLRYATKV
FT                   KAFKSNSLNTTMTLNTLNTINSANYSTKDTINKENGISKGASIKSRNSKRSSPMDYEPR
FT                   LSNDKMDLDPLNSNNTGHTTLNALNTNNYNNKDTIVKDTTTSVNDEIAERVEGMLKSQN
FT                   DEMIREFESILNSLQLNNTNSHIFKFLTGSNSPNPNNPNNSSAIKLYTVYNRTMSVLNN
FT                   NVNSIEDVKDRLKISFKFLLYLKQLLDRPT"
FT   CDS_pept        complement(join(626930..627215,627246..627461,
FT                   627519..627957,628009..628474,628505..628603,
FT                   628635..628847))
FT                   /locus_tag="TA14560"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.466 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74298"
FT                   /db_xref="GOA:Q4UF41"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040059"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF41"
FT                   /protein_id="CAI74298.1"
FT                   /translation="MKKKDQNSKSKSKKPKVSKNDKSKKFKKKPKYDNKANNKLKNNNK
FT                   PKKVNNTVKKTNKLKESKLEYKKRLNKSYSLLLLNHKDPLKSKEIIDSLLKELPTNFSE
FT                   GINRKNVSRILQACLKYGDADVRSSISQRFRDGLNLNNLNSHSSKFLIKLFHYCNTDVK
FT                   QFLRSAFFNEKQKNLIFSRFSSDVMDIIYSKLRPKDQISVLQLYTFSNSFYLNNDETRK
FT                   AKEVNSINQLIQLISTSTSKSSCLGTSIFVICCFLYLKKMDSVITKLAEKELMISSLSH
FT                   DLLFVYVSLIEDKTELVSQLHKIYGQLLSTRSGNNSILALMDYANAKIKKHIIKSMKRD
FT                   FPEAVYNKINVNFLIKLVNVTDDTKVVFQHLVEPLLEDLNRLLHDANSVKFVLNLLNTV
FT                   DTTSPNTLKEDKVRKEELQREFLPKLVEYFKESDLKSCILDKNCSQVLLHTLKISKDSN
FT                   LLDSVLSLFSENLSEFLDNQQVIRLYQSMVKCKNKISEEFKEFKVNERLWEHVKSDVKR
FT                   VLSSKSVFLLIDLLESFQIRNQTDLISDFKDTVTIDIINEAKSALTGIICILKCV"
FT   CDS_pept        join(629187..629341,629417..629722,629789..630145,
FT                   630212..630384,630427..630671,630707..630847)
FT                   /locus_tag="TA14555"
FT                   /product="CDC6-like ATPase, putative"
FT                   /note="chr2.C.cand.149 - AAA-atpase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF40"
FT                   /protein_id="CAI74299.1"
FT                   /translation="MCESSLDSSCLSPLEKHINDKKLAIDLLKISDNSYVGFREHELNQ
FT                   LNSFLTKCIESKRGGGMFIFGLCGTGKTTTVQHALNVTSSKKGVKTVFLKGSNYTSMKS
FT                   FKNDFYQKVFGFSAKKALKTLNLASQGKVQDYAKFSDHLLQHFQSQRSLKICLIDEVDY
FT                   LSTFISNFKSYNKSNWLIQALFKASCSPKSKVVVLAVSNNLEFASKIKTENCERMLFKP
FT                   YNEDQMVNIVMEKLKSVNENSQVLNKTSLLLIARRVANTSGDCRTYLDSFIRALSNSLS
FT                   DIEKDYESVESLASAVTSVGPDSFSRSEQTYQVESYEEFKTPTRNFSPLGESTNNFVDM
FT                   SKYNVGSKEIGVVTPTLSLNKTQQLKNQLSDLPIFQLLLLLGICKSTIILNQTISKTDS
FT                   KVYYTVITSILILKYFLELAEKLKLDPVDAENFCNSEFENSLENFKQLNFISIKGTRAN
FT                   "
FT   CDS_pept        complement(join(631154..631330,631364..631445,
FT                   631517..631617,631649..631714,631754..631838,
FT                   631903..632078))
FT                   /locus_tag="TA14550"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA14550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74300"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF39"
FT                   /protein_id="CAI74300.1"
FT                   /translation="MFFKVISGNFFRSFSTLTTTHVTRRRPVWKIKQTYYHKLWNLLTS
FT                   KKWDEFNQTLQLMREKGLNNDEVTYTLKAHYFILNPYVAVENCYLVIEEMKRALIHPAV
FT                   IRMNENLINSYFELEEIGCEPPKLLWQNFTKMIFQTSIKLNRVRRHNLKRQLLLKDPED
FT                   VMKLTDKDVEKMLIEEHNSNLITPFMAIDEIHDDPIEVNPEKFKPIKPKKLDFISLYSL
FT                   QHYDSE"
FT   CDS_pept        join(632176..632302,632338..632592,632685..632933,
FT                   633001..633521)
FT                   /locus_tag="TA14545"
FT                   /product="4-diphosphocytidyl-2c-methyl-D-erythritol kinase,
FT                   putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="chr2.C.cand.151 - signal peptide"
FT                   /note="Signal peptide predicted for TA14545 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.950, signal anchor
FT                   probability 0.005) with cleavage site probability 0.636
FT                   between residues 18 and 19"
FT                   /db_xref="EnsemblGenomes-Gn:TA14545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74301"
FT                   /db_xref="GOA:Q4UF38"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF38"
FT                   /protein_id="CAI74301.1"
FT                   /translation="MRLLKCVAFLNVLSLVTGGKKKNLLTDEFEVFKKINNKLKENRSE
FT                   NYENFWDSVDNSFAKINLTLNIDPSSNVLDKYLNLCSLMQKVTWGNKIFIKKITDEESK
FT                   NIANSYDLTQNGDCILLIDDTPKVEGVKEERELDFPFDDTNIISQVLNKFRVRGENYIV
FT                   LTRKSVPIGSGLGGGSSDAAAVLNRLFTNIKFGLVSIGSDIPFLASECNLASVFGIGDK
FT                   MYEYYNKNLYSGWVYLLIPYESVSTESIYKKARELITSGKFPKCDFHNVIMNSVNFVDK
FT                   INPSDDPNNFFKHYKVNNDLENCTTNRKVKKLQKALKRRFKRNKFSMSGSGSSFFVFSD
FT                   NDSDVTALRDSYKDPLIIVKTKFKQDNNSHEFHYLYTTQYLYL"
FT   misc_feature    632176..632229
FT                   /note="Signal peptide predicted for TA14545 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.950, signal anchor
FT                   probability 0.005) with cleavage site probability 0.636
FT                   between residues 18 and 19"
FT   CDS_pept        complement(633634..635874)
FT                   /locus_tag="TA14540"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="membrane protein, putative"
FT                   /note="chr2.cand.380 - transmembrane domains"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14540 by TMHMM2.0 at aa 32-54, 123-145, 155-177, 184-206,
FT                   221-243, 521-543, 553-575, 630-652, 672-694 and 701-723"
FT                   /db_xref="EnsemblGenomes-Gn:TA14540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74302"
FT                   /db_xref="GOA:Q4UF37"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF37"
FT                   /protein_id="CAI74302.1"
FT                   /translation="MSAPGGAETKQEHPSYCPIGCMPAEDDRGNCSLLMSAYILAGLAM
FT                   MLNIRLSYSSAPYALIRFKLPENLFSVFVRRMASSLELWCLPGFIIADSIELAVKLIIK
FT                   FDTSYGDNSLKSKELKFYAIIVPSVVAQWLNFLTYVLLLVVYVMGDDQGHLTTFYFVIA
FT                   ASGFVFGINNVFVFAADYNYIPIYIAGENCFPALTSFIHYITTLIFGNRRKYDSDFIIV
FT                   YIDIFVAIIISFVAAIVWTIAYGLCPDASFDGKITYTTTNDITKIIVTGIPTTDTNEET
FT                   ITITGGKVNIKTGTVKDGNCTYAPKTTTLTDSKATITPPKDGKATLTIDINVKTTAPEA
FT                   VLNALAHLASPLNCKVTVDTAKNTLTITIAPATAEDKCIEIEITADDLGADALKGTTKA
FT                   TVRVDPAPNHLTIKYGSEKEISFAVKITEAEETQGMTAITKDIADGIKKTAEAAPPGSK
FT                   NYYYVTHTKTNIRYSITLKNQLEAATANTINNAPATIIVDYGHIFAEGFSDTSAKPSMV
FT                   SPLLIVLVGMGLVYAIYPGIAPGMIVPFYLVDKIEMILLIATIFPPVIIALLQKFYPNW
FT                   SPKTKYVWHGPQAKNNGFGGWTQYPDKKESTHEFYIGEDECEDSGQHFDVHAYLWHLFD
FT                   LLIVTMIILAYLFIYSLHYTDSNISRSIVNQPKMSTALTIIFYMCHEISLAVGFPGMVA
FT                   NAAEYTVIAQMVGAFLMVFLALYSEGYIIEYKSHDPAHWPTTGMTPWNAFCY"
FT   misc_feature    complement(join(633706..633774,633793..633861,
FT                   633919..633987,634150..634218,634246..634314,
FT                   635146..635214,635257..635325,635344..635412,
FT                   635440..635508,635713..635781))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14540 by TMHMM2.0 at aa 32-54, 123-145, 155-177, 184-206,
FT                   221-243, 521-543, 553-575, 630-652, 672-694 and 701-723"
FT   CDS_pept        complement(join(636057..636748,636818..636882,
FT                   636944..637171,637229..637362,637456..637514,
FT                   637588..637699))
FT                   /locus_tag="TA14535"
FT                   /product="50s ribosomal subunit protein L28, putative"
FT                   /note="chr2.cand.379 - signal peptide, apicoplast target
FT                   sequence, PF00830 Ribosomal L28 family"
FT                   /db_xref="EnsemblGenomes-Gn:TA14535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74303"
FT                   /db_xref="GOA:Q4UF36"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF36"
FT                   /protein_id="CAI74303.1"
FT                   /translation="MFLTSKCLISHFIVLFQIYRISSFKFPNNVNLYQNGIIGNIHEFI
FT                   LYSEKRHKEAMFGKKFHTKPKSSQVRHHRIVGRGGGVPRLNKRTKLPAKPIVLPYRRCM
FT                   LLGKMDNTKAMQISHSGVKTRKTQKLNLHWKKIWHPLRKYFIRLRISMRGLKTIKRLGI
FT                   VEAARRFHLNIDNPKDPEPTNETVTTNITRNIETGITGSKQDEGLRDLAGKLYSAANDL
FT                   YINASGGDTDSPKKEAKDLKDAVGDKDQPGDPGKPKTLREALHQLGTAENDDPDLTDLA
FT                   KAIKDKYSNFDGSGVKQKYNAVVAQKQAGKYGPGQGDTQYTQVEEAWNAFNNKYHDSIS
FT                   TDKFNITVIPSIFSIWKDLSPSTKYVYHGLNRTNNGFGGWTYYKDHQGNSNDHTAAAAE
FT                   ECKDSDLPSDGSKGTHVSVHAWIWHFLLYR"
FT   CDS_pept        complement(638385..638615)
FT                   /locus_tag="TA14530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74304"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF35"
FT                   /protein_id="CAI74304.1"
FT                   /translation="MVLSPVKGHFFPSRTFTSKTTDLKALNENEPKTRVITVKPTNPAK
FT                   TRQASVTSKRSNKFFVFNSESFKCEFLGNAN"
FT   CDS_pept        complement(join(638851..639026,639097..639239,
FT                   639288..639430,639480..639553,639613..639678,
FT                   639728..639818,639853..639882))
FT                   /locus_tag="TA14525"
FT                   /product="eukaryotic translation initiation factor 2, beta,
FT                   putative"
FT                   /note="chr2.cand.378 - PF01873 Domain found in IF2B/IF5"
FT                   /db_xref="EnsemblGenomes-Gn:TA14525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74305"
FT                   /db_xref="GOA:Q4UF34"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF34"
FT                   /protein_id="CAI74305.1"
FT                   /translation="MGKLSDVTSENSAKGSPEEEVADKLSSMDLKPESQDPKPLDSKDS
FT                   PPKFNFGEKKKKRTVDAESPKAEIIDGTGQVFVKGHVYPYEELLARIQSMINANNPDLS
FT                   GSKRYTIKPPQVVRVGSKKVAWINFRDICSIMGRSMDHVHQFVLAELGTEGSIAGDGQL
FT                   VLKGKYGPKNIESLLRKYITEYVTCSMCKSPNTTMERDCRARLFTQHCEACGANRSVNP
FT                   IKNGFHALNRGERRKAKV"
FT   CDS_pept        complement(join(640053..640487,640525..640601,
FT                   640665..640734,640765..640883,640952..641071,
FT                   641136..641275,641434..641555))
FT                   /locus_tag="TA14520"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.378 - hypothetical protein, conserved,
FT                   pfl2150C"
FT                   /db_xref="EnsemblGenomes-Gn:TA14520"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74306"
FT                   /db_xref="GOA:Q4UF33"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR032378"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF33"
FT                   /protein_id="CAI74306.1"
FT                   /translation="MAGGNAKQQKAQQKALEKQKQKIVEDKTFGLKNKKSKSVQKYIKS
FT                   IQQQITGQPPKDSDKYIAQQNKEKEEKNRIMQQKALIASLFKTTETVKQVSMESQKLYE
FT                   PKQSRMDQKIDIYLDQRIQRSKEDENMSTWDITTLEGVVQQKNTNSCTTDIICKYFLQA
FT                   VESKKYGWFWVCPNGGDDCKYRHCLPPGFVLASDVPQEVVDDDETLEEMIERQRRELPP
FT                   GGEMVTEESFKRWKEEKEKGRLDELKDRVTKDSTTQLTGKDLFTFNPNLFMDDEGAADD
FT                   FDYDEDIDLDELIRENEESLTKGNVLPDDVSSFYNYFTSYNCVILNTVKIFCDLINDVL
FT                   GYGISENPFIVIHIANVYLI"
FT   CDS_pept        complement(641841..643712)
FT                   /locus_tag="TA14515"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.376 - hypothetical protein, conserved,
FT                   pf14_0413"
FT                   /db_xref="EnsemblGenomes-Gn:TA14515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74307"
FT                   /db_xref="GOA:Q4UF32"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014789"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF32"
FT                   /protein_id="CAI74307.1"
FT                   /translation="MLTKPLLSPGFYNILNKFNGNLYKKSFSTLIFTSKLSQLKPFDHQ
FT                   SSSLHIGSNYQNVLISSDFNFNLIRCCDFQLNYKSFFSTRSNVTTRPLWDLHSGIITEL
FT                   IERSDFVALDVEYTGLHVKDERFIGVDKCYESHSLGAKKFIPCQIGLTMAKYENDLWKL
FT                   TTTSLFTIPSEGKSFSVNMSTLNFLKDNNFDFNSWIRDGITHLTPKEEEERKSLIVSKL
FT                   HQIQLNLKNLSDSNVESTRNTSNVNTEYDVSSIKDLEDRRVVEQMIERINEWILVEGDE
FT                   GRAPLEFEVESAFLRLLMHSVISIKYPNLYSNSSQRNGVRYVMVYKTQMELLEEERKLL
FT                   EEELEAINKQVGLRTLFDKISKNNKILVGHNCFYDILHIYQTFYGDLPENVEDFKKKWV
FT                   QVFPTIFDTKYISEYYQQFTPHTTLKSLYNSFLPNQNVLNRFEISSLGTRGIVCGYGNV
FT                   LNEAEKEHEAGYDSLMTAIVFIHQLETVIKNKNSSLNNLIKAYLDTSNTANSMGKVIMN
FT                   IFGEVVNSVRLVKCQPSVINMNNEEDMSKHFYMFGFPNVWKKWEIMKIWSPLWVSISWI
FT                   DETSCWIIAKNSEDVKNINLIYKMMKNPQFKLYNYGQYLEKISQSTI"
FT   CDS_pept        join(644074..644583,644636..645525,645557..646552,
FT                   646609..646893,646937..647117)
FT                   /locus_tag="TA14500"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.152 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74308"
FT                   /db_xref="GOA:Q4UF31"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF31"
FT                   /protein_id="CAI74308.1"
FT                   /translation="MSLFESFEIFCPEFVDSGHHFGLFDRKYLELITKTGHLYKKLRNF
FT                   CENIPNPDYASELSNIFTNNGKFTTDFEPESLEFFSTNTHIHGLIENTDSFMENCITLH
FT                   NINEFKPSPYYLCCFANSMNSHLNKYRNYFNSLRNLTHLSVQVSCVSKFTEKLFKLLQL
FT                   LNNVIVQFEYKSLEYKDGFPKFKCLLEILDQDYPDEFNNIVNSKLRDDLLELFRTQLTY
FT                   WLIYGKLIDPFGEFIISSSECEKSDLKSKSASIFISELLNFKPNNSSSECNHFLTISNL
FT                   VYSSRISDNATFGPVDHNTANTILMIGKLVPILNCISANSSINKVLKKLADDCLFKNWN
FT                   EVTSDNEKFSSAIENYRLQFSTILWDTYNPKYNILNKIKLLKSVYLLLEKPIYDQLFEQ
FT                   SYDIMSMNFGENELKTVNKSFTTLINRLKDDMDGGLSPENENLDNFKFMKFTNQFDINS
FT                   SFKLINDIELNEGSYEVGNESSIWYPELIYVMNGFNMNIVVDLQLVNQSKEFSLVISPK
FT                   ISHSANGRSFNDHRTLNCKCLLINFRVIHSNFANLTFSIDIVLNHNPSDCENKFTRSLI
FT                   SRIEKVVEYKESNLKLGIEMMLKRNSLKVFLKSVPDEFCFLNNYSTQSSNPSNYSNQSN
FT                   NSNNSNPSGSFDNENVDDLEIAGGVTISTKSSEHEEDLYGLDNNSINLRIEINQENMIE
FT                   LLKLVSEFSYVGIVHHSKDLDYSLSELSIKGISNKIKILSWNYYTINYDTLNCAQKINL
FT                   NNSSEVNFNHDFDNWANIILYYNTKDINFINTKPYYQVFQLLFNTKKIMYGLENKFLTD
FT                   FKIRTRYTECENNLKYSDHMLLVRKTFAFKHFLHSRLSRLLSSLYSLVIVPSYLELESF
FT                   MNNSNDFLKIIHKHDEYITKIQRLFVSNENVVSSYIQCLNVCLRFIMTFDTFKEFLGLS
FT                   YGEVYEYLYLIDQLRYFSQHYNF"
FT   CDS_pept        complement(647253..648578)
FT                   /locus_tag="TA14495"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.375 - membrane protein"
FT                   /note="membrane protein"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14495 by TMHMM2.0 at aa 5-23, 120-142, 149-171, 186-208,
FT                   253-275, 290-312, 315-337, 342-364, 376-398 and 408-427"
FT                   /db_xref="EnsemblGenomes-Gn:TA14495"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74309"
FT                   /db_xref="GOA:Q4UF30"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF30"
FT                   /protein_id="CAI74309.1"
FT                   /translation="MKIFWLYRLIFYFIISMTIGPFYDGWSSTAKYLISEGVFSKLCEN
FT                   VDDPPKLFYLKPLCDNQAYNVGRLLSFYRISEFLSSIFTGIFMDNVGPKITVLLSIVLR
FT                   VISWVLIPTCNNVHAVIILSCILCGISSNGIAFPVFTIAQYSKKFFNVCMIAISVSLSF
FT                   GTFYTFILNRIKYSLHDHKPINIIVVMLILTHLPIFILSSILFPNLLEKDVKLNIVDEL
FT                   NSKRTKTASNDEVEDVFIHNNKWEFRTFLSILGRIDILVLSFASMVNVISLTFAQESFP
FT                   ILYGDNKTALTVNEILIPLSFIFSILSTFVLNKVGSVPIILFLNVVSAVMHMSLFFTNL
FT                   PASIFTSILMSLNYSLFMTQYYIYLDSQVPIQYQGSIKGFLVTLIGFVLFVNIGLNYLS
FT                   KTYFYTREIHLALMAIRLLVSLPLYFFLRRELPQRSRSFDKP"
FT   misc_feature    complement(join(647298..647357,647385..647453,
FT                   647487..647555,647568..647636,647643..647711,
FT                   647754..647822,647955..648023,648066..648134,
FT                   648153..648221,648510..648566))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14495 by TMHMM2.0 at aa 5-23, 120-142, 149-171, 186-208,
FT                   253-275, 290-312, 315-337, 342-364, 376-398 and 408-427"
FT   CDS_pept        complement(join(649000..649688,649775..650705))
FT                   /locus_tag="TA14490"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.374 - membrane protein"
FT                   /note="membrane protein"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14490 by TMHMM2.0 at aa 28-50, 102-124, 174-193, 208-230,
FT                   358-377, 392-414, 416-438, 443-465, 477-499 and 509-531"
FT                   /note="Signal anchor predicted for TA14490 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.980) with cleavage site probability 0.001
FT                   between residues 47 and 48"
FT                   /db_xref="EnsemblGenomes-Gn:TA14490"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74310"
FT                   /db_xref="GOA:Q4UF29"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF29"
FT                   /protein_id="CAI74310.1"
FT                   /translation="MKIRTIRIPVRMGNYTYRLHDFKIKCRFGIRLLIYFILLIFVGPY
FT                   FGNWTTTEKYLCRIDVYASECSLSERFGPATDSFRCSPQRFMIAKLGSIIRSSVLTIGF
FT                   VMGLLLDILGPKITFLIGILMRIATWLIFSVKNVNNSAIVFSSVLLGLSRNAIAYPTLT
FT                   IYMYTTNFKEYATTVMGIGITLAGLYIMVIERLLGFTGADPHRFTLYSVLITHIPCLFI
FT                   GLILFPWNSPTPKVKHKSTKSIQQTDDQISTDDMISTDDLISTDGKNTPSSDLTLATFS
FT                   QSSVRDCKISEHSSMDTCISSYTKDGNDKGYKDNTTVRIERSGSECSDVDLDAHVQTEI
FT                   SMDESQWNLRKFVKYLKSVEYSVTCSYFVLNFLDFYFMQMMFSTMYGEYNDVMILNEYL
FT                   VSFSFILTFFIGFLYKVFNPVTILIFSNMFGILSHFVAFSGARVAGYITASSLIAYASI
FT                   LFTQIYIYIQSTFDSKYFGSLVGTINTFSGISMFFNILLISLVEKFGCINYIHIAMIVA
FT                   RTLFEVALIFLNLNRKKRTKSI"
FT   misc_feature    complement(join(649027..649095,649123..649191,
FT                   649225..649293,649306..649374,649378..649446,
FT                   649489..649548,650016..650084,650127..650186,
FT                   650334..650402,650556..650624))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA14490 by TMHMM2.0 at aa 28-50, 102-124, 174-193, 208-230,
FT                   358-377, 392-414, 416-438, 443-465, 477-499 and 509-531"
FT   misc_feature    complement(650565..650705)
FT                   /note="Signal anchor predicted for TA14490 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.980) with cleavage site probability 0.001
FT                   between residues 47 and 48"
FT   CDS_pept        complement(650957..652522)
FT                   /locus_tag="TA14485"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.373 - transmembrane protein"
FT                   /note="membrane protein, putative"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA14485 by TMHMM2.0 at aa 5-23, 90-112, 119-141, 151-170,
FT                   183-205, 332-354, 367-389, 393-415, 420-442, 452-474 and
FT                   487-506"
FT                   /db_xref="EnsemblGenomes-Gn:TA14485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74311"
FT                   /db_xref="GOA:Q4UF28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF28"
FT                   /protein_id="CAI74311.1"
FT                   /translation="MRARFLFKTIVYFLIATITGPFFDNWTTTEKFLFQSDAYVSKCVE
FT                   SDIVGPPTDTFRCEKQQIAISSLLSYARMFEFASSVTTGILVDYLGPRIVAIVGVFMCI
FT                   LSWIFLVIFPKSGTMLRISMILIGLTSNATLFPALTIERYSKSRKSQVMIFVGSSSSFT
FT                   CLLIKLVELVARKTPMSPKMVGLLFIFVFLLPCLVGSFLFFPDNLNNDAKRYLQYEEGL
FT                   ERDTEECLKPVEEEVEGLHYNELARQVSVISLLHTKSYSRKIDKSRFKRPESTEIKSAQ
FT                   NESLEITKKISLDINPCSVIVTEESSKENLPTEETGETKPKWNFKGFLKALNSVEVIVC
FT                   TLYFSLNVVSITYSQQSYTIIYSSNSFLLAFAEYVLPFSFIPCIIFIFITRCISPYTLI
FT                   MGIGVIWALMQLCSMFYDYTAGIFIVIFFNICYSIYNTQVYIYIESVVNKDYYSSILGF
FT                   LNTMGGVSLLVNMFIISPLTDKSVITNINIALLFLRILFLFIFTFIYFRRSLVRWEGTK
FT                   HTTS"
FT   misc_feature    complement(join(651005..651064,651101..651169,
FT                   651197..651265,651278..651346,651356..651424,
FT                   651461..651529,651908..651976,652013..652072,
FT                   652100..652168,652187..652255,652454..652510))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA14485 by TMHMM2.0 at aa 5-23, 90-112, 119-141, 151-170,
FT                   183-205, 332-354, 367-389, 393-415, 420-442, 452-474 and
FT                   487-506"
FT   CDS_pept        complement(join(652954..653076,653107..653175,
FT                   653335..654122,654187..654271,654301..654393,
FT                   654505..654600,654648..654802,654904..655000))
FT                   /locus_tag="TA14480"
FT                   /product="hypothetical protein, conserved"
FT                   /note="WD40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74312"
FT                   /db_xref="GOA:Q4UF27"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF27"
FT                   /protein_id="CAI74312.1"
FT                   /translation="MDLSKFSVSVKKGKSHRFQYEINIAYNCWNWSRYRTFAEFEELQR
FT                   DLDKNFCDVPALPDIEFTAGLGALEHLHNAVDYLDNFLKELFARPDTRCSQHLLEFVDL
FT                   IHYLDEVPTPPMIKLVSTTAGYNYAVSDCVVLENECSLIVAYEEKTFLSKLGKLWSFIE
FT                   LETLGAIKIFQYDEFEYKFVEKKCLTFTQKVRCICYDEDSKILVMGTDLGFIKRFRLLF
FT                   KEDGFEFEEIDTLKLHENAILSIKIYDGHYYTSGYDGNIRKVNVKSNRVVAGGRLTKRL
FT                   NGHKIMTATVEKDVMLVGSSDNDILSYYMEREIPVLVNTTKLLEPLDIRKILVSGKNVF
FT                   ISHGNTISCYPYNKINVDLSGNNSKPKLHSNTIELCTLVGSRNSNSSSNVEKTVNVSIP
FT                   GANRTARFSPSSTTSILHTNKVYSIVVRSKNKQLIAGHDEVITIWCTSSGRMLFIWKAH
FT                   RDEQVHFLHLMEKGDLLLSGGSDGRIRLWKLPEDEKLTLWTPS"
FT   CDS_pept        join(655182..655410,655467..655877,655934..656204,
FT                   656236..656680)
FT                   /locus_tag="TA14475"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.155 - WD40 protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74313"
FT                   /db_xref="GOA:Q4UF26"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF26"
FT                   /protein_id="CAI74313.1"
FT                   /translation="MVESKSHDSDDVESDPEDQSNPELNDNDDELEVDDDFEIEEDDTE
FT                   GLEDENEHKVEEISPNSQNMVWRNDERPLNSDEELELSPGCYDMLHRISLDWSCLSFDI
FT                   LKDDLGACRVNYPFECYVVSGTQPGTSKGMDSLIHVMRWSNLTKNFGEIDSDDEEDEDD
FT                   CVFRISSIKHKGIVNRIKACPQNSRLVCSMSDTGNVYIWDIQNQLNNINTDNWKAESPH
FT                   KKKPLFTCSLHESEGYAVSWSPLVTGRLATGSCDGSLVLWEPIEGTWNNTKTLQLDTSI
FT                   EDLNWSYTDSNVLLSGSCDGLLRLVDVRNGQVVTKVSVSETDLNSISLNSIDNNLVLTG
FT                   SEDGSVKIFDLRYPETYLSNLKWHKKPITCVDWHPLDSSVCSVSCRDDSISIWDVSIEA
FT                   ESASDSDIPQQLLFLHMGQTEITEVMFHRNIPGVIISTALDGFNIFKTINVD"
FT   CDS_pept        complement(join(656767..657402,657448..657703,
FT                   657779..657867,657923..658016,658077..658167,
FT                   658214..658444,658509..658551))
FT                   /locus_tag="TA14470"
FT                   /product="vacuolar-protein sorting-associated protein,
FT                   putative"
FT                   /note="chr2.cand.371 - score = 36.55 vacuolar sorting
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA14470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74314"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR037191"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF25"
FT                   /protein_id="CAI74314.1"
FT                   /translation="MVQEFELSDSPTLQENVKLSPEKTVSPMNYTSEEDTERSWNFSAR
FT                   DESSSFGYHKELNNTVRMDTTLDTSHSLSYTDSCETYNSSTESLDSSTYIRPETPYNKF
FT                   LERLKDPSCHDIVTAIKGLVVMLPGNMVRSEVATISHNFIDIYAPKLLSLEIFSKLTDE
FT                   EKTETVECFEKFTMQKLYPQCYRMDPMDAIEDERLQIQMLCLNWIEPHHLEITTMGDVN
FT                   ILKEAQNHLRNLYKYRSPRDKLIIILNFCRLVVYSIQKVTYPFRLLDVSCDEAFPLLIL
FT                   TIILTNPVELQSCIEFIQYFRHPSRHISEEAYAFTLLVSAVEFIREIGTSSHLKINTQD
FT                   FQNKYNQNKLKYESRLQRLNSLVKTNSTETASNNIRNSVNNSVNNNTNSANLFDQLKKF
FT                   NLSTLFKMPLFKQDRKDVYDIIETLEYLESYLLDLPLTYQFKEDSLDPPDLVSDWRALV
FT                   AMKKHITETIAIVKTQAKKLL"
FT   CDS_pept        join(658855..659044,659127..659234,659278..659462,
FT                   659495..659636,659718..659809,659875..659985)
FT                   /locus_tag="TA14465"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.51"
FT                   /note="chr2.C.cand.156 - signal peptide, PF01553
FT                   Acyltransferase"
FT                   /note="1 probable transmembrane helix predicted for TA14465
FT                   by TMHMM2.0 at aa 13-35"
FT                   /note="Signal anchor predicted for TA14465 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.998) with cleavage site probability 0.001
FT                   between residues 29 and 30"
FT                   /db_xref="EnsemblGenomes-Gn:TA14465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74315"
FT                   /db_xref="GOA:Q4UF24"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF24"
FT                   /protein_id="CAI74315.1"
FT                   /translation="MNKLKSYLLTLESLLFLVLLALFVILTFLFQVFVFIFTFPYYFYD
FT                   NYYIHKLGNRVLITLVHFASFYINIHWKCEPLTDLPSRDPKNRVILMINHMNLADAIVT
FT                   TTLSKRFYSTYLYKDALHRIYPKPMLHLIGQVPIYFHYDKDKKTKSIKKDCVLGVMERC
FT                   KTLMDNGFDLFVFPEGTRSRTGKLQEFKDGFFRFSVDNGYDIIPCAVHNTKDAVYKPLC
FT                   ATSRTLYIMAGSPVSPKGKTVEELKFEVRKKVYNLIKMSPTFDPSTEIVEELE"
FT   misc_feature    658855..658941
FT                   /note="Signal anchor predicted for TA14465 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.998) with cleavage site probability 0.001
FT                   between residues 29 and 30"
FT   misc_feature    658891..658959
FT                   /note="1 probable transmembrane helix predicted for TA14465
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(join(660978..661091,661122..661256,
FT                   661301..661375,661423..661548,661608..661793,
FT                   661835..662293,662338..662744,662803..663035,
FT                   663102..663307,663338..663487,663541..663701,
FT                   663737..663827,663890..663973))
FT                   /locus_tag="TA14455"
FT                   /product="1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate
FT                   synthase, putative"
FT                   /note="chr2.cand.370 - signal peptide, apicoplast
FT                   targetting sequence, 1-hydroxy-2-methyl-2-(e)-butenyl
FT                   4-diphosphate synthase"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA14455 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.944, signal anchor
FT                   probability 0.000) with cleavage site probability 0.702
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA14455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74316"
FT                   /db_xref="GOA:Q4UF23"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF23"
FT                   /protein_id="CAI74316.1"
FT                   /translation="MYILLVLLLVNSDLEGVRIDSKKIKLKDRLNGQFGRNVTFIANFD
FT                   SKKRNSKLFDKTGEDGDKTYCENVYKRERFPTRCVKIGKVTIGGNNPIAIQTMTSCDTN
FT                   DVQQTVDQILKVQEYGSDMVRITVQSPREAKSSELIKEKLSSLNCDIPLIADTHFNAKV
FT                   AMLCADIFDKVRVNPGNYVIGRKNWDMKVYNTEEEFKKSGEYIEEAFTPLVLKCKELKK
FT                   AIRIGTNHGSLSSRVMSYYGDTPLGMVMSAIEFAEICRKNDFHNFVFSLKSSNIFVMIH
FT                   AYRLLVNVMKKRGWDYPIHLGVTEAGSVDDGRIKSCLGIGSLLIDGIGDTIRMSLTEDP
FT                   WFELIPCRKLLESVQKLYPGTKIINTDNIHENNKDQDKIIPSTTFNYDDWRDFRSIERR
FT                   EVNYGKSVLTYEDNNKNNLLNPNGSVGTVLNSHHLNNRVRIYPQLVELYKSLGLEIVKG
FT                   LPSRSLKSVDFVLLEDVPFFHEYNKQRVIKELIEGGVNVVLPLRKLKYNPIKFAIGLVT
FT                   VDEYNVLTRSTPKRFHNDSRINSHRDSRLIGIDLNEGDPGQSLLDDQDLLDELNKLEKL
FT                   VVKITGNETDDQLLDLFNTHQRIEKLNVNNKDRKNQIGFIILDIDPKLNYMYTVRRIFG
FT                   LLNKTKSDLPVIHQLNFPSLENQQDMLVDSCCLLGCNLIDKMGEGIIIKSKLPIDITNK
FT                   LSLDILQNSRMRNIKTDFISCPSCGRTLFNIQETTEEVRRRVGHLPGVTIAIMGCIVNG
FT                   IGEMADADFGYVGGSPGKVDLYVKKQLIERNIPKEQACDKLIELIKKHDKWVEPE"
FT   misc_feature    complement(663926..663973)
FT                   /note="Signal peptide predicted for TA14455 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.944, signal anchor
FT                   probability 0.000) with cleavage site probability 0.702
FT                   between residues 16 and 17"
FT   CDS_pept        complement(join(664036..664262,664333..664710,
FT                   664774..664864,664923..666248))
FT                   /locus_tag="TA14450"
FT                   /product="citrate synthase, mitochondrial precursor,
FT                   putative"
FT                   /EC_number="2.3.3.1"
FT                   /note="chr2.cand.369 - Citrate synthase, mitochondrial
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:TA14450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74317"
FT                   /db_xref="GOA:Q4UF22"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF22"
FT                   /protein_id="CAI74317.1"
FT                   /translation="MVFRKSICNLSKYGKKNEELLSPVLNDYRVSDITNIFSMSLVSEG
FT                   SRDIENPKEHHYKLRSNSFNRYNRYLSSQGNVVGSNTIRRSHSLSIDRKLRTSLTAVSE
FT                   LKNQRNNRTEKRHLDEVKHDLDNTEQKNFDLTDLNTVINSHQLNPVKTLITKDYLITPK
FT                   ITKIGLGNTVNGRAYSTNKPKMNKSELFKRLRIGAFAPLGLGVLEGKALNSLSLKENVR
FT                   EKTDLPRSKVLERLMDKVERLVNVKREKLAELHNKYADRRLGEVTLSMLFSGLKDVPAM
FT                   VTETSELDPYKGIRFRGLTVDEMLSVLPGKNPDCPYTESVLWFLLTGEVPSPVDVDDLS
FT                   YELYKRSVVPDHVYKVIDGFPRDTHPMTQYITAISALQTESVFREAYFDKTYHKDTCWK
FT                   LALEDCLNLFAKNSVVVGYIYRRSFLDENTKPEDVQYNSSLDYAANLAHFLGNKTELFS
FT                   DVMRLYLALHSDHEGGNVSAHASHLVGSALADPYFCFSSALCGLSGPLHGMANQECLVW
FT                   IKKMLSDMGDKEVTVDEVKKYAEDTMAKKQVIPGYGHAVLKVTDPRHTAFVRFALKHFP
FT                   DDPLVKLLDTCLKAIPEVLKASGKVRNPNPNVDCSTGVLLSHFNVDQPQIFTVLFGLSR
FT                   SMGILSQLVWARALRYPIERPKSLSLETVEKLCNSPDS"
FT   CDS_pept        complement(join(666626..666843,666927..667371))
FT                   /locus_tag="TA14445"
FT                   /product="hypothetical protein, conserved"
FT                   /note="conserved hypothetical protein, DUF279"
FT                   /db_xref="EnsemblGenomes-Gn:TA14445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74318"
FT                   /db_xref="GOA:Q4UF21"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF21"
FT                   /protein_id="CAI74318.1"
FT                   /translation="MGSNSSKLEDKVRENKRTIKRTIRDLERQKLSAQRQEESLVSMLK
FT                   EEARSGRMKNARLLARDVIRNRKLADHLCNMKSQMTALQSQLQTAHNTSLLSNSFKNVS
FT                   DLMTQVNCNTNVAEFQKIMANITQQGAVLNLKVEMMGDAMEDSLDFEDTIEEEKAVDKL
FT                   LEDLGVGVGATLDSLNPPKMEDLTYSTGKNMEEVMENNSGRMKEMMEIEERINNLKN"
FT   CDS_pept        complement(join(667393..667500,667564..667689,
FT                   667743..667832,667899..668027,668075..668191))
FT                   /locus_tag="TA14440"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.368 - PF02441 Flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14440"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74319"
FT                   /db_xref="GOA:Q4UF20"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF20"
FT                   /protein_id="CAI74319.1"
FT                   /translation="MQNTKNILFGVTGSVAAIKIPEIVERLHNLATSDNNSVNIKIVRT
FT                   LSAKEYFFDSESSDKFEVFDDCPRVKYNKSDPILHIELRRWADIYVICPLDANTLAKIS
FT                   TGLCDNLLTDIARAWDMNKPFWVYPCMNTFMYEHILTEEQLNKLKSFGIKVIEPISKKL
FT                   ACGDYGMGGLPEPQDIANDLYTSLFK"
FT   CDS_pept        join(668542..669964,670023..671974)
FT                   /locus_tag="TA14435"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /note="chr2.C.cand.157 - serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74320"
FT                   /db_xref="GOA:Q4UF19"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF19"
FT                   /protein_id="CAI74320.1"
FT                   /translation="MSSSKLPKSLEEDIELISKLENVEIKELEDSLLGNDCLYDDESHG
FT                   IQFEDSSHESIPQVYKFQVNILLKESIYAISRKKDCVVSLHIELTDNQSLPSIHLKSIL
FT                   NSSVKLRNKCLHFINKVAFSGSTTSSFSIYKLIVDFKSFLQYESRNEDIEHVTENSSNF
FT                   EEFITLSFSSINDAESTPNDFTLLYDKQGDNLNTESHDSRYRDTTRYNSITIYKNDRIY
FT                   NHLITHSRYFREFKEEAVLGSGSFGCVIKVLRNSINYAVKQIPIYHNYEFILHEEAAVL
FT                   ASLQHPNIVRYYDAWVEQSPEYLLTKYHHQLNLEKNNMDRNFDHEYTPANNDFKFGNRL
FT                   DRVIEEIDFDDQFNEDSDPDTDNVDLSPDNRNVIKIHNKHYKKNKHIPKKCLFILMEYC
FT                   GEESLFETINKQTLQDTPQKVTDLFRQIMEALSYIHEKGIIHRDVKPSNIFLKFENEIT
FT                   IKLGDFGLTAKLQQSKGKNTIVNENGVVGTLHYMAPEQFECDAYNEKVDIYSAGVVLFE
FT                   MLSKPFQTFMERCEILSSFSTPNKQWPEGFRERVDNRLFKLLESMLNINPNKRPSASEI
FT                   LQNEIFTSNKLNLQSLYNVITQYPHSMESVQLLNTIFSRKQQYKKLTDYYNMVISNNVI
FT                   NYVNLELGLIYDKEFKLRNAHNLHPHLLTHLPYSSKTNFLNHVVDKGTGLDRDKTFERD
FT                   KNTGKEKHQFRARLLLNNGRCCNLTYSLLYSFSECTTKELATIIRRYSYSPVYSTHGTG
FT                   NVGTRIEGLDIHYFLGYDIVVDYMIILNENNENEMNLDAFFTYELVSVSSRPLKRFINC
FT                   ALSLEWNHYEFLTKLLSSLKVPEQLLNQVERVMLSEVLVKGKNTGVFDELNSITINNQT
FT                   LPSVLLNIHPFLHKFKGRVSEVKKGLEALLNCELSQEFSEYLENLQFFERFLSDFDGQY
FT                   HFNPTYIESSSNCNSSNIPNDHLRGGGREGIFEKFYFRMFLEIGKRNFGDLTFGGCYNR
FT                   IIENNTNRRNSFGFEMNLHPIYDYFTQNMVNKNLYNNLHLNYAPEVVVYTPQMNLIIVA
FT                   TSLENKFWSVGVKCYKKVGGHLNIKRITRLKKAGLFSLQKLKYLVTIKKSNENHEIQYF
FT                   ICDINFDNKYVSYSLHI"
FT   CDS_pept        join(672179..672280,672311..672536,672608..672762,
FT                   672797..672855,672885..673344)
FT                   /locus_tag="TA14430"
FT                   /product="mitotic checkpoint protein, BUB3 homologue,
FT                   putative"
FT                   /note="all_bases.cand.1372 - mitotic checkpoint protein,
FT                   WD40 protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74321"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF18"
FT                   /protein_id="CAI74321.1"
FT                   /translation="MDSFETFDSPPRDVITKVLFGNKTNLLAVSAWDQTVKFYDADQPN
FT                   KNRLLYNLDWESTVLDFVFFENDKKMALADLNKNVSLLDVETKNFFTVGLHNGPVRCVR
FT                   YHEPTNTLITGGWDKKVRVFDLRSSNLKPVVDVDIYGKTYCMDLARNFLVVGDSMKRIY
FT                   VYDLSSGLTGFANPETKDGVLKFQYRFLKCFPDATGYVLSSIEGRVAWEYFPRFLESES
FT                   QQYAFKCHRTKTPNDSDVAFPVNCVDFHPKFGTFVTGGADGLLCGWDGISRKRLWKSSK
FT                   FNGTVASLSFNPAGDKLAIGVSDVFQLNPHQSHSPSLHLKHLKDEFRPRTRH"
FT   CDS_pept        complement(join(673411..674028,674100..674243,
FT                   674276..674479,674536..674891,674939..675416,
FT                   675469..675910,675942..676093,676125..676390,
FT                   676449..676638))
FT                   /locus_tag="TA14425"
FT                   /product="transducin-like G-protein beta, putative"
FT                   /note="all_bases.C.cand.452 - beta transducin, WD40
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74322"
FT                   /db_xref="GOA:Q4UF17"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013934"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF17"
FT                   /protein_id="CAI74322.1"
FT                   /translation="MDDDLNHLSFSYREIKSYFSYGGDDILILSHYNAFLSQFDNCLFA
FT                   APLPNTKFPISPKDFLLKEALLRDKDLKLDLDKREVLCILDSNEENFYNGKSYSNKCVI
FT                   SLGGISRYAINPSSDLLFVVFSNNILCVYSLLSDKQNWIYLHLLSALKINNNNNNVNTI
FT                   CVSENNDVCFGLMEGTVLVYNNNKFNHSFKLKNSTITLIKCFKSEKLFICNKLGDLYLY
FT                   DKAKKAKLAYFQDHTTYVKSLNYIVTKDNEIGLITLDNDNIINLWSLSGRVDKTSKGED
FT                   LVVNVSSKNEPIIPFKRIIKHENITSIEVVSGKLTEELDSKRKGSWMLLIIEESGKLYY
FT                   LDPIDESVLHKNTIMYGFGLVKKVDVTKEMIMLLSLNGTIIVYDKLFNLVKLFLSNFNN
FT                   LFQFILVPSSNDLRSKDQEEIEEEFDLENSEDLEIEMEKTVQTNVRNYYEYSLLWYNKY
FT                   AINNEMMIILIGDEVLRILLLNNTNEFIPLGLYNTSQTHKDVITTIHYNKEENLLLSGS
FT                   KDKLIILWDLSKLIQLKLINTINVVTSVLMIARPNNTVDVISSNDNIINLYTVKLNDLK
FT                   SELYGLCGEIVLNNKIDEKSEGVGDVNADKSNHTSVVHKTNINYLSSSHNQKYISSCSS
FT                   DKLIVIHYSNNLIVKGKCIGHRKSVLYTKFMKLTKTLISTSMDQTIRIWNLSNFTNIKI
FT                   LQGHNNSVMKVVPLDNNLQLLSCGLDGYVKLWNLPTSECIQTLNNHENDKIWDIDLHNN
FT                   LLYSISNNLIVVYEDSSKEERRLKALKDHEEEIVTSQINSLMLENNFRESLTLSIKLNN
FT                   IKLTNDILQKFRNKVIFQGQKLENDPVDYVIEGIREGDEKLLNNLIGFIKIWITNRKDY
FT                   LLANVFINKLLKEVKLEQLLKVEGLLETIDFLLYNLSHHQNRLTNLQEKSYLMDMLTHD
FT                   NTLSELNTNAVNEVLYNSK"
FT   CDS_pept        join(676821..676882,676925..677086,677117..677228,
FT                   677263..677375,677407..677484,677526..677624,
FT                   677676..677799,677833..677910,677944..678153)
FT                   /locus_tag="TA14420"
FT                   /product="cleavage stimulation factor subunit 1, putative"
FT                   /note="chr2.C.cand.160 - cleavage stimulation factor
FT                   subunit 1, WD40 domains"
FT                   /db_xref="EnsemblGenomes-Gn:TA14420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74323"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF16"
FT                   /protein_id="CAI74323.1"
FT                   /translation="MVEPERLFFYEALLQQLVDDGFEDAVALIESKYKVKPNSMLRKDH
FT                   LFDIFNKCGYLSSRVLLESKLNEEEDVLKCGKNRVREVLSYTNVPVEMNPDLNEVAYKI
FT                   MAEILNHKPSRCVAQSHDCSLVAVGGVSGSLRVIPFINVLNKREKRKPNTLSTNTLSGH
FT                   IEQVDALDFHPRKNILASGGIDNTIIFHDINTSNGFIYSTSEMSKECMKFHPCGDFLFA
FT                   GTSNSIIRLYDVVTSKCYTSSKTTHQHKGGGINGCDFNLLGSLLFTAGSDGSILIWDSK
FT                   NLECIYSMDSAHNDLPVISIKCDVNNHYLLSSGLNGITKLYDLRMLKEVIDLLFIDFPD
FT                   HELWS"
FT   CDS_pept        complement(join(678797..678920,678983..680007))
FT                   /locus_tag="TA14415"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /EC_number="2.7.1.32"
FT                   /note="chr2.cand.365 - choline/ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74324"
FT                   /db_xref="GOA:Q4UF15"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF15"
FT                   /protein_id="CAI74324.1"
FT                   /translation="MLNSNYDTSLGLEHENKTKFDSLTFKYDHSHSNLKSLCIRHVPFW
FT                   NNVNPEFIEIKKMNNGVTNRVYQATLVDGDKDRYPIKSVCIKKSSTYNSLVIDDDLQYR
FT                   IAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSLAKFHKKVTE
FT                   LVPKEWDRTPMFLTKIATWSPHVERIIKKYNLGFDYNELVQNYEMFKKILNNHLNTSNS
FT                   ITNSILFCHNDLFFTNILDTLHGIYFIDFDYAGFNYVGWDIANFFKIIYILLDPLMKYY
FT                   LYHNTSPVKDEFKPLFISVYLSQLLGQNVLPSDDLVNDFLQSLEIHTLGVNLYWIYWSL
FT                   IMTDKPKIDPSNSVKFEGYAMFQYNLFRNNIRRLTDNKIVNT"
FT   CDS_pept        complement(join(680209..680332,680398..681422))
FT                   /locus_tag="TA14410"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /EC_number="2.7.1.32"
FT                   /note="chr2.cand.364 - PF01633 Choline/ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74325"
FT                   /db_xref="GOA:Q4UF14"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF14"
FT                   /protein_id="CAI74325.1"
FT                   /translation="MLNSNYDTSLGLEHENKTKFDSLTFKYDHSHSNLKSLCIRHVPFW
FT                   NNVNPEFIEIKKMNNGVTNRVYQATLVDGDKDRYPIKSVCIKKSSTYNSLVIDDDLQYR
FT                   IAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSLAKFHKKVTE
FT                   LVPKEWDRTPMFLTKIATWSPHVERIIKKYNLGFDYNELVQNYEMFKKILNNHLNTSNS
FT                   ITNSILFCHNDLFFLNIVDFNQGVYFIDFDYCGFNYVGWDIANFLLKILHILHDPLCHS
FT                   YTSISPYISEEMKTIFTSVYLSQLLGKNVLPSDDLVNDFLRSVEIHTLGVNLFWTYWGI
FT                   VMNDKPKNELSKPVKLEAYPMFQYNLFRNNIRRLTDNKIVNT"
FT   CDS_pept        complement(join(681624..681747,681812..682845))
FT                   /locus_tag="TA14405"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /EC_number="2.7.1.32"
FT                   /note="chr2.cand.363 - choline/ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74326"
FT                   /db_xref="GOA:Q4UF13"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF13"
FT                   /protein_id="CAI74326.1"
FT                   /translation="MEHLTVVSEHDFQHKDPVKTPENEGYFLNEKETNEVKSLCIRHVP
FT                   FWNNIAKEKIDLKIVSGALTNRVYQATLVDGDKDRYPIKSVCIKKSSTYNSLVIDDDLQ
FT                   YRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSFQNLSVLTGIASSLAKFHKKV
FT                   TELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTS
FT                   NSITNSILFCHNDLFSLNILDFNQGIYFIDFDFAGFNYVGWEIANFFVEVTILYDPPKP
FT                   PYFISSEEYNLSEEMKTIFISVYLSQLLGQNVLPSDDLVNDFLQSLEIHTLGVNLFWTY
FT                   WGIVMSDKPKNELSKPVKLEAYAMFQYNLFRNNIRRLTDNKIVNT"
FT   CDS_pept        complement(join(683403..683511,683576..684603))
FT                   /locus_tag="TA14390"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /EC_number="2.7.1.32"
FT                   /note="chr2.cand.362 -choline/ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14390"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74327"
FT                   /db_xref="GOA:Q4UF12"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF12"
FT                   /protein_id="CAI74327.1"
FT                   /translation="MLNSNYDTSLGLEHENKTKFDSLTFKYDHSHSNLKSLCIRHVPFW
FT                   NNVNPEFIEIKKMNNGVTNRVYQATLVDGDKDRYPIKSVCIKKSSTYNSLVIDDDLQYR
FT                   IAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSLAKFHKKVTE
FT                   LVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNS
FT                   ITNSILFCHNDLYPSNILHTNQGIYFIDFDFSGFNYVGWEISHLFFKLCIVYNHHTPPY
FT                   FNFDDSLALSQEMKTIFISVYLSQLLGKNVLPSDDLVNDFLQSVEIHTLGVNLFWTYWG
FT                   IVMTDKPNNELSNPYSFIAYSKFEYYSLKIKFDKLISN"
FT   CDS_pept        complement(join(684805..684928,684991..686018))
FT                   /locus_tag="TA14385"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /EC_number="2.7.1.32"
FT                   /note="chr2.cand.361 - choline/ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14385"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74328"
FT                   /db_xref="GOA:Q4UF11"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF11"
FT                   /protein_id="CAI74328.1"
FT                   /translation="MLNSNYDTSLGLEHENKTKFDSLTFKYDHSHSNLKSLCIRHVPFW
FT                   NNVNPEFIEIKNVNTGIFNSVYILRLISPNKDRYPIKSVCIKKSSTYNSLVIDDDLQYR
FT                   IAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSLAKFHKKVTE
FT                   LVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNS
FT                   ITNSILFCHNDLFFTNILDTLHGIYFIDFDFSGFNYVGWDIANFFLKPGIVHESHTTPQ
FT                   FYFDDSLSLSDEMKTIFISVYLSQLLGQNVLPSDDLVNDFLQSLEIHTLGVCLFWIYWS
FT                   IIMSDKPKNEHKFVVLFHVKGELIYNLFRNNIRRLTDNKIVNT"
FT   CDS_pept        complement(join(686223..686343,686408..687456))
FT                   /locus_tag="TA14380"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /EC_number="2.7.1.32"
FT                   /note="chr2.cand.360 - choline/ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74329"
FT                   /db_xref="GOA:Q4UF10"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF10"
FT                   /protein_id="CAI74329.1"
FT                   /translation="MDVKNLSKDSSRYITYSQKTRLYIKTDKNSQKIKDQDQTNIKSLC
FT                   IRHVPFWNNVNPEFIEIKTMYNGITNQVYQATLVDGDKDRYPIKSVCIKKSSTYNSLVI
FT                   DDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSLAK
FT                   FHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNN
FT                   HLNTSNSITNSILFCHNDLYLDNILDFNQGIYFIDFDYSGFNYVGWEISHLFFKLCIVY
FT                   NHHTPPYFNFDDSLALSQEMKTIFISVYLSQLLGKNVLPSDDLVNDFLQSVEIHTLGVN
FT                   LFWTYWGIVMTDKPKNEFNAAIDCPLQAKLNHNLLEINIRKFTDSRILT"
FT   CDS_pept        complement(join(687923..688031,688101..689122))
FT                   /locus_tag="TA14375"
FT                   /product="choline/ethanolamine kinase, putative"
FT                   /note="chr2.cand.359 - choline/ethanolamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74330"
FT                   /db_xref="GOA:Q4UF09"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF09"
FT                   /protein_id="CAI74330.1"
FT                   /translation="MLNSNYDTSLGLEHENKTKFDSLTFKYDHSHSNLKSLCIRHVPFW
FT                   NNVNPEFIEIKKMNNGVTNQVYQATLVDGDKDRYPIKSVCIKKSSTYNSLVIDDDLQYR
FT                   IAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSLAKFHKKVTE
FT                   LVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNS
FT                   ITNSILFCHNDLYPSNILHTNQGIYFIDFDYCGFNYVGWEIASLFNKMYIIYDRVRKCY
FT                   LSHNTSFAKEFKSLFTSVYLSQLLGQNVLPSDDLVKDFLQSVEIHTLGVHLFWIYWGIV
FT                   IMDKPRQSTVIPGIYIESKLWINLFKSLVKNLVSKI"
FT   CDS_pept        complement(join(689455..690029,690124..690334))
FT                   /locus_tag="TA14370"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.358 - transmembrane domains"
FT                   /note="membrane protein, putative"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14370 by TMHMM2.0 at aa 55-74 and 155-177"
FT                   /db_xref="EnsemblGenomes-Gn:TA14370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74331"
FT                   /db_xref="GOA:Q4UF08"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF08"
FT                   /protein_id="CAI74331.1"
FT                   /translation="MSSTPLSHTNKFSELKSSTGSPRSKMGFSKQTNEEFNAVPVTSEF
FT                   YTKRTSYKTFFRPFLILLFSIYIVLVSFLSKKDSNSGFSLALMTFHTKVIDLYQVILDF
FT                   YKRCPAVMSIVKKLRFEVPYFIKILSLYVPKYEKQIVYLSNYNTLNNWLSIFVWATFAV
FT                   IFELLTAVVNNLVLSYRHRNTPRYCSNMVHPSKFHDKVFTQEQLNKLFKTREYLDLKNS
FT                   RHGLGPEAWNWQLRKTLEAKHNSKSQNAVSSGDESDIST"
FT   misc_feature    complement(join(689710..689778,690019..690029,
FT                   690124..690172))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14370 by TMHMM2.0 at aa 55-74 and 155-177"
FT   CDS_pept        join(690424..690498,690701..690739,690795..690974,
FT                   691019..691128,691181..691269,691308..691654)
FT                   /locus_tag="TA14365"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74332"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF07"
FT                   /protein_id="CAI74332.1"
FT                   /translation="MMENFEIEKNKKRMRKPGKRFGKYEIFNHNSQIPYSLLNPKLVCS
FT                   YNSFTLKLKLDLCFSLREQCSFCESSTLFNTEINPYPGIPKLDHYVSTLSHEYFSEIIE
FT                   NFIEKQNETMKSQLVDLRSNFSLLPCPVDLLINRINKEIGNFVECIRKRTQNELRGFRL
FT                   IKSLKKIKRSGIRNIVSEVDDLYNKINLAKRVSFISLSDVFGEPNCLKIFKTVRMCCVL
FT                   RYLKDKINIPIYQIISNNQKTDLRECSDYYKISGDFSKLDEMIRKQNEEVCYGINEP"
FT   CDS_pept        join(691850..692065,692165..692258,692289..693358)
FT                   /locus_tag="TA14360"
FT                   /product="hydrolase, putative"
FT                   /note="chr2.C.cand.162 - PF00561 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:TA14360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74333"
FT                   /db_xref="GOA:Q4UF06"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF06"
FT                   /protein_id="CAI74333.1"
FT                   /translation="MSDSNEPNDVDGTSSFEAGTEPSIEWCLENGYKIPKWLLKCNIKC
FT                   PYVKGRIFNGKYGPINYSVVGDPSASLVLTFHGYNATHTTFSIYQSVLSKNGFRVISFD
FT                   LYGHGLSGYPKYKVFGNTFSSKYYVDQADEVIDHLGYTGRKLSVIGMSMGACIAASYCE
FT                   THPDLVEKIILISPAGLIPKKPMRVVFLKYIQCCIPCTPLCVSKCCFSGRVTTPKSKSN
FT                   RESPESSQESLETGECVSVDEVSGESTELNPMLNRMLWTLFVTRRAISNLLGIVNRMPL
FT                   WSSRELYRRVGGMGKLTLILFGDSDTLTPPECADELSRLFTNSHTIIFSNSDHLLSFKK
FT                   PLQVVSTCLSFLGIPNQENAQNYTRWLPFDCNGVYIPKSRRELGHSDETELTHNVSAPS
FT                   LGSLTNHALPDEPPKSSTTSPFKIFRDYLPPDRTIKQLSLTEEYPRKKVPLVVVKQFEN
FT                   S"
FT   CDS_pept        693405..694091
FT                   /locus_tag="TA14355"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA14355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74334"
FT                   /db_xref="GOA:Q4UF05"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF05"
FT                   /protein_id="CAI74334.1"
FT                   /translation="MIGVFNKIILSNRKNPLFSSIVGRVNLESSVNVVESLKFNGIQSR
FT                   FKTVKVSAYRRPSRGSPTGQSKKANIGMKRLSAEYVRPGELLVKQRKFIAHNPNVTRNR
FT                   HFKIYPGENVGVSTKTTSLFSLVSGRVKYTHDITRNVKLVNVLPEPPDELLRDDLWRYR
FT                   TEHVTSVQDNTSLIWRRVKSSYAFTDKYALVNPPLKPYPRAKFLSKYDQWENPCYPNIF
FT                   RNFKYK"
FT   CDS_pept        complement(join(694144..694297,694326..694439,
FT                   694471..694613,694646..694716,694771..694951,
FT                   694983..696632,696664..696731,696763..696841,
FT                   696881..696939,696980..697085,697115..697263,
FT                   697314..697447,697490..697621,697657..697730))
FT                   /locus_tag="TA14350"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.447 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74335"
FT                   /db_xref="InterPro:IPR019155"
FT                   /db_xref="InterPro:IPR039272"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF04"
FT                   /protein_id="CAI74335.1"
FT                   /translation="MAKSNQSDPRNLISEQESINLNKFKYLHKNVLNKESSRIASSIQV
FT                   VDALKQLAEYLIWEDRTDQDYIFEYFCEENIMDYLTGVLCRSTSRTVRIQLIQTISMLI
FT                   HNIGKKKTLYYMLSNNYLNELISVPEIYSGGDISSWTVSLLKTISSILDKSTIKFFFLQ
FT                   KNETFPLLDKSLLFLSSHDSMKRAHFMTIILNIFKVNDKDVNEYIVNKSEILLRLVLYL
FT                   KYCWFRLNRYHNKYKSFSPNILSESNDVLCFIEELMDLEIEIINQKIVYLMFVICFIPL
FT                   IKRLAKVDVNTEKLLVDIGSPPNYSDLYNKLSNAIGLSFFYINNKTLLFNTNSADTTPN
FT                   VNPQNQCSPSTTSSKPPLNKLNRNESDVVEENKTEKNEKTGWLRDYELNSFDIPNDSDL
FT                   DKEDVVINDVIYNILVNVIINSKRKEFVNPLTTLLFSPFIPLDLLYTITGKSSDETSRP
FT                   EPNDADSPQVSSIITTPRNYNPEEETFEYKSYKIGEDSIKIFNLLLSFNDFMHKDSKTK
FT                   CELHGGGNIDSHNYEKGELEEDEPSMSLGDGFVKGCSVENSYKTVLNVIMGLFIYDGLK
FT                   SLKYNNDNNKMLNLLKLLIHLQNKVLSTGKSKNKEQCNLKLLKSIFDNNEIYLQLFNVI
FT                   SINMTNFNFNTLVLKLYNFFLQNYINFNTKNEDDLKSLNNKTKINPELENSVEDKGQQI
FT                   DKDVGQGVGFETVKPDSHVVANSKIIKMDVLIDEIKFHLDIVYNIIRIYILNSVESTTT
FT                   LLYLSVFYVEWIKYIKLYYNTLHFTASDIMFIDVNETKEQEVTNTNHDAVFNYSPIDIF
FT                   KRYIMMILILKELYNIISVNINSYKKNDRKQIKDINETNDYIYESCPLFYNQLDKLYIK
FT                   NTKIKLGNVINTVDCDVKFFKCLIKNKNEQRNRIILLHDVFFILAKVKRSHTRHNSGLR
FT                   KMSNSLDESDKEGVNLEITCVHLLWNCIIKKVDKQNNKFNILISWHPKFKTLSPSNRWN
FT                   ENINVMTSEFDVIFNDVNDLNAVLKLHNSNKKNLSNNSLLSLQDYLYN"
FT   CDS_pept        complement(join(698100..698335,698369..698619,
FT                   698676..698842))
FT                   /locus_tag="TA14345"
FT                   /product="hypothetical protein, conserved"
FT                   /note="DnaJ domain protein"
FT                   /note="chr2.cand.355 - PF00226 DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA14345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74336"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR024586"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF03"
FT                   /protein_id="CAI74336.1"
FT                   /translation="MEVASLSQNIEEYFDKRNCLVNELNYYEILELDSRCTKEDIRRSY
FT                   YHFARIFHPDKCNKEEYLFVLNELKAAYDILSDEYKRIIYDIKHVANKKEEQSYEIKKE
FT                   TLENVYDLVRQKHLTFLQEKASMYLNILYYQYKNQGLIIKKAIFGNLNLAKPDSLNPLE
FT                   TIELKHLKGPFIDVTVQLQLLVQNGVLHLCNSTSYAFLPGFYNPIHFVNNIKSN"
FT   CDS_pept        complement(join(698985..699222,699254..699318,
FT                   699367..700137))
FT                   /locus_tag="TA14340"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.354 - hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA14340
FT                   by TMHMM2.0 at aa 272-294"
FT                   /db_xref="EnsemblGenomes-Gn:TA14340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74337"
FT                   /db_xref="GOA:Q4UF02"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF02"
FT                   /protein_id="CAI74337.1"
FT                   /translation="MYGLLNKSNIPKLCSFRRFYNVQNTITNRNKILSNKCIEIFHQTN
FT                   EIQRIKCNINIKDKSLKSKNVKTFVNMYSLNNSQPYTTTNSGLNESKISNRVASNLGKG
FT                   SVVTGNQPNRPSNYQNGDKNGHVDYKPSDNNLKLNNEEKESSSKQTLHGNSVTSVGKKK
FT                   RFQKFRQYMSKSKRMNKLKLYLSNSKSLNKLRLYLESNKRLNKLKLYLSNSRRLEKLRV
FT                   YILNNRQKLKGLTNNVKRREKLRLMRSKFKEKSLAFRIGAMLTLKRYGKIGAIIYFGVY
FT                   GVTLAGMNAIVFLNYLTSEDVRKALNYLNISSVKVPDVDSPFAKFTVAYIATKIVEPLR
FT                   LVVSILLTVTFTKLFRK"
FT   misc_feature    complement(join(699177..699222,699254..699276))
FT                   /note="1 probable transmembrane helix predicted for TA14340
FT                   by TMHMM2.0 at aa 272-294"
FT   CDS_pept        complement(join(700391..700641,700671..700748,
FT                   700810..701085,701117..701222,701253..701285))
FT                   /locus_tag="TA14335"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.445 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74338"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF01"
FT                   /protein_id="CAI74338.1"
FT                   /translation="MFICYKFMDKLTFLNKLEKYFFTYDHDLIFFTEVELLRSQCRNAL
FT                   KEMIQFNEVDKRRHWIVIFREMINICNNYYRPDNKDLEIEVNGKTILLDHKYIISYEFY
FT                   EFVLYLTKDESLKETVHLTITEIIRNIKNSLHTIKDMSSTYVLSELLLLVVGVKMSFTT
FT                   EYLIIVINILESSIRENNFTFVNVHEITIHLKLIMHLVEDSTIKQNVKEKIASNYSYLY
FT                   MYIFRRMCYSIRIRNLEKIWKICQK"
FT   CDS_pept        complement(join(701439..701540,701611..701862,
FT                   701912..702655))
FT                   /locus_tag="TA14330"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.352 - hypothetical protein, conserved,
FT                   mal13p1.237"
FT                   /db_xref="EnsemblGenomes-Gn:TA14330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74339"
FT                   /db_xref="GOA:Q4UF00"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UF00"
FT                   /protein_id="CAI74339.1"
FT                   /translation="MVEDSEQTGDKSLLDMKMKEFENAKTLLISSKRPKAFLIRTACEL
FT                   LAGGTEVLILSALGDAMGLCLQLQMLLVSKNAATTFRIETLLNKCTSEKSKNPFYIPGL
FT                   LVFMRKHPEFKGSRISPGYIVFSPRTSTFTPLFDSEPTEFVLSVNAGNPDLTVGGSGVN
FT                   GAFAKLLGELGHDLGSYTTLFKRLAEQARNNNKSDENQHVAYEHEPNSQVLFAMCRLPN
FT                   DPSYFKLPNEGLVFVTLFNNKYPFTNDHNLGFVYVVGPNGANYDVDGFLESVHKLGDNL
FT                   VTTLCDYNGMAKRETAKKLPRVTLCRLCLVSGGVYKHKDVTKLDVAKSLLNGIAEGYRH
FT                   GPTPRFNFAYDEDVFRIVSVTNKLL"
FT   CDS_pept        complement(join(703080..703868,703899..704138))
FT                   /locus_tag="TA14325"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.351 - hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA14325
FT                   by TMHMM2.0 at aa 47-66"
FT                   /note="Signal anchor predicted for TA14325 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.983) with cleavage site probability 0.000
FT                   between residues -1 and 0"
FT                   /db_xref="EnsemblGenomes-Gn:TA14325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74340"
FT                   /db_xref="GOA:Q4UEZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ9"
FT                   /protein_id="CAI74340.1"
FT                   /translation="MATVTVDDDKKLKSRSLSTETMDGIPEFDEEPETQTRGRSAWDSV
FT                   KITITAFFLTFALLLLVVLIYEIRGHKNDQRKRDTRRYVNEELKKFRIEDKQKLNKIIV
FT                   GHLENLAQGTRFDKIELTAPENVENRQLKKESPLHFESNVNSFTLRESSPYKSFDELEY
FT                   KKVSYNCYRKDLFRQNINGTGTNLRFIAKSSKIPEGSSENSGKCATSYYWIYYTPETQK
FT                   TRIYSMGPYYGHHEVKMVESMFTPIDKEGNLTLTGCVPPIDNIRKDYDWNEEYKFIRRT
FT                   AYITEESPKFRDFVEFQEFLDRKIEEEVKEYDEKIRILSHDSESVQHYSTLKEATNCVY
FT                   SI"
FT   misc_feature    complement(703941..704000)
FT                   /note="1 probable transmembrane helix predicted for TA14325
FT                   by TMHMM2.0 at aa 47-66"
FT   CDS_pept        join(704682..704763,704798..704979,705021..705179,
FT                   705212..705943,706009..706065,706099..706272)
FT                   /locus_tag="TA14320"
FT                   /product="clathrin-coat assembly protein, putative"
FT                   /note="chr2.C.cand.165 - PF00928 Adaptor complexes medium
FT                   subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:TA14320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74341"
FT                   /db_xref="GOA:Q4UEZ8"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ8"
FT                   /protein_id="CAI74341.1"
FT                   /translation="MTISQFFIISHSGDVLLSRNFRNETTKNVDNFYNYLKENSNIGPI
FT                   FELEGMLYFYIRRSNLYFVMSTRYITSPSYVMELLNKITNYLKDFIGILNEETIKSNFV
FT                   LAYEILDEILDYGYIQCISINQLKQKIYNTSTVTTDNIKPMMSNRNMLPSVVSNKSLIN
FT                   PNNKNEIFVDVIEKVTAKLGSDVKTTVEGQIQIKSYLKGSPSIQMYISNNVQFSNNTSR
FT                   TSNEPELTNQPSSNLHLEQFPIPDNKFSVGSINAGSTDRVGSLEYHRDQTYRFQSLEME
FT                   DVFENKIVIEDYNLESDVEMVNNVMKFIPKEGEYTILNYKIKNVKMPFDIKTQLVNNTE
FT                   NTVGLSIRVACNLPINVHSFFLLKCKLPNNVNTINMSVNPKFFQQVSEYKLENNTISWN
FT                   IKNIQGSSEVVLNSEIVFNNKVNSNQFGPINLIFEVPLYNITNLKVSLTNSQFPNSDKI
FT                   PQR"
FT   CDS_pept        complement(join(706339..706646,706676..706727))
FT                   /locus_tag="TA14315"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74342"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ7"
FT                   /protein_id="CAI74342.1"
FT                   /translation="MKFFELYGTHYIVKIVLGGKIVIDENLSSGSSSESKNLDLNLGVL
FT                   RYLDKSSNSKNSNLNDRNISIFGGTVWDDNWYNELKTDPAPLKFTLATYNEIFKEYNIN
FT                   YKHYINTLKKHLKVR"
FT   CDS_pept        complement(706874..707380)
FT                   /locus_tag="TA14310"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA14310 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.860
FT                   between residues 22 and 23"
FT                   /note="GPI-Anchor Signal predicted for TA14310 by DGPI
FT                   v2.04 with cleavage site probability 0.15480001 near 137"
FT                   /db_xref="EnsemblGenomes-Gn:TA14310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74343"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ6"
FT                   /protein_id="CAI74343.1"
FT                   /translation="MLNKMFNFLLFLLVLIIKTSDSYHINLRNIQTIPNLELLGSSYST
FT                   ITKNANNDKNARKGSNDLKSEGIGEKDVHTGDGKNNVIDVTNLKNSVIDIKMMNKLNNT
FT                   LEYVHSDNVYIQNYPRCEILNENKVKDEKEEESAIFTKKSMKGNDQVNTKIIFCAKFII
FT                   GLNNM"
FT   misc_feature    complement(706967..706972)
FT                   /note="GPI-Anchor Signal predicted for TA14310 by DGPI
FT                   v2.04 with cleavage site probability 0.15480001 near 137"
FT   misc_feature    complement(707315..707380)
FT                   /note="Signal peptide predicted for TA14310 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.860
FT                   between residues 22 and 23"
FT   CDS_pept        complement(join(707504..707703,707745..707937,
FT                   707969..708100))
FT                   /locus_tag="TA14305"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /EC_number="6.3.2.19"
FT                   /EC_number="6.5.1.1"
FT                   /note="chr2.cand.350 - ubiquitin-conjugating enzyme e2"
FT                   /db_xref="EnsemblGenomes-Gn:TA14305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74344"
FT                   /db_xref="GOA:Q4UEZ5"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ5"
FT                   /protein_id="CAI74344.1"
FT                   /translation="MFYIIYYVIFIAFRPSLSINVIGPRFHYCLGINRTNLSNLRIQNE
FT                   IVIFNKNPPPNCKLEVYGKNNNIWIITWVGLPGTIYAGEEYKIKVMLPNGYPLKPPIIY
FT                   FLQPTPVHKHVYSNGDICLNSIGHDYIPSASISSFILSIISMLSSAKEKSLPIDNHLRN
FT                   HQILFINDSRY"
FT   CDS_pept        complement(join(708116..708250,708310..708380,
FT                   708447..708558,708614..708818,708868..708994,
FT                   709028..709142,709181..709329,709399..709447,
FT                   709525..709602,709656..709784))
FT                   /locus_tag="TA14300"
FT                   /product="GDP-mannose pyrophosphorylase, putative"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="2.7.7.13"
FT                   /note="chr2.cand.350 - gdp-mannose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74345"
FT                   /db_xref="GOA:Q4UEZ4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ4"
FT                   /protein_id="CAI74345.1"
FT                   /translation="MKSVILAGGYGTRIRPLTLSVPKPLVDFCNRPVIEHQIQACKNAG
FT                   FDHVIIAVTEHHNITEPIKNLAEKYSIRIDFSTESTPLGTAGPLRLAKDLICSDDDSDD
FT                   FVVFNSDIICNYPLKELLESHRKKSAKVTIMVTTVENSSEFGVILHDENGLIKSFLEKP
FT                   KNATSNTINAGVYVLSKEVLDHIPLKNYSIEKQFFPKYLKYNSSYIYKLNGFWSDIGKP
FT                   TGYLNGQNLFLSHVQGLEANSCKSNHDLRDGDFSPLISAENSFETDSSYKSTETKFRHP
FT                   VLIHPTGVIGNDCVIGPNVCIGPNVVIGDGCRILNSTLFKEVRVESYCYIADSIIGWKS
FT                   LIKQWCRIEGLSVFGENVIVDESLYIRGCIVLPHKTINSSVYEEGRVII"
FT   CDS_pept        join(709937..709953,709989..710019,710050..710152,
FT                   710198..710348,710379..710455,710517..710836,
FT                   710902..711312,711369..711887)
FT                   /locus_tag="TA14295"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.166 - DnaJ domain"
FT                   /note="DnaJ domain protein, putative"
FT                   /note="1 probable transmembrane helix predicted for TA14295
FT                   by TMHMM2.0 at aa 33-55"
FT                   /note="Signal anchor predicted for TA14295 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.995) with cleavage site probability 0.003
FT                   between residues 56 and 57"
FT                   /db_xref="EnsemblGenomes-Gn:TA14295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74346"
FT                   /db_xref="GOA:Q4UEZ3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ3"
FT                   /protein_id="CAI74346.1"
FT                   /translation="METSPKRKNKHSVKPSHNKTKPAKTNSHFWKVYAFFRSNLIVTTL
FT                   ILVLLLAFVLKYYEDVHDSYSNFKKMDENIYEILEVSRDAKDSEIKAKYRELSLKWHPD
FT                   KNKDCVECEKRFLKIKEAYKIILNPYLRELYDKTSGYTVDVIPSKTVNLTLSNYPELVG
FT                   PDVWVVQIYSDDNARCKAFSALWDEFATKYQKFAKFGRINVFLEQKLLKKLNVNPKIHP
FT                   ALLMLHNNKYDLFPNDVLNNLNVLSGYFVKNYPFTCNHVKSYKEFKAVNKKNKLLLYNK
FT                   RVGINSDVPLNLKYLCMRFNKVLPMYYTSSDVKEEVAQEVVNTDAKQKLTDSKNTLFVG
FT                   FYDNNELKYMVNNSTSNLTKLEKLFYTLFTLNVFEMDSDLNVLCSRYNIKERLCVFTTS
FT                   EDLDLHEMYKNYEMYNEVEKNAEPVVAEENEKVEVEEVETDGTVKPKKTEEPNQLLSNR
FT                   DLQFVKVDHKHKSELGTGKNSVMLVNLHKNSYFLLGDFDEALASKLLNDEVDITWTKLP
FT                   SKLHALFFSKSKFYDFLNALKAKLM"
FT   misc_feature    709937..710104
FT                   /note="Signal anchor predicted for TA14295 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.995) with cleavage site probability 0.003
FT                   between residues 56 and 57"
FT   misc_feature    join(710098..710152,710198..710211)
FT                   /note="1 probable transmembrane helix predicted for TA14295
FT                   by TMHMM2.0 at aa 33-55"
FT   CDS_pept        complement(712273..714393)
FT                   /locus_tag="TA14285"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="chr2.cand.349 - signal peptide, hypothetical
FT                   protein"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74347"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ2"
FT                   /protein_id="CAI74347.1"
FT                   /translation="MSPGYLLRHLVVYLLIFNFKCFVDLTNSDPSTSGTSSSSSNGSSH
FT                   SLGNGSSTANQQSSSQVGSSASVGHGANGTSSNLTGSSSTSTSSSSQASSSESADTIKP
FT                   VSVSIPTLSPVELKINKTSAETEFDYSDIGIYKTFTCKQGYGFNKITKPKTTGSDEVIW
FT                   QSTGNDYATKVRLRKDTSTKERQILLFLASMNYVFFHADKDKPFQNLTSKRHDFFKLKV
FT                   YTLDSGVEKIAAHNQYTISLYHMSIGCTIKNEYICSKIMYEDREVYKKDDYQDLGQLKG
FT                   VYLDLVRNSMYLIGINDETRVLEAMKTAKNVTLDISKDKSSDEFDFIEDYQKNVRIFKA
FT                   RGNAIFTKVIKAATLSSDEVIWQTSNNIYSTEVFTDGLSDFKKTKNVTIKLSDGIFKQF
FT                   KKPNGNWVETTNLVPLDITKTESSIEFDFYTKGDFKTFTAKSSFLFNKLIESKTFGSDT
FT                   VIWEAPNSSDHSNKVTLMVTGDEKYMGLLRKDNTVILLHKPPSSDSWTNITSNVSKISD
FT                   LKMSHYDSDTQKYYLLKPEQYKVTFNNLLHGYELKSGVTCHRVKFGSKIVWSSTDQDPF
FT                   KQAKAVFTYLRANNFILIGPSNEKKEISSRDLLQDDGIQEEELTEKEPDTESISSESDT
FT                   TESEELDLSLSLDPSQTGSQDSTTPETSQSTSTGEQQPSEPTSTTPESQPPEATSTASS
FT                   LDSNPSSETFME"
FT   CDS_pept        complement(join(715479..715562,715594..715694,
FT                   715724..715955,716046..716354))
FT                   /locus_tag="TA14280"
FT                   /product="splicing factor 3a subunit 2, putative"
FT                   /note="chr2.cand.348 - splicing factor 3a subunit 2,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74348"
FT                   /db_xref="GOA:Q4UEZ1"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR031781"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ1"
FT                   /protein_id="CAI74348.1"
FT                   /translation="MIDYQHRVGHKTGSGAPASAHDVAAHQRERLRKLALETFDLNKDP
FT                   YFSKNHMGHVECRLCLTVHTTESSYLSHTQGRKHQMNLARRAAKEQKDAFMTIAPISKT
FT                   RAFKAPTLKIGRPGYRITKMRDPETKQPALLFEIEFPEIQGTPKYRFMSAFEQKIEIPP
FT                   DPNYQFLLFAADPYETIAFKVPNLEIDNGPNKLFSYFDDKRKLFIFQVHFKLKKTFKVL
FT                   PGLPQRPTKFDHVGPGPQF"
FT   CDS_pept        complement(join(716429..716747,716797..717119,
FT                   717171..717290,717322..717566,717604..718024,
FT                   718104..718253,718313..718431,718463..718921,
FT                   718978..719158,719241..719681))
FT                   /locus_tag="TA14275"
FT                   /product="sodium/hydrogen exchanger, putative"
FT                   /note="chr2.cand.346 - sodium/hydrogen exchanger"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA14275 by TMHMM2.0 at aa 2-24, 39-61, 68-86, 137-159,
FT                   171-193, 245-267, 293-315, 330-352, 365-382, 402-421 and
FT                   434-456"
FT                   /note="Signal peptide predicted for TA14275 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996, signal anchor
FT                   probability 0.002) with cleavage site probability 0.689
FT                   between residues 26 and 27"
FT                   /db_xref="EnsemblGenomes-Gn:TA14275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74349"
FT                   /db_xref="GOA:Q4UEZ0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEZ0"
FT                   /protein_id="CAI74349.1"
FT                   /translation="MTLINLIKFLASILAILVLHIEGASCDSDNVNLSGVSENLASLVS
FT                   VTVFILISSCFLHFLSSKINDKIPISLVLFIYGMLIYGILMNFDHEKLPVGILRWVSSL
FT                   RNIDNSILYFVALPILLYEATQTIDWYSFCNFLLAGISLAVIGVVLQVAILGILFHYTL
FT                   RENDIWSFFISFLLASILSSTDPVAVLSILGDSTSSHKLITMFNGESLINDGTSVLLFQ
FT                   FFYLLSINEKSSYWYYIMLFIKLLILSPLLGIACAIVVIVWISFFRKCHNVQCIISISI
FT                   GYLLYFCAEYYLNISGPLCIVCYGIFIKAYGLITFDKEALEKHHVLIESLSYMSNCVVF
FT                   LISGIITVGMLRSQFKIKSIGIKTLRLVVVYIYLNITRTIMLLLFKPLLTYTGYQINFK
FT                   ELLLLIWGGLRGAMVLVLGLRLENDKKISNSISDLLSFYISGSTMIILILHGFTFNMLY
FT                   KLLNPYPVKEYRIEYLNKTMKFIEDKYLERLSNLENYWLYKNTDVLEKANLLVPVLSNV
FT                   KWTKLGTISYNVTHANIKNLMVIDERKGATQEELDIEDEENIFLLNPELNSNFAHDYLN
FT                   LNSQTSDLYNMPQHSGSGISATGIDTQIPPGRSMDNMEAIRYGVSNFSSDYEIAKKASI
FT                   AVNEPFSKEDFSEIDSGGGKDLDEYEIYIIIFNGLLYMYNEMYNKSEIDGKSLLTLKTI
FT                   INISLDFSINKLKQRSLNIWKNVKNSKINKLYSMINYENFNDGGADQENQISVGDFEDV
FT                   SKINGFEFEWILLKNNLEYILSKRLNFININNASFVLDIILSYILAHEKLVVKQNSIIQ
FT                   IILGNKLLESYMKQINNAKKYVFIIKNKMNVMFYYCLLIKTSSSMINIKKEIVKQYYSN
FT                   GMLLDEDEKKLNDLLDEYKISNKSNYTKIIKFIIKKFYQMITFRKNIYTTTNIV"
FT   misc_feature    complement(join(718007..718024,718104..718154,
FT                   718191..718250,718367..718420,718488..718556,
FT                   718599..718667,718743..718811,719021..719089,
FT                   719123..719158,719241..719273,719424..719480,
FT                   719499..719567,719610..719678))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA14275 by TMHMM2.0 at aa 2-24, 39-61, 68-86, 137-159,
FT                   171-193, 245-267, 293-315, 330-352, 365-382, 402-421 and
FT                   434-456"
FT   misc_feature    complement(719604..719681)
FT                   /note="Signal peptide predicted for TA14275 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996, signal anchor
FT                   probability 0.002) with cleavage site probability 0.689
FT                   between residues 26 and 27"
FT   CDS_pept        join(720025..720165,720213..720737)
FT                   /locus_tag="TA14270"
FT                   /product="50S ribosomal protein L22, putative"
FT                   /note="chr2.C.cand.167 - signal peptide, 50s ribosomal
FT                   protein l22, no predicted apicoplast target sequence"
FT                   /note="Signal peptide predicted for TA14270 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.000) with cleavage site probability 0.872
FT                   between residues 15 and 16"
FT                   /db_xref="EnsemblGenomes-Gn:TA14270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74350"
FT                   /db_xref="GOA:Q4UEY9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY9"
FT                   /protein_id="CAI74350.1"
FT                   /translation="MLIFLILLLVNSSECFLILSQKFNYTKSGNFALYPSHRLTVSEKM
FT                   EKIHIINSELPIRKYSADSPEVRMMENTLKQKRRSYLDALKAKELGIPVRKRHKGGRMD
FT                   KPILERTASAHAKYLFLSPTKLTKILRQIKKMPVLLALGDLAQRGSNRYAVAIFKVIKS
FT                   ALFNAKRLYENSEEPLKFRFRELSATPGGVVKKPLFRAKGRCDVIRKPKAHLKVVLSC"
FT   misc_feature    720025..720069
FT                   /note="Signal peptide predicted for TA14270 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.000) with cleavage site probability 0.872
FT                   between residues 15 and 16"
FT   CDS_pept        complement(join(720916..721031,721063..721139,
FT                   721169..721386,721492..721579,721692..721735,
FT                   721775..721897))
FT                   /locus_tag="TA14265"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.345 - hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for TA14265 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA14265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74351"
FT                   /db_xref="GOA:Q4UEY8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY8"
FT                   /protein_id="CAI74351.1"
FT                   /translation="MSKKYGKSTLGAMAARNTKAANVAKRGVADFKNNVKNVLLQGYNN
FT                   DQLSNIQTKKILNDIEKLQNDASNVLSSLYEYSEELRIKNESYVLYDSLLEEFKQNMGK
FT                   LEDLRAKLVNYQTSIPNSIRDVKHDMYVLKNFKSFRYVDEDENMELVQDQIYNIAEYPL
FT                   ENTIFDERSEQIKQLRSSVYGIQDMYIEIGDMVDYQGDQLGSEIILLIDSQIISKITC"
FT   CDS_pept        complement(join(722242..722523,722555..722662,
FT                   722732..723012,723042..723138,723171..723273,
FT                   723316..723416,723470..723565))
FT                   /locus_tag="TA14260"
FT                   /product="ribosomal RNA assembly protein, putative"
FT                   /note="all_bases.C.cand.439 - mis3 homologue, ribosomal RNA
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74352"
FT                   /db_xref="GOA:Q4UEY7"
FT                   /db_xref="InterPro:IPR024166"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR041174"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY7"
FT                   /protein_id="CAI74352.1"
FT                   /translation="MEEEKSRHRKYRRDKPWDNDTIDHWKIEPFTSEENEPSLVEESSF
FT                   RILFPKYREKYIQSVWGDVKRCLSQYHINCELDLLEGSMTVITTNKTWDPYIIIKARDL
FT                   IKLLARSVPFPQAKRILEDGVYCDIIKIGGLIRNKEKFIKRRQRLVGPGGSTLKALELL
FT                   TECYILTQGQTVSAIGSIKGIKTVRKIVEDCIYNIHPVYYIKELIIKRELNKNEKLKNV
FT                   PNPIENWDRFLPHFKKRCVKRKKTKVVKKKSENALLIPIQQPRKEDILLETGEYFMREE
FT                   ERKRKQQFERREKQKLKHQEKKLKKLQIYEKNGAKDTAEDKSTSETVEKAEIEKSDKKV
FT                   ISKKPSKPASKDYFI"
FT   CDS_pept        complement(join(723598..723669,723723..724018,
FT                   724090..724215,724369..724491,724525..724825))
FT                   /locus_tag="TA14255"
FT                   /product="ser/thr protein kinase, putative"
FT                   /note="chr2.cand.343 - protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14255"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74353"
FT                   /db_xref="GOA:Q4UEY6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY6"
FT                   /protein_id="CAI74353.1"
FT                   /translation="MSGLETIKLLHYGKCNDIFLAKDSKGNQFALKRFYREELEKRKEY
FT                   INRDGKLVKKDWFEDFKRALEVQKVLDNESCIKLHGIFGIDFSPEKPTFEDEIDLVFEY
FT                   AEFGSLMSLESFQEEVPNFPKEVIKCITKDVLNALLYRDFGESEFMTEDGKVKGSRGTY
FT                   YFLAPEVLEINSSTLSIPDSFEIVELWIIDENDGNAIDMWALGITLWILYFRNFPFYGN
FT                   SGSIYETITNIQNFNFKTQIQTLKPNNSHEKLEDEDEFVDLLEKILEKDPKKRIKPKEA
FT                   LNHNWLRNVDYEAAREYCRRNIKK"
FT   CDS_pept        join(725171..726457,726524..727324)
FT                   /locus_tag="TA14250"
FT                   /product="hypothetical protein"
FT                   /note="small overlap at the 3' end with gene TA14245"
FT                   /note="1 probable transmembrane helix predicted for TA14250
FT                   by TMHMM2.0 at aa 7-29"
FT                   /note="Signal peptide predicted for TA14250 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.670, signal anchor
FT                   probability 0.191) with cleavage site probability 0.440
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA14250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74354"
FT                   /db_xref="GOA:Q4UEY5"
FT                   /db_xref="InterPro:IPR010884"
FT                   /db_xref="InterPro:IPR038160"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY5"
FT                   /protein_id="CAI74354.1"
FT                   /translation="MQLLKSTLFIYFIIYSGSFCSAKFGLDFLARKMNSAVDLAMNYAI
FT                   MNETLSFKEAADFTADGESFMSYTLEPGSAIKFYCGTSQTIDSRQILMYPQDLKTNSLA
FT                   PMSKSGINHSIKRVVRNFDLFRSDSTLIYALAEFLGGGYMIQYPADSVIVSNNPDFSLN
FT                   FACVYDPNAPYTDNEPDELNGGEEKKDLLYRWVEVKFKNVYPMSYGCGSKGYPLFSNLS
FT                   PGYGLDFLSETFLQPGSNCEIEPKPGMVIGIYCAVGETFNDELCFRDASGNIFFDQNYK
FT                   HSGGLHLHLYRVPDSGYDSDVNFLCECKGKNGETRAQVRVRKYSTMNCDLTKIFSNYKP
FT                   GKKITLQACRRDLRPGESLKLTVPANFSKFNYMNASYSSLLEPIEVRFYAYRQKLDDYQ
FT                   VCFVTVLAHIYSTELLSYLSSYLSYPSVLAVRKVKLRDLIVGNGLDIEKSVVPGGVQYI
FT                   FKYKKDSILILTSETVSFEYFWTLFYKNPRERDVISYLNMNEKVVAVVSIGLFPTDPYT
FT                   YGCGTRNDIFRKELLDFRSELINNKPASICRVDGKNSPIGFYCPKPFLLEPRDCFKSVL
FT                   VSTDEGEKSVDLVKVDKHARHFTTKNLVVLDTYSNGGHVGPAQNEGGANYEDDNEYVNA
FT                   SEIMCKCVDEEGNLVASITVQLDKPVEAEKEGAEEDGGIPEPQENSGVEEDTGIPETTI
FT                   Y"
FT   misc_feature    725171..725236
FT                   /note="Signal peptide predicted for TA14250 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.670, signal anchor
FT                   probability 0.191) with cleavage site probability 0.440
FT                   between residues 22 and 23"
FT   misc_feature    725189..725257
FT                   /note="1 probable transmembrane helix predicted for TA14250
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(727311..729905)
FT                   /locus_tag="TA14245"
FT                   /product="hypothetical protein"
FT                   /note="small overlap at the 3' end with gene TA14250"
FT                   /db_xref="EnsemblGenomes-Gn:TA14245"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74355"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY4"
FT                   /protein_id="CAI74355.1"
FT                   /translation="MNGIQIASSIVRGELDDLCPENIIKCKIVKKVGSKRVKLSQELGD
FT                   LDLERQYTLYKPFNNDLELAKLYVNESPLCVEIFSLFESNNLIVKTKAISMLLFILSNF
FT                   SNLYTNFYNNLNNENNLSSSSDESSEGGLENNVNDSDGNFELSKKVKLVEKILKLYKEK
FT                   IDEIFVNDDVIINYSLKLLLECVKCVDLDALTEFLLNFNFFKYLTKCHIFTPSCDITLI
FT                   NSLNTDESAVTDEISSDADLYHENGKLKLCIILLLGLKGVNVLRKDLINIIVSHLKSEQ
FT                   LTTQFLLVRLLVKILNNLNEVELDEYTDKLFNNINNVIIILYKELGTEFGTKLNKEDLD
FT                   DILKDFIKFIHKYSDLCVKLILKYDIKTFKVVSTSLYTLNNEAYKSYVNSLKLPSNTEV
FT                   GLFLDIVEEFYDNTNELPNCFNKVIINKLLTNNVPIINKLIKLLIKVNSLPDLQLLLKL
FT                   INHNNNNDNTVNGVDADGVNSSKSVDLSGLLELLSRFDGAKSIFDPLKLFKYPSISSNY
FT                   EIMNEFFTCKTDMGVSRESDGRIEDRLELDKSLMKCIYNLSVKDIIIINKLQNKCLSIL
FT                   LQRYIQTLNYSTDYNCQLLEFIKSILNNVIDSNLTEIYITNLTDKNITNLFIILYNLLL
FT                   TLNIQLLYQNSSSNRSNQLSDVSTNPFLADDMKGEYSCVGCVLKCYFKGDLYLLMLLVL
FT                   LIQLKLKVHGTKVKCVKCNGTSVNLVKSISDNKSYEKCNDWENVMENYVLKVLANVLTI
FT                   PCETSKQLCTILTHYDIQIEPIEYKLKIEHAVETNSQQTAGTDDTVNTVDNTDTTNNVN
FT                   VEVNLLNKQMLQSLIDDKIDKTSLVKCAKQLNTPHTKYFIQTLIYTHQISIS"
FT   CDS_pept        join(730089..730782,730950..731182,731252..731492,
FT                   731652..731753,731781..731890,731928..732014)
FT                   /locus_tag="TA14240"
FT                   /product="leu/phe-trna protein transferase, putative"
FT                   /note="all_bases.cand.1381 - leu/phe-trna protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74356"
FT                   /db_xref="GOA:Q4UEY3"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY3"
FT                   /protein_id="CAI74356.1"
FT                   /translation="MKILNIMNNDRSLEKIKIEENLLNSWDSLGNLTLSDYFKRFDQFA
FT                   SVFEEYESDLEEFDLGVLDHFSAFEVVENDRLNRLKLFLKLCFDVKYSNNNRKICYKID
FT                   ESPFFQVFREILLFFHQDNGKLNHQVVTCEDSSSVNNLDEEEQNTFFGKNLTEIRIKVS
FT                   RGLMDSILLGSCEFPAKSITNQLKNDIKTLLTLKRIKELQIPLNTLQLLLPFNSLDSIL
FT                   YLYSLNIITDELCWTPSIDVEFVTLLMEFGFIPIGYRLVFPSFERVIILPKMHQFRCCL
FT                   VPTDIKLPKKALKLKDQLLITFNKDFNQVMNGIVNKFGENWLYPPIQLLFSLIHFYTNS
FT                   QPNDTENAINNNNTNSTSEVLNNNVKMENKEARSKLVSVEVWKGKELIAVVNGSVYTSL
FT                   TGFHNMNNSGKFQLIALAAILHFNGFELWDLGMHLPYKTEMGAKCISRTLFIRDLNRYK
FT                   FNARNLEIPKKYKNDVNSTQLIDDFTKLIF"
FT   CDS_pept        join(732165..732497,732640..732816)
FT                   /locus_tag="TA14230"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.170 - hypothetical protein, conserved,
FT                   pfb0590W, signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:TA14230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74357"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY2"
FT                   /protein_id="CAI74357.1"
FT                   /translation="MRIRPLENLKEIILDLLDWYKYATLKQQHATMLFSGAFLGLIVGR
FT                   TQHKRRMKSGEFSRDFELVAYKVEDEKRFEENWNRLALLAQKQPGYKYTKLYKACYPDR
FT                   SPIHYFKLRLWRNKDDLENFRNLEQYKVLRKNLDESSSKVRFGSTKVIIDDTVRREIPY
FT                   RNTLFY"
FT   CDS_pept        join(733285..733293,733327..733449,733534..733738,
FT                   733861..734040,734196..734287,734325..734407,
FT                   734572..734653,734704..734931)
FT                   /locus_tag="TA14225"
FT                   /product="molecular chaperone, putative"
FT                   /note="DnaJ protein, putative"
FT                   /note="chr2.C.cand.171 - DnaJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74358"
FT                   /db_xref="GOA:Q4UEY1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY1"
FT                   /protein_id="CAI74358.1"
FT                   /translation="MGKDYYSILGVKRGCNDAELKKAYRKLAMQWHPDKHQDPNSKLKA
FT                   EEMFKNVSEAYDVLSDPEKRKIYDQFGEEGLKGTAPGPEHGGSHTYVCMFPLRAGASRH
FT                   YLLIDTKPNTGVDPSELFRKIFGNDRSFMFGGGDEMGGFGDVFHVTSSSMKSTNYELEL
FT                   PLTLEELYTGTVKKMKVTRKRFNGNKQYKEEHTLKIDIKPGWKDGTKLTFTGEGDQQSP
FT                   MATPGDLIFIIKTKKHMRFVRDGNNLIYKFTVPLVKALTGFNAVLTTLDNRRLTIRVTE
FT                   VVSHKSRKVIAREGMPLSKNPNQRGDLILEFDVVFPETLTNEQKASISNIFN"
FT   CDS_pept        complement(join(735068..735349,735468..735581,
FT                   735876..736020,736138..736241))
FT                   /locus_tag="TA14220"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.436 - hypothetical protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14220 by TMHMM2.0 at aa 62-84 and 149-168"
FT                   /db_xref="EnsemblGenomes-Gn:TA14220"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74359"
FT                   /db_xref="GOA:Q4UEY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEY0"
FT                   /protein_id="CAI74359.1"
FT                   /translation="MAVPKNKRSKSKVKQRTNIIFFDQLCGNWRRRREWFYRRLAIEKF
FT                   LPSTCEPKFSLNRPVLFPGFWSTYFLHIINTITIRLVIMRIFKGFVKVLPDFQTKHFNY
FT                   RQFRYLGQAPQGKNIENFESAWEEGKKLFYRQSLSYNEFAKRVECLRLFLFWGLVTGLA
FT                   FDIAFRPPKSRYWFTWNLRERFSKPKHTSLPPLQDDNMTDATREYNKICNF"
FT   misc_feature    complement(join(735209..735268,735579..735581,
FT                   735876..735941))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14220 by TMHMM2.0 at aa 62-84 and 149-168"
FT   CDS_pept        join(736468..736550,736746..737005,737130..737318,
FT                   737386..737439,737577..738194,738249..739439,
FT                   739499..740790,740891..741036,741124..741343)
FT                   /locus_tag="TA14215"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.172 - hypothetical protein, signal
FT                   peptide, TSP1 Thrombospondin type 1 repeat, SMART SM0209,
FT                   transmembrane"
FT                   /note="membrane protein"
FT                   /note="1 probable transmembrane helix predicted for TA14215
FT                   by TMHMM2.0 at aa 1318-1340"
FT                   /note="Signal peptide predicted for TA14215 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.001) with cleavage site probability 0.426
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA14215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74360"
FT                   /db_xref="GOA:Q4UEX9"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX9"
FT                   /protein_id="CAI74360.1"
FT                   /translation="MKLMFLHICLLCCCSGYVTGTNSSNILEIDSFNLPEIRCPCGHHI
FT                   TVVAAHINCNSGQLDVYEEVWDLCAYRSSCMLNPSIYKRCNKSPHFEFVKFSCIKCIHT
FT                   HLLLSHTSYDMLGYDCGLFYGVDMKDDEMCQMLCLNYVRSCTSRYDLVPREYYLKCLSK
FT                   MFLRNNVKECEFLPDSKMKEFDSFKLEYYLKPKYILESVEINNYEWTELKYKEPIENPI
FT                   VIVSPVQTVDNVVVIVNNVTQTSAKLILQSVVPNNSGVSRTKSMVEVLIITIGNHSVDL
FT                   NKQIVVGLIEVMSDQFIKLPLDPLFDWVVVLKNQTDAMVNPILHENNTVKFYTQGPVTR
FT                   VKLGYLALNKSKDKSMLLYENELKYDQTNVKQVKLSPNTRLFVTPIDKPNYNTVYNITF
FT                   TDGSDVTNIVYTKENTITLISHYNTFLTRFKVLDSVPVTFNIITLESSVIIWIKRICEY
FT                   SRRVNLISKRNCYHQCINSSYLKDCLQGDTNYFFTCYKSKSENCEILNLSSLLNLILKY
FT                   RNDILTHFFNANTNVNNTNTVNKVDSNKNVDNTDRDKPTGNVVDTVKVINTNNVNKLDG
FT                   GNGTNNLLTVYSEWSDWSECSKICNDDVSKSIKVRKRLIYYPGQSDADQTIQAVECHKV
FT                   INCNKLCYYRVLNSNNALNTNKTVDNTSPTISNSNSDKTVEKAVKYFFVWNVNCMMKRE
FT                   KIDLGGKLISSVSKVDEILEYDENCDLDFNYSACDTPPGKGTGNRHLLINIKCPKTTKP
FT                   CERPDNNNVKPVDNRGEMCLMYNGEYDGKSWVKNGSCICPENTIPYPHLVIHMRTQIYR
FT                   YVYSISIIDILMKNVIGIGMQEYISLSGHERLVVPLGYIKVPTFDFFTSESQLENYCSN
FT                   GNINYSNDQLTNSTVDDQLLNTSVGNELLYVSCDNVILSELKISTGLEKSNLFESCISK
FT                   CKELEKECENEIDRFKEVDMIKCLKEFVKESNKFDVIVFKNYFEKQYKNVEIDEIITVI
FT                   HLIDAICIDDKLYNLCVTTLKNILNDCKNILNHDFQNKVKKCLHKRMNEDQSKNGVVNC
FT                   KFNKERKIIGNGLVYCKEITCKFTEYSKWISNQSNNNNQTDELYKRLEEISDELSEENI
FT                   MKVVNELGSNVKIRFRKVVSGSKHCYNINKLVQIYPNTSVAQVEPPNTTDQDKFSRIIL
FT                   NDSNNIDSNTSNIVDNDNNSEISSKTVDLIDNNGDRVESNLNGINCRIYLGQKQIQNTK
FT                   LIIQRNRCSCPYKMNQCSIEESLKSKDWNKQLSLVCNNKMRSILFLNRNSFYRYSCLSL
FT                   SYIKEDFESVKELCNEDDGMTFISCYGETSLLEVYLMASFMAFLGITSSCILLIYLHKI
FT                   KHISFFN"
FT   misc_feature    736468..736515
FT                   /note="Signal peptide predicted for TA14215 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.001) with cleavage site probability 0.426
FT                   between residues 16 and 17"
FT   misc_feature    741242..741310
FT                   /note="1 probable transmembrane helix predicted for TA14215
FT                   by TMHMM2.0 at aa 1318-1340"
FT   CDS_pept        join(741521..741850,741943..742305)
FT                   /locus_tag="TA14210"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.173 - hypothetical protein,
FT                   transmembrane"
FT                   /note="membrane protein, putative"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA14210 by TMHMM2.0 at aa 82-101, 121-140, 147-169 and
FT                   193-215"
FT                   /note="Signal peptide predicted for TA14210 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.861, signal anchor
FT                   probability 0.000) with cleavage site probability 0.529
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA14210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74361"
FT                   /db_xref="GOA:Q4UEX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX8"
FT                   /protein_id="CAI74361.1"
FT                   /translation="MKCLVILILNVFINCLNQNLRNPNPTQYSSNANNTILKVSNKTGL
FT                   ISETGKLINNTKKLLEQSLLSLYDFEYENELLWTQNNIIGVSIIIILNTLIFIIIIKQT
FT                   SSLFSKGLGRKYMNGGGWWLMLSALLGMLFGCLVGVIMRYSMLILGFSFMLLSVSALLL
FT                   GRMGMVVGGVAGLEIGSIFGTINSGSISRIIFEALLCCFAGVAIGFVPMFPNIKINARY
FT                   IQRSLKLV"
FT   misc_feature    741521..741571
FT                   /note="Signal peptide predicted for TA14210 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.861, signal anchor
FT                   probability 0.000) with cleavage site probability 0.529
FT                   between residues 17 and 18"
FT   misc_feature    join(741764..741823,741973..742032,742051..742119,
FT                   742189..742257)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA14210 by TMHMM2.0 at aa 82-101, 121-140, 147-169 and
FT                   193-215"
FT   CDS_pept        join(742730..742765,742801..745062)
FT                   /locus_tag="TA14205"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.cand.1385 - signal sequence"
FT                   /note="secreted protein, putative"
FT                   /note="Signal peptide predicted for TA14205 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.939
FT                   between residues 19 and 20"
FT                   /db_xref="EnsemblGenomes-Gn:TA14205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74362"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX7"
FT                   /protein_id="CAI74362.1"
FT                   /translation="MKLMQLILLLLCIIKTSNGVNNGFLNPKLTTYQPPFEPIILDLRL
FT                   ESSTKVFEHLDRDNSEEYIAKDGYIFDVIVVTSPFGPVLQHIYKARDISNCAIKVIKYT
FT                   FCHDITSVSLFLVNGDFKKLVKQNYEWVEVNDLKIDISNNRNIDTSMYVIQHSGSFNEV
FT                   VKDDKKTRVFRRFHDYKPTTIVLINKVVETRPVSGEETVIWKTDNTLYTAYQVSICTYQ
FT                   NLRYLAILHKNYDYTLFSRENTAKTWDDITLSRLNMRELRFYFEDEKDLSFVQQLSKSY
FT                   VVYLNQFRYVIDFNFDQKLLDKYTFRLASNLQYNILEDTISVQYVNGLKVTLNPGVRNI
FT                   KLYYNKISNISKQKISTMMTRRHFIYKLPEYFEFVNNINKTGMKKNNESDNESDMETET
FT                   SSETEDKYDGPPHDIHSCNEADINPETSCGTETKYDTPAPDIPSNTESDIKSEDQSENK
FT                   PDQQTDGKPEENSGNKVNNDDKEVENTGNDNNPSDSADSNTIVGDDKSEEKKSTDGTNS
FT                   SSEEEGEDLEVSDTKTFEESDSLSSDSEMYSRYNESDDEHSKLIELDINVRKAKISHKY
FT                   IRSDKYFEFSCISGYEFVKIYESSLGPQDKKEIWSTHDQNESVIKVLLLEGNHTKYLMG
FT                   LRYNYAFFLYKWKIEGMTWVEITDKKVSLNNLRMIDVNGAEIRNPNIIASFHEFQLEVI
FT                   PRITCHKIYYKSQKMWEDTEKKVLPKIDIIIIKILEDKVNIFFKNGQVKRFELYSDRML
FT                   LISQGLSTYESH"
FT   misc_feature    742730..742786
FT                   /note="Signal peptide predicted for TA14205 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.939
FT                   between residues 19 and 20"
FT   CDS_pept        complement(join(745143..745896,746087..747188,
FT                   747346..747537,747597..748329))
FT                   /locus_tag="TA14200"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.341 - signal peptide, PF00090
FT                   Thrombospondin type 1 domain"
FT                   /note="secreted protein, putative"
FT                   /note="1 probable transmembrane helix predicted for TA14200
FT                   by TMHMM2.0 at aa 646-665"
FT                   /note="Signal peptide predicted for TA14200 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893, signal anchor
FT                   probability 0.000) with cleavage site probability 0.439
FT                   between residues 15 and 16"
FT                   /db_xref="EnsemblGenomes-Gn:TA14200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74363"
FT                   /db_xref="GOA:Q4UEX6"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX6"
FT                   /protein_id="CAI74363.1"
FT                   /translation="MKIIAFLLLIKLSILISNQNDLFDQDYLSVNKMMVSTNETSNICN
FT                   GVKGTTKSYEKFCLEQCLKLVEMCEKEENILKCVAKVKAFDVNYNLFFKRCKFAQNFQE
FT                   SIERFENVILNGCFITRSVYRDSWVNEETNSCNCAVLNAEPCTLEDVNSVPENVIEEIK
FT                   GSGICPNIDYGNLVKDNNKSIYGVSISNNKQLHCPIINKSTNSENLELENRPIVSDLNQ
FT                   EELVNYCKRGPVYSSYTKNNTQYGEYHCAFVKSLSGDSDNSCIEICEEIEEHCDQFDSN
FT                   LIKCIKDRLTVQDEREQFEKYKCQIGEEKGLNELCKEVYKASDNKDECLYLCNFSKDVC
FT                   QTYTNSTKNLCKHSLFTTDDKINEFKFNEIKEKVDKFGEMCKFEKGNYLGFGYVLCKYK
FT                   TENCIFGEWSDWSNCNYNCIDFDHIPTRYRTRKLLNPIPDCNRNGLGTIEFQICTHLPK
FT                   CPQSGWITTSIPTKPLITSITKDNRVNNDKDKSKNYPEWIFYALEQYPDLISNTSKTTN
FT                   NGILDKGSAVTSKQLTKTTSNKKGVEWEIRKSIRVTTIKETKCGCPKKVESIKFNEFIE
FT                   NEKLISELSQLCRKNIFNQLVFESSGRYIYYCNIGILIKEVENKHIKCEEEDSTEYIIC
FT                   KKVVKRVKKEQIAIPAIIGILGVLGLIIIVDQINNYYNRKSFHRISNIIPGLRFPGLRA
FT                   SQLKYSTHDHHHHEEPPHYAYRGDGLPGVKCEQLQHMLHLNQKLTEKLEKSNKTYENLG
FT                   FQTYTDTVRSETADNLLDVQSEEVYYELKNLFNKVLLSNWHDTVQLTMNMDIWAGSFDR
FT                   LWRLARDIPHVRFQQLLTETKELFDVLYQVEDLQDHLYELMEELALHPQENSGSSMGAT
FT                   TNYNQHINEVVRRYHELKRNHPQYTQKLKESLGYTLAVMRQRYTFDWPEEHSYFY"
FT   misc_feature    complement(746119..746178)
FT                   /note="1 probable transmembrane helix predicted for TA14200
FT                   by TMHMM2.0 at aa 646-665"
FT   misc_feature    complement(748285..748329)
FT                   /note="Signal peptide predicted for TA14200 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893, signal anchor
FT                   probability 0.000) with cleavage site probability 0.439
FT                   between residues 15 and 16"
FT   CDS_pept        complement(join(748575..749111,749141..749227,
FT                   749339..749490,749521..749635))
FT                   /locus_tag="TA14195"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.434 - ring finger"
FT                   /db_xref="EnsemblGenomes-Gn:TA14195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74364"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX5"
FT                   /protein_id="CAI74364.1"
FT                   /translation="MNTNISNNNQLNYNDTLYTQFNNSPVDGVNIGPNRIRRNSSVPVV
FT                   FYRNDQISRRNRNNETLSANRYPMPNRQLSSPIHSNVHYYPFYSINLMNRHTEIMRIHE
FT                   ELSRYHNVIQSRLLSSPRFNPTNTNNSVNTINTINTVNSINMANNLTPRNMVGNDYIYI
FT                   TNNVYSGSGLGSSRVNSLDTRSFSRVNSDLSHLNQAQISTIPTQSINLVEPIEVQLPPE
FT                   ILESFPVNLFTGDSGELDESLRSCSVCLEEYQQGDEIRRLPCTHSFHKRCIDTWLKKST
FT                   ICPICKFNYIIMMQI"
FT   CDS_pept        join(750312..750360,750429..750622)
FT                   /locus_tag="TA14190"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.175 - score = 7.98"
FT                   /db_xref="EnsemblGenomes-Gn:TA14190"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74365"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX4"
FT                   /protein_id="CAI74365.1"
FT                   /translation="MKNSIFHILEIDIPLNDGSNKRYWYGSVSSDDGVIKMMKINDIKD
FT                   WESFIQRRSSRILEKNKILSNYEEIFNKNKPNVFF"
FT   CDS_pept        join(751127..751231,751300..751468,751568..751633,
FT                   751713..752553,752697..752766)
FT                   /locus_tag="TA14185"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /EC_number="3.6.1.3"
FT                   /note="chr2.C.cand.176 - ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74366"
FT                   /db_xref="GOA:Q4UEX3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX3"
FT                   /protein_id="CAI74366.1"
FT                   /translation="MSLSLDTSCKNDTSVDPTWKRDILDKNADKRYKTEDVTKTRGSEF
FT                   EDYFLKRELLMGIFEKGFERPSPIQEESIPVALAGHDILARAKNGTGKTAAFVIPLLQK
FT                   LDTSEPQIQGLILLPTRELALQTSAVVKELGKYLEVQCMVSTGGTSLRNDIMRLYKPVH
FT                   ILCGTPGRILDLTNKGVAVLSQCATVVLDEADKMLSQEFCPIVEALLKFLPTEKQIILY
FT                   SATFPASVQAFKEQYLPNAHEINLMDDLTLKGITQFYAYVEERQKVHCLSTLFARLQIN
FT                   QAIIFCNSVVRVELLAKKITELGFSCFYIHAKMMQSHRNRVFHDFRNGACRCLVSSDLF
FT                   TRGIDFRFVNVVVNFDFPKNSSTYLHRIGRSGRFGHLGLAINLVTEQDKESLFKIEEEL
FT                   ATEIKPIPAHVDPALYS"
FT   CDS_pept        753196..753411
FT                   /locus_tag="TA14165"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA14165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74367"
FT                   /db_xref="GOA:Q4UEX2"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR016696"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX2"
FT                   /protein_id="CAI74367.1"
FT                   /translation="MGTEIGNRILDYLTVREKINTRFTNIVSLLTFISTTVWKYLFNHH
FT                   CLLLKEKDDNKECILLIYLSYINSTR"
FT   CDS_pept        753808..753963
FT                   /locus_tag="TA14160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74368"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX1"
FT                   /protein_id="CAI74368.1"
FT                   /translation="MSCGSFVAGIVQGILTSAKFVSNHIYLNYLYSYLLEGGLNTSSRV
FT                   KQHPLP"
FT   CDS_pept        join(754392..754470,754759..755138)
FT                   /locus_tag="TA14155"
FT                   /product="histone H2A variant, putative"
FT                   /note="histone h2a variant"
FT                   /db_xref="EnsemblGenomes-Gn:TA14155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74369"
FT                   /db_xref="GOA:Q4UEX0"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEX0"
FT                   /protein_id="CAI74369.1"
FT                   /translation="MDAGGKIGGKIGGKVGGMGKGGKGKTGSGKGKKTPMSRAARAGLQ
FT                   FPVGRVHRMLKSRVSADGRVGSTAAVYASAILEYLTAEVLELAGNASKDLKVKRITPRH
FT                   LQLAIRGDEELDTLVKATIAGGGVIPHIHKALMNKGPQPVLVKPPKRL"
FT   CDS_pept        join(755489..755782,755971..756105)
FT                   /locus_tag="TA14150"
FT                   /product="YOU2-like zinc finger protein, putative"
FT                   /note="chr2.C.cand.178 - you2-like c2c2 zinc finger
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74370"
FT                   /db_xref="InterPro:IPR008560"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW9"
FT                   /protein_id="CAI74370.1"
FT                   /translation="MSWFEKLYKREPETVNLNERAERFQREVDEMLAEVTRMTLPLQKK
FT                   SFQCCTNCFDLSSENLDDITNCIKNCQKNPEEFGNAVQSELNQLQLSLTNCHQKCMNMN
FT                   KGDANVEMERCAVKCYDSNQNMIKTIWNNLQKNYQNFT"
FT   CDS_pept        join(756236..756256,756269..756339,756396..756449,
FT                   756481..756629,756749..756909,757079..757216)
FT                   /locus_tag="TA14145"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA14145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74371"
FT                   /db_xref="GOA:Q4UEW8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW8"
FT                   /protein_id="CAI74371.1"
FT                   /translation="MNINVLIGKAKKTRKFAQVKRRLSIKDSKLLNIKKDVEVKDTGPK
FT                   LTQQNVIHSGMFFNYNENLVPPFQVIVDTNFVNSSIQNKLDLHKSMMDLLLSKCIICVT
FT                   DCIIGELEKLGHRYRLALQLVKDPRIKRLKCSHKGTYVDDCIVERVQLHKCYIVATNDK
FT                   DLKKRIRKIPGVPIMYVKRHQYQIERIPFSITSK"
FT   CDS_pept        complement(757381..758454)
FT                   /locus_tag="TA14140"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="transmembrane protein, signal peptide"
FT                   /note="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74372"
FT                   /db_xref="InterPro:IPR011714"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW7"
FT                   /protein_id="CAI74372.1"
FT                   /translation="MEQVYNHTQDKPSYHADVLKAKAPDIKDKAQAVSSTADSHSRTEL
FT                   TAIRETDIQGDSKKGSQLQNKANQLKRETTNLYTAADAIVTEAALPTSPLNPLRDDAEK
FT                   LRDAAKKDPGDTTGLYGAAQLATHPTGTGGLDGKAKDVINKFELVASAYGALMASAKVI
FT                   QKETDPKVTAVDTAYKDLKGIYDRMLNLTKLHKAANDLQQAASTLPALSGPAGTLAQAV
FT                   KTLRDNAVPGNNYENAQTVIQNFEKVETAYSQLPEAETASVKDKFEALKTVYNSILNFA
FT                   KIKYYSTQLATAAEQLSNSGVNPEEVITNFNAVATAYKQLGETEQKHVQSQFDDLQIEY
FT                   SRAIYFYKWHFITLLPS"
FT   CDS_pept        complement(758548..759276)
FT                   /locus_tag="TA14135"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="transmembrane protein, signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14135 by TMHMM2.0 at aa 4-26 and 83-105"
FT                   /note="Signal peptide predicted for TA14135 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.861, signal anchor
FT                   probability 0.032) with cleavage site probability 0.535
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA14135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74373"
FT                   /db_xref="GOA:Q4UEW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW6"
FT                   /protein_id="CAI74373.1"
FT                   /translation="MIDICVAIIISFTTAIMWTCAHLLPPDGNAKATDIKGTTSSSQGR
FT                   RNADTTYNSLTTGEGPQARKLWHIKPPDKIDDSPKADVVSPVIMVIVGMGLVYAIYPGI
FT                   ASGDLSSQAGTLSTNAKNLYDALSGTGPDVEAAKEKVTALKNAASNSSDPKGLEQLLEA
FT                   LKTGLDVVVKAKGVLAKYNEVATEYGKVAADVEVQKKQVNLTKLNLHSLHFRKHHTKAP
FT                   TTPAKTKPQPMTNALSFTGL"
FT   misc_feature    complement(join(758962..759030,759199..759267))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA14135 by TMHMM2.0 at aa 4-26 and 83-105"
FT   misc_feature    complement(759208..759276)
FT                   /note="Signal peptide predicted for TA14135 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.861, signal anchor
FT                   probability 0.032) with cleavage site probability 0.535
FT                   between residues 23 and 24"
FT   CDS_pept        complement(join(759322..760387,760469..760761,
FT                   760812..761373,761430..761467))
FT                   /locus_tag="TA14130"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="transmembrane protein, signal peptide"
FT                   /note="secreted protein, putative"
FT                   /note="1 probable transmembrane helix predicted for TA14130
FT                   by TMHMM2.0 at aa 622-644"
FT                   /db_xref="EnsemblGenomes-Gn:TA14130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74374"
FT                   /db_xref="GOA:Q4UEW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW5"
FT                   /protein_id="CAI74374.1"
FT                   /translation="MISKALMFHLSSNGVNTVETVAGDLAGKAQELYNQADGIVQAAQV
FT                   SGSPLSTLSTPATALASAAKGTDGQDKSSLHHQANELSSATPTDPDKAIAVITAFATVK
FT                   DAYENLAAQTLYQENKRKPGISPLADTPAGKVKAVETAWKGVESDFQKLCMALIKHFAN
FT                   QVENNATSLASANGNQTHADKVITSFNVVEKAYDSLNRILNLTKLAKKATKLKEAASPP
FT                   LQSPAGGLASAARKLNNTDVVNAQAFKDTVKSTIRITGNTGNKNITVTNLPHINDTFKP
FT                   RQIKFWAIIIPSIISQCYRTDEELKAATSTGENLGLRALALALHTQANELNRAVDNPGS
FT                   NDNAANVLKHKAGTDDQTDGKLRKLAETLYTAASQLASAVQAGPDTGKTEAEQLANEVG
FT                   ENEEGDKLRAKLKDLGNYTQDTELTTKAGEVKTKYDAVSRAFTQVQLKEDKYTEAGHQD
FT                   KYQAVEKAWDAFNDVYKPEELLVTAVGEEITLGDNLASALKELGTASILDIKGLNTKAN
FT                   AVKEKFAGWGPSVKQKFELVQAQESAYTSGGIKSTKYDPLEQAFNNFNTAYRKAICGPK
FT                   FYSIIVPSIISMLSECPPKTEFVGSLGGFGGWKQYNDGGNTVYGQIWHFFDILIVIKFT
FT                   VAIIFIYSLNYRELHSY"
FT   misc_feature    complement(759349..759417)
FT                   /note="1 probable transmembrane helix predicted for TA14130
FT                   by TMHMM2.0 at aa 622-644"
FT   CDS_pept        join(761846..762457,762490..763239)
FT                   /locus_tag="TA14125"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74375"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW4"
FT                   /protein_id="CAI74375.1"
FT                   /translation="MLNVTKANLLKNQAAGMSTDAGTLHDNANQLASQAKGASALDPEA
FT                   LKQKAGENDSDPDKLRQLATTLHDRANALYSAMGSDSPPGKAEAQALAAAVGPEDRAPE
FT                   DGKPNTLRQALAALGDDKGTDPGQLPALANVVKEQYDKVKLLYAAVQKQKANYTDDKGQ
FT                   AQYGRVVTAWNAFNNLYQEAFKAEISTQTFPSMMSMSLLLVTAAQALKEMAQSVGTLSD
FT                   LGNKAGTLASEAGTLAGGTASNADNVITNYNTLEGTYNGLSTPTEKAKVEKEFGTVKHL
FT                   YDRMLNVTKAKKLKDAVGTGSGDNKIWHKASQLYEKANSLAEASNLRAPEDQQPDTHKE
FT                   LRNLAETLRDAVGESTSSGLQKALTDLNGARTDDPKDLITKAQDVVTKYNAVVEAYDNV
FT                   TEKEQSYTAALGGPGGDFAAKYTQVESAFTALQTAYNLGKCKAIVPIFDKPWIR"
FT   CDS_pept        complement(763261..764820)
FT                   /locus_tag="TA14120"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.337 - hypothetical protein, similarity to
FT                   T. parva fragment"
FT                   /db_xref="EnsemblGenomes-Gn:TA14120"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74376"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW3"
FT                   /protein_id="CAI74376.1"
FT                   /translation="MSTYLTSKASDIKTKAQALKSTAETQSNSELGNTNQTDLQQNNNH
FT                   PQTNLTKKAEQLAAKAQGLHTAADGIVQAAKQGSPLQPLNETAQKLKNAAKGTSSGLYQ
FT                   AAETLANKAQQTEAAQTQATAVITAFDNVEQRYEALMDEYKKILNNKEKAVKLTQTDKE
FT                   KVIEVVKAYYVVKTTYYQMLIVHRIQKKAIAFHGAASQLQSQAQPAEAPESPLGKLQKD
FT                   ANQEMADLVDAAKTLKDEAEKLDKAPDAQIVEKYLAVVEKYNELEVKKEFTDALEAKKV
FT                   PQVQNVKIKFDALQKSYVNVLRLRVQELSNMAHTLSGAAGTLSQDEQLRQKANLLKEAA
FT                   SNGNEGLKEKATALVSAINGSGDSDGTKAKLVIEQFDAVTDAYETLAGQPSYSAVLAKI
FT                   KQNPSSPSLPGDEEKVKDVYDAYTNLKTLYNKILNFTKMKKPATNLDNAADTLQKTPNV
FT                   ENARLFKDKYDKFKDVYDSIPPDIKATFQSDFESIKNVVCGVNLDKKYISYFSIFWTLC
FT                   NL"
FT   CDS_pept        complement(join(764908..765148,765251..765420,
FT                   765521..765724,765822..765904,765999..766071))
FT                   /locus_tag="TA14115"
FT                   /product="14-3-3 protein homologue, putative"
FT                   /note="chr2.cand.336 - 14-3-3 protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:TA14115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74377"
FT                   /db_xref="GOA:Q4UEW2"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW2"
FT                   /protein_id="CAI74377.1"
FT                   /translation="MSEDNHRSELIYTAKLAEQAERYDEMANAMKTLVETCVSDKEELT
FT                   VEERNLLSVAYKNSVGSRRASWRIVSSVEQKEASKNNTGHKALARQYRVKIEGELNEIC
FT                   NNILSLLNNKLISSTNESESLVFYYKMKGDYYRYVSEFSCDESKSNASNNAKESYQRAT
FT                   EIAENELKPTHPIRLGLALNFSVFFYEILNKPHEACEMAKRAFDDAITEFDSVSEDSYK
FT                   DSTLIMQLLRDNLTLWASDIQSDSVDDKQTKPDD"
FT   CDS_pept        766731..767078
FT                   /locus_tag="TA14110"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.181 - hypothetical protein,
FT                   histone-like"
FT                   /db_xref="EnsemblGenomes-Gn:TA14110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74378"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW1"
FT                   /protein_id="CAI74378.1"
FT                   /translation="MVKVMKENLKVKKEVKKDLKKKVVGGGSKKKASMKKLSGGQESKM
FT                   NAKMNQHRPKLNAKHSGKVAKKAPKAQKKGAKLNSKLAGKAVKRPGKVVKKAVKKMKPA
FT                   KKVVKQKGNKK"
FT   CDS_pept        complement(join(767535..767690,767755..767873,
FT                   768014..768640,768849..768894))
FT                   /locus_tag="TA14105"
FT                   /product="mitochondrial solute carrier-like protein,
FT                   putative"
FT                   /note="mitochondrial carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74379"
FT                   /db_xref="GOA:Q4UEW0"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEW0"
FT                   /protein_id="CAI74379.1"
FT                   /translation="MDSDPNDPLDWENWTGDMPFWQHAFCGSIAGVMEHISLFPLDTIK
FT                   TRLQTNSTSSYSINSGNSRNTLNSQCKSIYNGVKRRLTTYSINTKLSNPRGLYTNLFKG
FT                   SNVIIIGCVPAHVLYFTVYEKIKNSGNIAISGATATVCHDLILTPADVIKQRLQLNLHS
FT                   STLDCVVNLLKTEGFGALFRSLSITLFMNIPYHSLLVTIIHLLKKINKEDNTSNYKQFI
FT                   YSGLGGAIAGALTTPLDVIKTRLQTQTCHYNSHQPYYPLKYKNIIMTYKNIYRNEGLRG
FT                   FMRGMSTRVGMCTPSAAISWGTYETLKNLIKLLN"
FT   CDS_pept        complement(join(769265..769372,769467..769614,
FT                   769799..769860,769894..770439))
FT                   /locus_tag="TA14100"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.334 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74380"
FT                   /db_xref="InterPro:IPR018800"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV9"
FT                   /protein_id="CAI74380.1"
FT                   /translation="MDWLNSALSDSDSDDSDHSANNNLNDHNINTSTVDNSDNTDDNVN
FT                   NSTIVDNNNNKISNINDDNKTDNSKVEEKDIICKNKVEPAEVGKKDKSGGLFTINRKLR
FT                   RIEKFDNVKIKSQELTESDLLESQPSNTDDKLNNLPDSKPSEINDDKEVYEEGIDYNEA
FT                   MTSFNKSNVNFDKLLKSSQWLGPKVKVTDIKADDLLLSKLDKERNYTCNKEILYEGVKR
FT                   FNMPTRLMETEDGQVITTNVARRTQKRKHQINWLAMEAQDKEAEIMEQTIHMRKSKRET
FT                   QMKYGW"
FT   CDS_pept        join(770462..770531,770572..771294,771408..771553,
FT                   771679..772129,772174..772646)
FT                   /locus_tag="TA14095"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.cand.1391 - GTPase of unknown function"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA14095 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.944, signal anchor
FT                   probability 0.000) with cleavage site probability 0.365
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA14095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74381"
FT                   /db_xref="GOA:Q4UEV8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV8"
FT                   /protein_id="CAI74381.1"
FT                   /translation="MFFTLLTLFLIYSQNSSYNYIIKDFNFFFHFTPFNTHYRQFIAKS
FT                   SDSNSNTTNLSENEKIKQLLLSVKEWEDSNKSSKNDSLSSNSNISVNDLVKLEKKFLES
FT                   IESDENSTFNRIISEKIKETIKEKEEKKEKTVDWRDLVQEFRLIGAGKKCYGCGVNLQF
FT                   ANINKRGYVQECYYHNDLAKCERCSSLSSDIKSSLIKNTSGVDGNNLNLVSENLIREAS
FT                   SETINIVRNMLRIKKRRRITILYIIDVVDPHIEFKLLEIIKQREEIGGIRFYLILNKID
FT                   LLPKYNRDELVQFFKKMINSKVDLLKSKHIFTISSKFKKHVSELMSVILEEAKRLGNQI
FT                   LFIGPTNSGKSTLINLLRSSLKSKSRSLKNAKSTNNVIMNGSNSLMGKRLTSSIIPGTT
FT                   LGVINISLGDNLSIYDTPGIFVPNSLISHVNGINLKDIITQNICPNTPIRLKKGSLTVS
FT                   LFSSHIDIVTIGYSMLIDKYVRIDMTSGRDVFFKCYFSDKLKLHIKPTHKINQFLNKHY
FT                   SDQFLHYPTTQHTSITSDDTVNGVDNVNSNNSTNDNWVMRRMNIILNGWDNATCDLCIK
FT                   GLGFLTIGGALSADFNLYTMKNILYYLRPPLFPKNIFPFVPRKS"
FT   misc_feature    770462..770512
FT                   /note="Signal peptide predicted for TA14095 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.944, signal anchor
FT                   probability 0.000) with cleavage site probability 0.365
FT                   between residues 17 and 18"
FT   CDS_pept        complement(join(772772..773025,773194..773395))
FT                   /locus_tag="TA14090"
FT                   /product="T. parva transmembrane protein 17 homologue,
FT                   putative"
FT                   /EC_number="5.3.4.1"
FT                   /note="chr2.cand.333 - thioredoxin, signal sequence,
FT                   transmembrane"
FT                   /note="1 probable transmembrane helix predicted for TA14090
FT                   by TMHMM2.0 at aa 111-133"
FT                   /db_xref="EnsemblGenomes-Gn:TA14090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74382"
FT                   /db_xref="GOA:Q4UEV7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV7"
FT                   /protein_id="CAI74382.1"
FT                   /translation="MAPAWESLAKTLKGQVNVADVDVTRNLNLGKRFQIRGYPTLLLFH
FT                   KGKMYQYEGGERTVEKLSEFALGEFKNVTGVPVPQPLSLFALVSDFMVSGVNEALRVYD
FT                   AALAGFVTISSFSFLFGLLVGLMLSLFLFTRRATRKPKVLTERKKDK"
FT   misc_feature    complement(772829..772897)
FT                   /note="1 probable transmembrane helix predicted for TA14090
FT                   by TMHMM2.0 at aa 111-133"
FT   CDS_pept        complement(773480..773740)
FT                   /locus_tag="TA14085"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.333 - thioredoxin, signal sequence,
FT                   transmembrane"
FT                   /note="1 probable transmembrane helix predicted for TA14085
FT                   by TMHMM2.0 at aa 46-68"
FT                   /note="Signal peptide predicted for TA14085 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.951, signal anchor
FT                   probability 0.000) with cleavage site probability 0.316
FT                   between residues 16 and 17"
FT                   /db_xref="EnsemblGenomes-Gn:TA14085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74383"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV6"
FT                   /protein_id="CAI74383.1"
FT                   /translation="MNFPILNCLILFTVLSSETTNVKLEREDQNHLVVLNEKNFEKLTQ
FT                   SSTGATTGINYKLFIYLLIIYIFKKIFYFMENYKVNNTVKQ"
FT   misc_feature    complement(773537..773605)
FT                   /note="1 probable transmembrane helix predicted for TA14085
FT                   by TMHMM2.0 at aa 46-68"
FT   misc_feature    complement(773693..773740)
FT                   /note="Signal peptide predicted for TA14085 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.951, signal anchor
FT                   probability 0.000) with cleavage site probability 0.316
FT                   between residues 16 and 17"
FT   CDS_pept        complement(join(774033..774187,774316..774758,
FT                   774892..776051))
FT                   /locus_tag="TA14080"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.332 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74384"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV5"
FT                   /protein_id="CAI74384.1"
FT                   /translation="MECVSLGDVTDCDVSDTFDCVSLKDSDLNFFDRNLEFFESLNLRG
FT                   LCSFLSSLYNFVRLNFLSSRRPTRFEYKSGARKLLKSLKRLFPKQQRTVTFDLKSQNTT
FT                   NSEDKLDLLFDFFVNDKYLTVVSSFHGCNLKVTTIQLHSNFNVNSNYISDELGYKVNKL
FT                   GTNSSVLITSLTDCKITSLCVNDLLALGFEIFVSFSNKYVAFFRVNTFDYNKSPEFSLS
FT                   SAVNVTGFLQLKRPAVFSKYSPNREMVLVATDTQVYLLEKSGFDVEYEKLAEFKPGSLL
FT                   CTDFLNDFEILVLENNFILTVYKKYNLKYHRFIKYNIKSLVTGSAVNTVSPGLGRFARD
FT                   YMGNLYLLVKNMNLVKFTWSESILPHSNQLYLQPPNDLFHIDKSFSTLVYNFCVENNLV
FT                   VVTFENSECVHLYGLTSLKELYHLKPPVQGYLPRLVSTSSSNNYCFIVVLWAHSSNFTT
FT                   ALGNDLNPLIQRNVLHRDLIKAYRVKSGLTKDPVTDEPPLSYHSTRPDFTNISTVPNKM
FT                   NKLPILSSLHPKISFNTRRNDYKKYEDVFGYRRNFLGRSLSDHSLRQPHETVYSLEEFI
FT                   RNRHKPNFY"
FT   CDS_pept        join(776813..777155,777247..777689)
FT                   /locus_tag="TA14075"
FT                   /product="proliferating cell nuclear antigen 2 (PCNA2),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74385"
FT                   /db_xref="GOA:Q4UEV4"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV4"
FT                   /protein_id="CAI74385.1"
FT                   /translation="MFECKLDGMFLRRLFESLKEICGDVSIDCSDEGLTMQAMDNSHIS
FT                   LIHLKLAPDFFHLYRCDLPCTLGLNISFMLKILSVVKEKSLIYLSRGDMTEDPVLNIRI
FT                   IEDVGANLTLESDSLEAQVKLIEVDREHLEIPTCDYSCKCVMNSKKFQEFAKYLHSIGE
FT                   TVTISMTENEMRLETEGEGIRASKRFHSDVGEVRVTSLENLSQIFATRYLVLFSKATNL
FT                   AEQVSINLSAGIPLSVKFGFGDEEDSSFINFYLAPNIEE"
FT   CDS_pept        join(777908..779380,779461..779568)
FT                   /locus_tag="TA14060"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.184 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74386"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV3"
FT                   /protein_id="CAI74386.1"
FT                   /translation="MKEMTVGDRVLEGDSLGTVSSEPLKCEENHKNSVCDCKLLVKPDD
FT                   LTNGELEEGSKKLENFKKIKVKIFEYFDKIKENSMNFEELTRILSERFDFHDFSNPNSC
FT                   VNLDSVSLGSTFEREFRNKYLNTDEELEAEDSGVNYEFVGMEKACNFFSDPKKLITVTL
FT                   NDCKISQIGTITEFPKCTELFLSNNLLTSSEVNKLVEYFPKLTVLDVSENKIDKPINAP
FT                   SVKTLIMNRVFVEFELVLETLDRCVNVTNLIFSDNMLDEVVFKGKTYPNLTAIDLSNNF
FT                   IYSWDSICNLFKIFPNLEKLFISHNLLHNLDSNSMEFNSLLELDISNNLISDIDVMVKV
FT                   SQAFPNLTSLKVNSNPISPNFMEKYSNLPYIKSVKGDKNDEIIRMYMIVTFANLKVLNG
FT                   TTITGEERTNSERYLNYLEDKEQGEETKTKVNLEKKNRIKVLLVPDGDSESFLYEPVEK
FT                   KLSESCTVSDVKLLCSKLFKMNLKDIKLVYNNKMMPLCEEMDDDSAELCRYGISDNYQI
FT                   RVQNKNIKF"
FT   CDS_pept        join(779700..779919,780002..780070,780147..780212,
FT                   780241..780383,780413..780513,780544..780877,
FT                   780909..780999,781040..781296)
FT                   /locus_tag="TA14055"
FT                   /product="cyclophilin, putative"
FT                   /note="chr2.C.cand.186 - PF00160 Cyclophilin type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TA14055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74387"
FT                   /db_xref="GOA:Q4UEV2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV2"
FT                   /protein_id="CAI74387.1"
FT                   /translation="MSEVYSLEPSCKGRVVVNTSLGELDIRLWSSHCPKACRNFVQLCM
FT                   EGYYNNCIFHRVIPNFMVQTGDPSGTGNGGESIYGEPFENEIVSRLKFRNRGMVAMANT
FT                   GGKCSNMSQFFITLDRSDFLNGKYTLFGKVEGNSIYNLLKIGKSEVDKNDRPIDPPKIL
FT                   SCYVVENPFDDIVPRLLQLSEPEEEKQEEEVTTTQTKDKRLLSFLDSDDEEDQSVKIKS
FT                   AHDLLQDKSLSKTSVQIKETPKSDQPDEPATAEELEDIEDEVNEEVEDLNEEDEMRKKE
FT                   INELEKKLIDNKDDLYNRKKKKKTKHDPKETLERLALFTKKLGEISKNEKLANKQPETD
FT                   EDMSDGSWFAGTKLQFSIDSNRAYAYDAGRDTVFLALNFIVQLDVYDPLKGKDNKLNSI
FT                   KNIRRNVFLDYLTQEFLVNNNYSCLSR"
FT   CDS_pept        join(781561..781663,781697..781732,781787..781878)
FT                   /locus_tag="TA14050"
FT                   /product="ubiquitin-like protein (NEDD8 homologue),
FT                   putative"
FT                   /note="chr2.C.cand.187 - ubiquitin-like protein nedd8
FT                   homologue"
FT                   /db_xref="EnsemblGenomes-Gn:TA14050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74388"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038738"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV1"
FT                   /protein_id="CAI74388.1"
FT                   /translation="MQIIIKTLTGKCQSLNFEPTNTIADVKDVLRERECIDPGQIRLIY
FT                   SGKQMSDELTLNDYKVVPGSTIHMVLQLRGG"
FT   CDS_pept        complement(join(781897..781988,782029..782109,
FT                   782276..782495,782584..783369,783403..783630,
FT                   783692..783694))
FT                   /locus_tag="TA14045"
FT                   /product="U4/U6 snRNP-associated protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA14045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74389"
FT                   /db_xref="GOA:Q4UEV0"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR019175"
FT                   /db_xref="InterPro:IPR027105"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEV0"
FT                   /protein_id="CAI74389.1"
FT                   /translation="MGTLADSFLADLEDLENEDNEQENSDLNKGLNATENFESDEETPI
FT                   VDAVAEYFNTSGSSENSFSTLIKDPEINSIVEKAKLLSLSKDVKATEISFIDECNKTVI
FT                   KIDKEIINIFNYVRDIYSKRFPKLESIVYSPLDYIAVVKRAQNESDFTKIDLTDLLPNS
FT                   MIMAVTVASTVASGTCLSTQFLNKVVSACNEGLLLAEFRNDLLVYLEGRMILIAPNTSA
FT                   LIGSALTARIIARVGSVENLSKIPSQNLMMIGADKNQNYILNGLHLNIINCFTLNDCLG
FT                   ILNNCDLVLNSEPSLRIKALRLVCSKVSLASRIDLFKQHKDGKMGHEYRKSILQSLAKA
FT                   VELPPAPMKKSLPVPEEKGGRKRGGRRHRKTKEKYSLGEFQKYRNRLKFGVDAEDDFGL
FT                   EMGNTIYIIILTLTKKRVVSMQSSGATNGMSSSLIFTPLQGIELCNPNMNREVKRKSVL
FT                   DNQDFLKVKKT"
FT   CDS_pept        join(783910..784380,784411..784521,784552..784673,
FT                   784736..785510,785541..785666,785697..785974,
FT                   786009..786120,786152..786228,786258..786792,
FT                   786848..787153)
FT                   /locus_tag="TA14040"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.189 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU9"
FT                   /protein_id="CAI74390.1"
FT                   /translation="MARVSTFDLYKNVRKVLNTSGSNLTDFCNVISKLTRDKSKRFVIN
FT                   SVDSIFEGIKIPEILEPKSPNESISVARSLIKVPKALFLPRNLDEDSKCQNLPKLLESS
FT                   LTQITDPRGKLSEINSFFTELRSTTQFLTDNSLQDNYGPLRPFVIDFLRKHEEELLGYE
FT                   ELGDMKKLRFCLTLMDVLKTHSMDSQKLHQKIIEIVEKTPSIVKQVPFETLTILSKLKL
FT                   PQNSKKYFKEHLQSMVFEDLSTIINYSRMVFTQFDDKSVLEAFLCSLKHKLRTEKCEGD
FT                   QLVLLLRNLKLLKNRHADEDLNSLTESLLELVYPRVSQMLHDSKNKVDSENVLAVFDCY
FT                   MSVCRNSSNIFLKNCVDGLINYVLENRGIFTPVQLITVLNHFHTGSNGTKILVKGEYLE
FT                   MNDLNDELTKYFLRELSLLEFKDFCELLYSIPLNDYFKLYHIMSSFPLGSNNPLTPEEE
FT                   VLRVKVKEIVKRRIIHNLDNNNNSQLYNKQISNIMLYKDNDINAFFESNIENITETLSV
FT                   NQLIQIINSHNHKNLNQKVLNGILSCLEKKMIGIGKLDVLTKLVERNKLIKTNSNLTNK
FT                   LFSILVYKLINSKNGYVQLLQTLAYLSNEVDSVLVNIVVQYYRRYLVHLSVYDIELLLL
FT                   CINKYNLVDSDLLSLLNHVYDINISNIPNQVLINILQNLKNLKVRHDPLVKKFTDKLLN
FT                   NFKSSNYVIHDLISLIDILSALSIPYNDLYIYLLNYLSAVSSGGSETKPNHFNSLKVRD
FT                   KVDLLHSIANFGIVDQNLKKLYLSVIDQLYPETDGDEAKDCEGGSLTQKTKPDEPKDNN
FT                   MLLKLYEIHIDLVLNNIYNDEVEFLGKKLEQASKAWFTRQELKAHNFQKSNTYITVKEA
FT                   LEKLDVKFDSGVTEIYFCNFVIKEKGTVIQVIPVEDELRFWTTNLDSRNLIENSKIFMG
FT                   NSQKVIKNLKLSGYQVVELSQSKWDSMDQERTEYLQNLLK"
FT   CDS_pept        complement(787259..788080)
FT                   /locus_tag="TA14035"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.330 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14035"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74391"
FT                   /db_xref="GOA:Q4UEU8"
FT                   /db_xref="InterPro:IPR015267"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU8"
FT                   /protein_id="CAI74391.1"
FT                   /translation="MNSSKVCKALDEINIDEEYWKLKSDLLKEFTSKEDCVPGAAYKQI
FT                   LNGVLDVLSQYEDIDKEVKLNKECFIVIEDIATTGKCRYPWKVVKMLIVVVYNKLFDEL
FT                   YQSNRASKGVQNSATTGTDSSEPSDSSTDSEKPKESQPANNKINQLESEEEFRQLKIDC
FT                   LVHLVEFDIPPFTLQRICEIPLKQPYTVFRKLFNAYRKLFNVRNIEYEPIKMPEFFNPS
FT                   DHPQLDRVYSILDSWEAKYRNLAPEWSDELLFDNSEDFESSDEKPFKRPLE"
FT   CDS_pept        788958..792293
FT                   /locus_tag="TA14030"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.191 - possible signal anchor,
FT                   transmembrane protein"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA14030 by TMHMM2.0 at aa 12-34, 39-61, 68-87, 91-113,
FT                   126-148, 158-180, 234-256, 276-298, 305-322, 337-359 and
FT                   799-821"
FT                   /note="Signal anchor predicted for TA14030 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.954) with cleavage site probability 0.001
FT                   between residues 25 and 26"
FT                   /db_xref="EnsemblGenomes-Gn:TA14030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74392"
FT                   /db_xref="GOA:Q4UEU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU7"
FT                   /protein_id="CAI74392.1"
FT                   /translation="MKKRVPDAGDFLESYFLGLSCLVCSEQFYILISQTKASASFQWYL
FT                   LLFTAFATLTSVLILYEKTHDEFITLLHYYYSCLLAFLVGFVWIKITSVLVSTCTTIVI
FT                   GFLTTSLIIEACAHYSSNAKLLLSFIAGLLSARILPSFCWILTSKEDYESQSMSISLIL
FT                   SIARFSSCLLSICMKFIKAELSFAKVKSIKFESDQFSFKFCPEAFSKLYEFYCQRITTD
FT                   LKEEKEIYLTIYSYIKYFFPIFCFFCSVVFFLPLSPVMDAHLNRRSKFMYAPHVIRSLS
FT                   IFETASHLLGFSIGILFPASISCNLSFCFINILNISIRLFVQERFSFFLKFFSNIGIYL
FT                   MVIIYSTLNGYVCSYDLFVIRNTFHNCKKEDSEHTCCGDKFLTQCYCRYPAIIDERNKC
FT                   IYSRTNLCNSKSYVAFLKNCNSMNLILNFSSLTHCYPFNRFSCSESFCKYKSLDYCSSG
FT                   PNAILLVQKDKKKEMSEMCKRICCEGNCCETPCQKEKCGCLRLCGMYEIETVTTSTCDD
FT                   CQLTVRIEGTKCDICSKCSEAGSSGTCSCNGKGSNSCCVCVKCCDKNCCTKSCTDEKCC
FT                   IKLCCCKNCKNSVKSNGTRVFLFYENNDVCCIREIKPDTTPKFDGNAKAQCTFYISSIF
FT                   ISDCCHSDIQVDLHCKMSNNFFRVTDIKYPKKTIAPTSVQLCQNNKQCCEKKEEKQCRC
FT                   ASALKKVIVEYPSEDPKSEDEKCNCPASCTKCSCCQPGNCSCTPKSNESNCCKCSEDGC
FT                   PCSKGDSSCNNGCCKDGKCCCCFCAKFTISPDNSFDKRMKPVKIKLISIFWILFFLILI
FT                   LTYLIMSSIKVKELDYYDFKPVTSYEMITSKTKRNALNSPDDVKRRIDEFLMNSGLESK
FT                   EYDSELEHMLKLFECTLDPNNFTFLKYHLDEVSLKLLNNPVFILRTKIEMVTWSCCLGF
FT                   MYTYIIEMLIRIQSFFVNWEYVWEKEYKYYRMKMANRINQFTRGSKFGVAALSESDIGL
FT                   KTYMLIGKSRKDTLEGLSERVESYLDLYDGEIEIKEKEFPESLDERLEYFISIWESRID
FT                   HLEDWITSRTNVFDWDIFMEQYPDIRTWVNMFGRYIQGALNEVEFDEKKFNKGTEVFLI
FT                   DKIN"
FT   misc_feature    788958..789032
FT                   /note="Signal anchor predicted for TA14030 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.954) with cleavage site probability 0.001
FT                   between residues 25 and 26"
FT   misc_feature    join(788991..789059,789072..789140,789159..789218,
FT                   789228..789296,789333..789401,789429..789497,
FT                   789657..789725,789783..789851,789870..789923,
FT                   789966..790034,791352..791420)
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA14030 by TMHMM2.0 at aa 12-34, 39-61, 68-87, 91-113,
FT                   126-148, 158-180, 234-256, 276-298, 305-322, 337-359 and
FT                   799-821"
FT   CDS_pept        792617..796123
FT                   /locus_tag="TA14025"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.192 - signal peptide, transmembrane
FT                   protein"
FT                   /note="13 probable transmembrane helices predicted for
FT                   TA14025 by TMHMM2.0 at aa 20-42, 57-74, 79-98, 103-121,
FT                   128-147, 151-173, 185-204, 224-243, 318-337, 385-407,
FT                   414-436, 859-881 and 985-1007"
FT                   /db_xref="EnsemblGenomes-Gn:TA14025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74393"
FT                   /db_xref="GOA:Q4UEU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU6"
FT                   /protein_id="CAI74393.1"
FT                   /translation="MELEVRRTTGSSAKGIKRSIGISYIVEPFLVGLCCLIGTDQFDIL
FT                   LFHTDISIKFQYYILQITVILTLLGSVLINFENNFILNIFYFSYTMLLVIIHLSRVKFI
FT                   YSFIFGLVFLVLDYFLLELKTDNFANYFILHVGVLHFLIIALVKTRINSAFIITLHTIC
FT                   IGYSMTLIIIHSCSYYSKYNSGLVWFVLGLFTARSLPQLLWSFRDGDLDREIQVQSFSE
FT                   SLAIWRFVFCFVSFIMKLTMGKANFYTNSEGGTKYFEKICDKLKKAYEPFCDKKKDFKD
FT                   NFKELYKHTKDFYMFNNENCNNNGECSWCMPFLEKIFYLCRLYPFFSFIFTGGFILKSP
FT                   PLTHLIYCPYSSHQKLIIDNINRISFLIGCCFGAAYPASVTGNHYYYYIITFSVYLSHI
FT                   VLSVTLAYIGQFLSLYILYTIASLSGFFLGYTFSYSLGAFTNSILIQTCRREEFDNPFT
FT                   SEKTDEKLMPCCGDKFNNECYCKYPSIIPVHQTVQMPLRCSKSIFECRSLKYDPNGCNA
FT                   IIICDNDAKITNCTKSPCEGVCCTETDCKCLRLLGVYKLEAVSTSACAECQLTVRIEGT
FT                   KLECNSCGGTCSSGNSGGTCNCQNGDGTCCLCVKCCDKGCCTGCSQEKCCCIKFCCCKN
FT                   GCKSCKCKCNGKKKCCNECNGTNSKGSNGNCSNGKDSNGNCSNGKGSNGKEFKIENVCT
FT                   RIFICYKNCANNGDNCCLRELKPNSVDFDGMLDKFECFDIRYIFFRDCCHVDMQIDLHC
FT                   SLRNNYFRLNGVNYPKKSNDSKTLKFYGRILKSCKQPEKQCCCLFRKITKLFLSPEDCD
FT                   PEKKCSEDCTGSSGGCCTCPNCLLFCRLKIDKSGSFVKRVDKFRVKFIVISFVIFALVC
FT                   LMIESLVMISRYRNRPAIFNPNATYEQITKLVEKKNFNSVEQVSARLTSLMNVNKIAEG
FT                   ANDEKINHFKKMSEVLKKHMSEPEYLKLYSHLENVSLTFLSRSNRTEFKSLEKQVILWS
FT                   HCVGFFYGYAFPLFTFIQEFFTKWDMMWNIEHENYIRVVRPRLNKMSHLSKYSLTLLDV
FT                   LTTSDKTVRSIGMTRTSSWVGVMEELKWAVKLDETEKGVSDLPLATSMGEKLERFLKAW
FT                   LHRQTYVGSWITKKTNVFDWAGFTSQYENIEKWIEQVSPYLMLGSEYVNIQLNELNQEV
FT                   KS"
FT   misc_feature    join(792674..792742,792785..792838,792851..792910,
FT                   792923..792979,792998..793057,793067..793135,
FT                   793169..793228,793286..793345,793568..793627,
FT                   793769..793837,793856..793924,795191..795259,
FT                   795569..795637)
FT                   /note="13 probable transmembrane helices predicted for
FT                   TA14025 by TMHMM2.0 at aa 20-42, 57-74, 79-98, 103-121,
FT                   128-147, 151-173, 185-204, 224-243, 318-337, 385-407,
FT                   414-436, 859-881 and 985-1007"
FT   CDS_pept        796456..797796
FT                   /locus_tag="TA14020"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.193 - TLDc domain in TBC and LysM domain
FT                   containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:TA14020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74394"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU5"
FT                   /protein_id="CAI74394.1"
FT                   /translation="MSSFDYKYRLTPGAIKEAVLSTFQSDISDSSPKNSSESLSPTSSQ
FT                   NETIVFREKCQYCIISRSILGVLTLTRESLTFEPDIRDVNVDEHGQGYYQIHVDMENIL
FT                   ECGCIGGPSQELLGLEDMRCNGFLQVVLRQFSDSFDLLYQSSGSSFESAYQEPIQERSK
FT                   KSMGFNFSKIGSAIFSVLPGTKGRNSKLFKRSHSHVSILFGFFNKELAYMCTNKLMALL
FT                   DMCNNSTPSSDRSRIIRIPFSSNSLIESWNNLTDTAEELDEPNDKYVNFEHFSAVGNRS
FT                   KILTFDMVKNLNSYLPASIAIREWILSFETVHDGISYHTFYKNLENKDNCIIVIEDSKG
FT                   GVFGAFTPQIRYNLRFYGSGETFVFKFQKGNLKVFKSQGKNRCFIYSSDHSVIIGGGNN
FT                   PAITIGRAFKVGTTAHSETFDNEPLSEDYHFEIKHMEVWTFGGFLTS"
FT   CDS_pept        join(797914..800400,800479..800788,800859..800974,
FT                   801044..801355,801387..801569)
FT                   /locus_tag="TA14015"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74395"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU4"
FT                   /protein_id="CAI74395.1"
FT                   /translation="MYTHTLVNQKNTLVKFTKSSKLNENHENHAGNEDVSLDSEEWDSS
FT                   CSFNLNSKDLHECLSSLNSKVEKSLEYLLKYGRNKQFSSEVNYFIKLLKDFLKNSKIEE
FT                   KSRNLLEISLLILIFLKDGDKGGNEVDFSRLRCTQEFEHKFDLCPEVVNALVNQRFLFE
FT                   NVADESLNFLVNICLWAIETSKAPNVVQLCYEILVLSIKLGHRSKLILPYIENVLSSSF
FT                   VICSTSYSEAQYQKIYWSIRILQAALARNIINSKCFERVLEFGLNSTKLQNKSIYILNE
FT                   AACLLAQLWLIEPFEFDLLCEDKLKLMVLSKLLAVGDESFLQFFSMDYLVKLAVAGPID
FT                   LRKLAINCLNLRADTRQDEIFNSKIDHLTYKNNFKHYKSLLPRIDLGILTVKAKFLPNL
FT                   KGSISYLHSLHNLLNNIFYLRRPRKIIIYENGHGIIKPEKTEYTKFIVQVNNVMSGKMS
FT                   KGRFMEWLKWIKINLKRNYYSIFQVVNAIIATRSVMYSLNSMGIKVQHTDDLSIYFLLR
FT                   LDGTYRSICRDYIGCLTISSNHIDFSFITYIIETIHKSLHARIISRIVVKTLLIGVCEY
FT                   LEILLKCNVRDIYGINYPRINEMCSEILVLFEELVKSRVSRADFGLLSHVVSVLKLVYE
FT                   YDESTFKRVVSLFLRIIRIYEERDLSLDAKYRERIDGCKKDLKSSIIDLYLALSTGKLP
FT                   FKIHERAILELDKCQNVVNLCVGLMNSVSLYSNKELIQTLAFQLSLLQVQDFDSKSMKT
FT                   LKKLANVVFMKLNRDNCTIVTYYKGRNMFEFKSYKFKIIRDSINKCISQLINLHLQSVS
FT                   QVYEIKLFNPDYTVCSDFMILTRFRLVGVSSDVLSSVPWAGTSRLVSIMDQVVQRGPND
FT                   QKTWNILTRRADLIMDSFSSNNLSRMVVLLTKSPLSDVNFKEKLKKQSLKMVQESDLLS
FT                   CCGFLFGFSKMGVSDLEIALKFREKIIEQLSSAKNSYPLALILSVYCKNKDEKMVKLLL
FT                   KELVGHMETMTPKSFSMVITDVLSNFNSEEIFSGLDPFIIQSLKCMKDMDLRSLLQLYS
FT                   VFCTTNHPLKGEYLQNLSRNISPLVNHATLHQLSVILRGYSKSLVDTELLQLTLASLKS
FT                   KYSSGELQELLFILSHLLKLNLTGNSPI"
FT   CDS_pept        complement(join(802152..802462,802492..802681))
FT                   /locus_tag="TA14010"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.423 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74396"
FT                   /db_xref="GOA:Q4UEU3"
FT                   /db_xref="InterPro:IPR013924"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU3"
FT                   /protein_id="CAI74396.1"
FT                   /translation="MDVEVNILPCLIKYNGPTEFRKRFKEKIRTLSQDSSDSSTTSCTT
FT                   DSSNSSDSTDSTDSNSIPGGFDIKEICGSCTNNVNFSVKVTEKLIKDVYYPIRGVDKLL
FT                   KDKYYVLFRGRQMRGSRLALEDFGYNMSVVTKDNRHKESNFSKNTSTESTYLIKTANIS
FT                   SIT"
FT   CDS_pept        802915..803772
FT                   /locus_tag="TA14005"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.196 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA14005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU2"
FT                   /protein_id="CAI74397.1"
FT                   /translation="MVNIFDEVRIIFRGPCERLFIAYKPFGWHVCSPQKKKFSESLSSV
FT                   IGASLGIPEDSIKFPSKLKINQNGLVIGTTDSAMYSQITRIIENKQCTKCYTCLIDTNS
FT                   SIFNHIGKGISELNGTIRFNLLQKKSQFEPNLHISNIQVTLEDSILSQDTGLKSMKFKL
FT                   TSLEHLSNPENAMNWPETNMKSLSTYTNLLENNYSLEFQNKCLFELQNKYLLELHNKYL
FT                   LELEVNDKILDKNLEEILDQLGINISNKFHTITLNTIQLPHPILKDKIITAKINFPLEN
FT                   FLSI"
FT   CDS_pept        complement(join(803839..803991,804023..804144,
FT                   804307..804376,804408..804520,804605..804704))
FT                   /locus_tag="TA14000"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.422 - hypothetical protein,
FT                   conserved, pfi0770C"
FT                   /db_xref="EnsemblGenomes-Gn:TA14000"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74398"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU1"
FT                   /protein_id="CAI74398.1"
FT                   /translation="MLKISNLYRSQKVCDALVMFGAHIYRIPFVSHPGVMAVAQLLEMK
FT                   SLVEHRAHFTQEDVNRMYHFDSELAKKAQVAVDHNLPISHYNLDYLHKPGFLESLLEER
FT                   KLNEKIANEVLSAPEGDYKQPESLKSYKSITVPVEWRQHELAFTDLMVDVQPSIKREME
FT                   TQAKMRKFVEEHEKTFKTKSNN"
FT   CDS_pept        complement(join(804823..804885,805028..805354,
FT                   805383..805595,805675..805782))
FT                   /locus_tag="TA13995"
FT                   /product="casein kinase II beta chain, putative"
FT                   /note="all_bases.C.cand.421 - casein kinase ii beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13995"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74399"
FT                   /db_xref="GOA:Q4UEU0"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEU0"
FT                   /protein_id="CAI74399.1"
FT                   /translation="MEEEYTEWDQFSSESCETLKWIPWFTSLEGHEFLLEIEESFVRDQ
FT                   FNLSGLKSLRNYNGAMSMILGPAPTEEVFMDGKFLELYMNATDLYGMLHSRYITTPIGL
FT                   RLMREKYQQGVFGQCPRVECQRQNVLPVGFSDNLHNHRIKTYCPRCQEAYVIRSGEVHA
FT                   DIDGAFFGRSFPHLFLLTFPNLIPDQPPVPFVPKIFGFKVHNINSLIKIKLENGEFGKI
FT                   QDQDSNSQDDMKVD"
FT   CDS_pept        join(806156..806564,806616..807971,808011..808430,
FT                   808479..808952,808987..809019,809141..809385)
FT                   /locus_tag="TA13990"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.197 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13990"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74400"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET9"
FT                   /protein_id="CAI74400.1"
FT                   /translation="MYSNNLNILRLYNIILKYKTPLKYSYNTIHTVYDIKDKRDETDSI
FT                   GFDKNDLRKTWTNKDDIYQEFLDIDLFKPTVETYKVCKITNERIRVNLPIDSLEGYELI
FT                   SAIANLIGISDITLESFSNIEISPNLDKKLINKHSIMILFIFDSHELRNLIQSYMLINI
FT                   HKFTPIEIIYTFKAFSKYKRYKSFLNLLCLMFYDHMIPNFTHNSNLRSGNLVRLDNSNI
FT                   RSSNIRLDEIILFLKVLKDFKFKKLTDVLYSHIYDHIYSINHNSSLNQPITSSIENTVE
FT                   NSMENDVENDVEKISIEDLILINEIFFKYKRDPNFVELYTKIHSIIFKIPLLDFYNFEQ
FT                   YTLKQLNLYNSSVTVLGPTGTSTEVTGTKDSSSSTCTIGPSTLTEGKGANSTAMECTMA
FT                   TTVRDTSTNGGTVGASTVTGVTENLNMLKCIFGCRSEFLISSVHHRIEFKRLWKYNIIN
FT                   NNIPWKFINPVTVLGHTDSTVVPGTSTTGTIGASIVTEGKGANSTGMECTPGKGANSTG
FT                   MECTPGKGANFTAIECTGEKIPNKIAVVTKTRESDTFTKDTKEVGERVTTDGLDEGVGC
FT                   REPDTVTENLNIKNIIIRNFNYQDKTIEFITNLISTVLDYSRYSNSKNTFNILLNLYSI
FT                   VGNFNNIKLSQLKLIIPNTLRNNSHVYFYKIDPNKFFYQLHSKFNIEYTIDSVNTVDTV
FT                   DTTGDNTTVGDNTVGDRIYYYKCELPISLLFEGNKKKDLMYFLYVVQELLHPIYCFKLS
FT                   HMKPFLKIDLLHMCNKLNNENVLEISSKCVDTIEELLKTQFKNHLNNFIQFCTNILNDL
FT                   LESGEGRGDGTGKLGGQGQDGIGQLTDDPIKLTEDTSKMDNSYQMMEKIEILKTILILK
FT                   ICNNEILLHEFINSTEELLNHFKYTTELEIKVGMDLKLFDCVCDLMLIEFNDKAYHLLI
FT                   QLLKIIHQRIDYYDFPQHIKLINSILFSIKHFSCNSLVTVLAPTIVVK"
FT   CDS_pept        join(809964..810533,810793..811827)
FT                   /locus_tag="TA13985"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13985"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74401"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET8"
FT                   /protein_id="CAI74401.1"
FT                   /translation="MKNINSPLSCCILPDQNMNPVFKQQYVTEGGKMKMTVPLSPMHYI
FT                   TNAKIYTYDDRFPPRFDPTYGYFNDRICKARNVDYEYKQKFVTPTVSFTRPRRNLTAQM
FT                   NDNLNQGNLSQVIDNLNQDRNLIQIDNLNQERNLIQVNGISRCNSINFNQILTSINEKL
FT                   SRIEFMCKNNQEDIYELKQLIKSTQTKNVMNEGTKLVIRKLNPFESVDGKIIKSEDMCG
FT                   NSKNNKSLTNNTLINLVSDFTTHKTVDFTRDKIDTTLKTLDFTRDKIDSRDKTDSRDGM
FT                   DEISELKKSNDLLERYIRNVKIDDLCCLENKLDVMSSDFAKIHSEIQNFPDKPKDVSLL
FT                   SNLESKFKKILSKFDSNDSETSSKHNQHNDVETIKSVETTNLQEPVKSVESPNLQEPLQ
FT                   SVESPNTLESTDPPELDPDLPKLDSNSTETELNPTEMELNSTEVDNMIINPIESITSES
FT                   NDSNSTMCNKLSGCEMNILKGLPDEVKASLTEDEVKFLQNLKSQNLGNSNLIDVVGISL
FT                   ESDTNSLESHWIKSLDF"
FT   CDS_pept        complement(join(811911..812102,812277..812869,
FT                   813099..813184,813246..813367,813539..813709,
FT                   814008..814235,814396..815138,815298..815357,
FT                   815544..815682,815816..815873,815910..816454))
FT                   /locus_tag="TA13980"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.322 - hypothetical protein"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="Signal peptide predicted for TA13980 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.712, signal anchor
FT                   probability 0.009) with cleavage site probability 0.269
FT                   between residues 19 and 20"
FT                   /db_xref="EnsemblGenomes-Gn:TA13980"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74402"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET7"
FT                   /protein_id="CAI74402.1"
FT                   /translation="MFISCYFILICFIPLNSLTFNYKLFKTNSNQFNNSNHFRTNCYTF
FT                   NNLNQFRTNYYTFCTNIYNDNFNIYYNTNKNINNPSNERNPIQRDSIEWNPNVKNANVS
FT                   NTNLNNSFGNGFKIGSYMGYSEPLIFTQCSDPGKEHEVVVSDSQTHGINKVIHDVRRRN
FT                   NTNKPIFPVGSHVFIQNGPNNCGTVLFNKFTQIAKPYQVLIALDCRNNDGLIKENYLKY
FT                   HGTSHWIPEHYLTIDSKKFSNYQNTRMRKNVKPNHNFNYQTNSNQKMVVKEYNLIKRYN
FT                   DEILLSFSLNKIISLYQEANENHMIDDHTDLITLVQIARVFNLHYDSAYRNFTDSLENK
FT                   QVKRSKFKFTRYQINFLILLTSKIIQKLQINQSNVENTLKNIHYNTLKNIHYNTLKNIH
FT                   DNTLKNIHDNTLQNIEWNTLRNMYENIKEKNYSINDYIKLMWSSGMLLPLRFIRSKLLE
FT                   IFRLSEEKITFEDISKLELKELMKILHAYSFNTKNNKHLFNIFNIINNIPIQQIDPQII
FT                   ILLIRCFDKNKLDFGTLSPLIIGFVNNCEDKISKFMAGFMIKHLKNFQNFKPIIDKLFS
FT                   IIFSHEGDHNFFNTKDFYYILCSCIGNMEMFEKFEKLIYSMEIKLEPFTILKSLLSLRR
FT                   TTHYNMISFLIKMALKNIEEFSSSELNLLLKSVNNTNIPKDSIIDLYNKYMSIKGESID
FT                   YRNYFILLNFIYKHSLPFPQDIIKILNKLNEYNEFHISDPVFSCIELLEKISKKYEIDI
FT                   YKVSPRFVESLLNKFPTKKFLLPSTLGQFIYYISEIAPELLHKSISYNLSSHNTMDNLS
FT                   SHNTIDSTMDNLSSYSTVDSTVDSTLDSELANEQCEILNKKHEMIHIKALILLNKSMKI
FT                   IKESLSRSFNDTFLISIDENNIFNRTSSLQYNFMKWPILFLYLTVKNNLINEMNFPREK
FT                   LLNYLNFIKEGLTNLDLNLLKSTLDLLKLDTQQFNEIIQSIPKGINHI"
FT   misc_feature    complement(816398..816454)
FT                   /note="Signal peptide predicted for TA13980 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.712, signal anchor
FT                   probability 0.009) with cleavage site probability 0.269
FT                   between residues 19 and 20"
FT   CDS_pept        join(816656..817097,817325..818430)
FT                   /locus_tag="TA13975"
FT                   /product="peptidyl-prolyl cis-trans isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:TA13975"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74403"
FT                   /db_xref="GOA:Q4UET6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027799"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET6"
FT                   /protein_id="CAI74403.1"
FT                   /translation="MVSSKHRHSKDKLYLLPSELALTQAPVRSNRPSELVPLDSCFLTL
FT                   NPFSNPFCTINGHIFDYDKIKEFITLYGKNPINSLPLSLDDLFPLHFTKDENGFFQCPL
FT                   SLKRFTSNSHIVTVKPSGYVYSYNTLKEVAKKEIDGFMHDPITGVKFGKNDIITIQDPH
FT                   NTNLRTISTFKHINSYFKPKSTTQSTETNTKTTNTKSTQSLTTDNTTQSVTTESTETKH
FT                   GLLEEHLKIFKNDKSTDINRPKHELFTTGSQAASFTSTATTPSYKVEYRDKTVFEVRLP
FT                   LYDYVKKNKQKAYVKLVTTDGDLNLLLHTDRVPVTCDSFLQHCEDKYYDGCEFFRCVSD
FT                   FMIQTGDPTNTGLGGESAFYTRAKRANLAEKVPKYLRDEFDNTLYHVGTGVLSMANKGK
FT                   HTNGSQFFITFTTCSHLDNVHTVFGKVVGGLEVLRKWNYLKVDDEERPLNPPKILQTII
FT                   YSNPFEDAKVNISKELEEKKLQEKKRVLNSNTKWLLNPQDNTNKKYKSNKIGYLINK"
FT   CDS_pept        complement(join(818823..819028,819122..822884))
FT                   /locus_tag="TA13970"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.321 - hypothetical protein"
FT                   /note="Signal peptide predicted for TA13970 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.608, signal anchor
FT                   probability 0.000) with cleavage site probability 0.359
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA13970"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74404"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET5"
FT                   /protein_id="CAI74404.1"
FT                   /translation="MSSFGLSISSIGLSMLYEILVAESKYECRGVEYRSRLKSVYNQML
FT                   REHENHHEPTYKLTKQCFNKYIEALGDSVRVLDPTEIQSTDLELCYGIHQYVFPKIPEF
FT                   TLLDFKFLDRWNKFYNVLPAQFKQTERRIKRMNEKQKTYQMIKRRYIKDSDSSSESDES
FT                   NIKSNDPILITEHDFYTLESSVTVTGPPDSTNDSNSTKGANEDTSTVVPSTVTKNTTTK
FT                   DIKDTEGITGKDTKDSEDTNTKEAPFGAGTVGASTVTEEHINIDENMDIIDSNIIIPIL
FT                   TNKEVEINEESIVFGMMDEEKLNDWVSTTSFDNYLQLFKLIYHYDNTLDYFNTEINSSV
FT                   TVTGPPNSNGPEVTSMDTSTKDPIGPSTVTQGKGANFMVTECTPGKRATGTVGPSTVTP
FT                   GKRANNTFSTTPKGANSMGTKCTTTNSTNSSNSSNSKYDMLDINDFYKKSNPKVLSSNF
FT                   IHNLDHFDPNSIYGNYYLPNSSVTVTGPTATTVTEVTSTNNITTTPTGASTVTEGKGAN
FT                   STAMECTNTKDSKGVNTKETPIGVDDDEVDEDTSIDGPSTVTEDTVMEEIYRIKSYSIN
FT                   FMEVNTKYYYNSRGLFEVHSNAYIKEPFISRIMKGNIEQNTGLYQELQLLLKRIFSLKR
FT                   KITGNCLICSGWNLLHGIALTFCEYCEDKIYNSDPSILLKIYEIRRYLVSTVYPIVGYN
FT                   YNTTNLFINSELIKDWEHQLKLQNVSIQSLINVGSTFPKASLHDSRFLPNPILLPFNIC
FT                   NTINTFQFPKINHNTITNRDILDSSRIVDSSRTVDSRDSVDTADSMNTEDPVDIENDKE
FT                   MDIEYIKSEITTPNNYTSSNINNTHSIHSTSVQSTSSLSSTQSINSSTSSTSSTSTNSM
FT                   NMIGYNLMDIINYRRNYRGKLLNDFFEDIYNNYHSKLISQRSNQLINHYNYIIKSGLLP
FT                   STPNVILNSNFDGENTSTVVPSTVTPGKGAKDSTNSVDTNTKGNSSNSEGVGEGSGTVG
FT                   ASTVMENKNMKEYYDENVSYILSRLPLDNDLIKLSFYHRGIYLTKSNNLKTFNFIHIAK
FT                   IFGFHFHNTNGVSNSTVDGNGTMGTVDTKGVNTKSTDDEEIYNWHEILYRNINKENYLI
FT                   NNQQLYNYNLIHSFINQTLNTDTMDNTLDTDMVIEDNTVIPGTSNTEDTTSGVSDTVME
FT                   DNTLDIDMDIEENSNTNGTMGKGANGTFDTTGKGANSTAMECTIKDITGREPAPVTDDT
FT                   VMKNIIEELYEKELLQNMHTIILKNFINTRKLKIGYPTSLEMYILNIPDSIMDCNMYDG
FT                   IGKGFSYSLENIIYNLALLSSFIKIGTVNKRKKYYKSI"
FT   misc_feature    complement(822813..822884)
FT                   /note="Signal peptide predicted for TA13970 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.608, signal anchor
FT                   probability 0.000) with cleavage site probability 0.359
FT                   between residues 24 and 25"
FT   CDS_pept        complement(823238..824494)
FT                   /locus_tag="TA13965"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.320 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13965"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74405"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET4"
FT                   /protein_id="CAI74405.1"
FT                   /translation="MVNNGFPNPCLKYSHLLNPVMLELTSKISNKYFTYHEKEDGGYYS
FT                   RNDFYACNRVLINRRTLWKTNNESEYIGQVHIYGEINTITLCFLNGDIKHLTKVENTYI
FT                   AKNKINLNIKSDVEDFEGQKYTIKVYEIGNIKYINYKSNSVYLFKKVFEFDELIWKSNN
FT                   FSESAKSISICIMKHEKYLGILLTNFNYLLYQYINNNWINITNKRLRLNKFMLIFNINS
FT                   GLKRFKNVPIDYETDLMNLEYSLFFNFTPEFEQNLDITKPKCLTYNLITNDLSIVLCNG
FT                   NKIPIDTNKALIKIPINPVNSYLFPSKSFSEFTFNTAKSSFSTTSLEPNKNSIDQLDKT
FT                   IDELDNSIDQMDNPIGQITNSIDESTNPMDQLNVEIEDEMNEYISVTQSEEEIEQEYEN
FT                   LTHFTRNELFKALSRPIEF"
FT   CDS_pept        complement(join(824888..826680,826947..827189,
FT                   827350..829254,829816..830871,831084..831264))
FT                   /locus_tag="TA13950"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase alpha subunit, putative"
FT                   /EC_number="2.7.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:TA13950"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74406"
FT                   /db_xref="GOA:Q4UET3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET3"
FT                   /protein_id="CAI74406.1"
FT                   /translation="MLYTLDDNYLSSGRENRLDDSDINESYPLEKSNDKNYTHIDKKLT
FT                   FDTKTTKFKKALNATDPLKRVNSMYSSKSVYEELQMARRVKLPSVLQSIHHVLTEFDDS
FT                   SEDLSMLPQVSKFLPYICNNKLVKIESQLLYTHTNSTHTNSSITNSTYTNSSHTHKGAN
FT                   SNTNNKSSNPNLTNFVQLNTNPRTDTRVDTRVNPIEPNPMDRTPVERTPIQPNPIDGTP
FT                   VENNMENENIKNDSNYNLISLMDNNIRRKKSVIENSIISNTNMEMEMEIMDRRYNKIYS
FT                   NQMKIGLILSGGPAPGGHNVIAGVFDYLKYRNPESQLIGFIGGLDGLKYKRYQIINEEQ
FT                   MDQYRNLGGFNMLMSGRGMIANNNEFEMVLKTVTELELDGLIIVGGDGSNSNAANISNY
FT                   LAQYYHNKYNTKNGNVVMKSEKRCVVVGVPKTVDGDIRSNNIELTFGFDTAARTYSELI
FT                   GNLCIDAASTQYNYHFVRIMGRSASHLALECALQTHPNMLLVSEEVSQKNISLQQIVDD
FT                   IVDLMQKRYEMGKTFGVILIPEGLIEFIPDFKILVQELNTAVTVSSVTGSGTKDTKDTK
FT                   DTKGTEGTEGTEGTEGSTNTVGSGPDTVTEETEENLLKNFDVNKLKKSKEIWNFLPTNI
FT                   QEQLLSDIESSGSILVAKIATESLLSMLVESRIISRKLNHLLEIIIMTHYFGYEGRCAI
FT                   PSEFDSSYCYSLGYTASVLVAQRKNGYMAAIRNLKNNIEDWIPLGIPFSHLTTLMKLHK
FT                   SQSNSSVTVTGTTETNSTKDSITKDSTNGTKDTNTSTKDNVTSSQTTTVGASTVTDTVT
FT                   EELYKNYRCSIKKTLLDLNGELFKTFEKVRDIWKYEDLYRSPGPIQLTTSQLLSNSTDL
FT                   SLYLNTYQSNHINKLNNQVTVSSTNGVNGSNIGVTGSNNGVNGMGVNGNNGSSSRSNNG
FT                   GVNVVSRLDNVVNGTNTNSTVSISNTSNTGMNMTNVSMSNVSNVSMNNVSNVSVGSVGV
FT                   GSVGMGSSRMNGYDDDMSSYSHESSNDECIDMDDINERRCFTLLIPTLKELVGNYPFNG
FT                   DYVGLRRKDKSFMSELELKRLEVIPDIPIVCSDVKSKLVPFKQHVEFDQYIKNQIMLYY
FT                   PYQHKLNHFNQYELVLNTIPTGMGKKLGTLVSSEQMKSDSLRVGVVPVGKQAPGVLNVF
FT                   WGIFTRVSKMGGKCIAFHGIKGLLQSSYIELKGEDFECFKNQGGLELVLRSKRSFLWKK
FT                   DKLEAVYKTCTALDLDGLVFLGDEMSMTQASFVTEYFMSKNSKTCIIGVPVAGGNSLGG
FT                   DLIEACVGFDTNTRIYASLVGNVLTDAISMPKYWHFVKILGRFPSVDVLECALQTHPNV
FT                   VIIAEEYRNSDKSLFDIVDEIANAIVKRSKLGKNFGTVLIPDHLVLHLPNTKNMLQEIG
FT                   NALNKANQLNKRKNAIQQLMSYSVYSTNTTNTNGTKDNGKDTNGKDKDMDNIVDVEDNM
FT                   GEYVKMITPWSLALFSSFPEYIRREILNMDFTDLGLENLEIEVMLAKMVKEELLIRKKR
FT                   GEYNGNYAAVTHYFGYQGRCAIPSEFDCSLAYSYGHLAAICVESKLSGFCCSIRAVCGA
FT                   VKDWKLFATPFTCMMKIAPDSFKMLINPKSEMPIIPPNNVSLNGKPFMKLKSARRKWLV
FT                   EDLFNNPGPIQFNSFVGTQNIMLIIEHSQYYHMITSVERFTEIIKNICKFGVSEEYLHH
FT                   AFIQLWGLIKITQDKNQLISLSQDFKLL"
FT   CDS_pept        831993..832583
FT                   /locus_tag="TA13945"
FT                   /product="guanylate kinase, putative"
FT                   /EC_number="2.7.4.8"
FT                   /note="chr2.C.cand.201 - guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13945"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74407"
FT                   /db_xref="GOA:Q4UET2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET2"
FT                   /protein_id="CAI74407.1"
FT                   /translation="MLESIELPILIIVGPSGSGKTTLNSRLIKDYPEIFESSVSYTSRP
FT                   MRIGERDGVHYTFISTEEFDQMYVDDEFVEYTNYVGSKYGTARSELKRIQNLGKVPVLE
FT                   IDIKGYKQLLNAKLNLKGVFIEPPCLETLRQRLIKRGCNTEESINKRVERANQEVEESL
FT                   KCHFDFRLPNENLDEAYNSLINKLSEWYPIHKT"
FT   CDS_pept        join(832872..833374,833431..834760,834891..835244)
FT                   /locus_tag="TA13940"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.202 - membrane protein, putative"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA13940 by TMHMM2.0 at aa 81-103, 143-165, 559-581, 641-663
FT                   and 705-727"
FT                   /db_xref="EnsemblGenomes-Gn:TA13940"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74408"
FT                   /db_xref="GOA:Q4UET1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET1"
FT                   /protein_id="CAI74408.1"
FT                   /translation="MQPNGSAPLEDTSSAVPCTVSVAIDNKTLTINYGDNKCIEITLGD
FT                   SDSITKAGTAVPYGHILTESFDMSKVHWPEIISPTLMVIVVIVFLIATIFPPVIIAVLR
FT                   LRAPAWSPQHNLGGRWGLWTKYDYAPDWNKPSETTTVHAYLWHFFDLLMDIKISLAVVF
FT                   IYSLQFGTTQSWDGYDTTRNTSLDFKVTLNATSGSNTFASSGSIKITVGAADFATLTGT
FT                   NVQVTNIGGTIKKYIDSNKPPDPSNLQPITNTSDPLNKGTKLEIDATGSISSITAEVTI
FT                   KGDLTVSSTDQKLGSSALTLGGSEGLGGTITPQDSGTKVTIKNTSTITLTRKALTAIQS
FT                   LTQNAVTLDKTGGGQFTSKATITITRGEDNKTDYNFTALTVTTNLEINITQGTIKNATN
FT                   TLQTTSPELDKDDVLELNATGTITKPVGTTGDVKLAGTIVVTSDKKQIGSSLTITGGPS
FT                   GGVGGTLNLTNQTKTDTIPAHVTISSSTLTIDKAAYDTLKSAGAVTPDSLKIGASDSKV
FT                   RIPANATGGAKEAGLANEPSFKKYWHLFPPNYYDEDFPYWTSIFPALMVLLIATIFPPM
FT                   IVVILQKEAKTHSPKYYMGWGDGNLRYWHLVDLLLDTQEAKVKEATYTPPTGAPYKYIV
FT                   KDPKTNITYTFTTTAQLTSGAATITVTVDYGHIFAEGFGDLEDVKTSKHVEQESEPEKC
FT                   NEDAENQSDNLVHAWIWHFFVILVVVDCCLWLLS"
FT   misc_feature    join(833112..833180,833298..833366,834602..834670,
FT                   834978..835046,835170..835238)
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA13940 by TMHMM2.0 at aa 81-103, 143-165, 559-581, 641-663
FT                   and 705-727"
FT   CDS_pept        complement(join(835719..835941,836076..836341))
FT                   /locus_tag="TA13935"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.314 - hypothetical protein, signal
FT                   peptide, apicoplast targetting sequence"
FT                   /note="hypothetical apicoplast protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13935"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UET0"
FT                   /protein_id="CAI74409.1"
FT                   /translation="MKRIIIYIIILKYIKCVESLRRFGFVNLIPNQINSLTQINTKSLI
FT                   RTKLLNKYNKLNYKNIFAKNSQYENCLSDDLFDCPGFNHIFNQSYVFSGEFEDLGVNNL
FT                   LSRELDYRKYSLESHKGLKKFMAVVLSAVAVGALYKFATFLKDIIEQQVIDLVSPVTV"
FT   CDS_pept        836486..836764
FT                   /locus_tag="TA13930"
FT                   /product="hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA13930
FT                   by TMHMM2.0 at aa 19-41"
FT                   /note="Signal anchor predicted for TA13930 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.979) with cleavage site probability 0.000
FT                   between residues 40 and 41"
FT                   /db_xref="EnsemblGenomes-Gn:TA13930"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74410"
FT                   /db_xref="GOA:Q4UES9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES9"
FT                   /protein_id="CAI74410.1"
FT                   /translation="MELLKYYNRIKRFDKRSGFFTLGIPSLTVMLSIIITGTFLIDKQL
FT                   ELKYLREQSVTSREQTLKEEHEEMIKMLNKVIPTQNLNNSIPIPQSD"
FT   misc_feature    836486..836605
FT                   /note="Signal anchor predicted for TA13930 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.979) with cleavage site probability 0.000
FT                   between residues 40 and 41"
FT   misc_feature    836540..836608
FT                   /note="1 probable transmembrane helix predicted for TA13930
FT                   by TMHMM2.0 at aa 19-41"
FT   CDS_pept        join(836767..836830,836901..836948,837002..837156)
FT                   /locus_tag="TA13925"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.203 - score = 10.91"
FT                   /db_xref="EnsemblGenomes-Gn:TA13925"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74411"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES8"
FT                   /protein_id="CAI74411.1"
FT                   /translation="MEQFINIKLQYITSIFPYSFIGEVINSYENWNNKYVIGFIGMNSR
FT                   IINDIIELQPINQVSILPNDIKIDTKIIVNNLKPLITSLLCKF"
FT   CDS_pept        join(838034..838145,838254..838453)
FT                   /locus_tag="TA13920"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for TA13920 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA13920"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES7"
FT                   /protein_id="CAI74412.1"
FT                   /translation="MKITSGYGASAILILDGTIEAFSTNQVTLHRQILLSTGIGGRIVW
FT                   CNEIEQIDPCECKCLYSKGISLSFFNPKSIFNTNSYQGIIQHSILLFLKHINTLYLSN"
FT   CDS_pept        complement(838599..840539)
FT                   /locus_tag="TA13915"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.313 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13915"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES6"
FT                   /protein_id="CAI74413.1"
FT                   /translation="MDFIDSTYFNNTHTNTIPPPNGATTNTVNTKESPYGVKETPYGDK
FT                   VVPFGGGRGASTVMENITSPNKFNIDDGISGYENIYNSIEIIDIPEIKSKFNNTYTPVT
FT                   VTRPTDTSSYDTEYTTNTNTTGSIPRILSTHNLTSTKGAVGPNTVTDTVMDENYIVAIT
FT                   GNTNRNTKQFTINTTKEATVTKDMENMDMDMFDSIDTVDSLNRVDSFDRVDILSTKGTM
FT                   GKGANSMGMECTMGTTNTMSRCSSMSRVDSRSTISRISSMSRINSMSNMIDGMKNMKKE
FT                   MSKVVKTGFNKRVSSKHFFEIDSISRYGDRSNNSPKINILTSTNSILTSSNSPKSNILT
FT                   NSTSTSKFNTLNTFSTNNTMGKGANSMVTECTTNNNTTVRDSMETPWGVKEAPFGAVGS
FT                   GPDTVTENLKLIDPKNDIRRIPSFYDLEQVEIHCQNSLKSTESLKRVGSKDSFEYLLFG
FT                   NSQEYISILPTTDTEVYNKFNSHLKLDRFLLFGFHFNKLLNSISWLASIQLSCKSFNSV
FT                   TVSGTTATEGTEGTSIDTIDSTFVPNSSSSTNSIPRILSTHNLPNTSNSTNSTKGVGVD
FT                   NKVDPFGVSTNTKVDPFGVSTNTKVDPFGVGGGPDTVTDMESNIEMNFRRKFNTFQKSS
FT                   STPTFTNFNIH"
FT   CDS_pept        841109..842389
FT                   /locus_tag="TA13910"
FT                   /product="60S ribosomal subunit protein L4/L1, putative"
FT                   /note="chr2.C.cand.205 - PF00573 60S Ribosomal protein
FT                   L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:TA13910"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74414"
FT                   /db_xref="GOA:Q4UES5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES5"
FT                   /protein_id="CAI74414.1"
FT                   /translation="MVHRPVVSVFSVSTEKRMGSTIMPRVFSTPLRSDLVHYVHTNMSK
FT                   NKRQAYAISRMSGYQTSARSWGTGRALSRTPRVKGGGTHRSGQAAYANFCRAGGMFAPT
FT                   RTWRHWHRKINLKEKRLALAVSVAATASVPLVMSRGHRVESVPELPLVLDDTMETLTKT
FT                   RDAVELLNSMGLADELKRVSVTKRTKRKGKKRPVGPLVVMRSTAVEGKRAFRNIPGVDV
FT                   MSVEHMNLLKLAPAGTLGRLVIFSKSAFELLDSCVTVTGPTGTKGTKSTVGTEVTESTV
FT                   VPGTTTTAGPSTVTGTVTGKNLLNISSGLKSADVNRLINSTIVQSNLRHQKLLTRVHKV
FT                   QKKHSRRLLKLLHNSTVTVTGTRDTVVPSTKDSTVVPGTSTGVGTVGASTVTGTVTKST
FT                   LKKNSRKYYKDIQEGLGVKKPLVLHLN"
FT   CDS_pept        join(843754..844088,844342..844653,844861..844951,
FT                   845140..845290,845387..845496,845520..845573,
FT                   845675..845741,845864..845994,846080..846367,
FT                   846558..846768,846826..846896)
FT                   /locus_tag="TA13905"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein"
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA13905 by TMHMM2.0 at aa 93-115, 248-270, 282-304,
FT                   319-341, 348-370, 400-422, 474-496 and 506-525"
FT                   /db_xref="EnsemblGenomes-Gn:TA13905"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74415"
FT                   /db_xref="GOA:Q4UES4"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES4"
FT                   /protein_id="CAI74415.1"
FT                   /translation="MTGTKDTKGTGTKANTTKANGTKVNIPKANNAKANLKVKTIGNIF
FT                   DNKDTRINNELEKIRINDLKLVTSKTKFNKELIKLKDDSKHKDNPLRGRLVVCIFTSTA
FT                   IIFTFFAQMIYNKTTFGGRCISRILYKNESNFIPIGHGACENNLLTNATKRVFMGPSEA
FT                   DKGWPIIKTTNIEREIKWYFPFETDSNTFQINSIFSFGGLETNYIRNYKEYFRLFWSMF
FT                   MHKGVAHLLINLLSQIQILWIIEPDWGFIRTFLLYFISGLGSSITSASLDPCFITIGSS
FT                   GALYGLYGGLLPYIIVLGNITISNFLDNFPHYFHCKNFYTIRQLDYIIKLIGIIGVLMG
FT                   FTQNIDNYAHLGGCIFGLLWGFSTIRSISIFDACPRPTIDLDITPKRRSLNPPKGFPSY
FT                   ITTSSLVIYPLKELIIYLVLSPLRGYCLTKHRNVIIDLKGKNIKFSEETRNKFDFIFKR
FT                   MEKNGTSVFKNRLREWIVRIISITLLVSPVTVLVHTYLDIAPKGAPIFPEGAFYILIIS
FT                   LVMTLLLFEEKMYSKFKPWGQMKFSGFAKCTCCYIKPEKLQRLQLPINTFWCFDDSDTA
FT                   NNLCQLQSGLDGGVINTTKAAALHLLGYLT"
FT   misc_feature    join(844030..844088,844342..844351,845143..845211,
FT                   845245..845290,845387..845409,845452..845496,
FT                   845520..845543,845562..845573,845675..845731,
FT                   845941..845994,846080..846094,846248..846316,
FT                   846344..846367,846558..846593)
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA13905 by TMHMM2.0 at aa 93-115, 248-270, 282-304,
FT                   319-341, 348-370, 400-422, 474-496 and 506-525"
FT   CDS_pept        join(847017..847395,847435..847673)
FT                   /locus_tag="TA13895"
FT                   /product="proline synthetase associated protein, putative"
FT                   /note="chr2.C.cand.208 - PF01168 Alanine racemase,
FT                   N-terminal domain UPF0001, possible proline synthetase
FT                   associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13895"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74416"
FT                   /db_xref="GOA:Q4UES3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES3"
FT                   /protein_id="CAI74416.1"
FT                   /translation="MSYIEKWLELRNEIENFGVELLVVTKNCEKTLINELYKLGQINFG
FT                   ENRVQELYEKSRELDSTIKWHFIGHLQSNKCGKLLEVPNLYMIQSLDSLELCNLLILKT
FT                   EKLNREINVLIQVNTTLKTTQYVTRILESQRLKFCGLMTIGDGGIECFQRLNMIKNVLM
FT                   EQFIQCKGLGDEFIMSMGMSNDYKLAIQMGSNHIRIGSLIFN"
FT   CDS_pept        complement(join(847773..848390,848489..848715,
FT                   848783..849538,849630..850205,850304..851059,
FT                   851202..851496))
FT                   /locus_tag="TA13890"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.311 - hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA13890
FT                   by TMHMM2.0 at aa 993-1015"
FT                   /db_xref="EnsemblGenomes-Gn:TA13890"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES2"
FT                   /protein_id="CAI74417.1"
FT                   /translation="MVIGNMDSTHPKNETTKIDKGNVTIKTGTVENGECKTATPPKITG
FT                   GSGKHASKEGKGATLTLSVTDATSLAAIEDTSATQCNVSVDTDKLTIKYTDTAVTAAET
FT                   AASTNKLQSANLTLNASSGGGNPDALTYKFPRPITLNSTITVKLKLQDTNITITQSGTS
FT                   NTVKATLTTIASKSTTLTTLKTGVDLNLTTGPLQTPKLKLNNEAIKTSTELKTGEKITL
FT                   TGNIGTGTTIEATGPIEITDKNGQPSDTSLTLSDGATVNLSGGLTGSGNLTIDNSKATL
FT                   SGVNLAAVQYDPKELHDVHKTYNCCYYGKFNLWKRYQYAPDWTKPTETTPVHAYLSNFF
FT                   DLLMVIKISLGLHFTNACGTEGNPANDADNAVTLSAGSFQSKATIKVTDYNFQSLKLVS
FT                   GQSLTISINSGTIKNATNNLQIGSPELTKDTVLVLNANGSLSGGSVSGNVPVTLKGIIV
FT                   VTSTDKPIGKNTLTITGSGTSNGVSGTLNLGNQTSPPKHMTITGGTTSKITIDKTAYDN
FT                   LTDKTTNTLKIGASHSTPRDPTNATGYNHTQDTSIGIHANILKTAAGASESEPSDGLRA
FT                   LAKALHDKANNLNDAVKNVADNENAAKVLKHKAGTNDQASDSKYLRGLAEKLYESAQAL
FT                   ADKVTGSPDDDGKANDLAEAVGESESATGIRKELKALAGAKGTDLNAPAQAVKTAYENG
FT                   LNGVKPKFEAVKGQKEKYTDPAKYQAVVDAWNAFNAVYNPEEQLMDAVNSLQGALNQLA
FT                   DASIINLHSKAEEVKKKFEGWGTGVKSKFELVQKQENAYTAERSYILINSTGLLFILSL
FT                   YLVRMVTKTEYVFHKVGDDKNGFGGWRTYKKHKPGGSGGCADDEPVVHNWFWHFFDILD
FT                   ASQNRLTITYKGDDKAKVENAGYTEEQVAGTTNYKYTVTDAKNITYTIVTTSQLTDSSA
FT                   TATGTVTIEYGHIFAEGFISLEDPEASEHKPGGSGGCADAAEADNLVHAWIWHFFDILI
FT                   VLKILLTAILYIHSTPAILWTLAYGIYTDTKIKEAITKYPPDPSIKTINYGTPPNCNAN
FT                   QATANGTASIEAPTDLGATLTITTIYS"
FT   misc_feature    complement(847956..848024)
FT                   /note="1 probable transmembrane helix predicted for TA13890
FT                   by TMHMM2.0 at aa 993-1015"
FT   CDS_pept        852106..852696
FT                   /locus_tag="TA13885"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.211 - hypothetical protein, signal
FT                   peptide"
FT                   /note="secreted protein, putative"
FT                   /note="Signal peptide predicted for TA13885 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.976
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA13885"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74418"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES1"
FT                   /protein_id="CAI74418.1"
FT                   /translation="MKFVILALLALASGLHAKKLDLKPLGFVLFGKHGEGTKTSVASGA
FT                   CPLGTLPDTVFLHKTFEKAGHFFTWVRPVHGKVDEVVCGTHAVWKAAAGEVLLDLHFVG
FT                   KKDSDKFVHLELFHPAVGSHHLFLKFVADGALAGYLGMAAFVVGVHGLVAELPKVEGLP
FT                   AHPLVHALVAHAAHVAHGAADGLGAEGAALVAA"
FT   misc_feature    852106..852156
FT                   /note="Signal peptide predicted for TA13885 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000, signal anchor
FT                   probability 0.000) with cleavage site probability 0.976
FT                   between residues 17 and 18"
FT   CDS_pept        complement(join(853067..853966,854140..854337,
FT                   854560..854777,855020..855203,855319..855468))
FT                   /locus_tag="TA13880"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein, conserved, pfe0380C"
FT                   /db_xref="EnsemblGenomes-Gn:TA13880"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74419"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="InterPro:IPR024682"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UES0"
FT                   /protein_id="CAI74419.1"
FT                   /translation="MIIRLKSKIGISRIILDEDSTVLDLKNKIKERIEIKNNSFLKLFT
FT                   ENNYQLLDDEKRLNEIGIIHGTSIILDNNIDEISYKTIVNNIKSENEPEEIDLTNSQSN
FT                   DSITNTQLENEKIDGPLFKSFDAYLHENGFEIGDLPLMNSFLPIKIKRGIINKVFRYGD
FT                   WSTANHQSPRRGFLTPYRGSLKYRHVDHLEMMNVEEVRRFANFWLNELQMSLQRIGWMY
FT                   GYYTEDQHYPYGIRAVCEAIYEPPQYSNINDVIMIEDEMLMNVDKIAERLGLERIGMIF
FT                   TRLPNECFLTARELIRVIEMQYNSLKHIHYTGYPISTMVTCTMSPDDNGQPVLNAYMAS
FT                   DLALALFRDELFTSSQSFNHIISTKCNIHHDSTNNSSSGGGSGSSGTSGSSTNTTGGSG
FT                   TEEVIRELMPILIESGKEVVDFDTSWLIVRINESAPIKPNSFFPKLTIPFPIENRNTQS
FT                   NSTNTSNSTISNSNNNMIDNMNMDGIKYNVIKVEKKELMEYINGNGDELWNNFHFLIYI
FT                   CKVLDVDTALSICDSIIQQQPIDDLIKELLLH"
FT   CDS_pept        complement(join(855699..855890,855996..856141,
FT                   856352..856511,856637..856897,857102..857192,
FT                   857476..857852,857901..858695))
FT                   /locus_tag="TA13875"
FT                   /product="hypothetical protein, conserved"
FT                   /note="membrane protein, Rhomboid family"
FT                   /note="chr2.cand.307 - PF01694 Rhomboid family - membrane
FT                   protein, protease"
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA13875 by TMHMM2.0 at aa 267-289, 391-413, 423-445,
FT                   452-471, 481-498, 503-520 and 600-622"
FT                   /db_xref="EnsemblGenomes-Gn:TA13875"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74420"
FT                   /db_xref="GOA:Q4UER9"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER9"
FT                   /protein_id="CAI74420.1"
FT                   /translation="MEHVLDSNVNENTKLDNTKLDNKDLENVKSENVLKHEIKKKKKLK
FT                   TKLKSVKNEKLDDKNLENNLENENLENEKPKIKKNAKLIKKTQLTNTNTTGTNTNTKGK
FT                   GANDTFDTPGKGANFTATECTTKDTKGVGEGTGTVGPSTVTEDKNISREKVAKLKKKFE
FT                   TKKNQSTYNKVINLFKQHNLLTEQQNDEKNQLDDKKSSDDKKILNNENNSLNDKNSLDN
FT                   VIINIESNTNKQNNTTNTTTGTTTNTTTATTTVGMNKIKGVKKITTVFGGYPVLTLTSS
FT                   VILFVFLFQIILNKISFNGRCISKVLYPNDSKAYHTMFGYGACEYNLQQKIEEIGYIGT
FT                   KANDKGWPSTLVSDENVVESTSTFDSPNYRGFTLFGGMNTNYIRNYKEYFRLFWSMFMH
FT                   SGVLHLIFNLIAQTQILWIIEPDWGFFRSLSTFILSGFMGNLFAGVFEPSFTVVGSSGC
FT                   MFGLIAALIPYCVENWSLLRSPIYIFAFAIIITIISFTFFNNTVSIYSHLGGWVGGLLW
FT                   GFITLRSTFKLKDCAIKESLLLSFFKDKLNPDDKNKLKESFLIKQRKCINEIRIERRRK
FT                   KFKQRIKNLIKYPIDYFKKGPYDILIRIIPLILFVILIIILCSNLLIESIYNRMFLLNE
FT                   SSNLSQCCYTNAKSEIIFNRKVFWCFENYQTAINFCKI"
FT   misc_feature    complement(join(855855..855890,855996..856028,
FT                   856476..856511,856637..856654,856667..856720,
FT                   856748..856807,856826..856894,857126..857192,
FT                   857476..857477,857781..857849))
FT                   /note="7 probable transmembrane helices predicted for
FT                   TA13875 by TMHMM2.0 at aa 267-289, 391-413, 423-445,
FT                   452-471, 481-498, 503-520 and 600-622"
FT   CDS_pept        complement(join(859209..859759,859867..860065))
FT                   /locus_tag="TA13870"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.306 - hypothetical protein, conserved,
FT                   pfi1455C"
FT                   /db_xref="EnsemblGenomes-Gn:TA13870"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER8"
FT                   /protein_id="CAI74421.1"
FT                   /translation="MEELEELRLRVITAYPNVEKDIEILFNTNDISNENLLPYDIVEAL
FT                   LRHYLLQQGFQDYIFTFLNSNGMLDLKYIRNYLHENNMLVVNEETMLNIKEMKLLAIIW
FT                   LKLLSDSYFSKTFNQPNYLTHMTNNNTNNNTNNQFIHITTNTLTNSNGTDGVGGTEGTM
FT                   GTNGTNGTNGTGMGNDMEEEEEEIMKYMKNIKDEIEKNKMCGIKCYTYPASLIPNGSCA
FT                   SAGAIIPHRRLKNNKPIKNIFTLFGCC"
FT   CDS_pept        complement(join(860455..860900,861046..861484))
FT                   /locus_tag="TA13865"
FT                   /product="proteasome subunit y, putative"
FT                   /EC_number="3.4.25.1"
FT                   /note="chr2.cand.305 - PF00227 proteasome A-type and
FT                   B-type"
FT                   /db_xref="EnsemblGenomes-Gn:TA13865"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74422"
FT                   /db_xref="GOA:Q4UER7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037559"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER7"
FT                   /protein_id="CAI74422.1"
FT                   /translation="MNLQILPHQSINILNPMNNMNIVDNISGLDKMNMDKMNIMDNLNG
FT                   LDHLENNVSLEMLEKKYEDIQMGTTIIGMKFMDGVILVADGRTSSGQIVANRVARKITR
FT                   ILPNIFMLRSGSAADSQTLSTIIRYHAQSLKQQLKPSGRYTTHIRDEMDIDEMNEFDEY
FT                   KTNEYSIELMNGPLVKSLAKATHNLVHEYRNMLYCGVILAGVDELGSQIYNITLGGTLI
FT                   EIDDFLATGSGSSFITAFLQDNYKKNSTQEDCLKLLKKSIEYAILNDNSSGGIMRAIII
FT                   TKYKVKEYYFTLH"
FT   CDS_pept        join(861865..862259,862339..862756)
FT                   /locus_tag="TA13860"
FT                   /product="GTP-binding protein, Rab-family, putative"
FT                   /note="chr2.C.cand.212 - Rab family small GTPase, signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:TA13860"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74423"
FT                   /db_xref="GOA:Q4UER6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER6"
FT                   /protein_id="CAI74423.1"
FT                   /translation="MAEEYEHVYKIILLGDATVGKSHLLCRYIKGNLPIQSKATIGVEF
FT                   ATKTVPLASGGSIKAQIWDTAGQERYRSITSAHYRRAVGALLVYDVTNRISFYNCKKWL
FT                   NELRASSYDDIVILLIANKIDLINKYNSNEKENVKENVGSQENKDTVQEINDVDVVLMI
FT                   EGMEFANENNLYFFEASAVTGYNVKEIFEFLIQQIYNLKSRLPSIRDSNTLNTLTNNDF
FT                   TNKNFNTNLSSKNFTGTENFTGTKNLEKNSRQFGCLEQNCLTNNCIIQ"
FT   CDS_pept        complement(join(862880..863022,863422..863744,
FT                   863985..864123,864239..864429,864617..864708,
FT                   864749..864828,864931..865354))
FT                   /locus_tag="TA13855"
FT                   /product="nucleolar protein, putative"
FT                   /note="nucleolar protein, PF01189 NOL1/NOP2/sun family"
FT                   /db_xref="EnsemblGenomes-Gn:TA13855"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74424"
FT                   /db_xref="GOA:Q4UER5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023273"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER5"
FT                   /protein_id="CAI74424.1"
FT                   /translation="MIHFGSEPTNGKNLNSEPMNSENLNTEQLNDLKNDSEPMNGKNLN
FT                   IESLNGKNLNSEPLNEENDSESDFSDDLIETDEFDQIPLDSTGDNFNLASDSVNLDELT
FT                   GNKSVDLMDLSTVKERIENICGILSKWKSLNSTTRNRESYINELKQLVTVYYGYSEELS
FT                   DYFFKLFNPLEAIQFFDANEQPLPLTIRTNTLKTKRKDLAVNLINRGANVDPIGDWTKE
FT                   GLVVHSSKVPIGATPEYLAGHYILQSASSLIPVLSLSPKPNEMILDMCAAPGGKTTHIG
FT                   QLMNNTGILFANDSNKQRCKSLVSNIHRLGILNSIVCNYKGEELLKVLPKMDRILLDAP
FT                   CSGLGVISRDPSIKIKRNLKDLQRNSNLQKQLLSVSINLVKPNGIIVYSTCSLSIEENE
FT                   QVLHYCLKKFNIKLLPLGLEIGSPAISNFRGKKFHPSISKFARRFYPHKHNLDGFFIAK
FT                   IIKLH"
FT   CDS_pept        complement(join(865453..865872,866026..866100))
FT                   /locus_tag="TA13850"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.303 - hypothetical protein, conserved,
FT                   pfi1565W, PF00235 profilin"
FT                   /db_xref="EnsemblGenomes-Gn:TA13850"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74425"
FT                   /db_xref="GOA:Q4UER4"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="InterPro:IPR016814"
FT                   /db_xref="InterPro:IPR036140"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER4"
FT                   /protein_id="CAI74425.1"
FT                   /translation="MAEWVPVLKETALANNSCYGAGIANGEDGELFVASDVDHEGLHWD
FT                   SVYKEGYEYETMDDAGNPLKVKVDEKFTIREVFEKKMSSEGIFLGGEKYTFASYDPDME
FT                   SGSFKFECVCGAKNKGGCHLIKTPGNYIVVVVYDETRGQDKTVSRMAAFNLAEYLASNG
FT                   Y"
FT   CDS_pept        join(866643..866965,867290..867828,868221..868399,
FT                   868628..868906,869061..869273)
FT                   /locus_tag="TA13845"
FT                   /product="hypothetical protein, conserved"
FT                   /note="hypothetical protein, conserved, pfi1560C, signal
FT                   peptide, transmembrane/DUF21 domain"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA13845 by TMHMM2.0 at aa 20-42, 84-103 and 110-132"
FT                   /note="Signal anchor predicted for TA13845 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.089, signal anchor
FT                   probability 0.836) with cleavage site probability 0.043
FT                   between residues 41 and 42"
FT                   /db_xref="EnsemblGenomes-Gn:TA13845"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74426"
FT                   /db_xref="GOA:Q4UER3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER3"
FT                   /protein_id="CAI74426.1"
FT                   /translation="MPQCYKLISNCFNCKMQKWAKILATIVCSALSALFSGLTIGYTSI
FT                   DLFQLHLLSQFTPTTKEDIANQKRARKIIPLRSDPNNLMIALIACNAMINSLLVLFVGE
FT                   LFEFAMGFIVSSLIVTIFGEIFPQTVFFRYQLQLCSFFAPLTFVVKYVLYPITKPMSML
FT                   LNLIIGTNTEVIYNKQQWKALVDLQKECGGVLSEEEAKLLKGCLSLSNVQIDSIMTPID
FT                   KVFGLDIDSVITISLIQEIAKEGYSKIPVMDKTKSQPIVAILLIKDLLLLDPNSSYQLD
FT                   ELLSTIGKPAYAVDHDIGLLSVLMHFKDDQTHIAVVRKVEYQNNSDPLYKHIGIVTLND
FT                   IFQMINQDESGEIVMTTGDSVERSRHRSRIFKILDNLKDPRSFNLNSILDILPIQEPEN
FT                   LLKLLRLPINPDNLDKINQHRIYLIKPQVFLPTHSLTIITKGIVTDEDNKCKFEAPFVI
FT                   NQKKAKLTYENEVFVTLTECHLIQINPDLLISTTQVPTKHLNNTNNNLNISQ"
FT   misc_feature    866643..866765
FT                   /note="Signal anchor predicted for TA13845 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.089, signal anchor
FT                   probability 0.836) with cleavage site probability 0.043
FT                   between residues 41 and 42"
FT   misc_feature    join(866700..866768,866892..866951,867294..867362)
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA13845 by TMHMM2.0 at aa 20-42, 84-103 and 110-132"
FT   CDS_pept        complement(join(869509..869720,869750..869875,
FT                   869905..870085,870119..870166))
FT                   /locus_tag="TA13840"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA13840
FT                   by TMHMM2.0 at aa 126-148"
FT                   /db_xref="EnsemblGenomes-Gn:TA13840"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74427"
FT                   /db_xref="GOA:Q4UER2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER2"
FT                   /protein_id="CAI74427.1"
FT                   /translation="MEIDCSGTFFGKYFGKVFDQISFGCPFQSNVNKKLIKEYNRKPKK
FT                   YRKSLNDVVRDVRGRVSASQFTQPRNHSINPSDYDENEIKYIEQVNESSGSCNSTCNTV
FT                   SCNLGSCKSGLYFLGAGVGAVGLGALGAVAIVAVGTVACTVYLFEQLLCVDKEYQEELK
FT                   ALQVPNVYRPDIYNNMYEYKSPYRY"
FT   misc_feature    complement(869632..869700)
FT                   /note="1 probable transmembrane helix predicted for TA13840
FT                   by TMHMM2.0 at aa 126-148"
FT   CDS_pept        join(871141..871534,871857..873427,873522..873647,
FT                   873677..873724)
FT                   /locus_tag="TA13835"
FT                   /product="sulfate transporter, putative"
FT                   /note="chr2.C.cand.215 - sulfate transporter"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA13835 by TMHMM2.0 at aa 169-191, 198-220, 235-257,
FT                   264-286, 301-323, 330-352, 398-420, 432-454, 469-491 and
FT                   539-571"
FT                   /db_xref="EnsemblGenomes-Gn:TA13835"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74428"
FT                   /db_xref="GOA:Q4UER1"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER1"
FT                   /protein_id="CAI74428.1"
FT                   /translation="MSSEETKDLDENLVDSNSYPLRNESKDDTFLIRVEESSASLKRSK
FT                   TDPDMDCIKVVQYDEDDTEICYKFYGEKDSPNMEYNYHDFSHSTWYDFTKMKTPIPSKI
FT                   EKHTCDDISICLPIHAGILYSFKRSISGITIGWAFLRKSGRRLISYYLKEFLNGILCAI
FT                   TMLPEVISFSFIAGIPIHVALHGSWILCLCATIFGGSPGIVTGVSGAFAAVAGTYALDH
FT                   EDTSYTIDDHNMNLTRLLVAVMIASILLLIFSFIHLASINQFLSTSVIIGYSNGLALII
FT                   AKAQLHGFHDFDTGKYLRGADLYISILYCVVAFVITQFIHYIPKIGKYIPSPLLAIITV
FT                   IVIHYSIVIHTLPSIKISTVGSVANLSSETSFPSLLFLTHLKYVRELKFDFALVRQSLV
FT                   FTASILIEMLIIADVVKTLGAREPNSNQQLFGLGFGNFLSSLMGSMGGSSMVGITIMNL
FT                   NSGSKWKESSLVTGLFVFIMLAGGYPILNYIPIPALCGIMFSVSCHCFKWFSVPMVIFS
FT                   ALPGRIRSLHPRMEMKISRYDAFIILSVTVLCVVWIVPLAVFFGVIIAAFAYVWESKSK
FT                   FKVEIYYDKEANIKYYEIEGNIFYASKRMLTRSFTPREDPPTTIIVLLASTSLFDYTAI
FT                   EALNSLKGLYASYNKSLIIKGLSHGCIKKVAKMNRLCRHMEHDLVGITPPTLPTLYTPF
FT                   YHTTLTARTPNSQLQPIY"
FT   misc_feature    join(871967..872035,872054..872122,872165..872233,
FT                   872252..872320,872363..872431,872450..872518,
FT                   872654..872722,872756..872824,872867..872935,
FT                   873077..873175)
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA13835 by TMHMM2.0 at aa 169-191, 198-220, 235-257,
FT                   264-286, 301-323, 330-352, 398-420, 432-454, 469-491 and
FT                   539-571"
FT   CDS_pept        join(873827..873865,873895..874248,874281..874381,
FT                   874411..874530,874568..874604)
FT                   /locus_tag="TA13830"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.217 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13830"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74429"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UER0"
FT                   /protein_id="CAI74429.1"
FT                   /translation="MESPFDKLKKTFMNGIFDQNKVSEALQERVERQSGIKVQELHSYP
FT                   FLHRLPILPDFIRYILTNPRSLILPFVGEILTHEDSEFSLINLDQIGLCDQDYFRLNRC
FT                   VVEGLRKDNKDQNNPKFNRLSKCKHHFIIYNKCVNKRDVTIDKQILKHELNHLKDLNEN
FT                   QREEYFKRVEKVISECYSQMDSCKEQTEKYALNRKIKLMEERNFCFFIVTNVI"
FT   CDS_pept        875121..875762
FT                   /locus_tag="TA13825"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.218 - signal peptide, transmembrane"
FT                   /note="1 probable transmembrane helix predicted for TA13825
FT                   by TMHMM2.0 at aa 187-209"
FT                   /note="Signal peptide predicted for TA13825 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997, signal anchor
FT                   probability 0.000) with cleavage site probability 0.719
FT                   between residues 16 and 17"
FT                   /note="GPI-Anchor Signal predicted for TA13825 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA13825"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74430"
FT                   /db_xref="GOA:Q4UEQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ9"
FT                   /protein_id="CAI74430.1"
FT                   /translation="MKILYILLLLINLSICDDQPSVNIVYKNVTLDLTLGSENTDEKVV
FT                   PKKPDQEDVPTGFNKYVIYGTPRGYYFNVSDVVYNGETLKLGEEKVTQDYVYDVYTYWS
FT                   NGRLLVFCFRYDYGNYRSKYKYYKLDNNEWKLVEGDDYQPDGYGKLTGNGLAGLLKKTE
FT                   TDNAPAPGPTEETKKDTETNTRTVVIIGSVVGGVLVVLLLGFLAFYLLKK"
FT   misc_feature    875121..875168
FT                   /note="Signal peptide predicted for TA13825 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997, signal anchor
FT                   probability 0.000) with cleavage site probability 0.719
FT                   between residues 16 and 17"
FT   misc_feature    875679..875747
FT                   /note="1 probable transmembrane helix predicted for TA13825
FT                   by TMHMM2.0 at aa 187-209"
FT   CDS_pept        876151..876750
FT                   /locus_tag="TA13820"
FT                   /product="hypothetical Theileria piroplasm protein"
FT                   /note="chr2.C.cand.219 - hypothetical protein, signal
FT                   peptide, transmembrane, low similarity to ts-chitose type
FT                   23 kDa piroplasm surface protein"
FT                   /note="1 probable transmembrane helix predicted for TA13820
FT                   by TMHMM2.0 at aa 176-198"
FT                   /note="GPI-Anchor Signal predicted for TA13820 by DGPI
FT                   v2.04 with cleavage site probability 0.24939999 near 174"
FT                   /db_xref="EnsemblGenomes-Gn:TA13820"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74431"
FT                   /db_xref="GOA:Q4UEQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ8"
FT                   /protein_id="CAI74431.1"
FT                   /translation="MLIHFKINLIYLTLLFGIIGLNGEKNEQVTIDINKDATNPRKNHY
FT                   IVNRDIVSIAPDGYTEHIYEDDSLFDITNLFFGKKKLEVGTKELSAKSVEKVGVFWKHE
FT                   TPVLLYFKQARTVNNKVYIYYKLTSKKDWAKVDLTEELSKRLPLSGEDLKNVLTDIVND
FT                   LGEIPEDRPISGIGSFHLSSISISLLLPILLTIFFQ"
FT   misc_feature    876676..876744
FT                   /note="1 probable transmembrane helix predicted for TA13820
FT                   by TMHMM2.0 at aa 176-198"
FT   misc_feature    876694..876699
FT                   /note="GPI-Anchor Signal predicted for TA13820 by DGPI
FT                   v2.04 with cleavage site probability 0.24939999 near 174"
FT   CDS_pept        877110..877751
FT                   /locus_tag="TA13815"
FT                   /product="hypothetical Theileria specific protein"
FT                   /note="chr2.C.cand.220 - hypothetical protein, signal
FT                   peptide transmembrane, low similarity to ts-chitose type 23
FT                   kDa piroplasm surface protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA13815 by TMHMM2.0 at aa 4-21 and 195-212"
FT                   /note="Signal peptide predicted for TA13815 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.975, signal anchor
FT                   probability 0.012) with cleavage site probability 0.664
FT                   between residues 16 and 17"
FT                   /note="GPI-Anchor Signal predicted for TA13815 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA13815"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74432"
FT                   /db_xref="GOA:Q4UEQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ7"
FT                   /protein_id="CAI74432.1"
FT                   /translation="MSILFTFICASVLVGAYYVSVDIDWRATDSSSTHMITNNKTKELC
FT                   PDGYTKFVAERPDCFSVSGVRLGNQSIQVDGSDIVLHYIYGIESYWKYNTPIMIRFKKY
FT                   HGWEDRVYPAYVLTKSGKWKEERTYYWEKNITTGHLRIILDDVLSDVKDIVEQEKGKGT
FT                   NSVEEDDEKRTREFEFFEGDKLRGKKSDFKSISVPLGFLVLHIFYILALG"
FT   misc_feature    877110..877157
FT                   /note="Signal peptide predicted for TA13815 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.975, signal anchor
FT                   probability 0.012) with cleavage site probability 0.664
FT                   between residues 16 and 17"
FT   misc_feature    join(877119..877172,877692..877745)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA13815 by TMHMM2.0 at aa 4-21 and 195-212"
FT   CDS_pept        877952..878641
FT                   /locus_tag="TA13810"
FT                   /product="ts-chitose type 23 kDa piroplasm surface-like
FT                   protein, putative"
FT                   /note="chr2.C.cand.221 - ts-chitose type 23 kDa piroplasm
FT                   surface protein, signal peptide, transmembrane"
FT                   /note="1 probable transmembrane helix predicted for TA13810
FT                   by TMHMM2.0 at aa 204-226"
FT                   /note="Signal peptide predicted for TA13810 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.930, signal anchor
FT                   probability 0.000) with cleavage site probability 0.401
FT                   between residues 24 and 25"
FT                   /note="GPI-Anchor Signal predicted for TA13810 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="EnsemblGenomes-Gn:TA13810"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74433"
FT                   /db_xref="GOA:Q4UEQ6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4UEQ6"
FT                   /protein_id="CAI74433.1"
FT                   /translation="MNKYFKVFFFVLLTHALKSSLIFGQATLQKGLSLDIDKDSTATDR
FT                   LVVKHLDSDKQGYKVYTFKKEGWEYVNVKHVYFGERLLRVGRDNDMRCDFVHYVKVFWK
FT                   GDVAPFFIKMNYYNWAWVSTRLHFKLNPDLTWTEVTVLTLDENAEQGFTTLFKQKLDEF
FT                   ASQVGDDVLAKYKPFVDDPNKKRFDLKATDEKEETSKKKYVLMVVVVVVFVVVASLVVF
FT                   LVKFCLK"
FT   misc_feature    877952..878023
FT                   /note="Signal peptide predicted for TA13810 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.930, signal anchor
FT                   probability 0.000) with cleavage site probability 0.401
FT                   between residues 24 and 25"
FT   misc_feature    878561..878629
FT                   /note="1 probable transmembrane helix predicted for TA13810
FT                   by TMHMM2.0 at aa 204-226"
FT   CDS_pept        complement(join(879945..880170,880412..881551,
FT                   881666..881790))
FT                   /locus_tag="TA13805"
FT                   /product="nucleolar protein nop5, putative"
FT                   /note="PF01798 Putative snoRNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13805"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74434"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ5"
FT                   /protein_id="CAI74434.1"
FT                   /translation="MLMLLETPAGYGLFKLTNDKMLECSAEEVYKYFEDSDTAKSSVCL
FT                   KSFMKFKNSEDAVKEANCLIESRLGKGLRKFLTKNILNKSLTDELAICDKALGMEIQNK
FT                   LNINVCFNPKTSEIIRGLRMQFHELVTGLSEEDTRSMALSLSHSLTRFKLKFSPDKVDV
FT                   MIVQAIGLLDDLDREVNKFGMRLKEWYGWHFPELDKIVSDNLLYAKVVKMIGMRENAKN
FT                   AKLSDLLPDDVCKEILQASEISMGSEIFKDDLESITELATRLEELLEYRQTLEQYLKYR
FT                   MNVIAPNLTYMVGELIAARLLSHSGSLMNLAKHPASTVQILGAEKALFRALKTRSNTPK
FT                   YGIIYHAGLVGQTSPKHKGKISRILAAKLALCVRVDALGESDKPTVALENKKYVENKLV
FT                   QLLSDGNQKRKLFKPTFNNDKKRILRSGYKLRSVIRLSARSLGAVINDPLVVFCLAPCC
FT                   VWPCVSPSLWACSPVLVSPSDSGLLGSMRGSFSGVLSD"
FT   CDS_pept        882073..882888
FT                   /locus_tag="TA13800"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.223 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13800"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74435"
FT                   /db_xref="InterPro:IPR035426"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ4"
FT                   /protein_id="CAI74435.1"
FT                   /translation="MDVNTYLNQVKLENDSLPKVVVIDTPKLRNFDSYEAAGTEDSKAT
FT                   RLFNRLIHIDEEYKKLDSGFILTDEELKYFKLLKSNIASIYGIQNDKLCSSIYNYARIH
FT                   FIDQSHDHTDSIQSSNTINSTNTNNTSTISKNVNDLSLNREEESVMWKMLMDSEPPPIS
FT                   TICNDGINYACTEDCLHILGDLICQFPGSPLLRNRAKWLFIILLILDELHSMTENVSYD
FT                   LQRIRRSLLRRSSMIESKELDTTEFSDFIDELCTIKLLSSLISTHFKQY"
FT   CDS_pept        complement(join(882952..883180,883254..883714,
FT                   883766..884003,884182..884456,884500..884514))
FT                   /locus_tag="TA13790"
FT                   /product="(Lariat) debranching enzyme (dbr1 homologue),
FT                   putative"
FT                   /EC_number="3.1.4.-"
FT                   /note="PF00149 Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13790"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74436"
FT                   /db_xref="GOA:Q4UEQ3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007708"
FT                   /db_xref="InterPro:IPR041816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ3"
FT                   /protein_id="CAI74436.1"
FT                   /translation="MNVSLVAVEGCCHGELDKIYQRIKNFELENSTKVDILFCCGDFQA
FT                   IRDESDLNELSCPQKYREYRDFRDYYSGVKLAPLLTVFIGGNHEAPDFLRNLYFGGWVA
FT                   PNIYYLGHSGVLNFCGIRIGGISGIYNQNDYTKGILLLKQLFKGYFESKPYNEQTKRSS
FT                   YHMREFDVKKLSLIKGKVDVFLSHDWPAGIENFGNLDQLLKIKPFFYEDIKNNTLGNPK
FT                   TMELMGKLKPTLWFSAHLHVKYEAEYKHEDGSTTQFLALDKVLPYREFLRIIQLDPDNS
FT                   SNKRKFESPDPVEVTPKLCYDREWCAILVANRDKMPLNQFSSVNPITLNEPVEKDFEFV
FT                   DQRFNESGYESLTLDGNTFFVIPFKDDDHKEPESQREAFMSLLDLPTNNYFRPGTQDKM
FT                   TVNFVE"
FT   CDS_pept        join(884680..884733,884768..884852,884887..884934,
FT                   885035..885198)
FT                   /locus_tag="TA13785"
FT                   /product="hypothetical protein"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA13785 by TMHMM2.0 at aa 29-51 and 82-104"
FT                   /note="Signal anchor predicted for TA13785 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.660) with cleavage site probability 0.000
FT                   between residues 47 and 48"
FT                   /db_xref="EnsemblGenomes-Gn:TA13785"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74437"
FT                   /db_xref="GOA:Q4UEQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ2"
FT                   /protein_id="CAI74437.1"
FT                   /translation="MENPSINRILTKISRILDKYIVPEYRWKIFTIYGTLLVLSILRLI
FT                   LGRSFLEVGLKVCSRYSRCLSFIRSSRSSTLKIIRTFYFIFSNVFPLLFPFIIASFVQL
FT                   ITPSFRDSDFYD"
FT   misc_feature    884680..884820
FT                   /note="Signal anchor predicted for TA13785 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.001, signal anchor
FT                   probability 0.660) with cleavage site probability 0.000
FT                   between residues 47 and 48"
FT   misc_feature    join(884798..884852,884887..884900,885091..885159)
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA13785 by TMHMM2.0 at aa 29-51 and 82-104"
FT   CDS_pept        complement(885258..886409)
FT                   /locus_tag="TA13780"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.299 - hypothetical protein, conserved,
FT                   pfi1425W, some similarity to tif"
FT                   /db_xref="EnsemblGenomes-Gn:TA13780"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74438"
FT                   /db_xref="GOA:Q4UEQ1"
FT                   /db_xref="InterPro:IPR006751"
FT                   /db_xref="InterPro:IPR037817"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ1"
FT                   /protein_id="CAI74438.1"
FT                   /translation="MDELVDELENVIEEDLNNVGSTEDGNKPSGSYANSQIEDDLEGSL
FT                   AGANTNLSDYTEASGSQLDNYNKPESTQPNDTFKGTEVKFEDSKTFTKKDVEIGRILAR
FT                   RGIFSTDVLNEETLFTGSTRTHDYQRTRRYQAADTNVKDLNDPGLNDKNCVLRLPEYAA
FT                   DLVRERQSKGEPLGITVSPTGRYDFREYKVEIKGLDTPLYAILGELPCVIEAHKTLNND
FT                   LLFKSADISQLMIAYEKDQADKVAEILKDRMWEWPDGLTPGTKNIRKKRFKDFNDYTKE
FT                   EIKEAEREILILMNGLVRDTYHFEIKTTQEVNDLVQNYRIGNIKERVIGPDEDVSVYIK
FT                   ALEEQENEELPDLSEIMFDSEIASIPNKFIYNNIKNRIFNRPT"
FT   CDS_pept        join(886659..886705,886802..887012)
FT                   /locus_tag="TA13775"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for TA13775 by DGPI
FT                   v2.04 with cleavage site probability 0.3306 near 47"
FT                   /db_xref="EnsemblGenomes-Gn:TA13775"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEQ0"
FT                   /protein_id="CAI74439.1"
FT                   /translation="MILKRNFTWTHLFYYWMPQVIIDNLEIPLFRLSLLGPVHSGKTFL
FT                   ANSLVNNVLPSVYKHTHLPEYTFIITYDFKIILNLNLASF"
FT   misc_feature    886797..886802
FT                   /note="GPI-Anchor Signal predicted for TA13775 by DGPI
FT                   v2.04 with cleavage site probability 0.3306 near 47"
FT   CDS_pept        join(887029..887161,887232..887659)
FT                   /locus_tag="TA13770"
FT                   /product="small GTPase, putative"
FT                   /note="all_bases.cand.1420 - small GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13770"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74440"
FT                   /db_xref="GOA:Q4UEP9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP9"
FT                   /protein_id="CAI74440.1"
FT                   /translation="MYTISPLELISKVPHVMIKRPFVSKSRTPLPISIYSISWIFAVPD
FT                   EYYDDSQSYIPFAFYDAPKSPFMEGDSYSPIGQRRMSFLVLFDVTSTESYLHALSITEL
FT                   LLSRNQTTGLHDPVVALVANKIDLVESDNELFSHAETYTQSKSIPFYRISCLTKKNVRN
FT                   MMKEMALLIYGNVRLWELVLRND"
FT   CDS_pept        complement(join(887721..888048,888110..888484,
FT                   888555..888755,888787..889034))
FT                   /locus_tag="TA13765"
FT                   /product="NADH-cytochrome b5 reductase, putative"
FT                   /EC_number="1.6.2.2"
FT                   /note="chr2.cand.298 - score = 10.43"
FT                   /note="chr2.cand.298 - NADH-cytochrome b5 reductase,
FT                   putative, Oxidoreductase NAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13765"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74441"
FT                   /db_xref="GOA:Q4UEP8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP8"
FT                   /protein_id="CAI74441.1"
FT                   /translation="MDLNVCIDVEQYVKKEKIGINLKNNQESYLYDLELVEKIKSSPTS
FT                   FVFVFEYPEEIRDVVEVDIFSAFMFIGTHDTPSIPGTWNGIVLDEEDHQVKRKYTPIYI
FT                   DVDKRLVHFLIRIYSPTDLYPDGGKFTRYLDKFLPTETITFMPLKQKYKLITDNTIKAL
FT                   GKRIEFDTLNIAAGGTGITPFIRLLNYYQDLPYDINLIYCNRSVEEIMLKGLFDKLASI
FT                   NKRLKITYLASSGVPSEDLVITRITEEIVSKKFINTEKAVCLFCGPPGFNDLFDNLNRF
FT                   VAKAIVLSKLVKLRLAQPMLKGSVEDSNKSLSVSVKAVSFLTKIVPILKLAQALSNKSL
FT                   VSSTVSKGTKKVGTVRLHNKEEQIWRVLRPGYEKQTKHLRWRK"
FT   CDS_pept        complement(889178..889861)
FT                   /locus_tag="TA13760"
FT                   /product="U1 small nuclear ribonucleoprotein 70 kDa,
FT                   putative"
FT                   /note="chr2.cand.297 - u1 small nuclear ribonucleoprotein
FT                   70 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:TA13760"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74442"
FT                   /db_xref="GOA:Q4UEP7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR034143"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR040252"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP7"
FT                   /protein_id="CAI74442.1"
FT                   /translation="MSALGMPPHLLVLFQARPPLQHVDPLPSKPIRQIDGLCGFLDSFN
FT                   SETPPKKEPFETPRQRRDKRKRERLLKYKEELKKKASQYDPSYDPRLARGGTSSWLTHD
FT                   PYRTLFVANIAYDVTEKQLSKEFQTYGKIRRVRMIHDRSNKPRGYAFIEYESERDMVTA
FT                   YKRADGRKISGRRVIVDVERARTVEGWLPRRLGGGKGKSRGAPPKFYDGKPLLPDKDKK
FT                   DSHKE"
FT   CDS_pept        join(890339..890428,890468..891790)
FT                   /locus_tag="TA13755"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.225 - hypothetical protein, signal
FT                   peptide, transmembrane"
FT                   /note="membrane protein, putative"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA13755 by TMHMM2.0 at aa 176-198, 285-302 and 322-344"
FT                   /note="Signal peptide predicted for TA13755 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.694
FT                   between residues 18 and 19"
FT                   /db_xref="EnsemblGenomes-Gn:TA13755"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74443"
FT                   /db_xref="GOA:Q4UEP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP6"
FT                   /protein_id="CAI74443.1"
FT                   /translation="MQSILLILLLLSAKLISSRLVNSKNVSLTTELLPHTGDNTNCKYH
FT                   ANKQHGCDSTDIHTNLNYSKSNSYNPTNTPHNNTSVNLITNERRVNDDNAYNDKPGNNE
FT                   RISRREGLDGKGESLSLLKSSSYKRAYDEITRKVTLMVCPFKPTPSLTKAVKHSLKALK
FT                   LYLVPSGFEKPNLLIFGFTTFFSALFGGAFLTVAGSDKVFAKLRDKWAFQGDFGNGSIE
FT                   SITRLGLMILVTDLLFRNTAMKSALFKSLSNSTFLTHANWMTNNLAKLDTTIFQKLFTG
FT                   CAKGYTVFRLLFTTLLHLVLMKTNWNTGSFMVDHESSRVLSGIFFTLFLVSLFGNLADV
FT                   FFYGNFSRFLDVQYVLEPLDFRETYKKLRVYEESKNLYFSLPDSLRGLYDTNSRLLFNL
FT                   YNVLQMIDVYIPYNVEWLFLYLQAAMALYSNSASGIYLSAVQYVYLAIEQCIMEVEKIL
FT                   LNEKVSFKKLFE"
FT   misc_feature    890339..890392
FT                   /note="Signal peptide predicted for TA13755 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999, signal anchor
FT                   probability 0.000) with cleavage site probability 0.694
FT                   between residues 18 and 19"
FT   misc_feature    join(890903..890971,891230..891283,891341..891409)
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA13755 by TMHMM2.0 at aa 176-198, 285-302 and 322-344"
FT   CDS_pept        complement(join(892321..892411,892443..892576,
FT                   892666..896166))
FT                   /locus_tag="TA13750"
FT                   /product="isoleucyl-trna synthetase, putative"
FT                   /EC_number="6.1.1.5"
FT                   /note="isoleucyl-trna synthetase, putative, PF00133 tRNA
FT                   synthetases class I (I, L, M and V)"
FT                   /note="Signal peptide predicted for TA13750 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.867, signal anchor
FT                   probability 0.000) with cleavage site probability 0.532
FT                   between residues 15 and 16"
FT                   /db_xref="EnsemblGenomes-Gn:TA13750"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74444"
FT                   /db_xref="GOA:Q4UEP5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP5"
FT                   /protein_id="CAI74444.1"
FT                   /translation="MLILSVLFIYVTVKSDSSCVYLTQNTNCKNILNQDYNKQNYTFIN
FT                   PLNIIKSWGTFKGRDELKTDYDDDQISKTINLPRNVWPSFPDVNEAGIERQERVQKYWE
FT                   EKNVYQKLFEKRFLNILKETKRYKYLLNHFKIIFDGPPYANGVPHLGHFLNKTIKDVFL
FT                   RFFLLKGHLPIMIPGWDCHGMPIEHKILKMYNTDDNLDRINKELIKHLKEKEEEPDPEI
FT                   DEMFKSVEHPLFTDEGSIYVKKYLNKIEDNSEEEKEEKLQKEKKNWTIFVRDKCQELAY
FT                   RNIKAQKIYFKNAGIWGFWDYYYATYHSRFEKLTMTTFMRFYDTGLVYKELLPQIYSTK
FT                   SKSVLADSEVIQKTKRVLTSFITFNVDLETCSKGVLKNLKAKMKELGLKDLKLVAWTTT
FT                   SYTIPGNKGLAVDPKGDYHLYRKGNSLYIMNDLPTKSSDPFWSEFKRVGSLNQLNSSVE
FT                   SKETQLNGSVKSNGPEFREYIIDGFDMGGLEYYDPVYGNKFSVYYGNYVDLKKGTGIVH
FT                   LSPAHGFDDYNTINADKRFKSSNNNNGFRYCNLFDKDENFYPDIHFGLVGMNIRDFNEN
FT                   NLLELLGENLLKYEYKDIEVDVDWRCENPVHTRLTKQYSLSLPQREEIVDLLNHIQITP
FT                   NSARKYLNNIIMARNRDWCLSRQRCWGAPIPYEDKECLMTYESFEEGISDRVWKKSNRI
FT                   LDTMDIWFESAMVSKYTIEMAVYIIKEILESKNLSYKKKIEEVLKGCKKYVIEGQDQNR
FT                   GWFQSLLIVDMLTKTAAKLSKTSEYMERINRIIKNNKPVEKKVPPFDNLFTHFFVKLKD
FT                   QKLSKSKQLPKLDQNLERALNGTKELVVTNRDVDTKYCLYKPGVGDHKIDVEFSQVKDK
FT                   IKPGYDIPQLLQTSTNPDNLSTKGSSELDKENNMYMNVDLLRTLVCNNDFLSHDLDLSV
FT                   DSFKSSQQLQKKIVNCFKYIIGVLTESESEPEPSENMLPVGSVNNDTLNSKMDDDIKAD
FT                   WSVISIPDIGISTVKKSQLSGMDLYFLSQAYSLAESSSEYYRKGQFFKVLDMVEKFITS
FT                   LSSVYLSYIKNFLYVYKREDEKNKAIRFVLFKILYILLRVLGPIVPHMCEDIYRSINPE
FT                   SISLFRRRWPVRPKTLTDVTESIGTALTVRKLINKQHAHSNNFILRLENNQITEVLRLI
FT                   QDQYKVDLNLLFNVAGVEFVNKLKNGHGDGIVKYDLVDSKYKKCKRCWLFKKSVGENLL
FT                   CDQCQEFLNNYYTKTK"
FT   misc_feature    complement(896122..896166)
FT                   /note="Signal peptide predicted for TA13750 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.867, signal anchor
FT                   probability 0.000) with cleavage site probability 0.532
FT                   between residues 15 and 16"
FT   CDS_pept        complement(join(896245..896319,896414..897304))
FT                   /locus_tag="TA13745"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.294 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13745"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74445"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP4"
FT                   /protein_id="CAI74445.1"
FT                   /translation="MDNSPITVSDDEESQSLPNHGNELANGTSKDYDQMDSDYTPAPRF
FT                   LLVDKSSGKDIKKVQKTRKKRYTASKDFLDSIPFWVNSPKDVRDIPSHIKMICERLIHV
FT                   EKQIKKFCIERQGLLSTLWKLGGDGYINLFPDPVLKSLTFYGVSNGSEENDIYNDEKDS
FT                   LDSEIEDKLNYNNLYSSKLENGDLKMWKSTWMTNESEASPIKTPTQTPTQIPTIKTFVS
FT                   NYIKSCGSSSEFGISTGMNDSKKSSYTNESNGSRDSEEYEREPIEFFKNLDFSKLNEAD
FT                   MEAWRKFFGLKVYNYIKMEDEEMVKELVKIREHLLSFIDV"
FT   CDS_pept        join(897783..898054,898086..898449)
FT                   /locus_tag="TA13730"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.226 - hypothetical protein, conserved,
FT                   pfl1195W"
FT                   /db_xref="EnsemblGenomes-Gn:TA13730"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74446"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP3"
FT                   /protein_id="CAI74446.1"
FT                   /translation="MNTLILSGIKSNLEIINNLVYKHLVNTKYRNYGVSGSYGASIYGV
FT                   QNTATNSRLVKLPPQKPKPTISINPRLHVSRWPGNIRSLRSNYFFRDNQKTNTGYYQML
FT                   IKEGDEVKKDLCFVSNIEKNLTCTRTIESCLSEQTRGFVGQVLLHGRGVKAYFEPEFPH
FT                   LMFRLGVGSKCIDATRICTMYSKYVRVEVDRTGESIVFTYFRAQLINA"
FT   CDS_pept        complement(join(898693..898804,898834..898938,
FT                   898981..899058,899090..899163))
FT                   /locus_tag="TA13725"
FT                   /product="RNA binding protein, putative"
FT                   /note="RNA binding protein, possible branch site protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13725"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74447"
FT                   /db_xref="GOA:Q4UEP2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034150"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP2"
FT                   /protein_id="CAI74447.1"
FT                   /translation="MLNSVYPSKKNIRLPPEVSRILYLRNLPYKITSEELYDIFGKYGS
FT                   VRQIRKGNSATTKGTAFVVYDDIFDAKNALDHLSGFNVAGRYLVVLYYNPARVNKRKDL
FT                   DKQEADLKRIRTAMNQNN"
FT   tRNA            899311..899384
FT   CDS_pept        join(899955..900056,900203..903092,903193..904841)
FT                   /locus_tag="TA13720"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.227 - hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA13720
FT                   by TMHMM2.0 at aa 1524-1541"
FT                   /note="Signal peptide predicted for TA13720 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.000) with cleavage site probability 0.683
FT                   between residues 19 and 20"
FT                   /note="GPI-Anchor Signal predicted for TA13720 by DGPI
FT                   v2.04 with cleavage site probability 0.516 near 1520"
FT                   /db_xref="EnsemblGenomes-Gn:TA13720"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74448"
FT                   /db_xref="GOA:Q4UEP1"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP1"
FT                   /protein_id="CAI74448.1"
FT                   /translation="MIKILIYSFLILLSHICYSHPQITEYYDINEVNKLSQFELDRSRF
FT                   DISLQSNLQISEYGFFDFSHPFNGRSIRISGILLPRDIEVYLRILSSPVLHNPPYNISL
FT                   GQDERLMRHLGFVKGVVTLPQTGAAYEIIERILRNQVSSLTRIKDLYKPEQTWPTYLDN
FT                   RAAYTNLWKHATNLFTVKLHPEDKMYYYLVNGQVQVFKYHISFDKTKFQDLCLLLGYWN
FT                   FDNISIPDYLVKDFEAELNHADRSNYPETFFSKIEDLATDLNNNKLYKKYFDHSQNVKD
FT                   TSIFFDDFFDLDDLENSFVDSEHNEDDVTEVNFTVKDITDTVYSLGNGNGFTNYRNPMD
FT                   ELFTNQHLKTSPANLQKYVSGNGITFDPNAIKLDFDKIGSKISENETKSRDTSETKSSN
FT                   NNEVKNINKFENIRVVNWVGGLSWEEAMRVESRRVARVLIKILYKATRNMMKSHNIDIS
FT                   SIQRKRIKLYKTTLYSRCVNKLRNMINNSRLLTNKYDGILLDEEAEEILFESGSKYKVY
FT                   WNFKNDSLYNKRTVSDRSADLSQRFIEELLFEPNRFYNKLINISGDSIDFKQVYDILLA
FT                   LTQETTAYVPKHIFSNTNNYHYNKTIGSGNKYKYVYNNTSVNFSRRIDTMVGKVLEQYR
FT                   SLPSNANNLLRGRAKCLMAFLYLFGVSDSKGVVNFPHGWPRHIKKSMTLLISGMSSPCG
FT                   LCNTLLGFLASIGFPPVSNNMYAWETRKNDEETTVYQLISGNLYNSFLKYSGSSVEIPS
FT                   FDSFDFKSKSSNNKSKQSDKSNSNVKMNNTSDKLNVDASNKKDEKVNNDEVDDTNILVD
FT                   RSGYDLPLLCYLSGSYKNDELSSLAYSYYIHSGIGNPSRTCQKSAQSSINRSPKNVGMM
FT                   CLEAIPYAIESAKSSMKNKHDQFHDTSDEYKSKRYAEFIKKLSHMGDSDGLRMMGDFYY
FT                   TGHEQAGIRRNYQQAINFWSRAAESGDPSSALAIAHHHLSNLQTDDSGHSAVQAERYLR
FT                   MVLNSSSPNSSAFSTANFYLYRHGLGQPRDSAMAARYLRESADRGDVNSMVLMGHSYAG
FT                   ILTDVTPPEGRNIFMSFYYYRRAAQSGNIVGLFNSAVFTLHGYDLEYTSALDRCNEAYK
FT                   LFSRVARMGTMSTALKVLSKRAKNNNDKIGHVLMNMLLSELGDSNAHRELSKHFKTNSV
FT                   FCYTESLDPDITSPTTLFSAKNTSNSNNPVTFKNFQLIQNLMSKSNTPERDNTFYDAQS
FT                   EGLSRGSTLGNMGANTNLTGTLTNTSPRVSYQDRNEVNRLTREIRMLNMVRVTEMPEDP
FT                   EVDLRTRGLWNRDDSQNVSIFETIMSGNNKNTSPNTKSQNNTAQSNTKTQNTTTTSNTP
FT                   QASENELNVTESVVTGMSESEHGKTESGGCYYYYSRRGAYSPQNSTPLLLAEALLSGKP
FT                   WLPSEALFWAKRSKESDSLKGSYMYATMMEAGLGAPKNCQASFKIFKEFMSSKSRGERI
FT                   LGLVCILRNKIISKVRHPHFLYTFLVKFLYDSYAFNNITHSSYTPCNYTFFDYDRIPPS
FT                   GLKLLSFIYLFIVLFTLIVYFKITSH"
FT   misc_feature    899955..900011
FT                   /note="Signal peptide predicted for TA13720 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.000) with cleavage site probability 0.683
FT                   between residues 19 and 20"
FT   misc_feature    904512..904517
FT                   /note="GPI-Anchor Signal predicted for TA13720 by DGPI
FT                   v2.04 with cleavage site probability 0.516 near 1520"
FT   misc_feature    904770..904823
FT                   /note="1 probable transmembrane helix predicted for TA13720
FT                   by TMHMM2.0 at aa 1524-1541"
FT   CDS_pept        complement(join(904904..905143,905234..905361,
FT                   905454..906424,906530..906696))
FT                   /locus_tag="TA13715"
FT                   /product="5'-3' exonuclease, putative"
FT                   /note="chr2.cand.293 - 5'-3' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TA13715"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74449"
FT                   /db_xref="GOA:Q4UEP0"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEP0"
FT                   /protein_id="CAI74449.1"
FT                   /translation="MCKKMCRKKERRNGIFGELFEEIINKGPICYINFIKFCKIISIIN
FT                   VSTQRTHNHIINFYHGIQLTHNHNKYRNRNDNYLNKPSKYRSSNFANISNLKNELKRLC
FT                   YISTTLKGINLGYKTESANSPERVMIVDGTGLAYRCFFALPDLKTSKGTDIGCLMGFMN
FT                   SLARLHRMFDPKYIGVVFDSPGANDEKRDIWPEYKLNRQVVSYSFRNQLGWIREFCAIL
FT                   GLPVFIEPSTEADDIITSMITFFRESSKKLDQPNETPNDSNKTRNTLDQTINKLAESDI
FT                   KYPNEVIQKSVRGIFDKYSQELNGNSVQALPYREYPVTSENDIMSNGVYRGYDITVVTA
FT                   DKDLLQILSQNDVNKINVKIVQPHKSYRIVNQHTVKQEYGIEPERFSEYLALVGDTADN
FT                   IPGIMGIGPKTAPKLIQKYQSFDDILRSEEISKLSSKGGKYRESVRMAHEFHSIVKLKR
FT                   NLRVLKSMDQLVKSNALTCQLSKFLKMFSLQKASSKWSMFTKP"
FT   CDS_pept        join(906863..906979,907047..907156,907226..907259,
FT                   907292..907349,907402..907499,907564..907686)
FT                   /locus_tag="TA13710"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.228 - hypothetical protein, conserved,
FT                   pfb0177C"
FT                   /db_xref="EnsemblGenomes-Gn:TA13710"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74450"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN9"
FT                   /protein_id="CAI74450.1"
FT                   /translation="MFSYVNNRKIYGDEIPPSIEIRNNSYNIHPRFLNHRPYHKMNLKV
FT                   LEELPENYPIYCYEMSEVKEIIFTDEIVAVLMKSGLARAFDLISGVLKCELNPDINSIH
FT                   FPCVHTIVYNKRNDTLIIAYSSFPSHLQCKVIYCQYLIEGKMLSPTSSFNFEQVVLNHP
FT                   AYFEFCGYSSTILPSI"
FT   CDS_pept        complement(909289..910296)
FT                   /locus_tag="TA13705"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.292 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13705"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74451"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN8"
FT                   /protein_id="CAI74451.1"
FT                   /translation="MNCYRKDERFDFISNDNEYKCEEKEGCLKEPKEVIDKRFKPDRCV
FT                   CLDIYHREIGPDNYEQYKENETLVTKFKQDCAKIKYEGYVLFDVLLTPGFGLVNQMIFN
FT                   GSDSKIELISGSDKIVINAIGAQLTLSRPGTNGSLIPLRPASYEMVKCEGDRSLTTLTG
FT                   KEICTHVALNGVPKWRGTVDGPKLISILNDQVNPMLILRFPKCFLLITLQDETFSYTIP
FT                   IPPIRAFYDFNGQETVIPDEVIELKVSDKNNISFTFDKKITIKKVKLSNFKLLSDESDG
FT                   FKIKSVEYHDIEKKLIYRTEKEAITHFLTEGHKNLITRLSERESAVVLDGVIIS"
FT   CDS_pept        complement(910845..911786)
FT                   /locus_tag="TA13700"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.291 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13700"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74452"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN7"
FT                   /protein_id="CAI74452.1"
FT                   /translation="MKEEFSSQSFEGITPDFITLDSEFTALTTHSSARHKTQKELEKEE
FT                   ILRKLQGLVSGDRLFFKKSTLGQQVSNPEIPTTNDFVESKFVYWIYDKMSIYLLVNIDP
FT                   YGKLRFTYGDLYQMAVSHDLFFHKLETRFVKNIKSEHTGYKRAESTKTQTTQMDPFPME
FT                   PSYFRQDSEIKQKAINYDIKSRPTPAGVESFCRCKFSNKNEFIKKLRLIIKTNKSKFMD
FT                   KTAEMKELRLIMSQNIRTYEVEIMGYIMDENPWTYSTNPWDEPEEEKVKEIIEMYKKAV
FT                   NDPVYKDMYQKWLNKYKLQINQAGTHMIQKIK"
FT   CDS_pept        912057..912425
FT                   /locus_tag="TA13695"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.229 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13695"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74453"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN6"
FT                   /protein_id="CAI74453.1"
FT                   /translation="MLINKFIKIKHINSHLFIYNSIPSEATFKNYNPSISKFNLISTNQ
FT                   YYTSNSARESEKFKEFSRYLIESETERRNRKLKELTVQNYLKKLKLRERNLARPPLIYE
FT                   GPVYLNYWLRRRRSGARK"
FT   CDS_pept        913250..914152
FT                   /locus_tag="TA13690"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.230 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13690"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74454"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN5"
FT                   /protein_id="CAI74454.1"
FT                   /translation="MKTDWEKYTHLQLFLKYSLNSQKNPSQIVNHILSFVNFNSNSNVP
FT                   INVNDSSEKRKLNHLSNYCKIRKINNDKANNCNYIENGNHISNIETNTTNTNNTNNTNL
FT                   TIREENNSIEDTSANDDRNVENGSDLIFDMKYCSLQLPIPLEVYQSDEGLYTLESDQSE
FT                   LITSYDVCFDEEMASNFIMVEPFRFLCKVHITFDDKLGHQWCCCYFDARGNCTKKRFNT
FT                   SSLAFNTAKMLAHRCKEAAEHSFHNIWILKHKDALNWPIPTNLTNSFIDLIDKVKNELT
FT                   NKNCPNCSINNIKHILNSF"
FT   CDS_pept        join(914489..914544,914638..915116,915172..915325,
FT                   915350..915557)
FT                   /locus_tag="TA13685"
FT                   /product="hypothetical protein, conserved"
FT                   /note="1 probable transmembrane helix predicted for TA13685
FT                   by TMHMM2.0 at aa 273-295"
FT                   /db_xref="EnsemblGenomes-Gn:TA13685"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74455"
FT                   /db_xref="GOA:Q4UEN4"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN4"
FT                   /protein_id="CAI74455.1"
FT                   /translation="MQDHSFNNISKHDLHNAIRKIVRSDNLSDLTAGGVRKKLSEHFNT
FT                   PKEYMDTRAQEVSSLINEVLREIAITSDQSHDHNANTDQTEDVLLRKMVDTDKFPDVHS
FT                   KHSKTPLKVNTSVKYSSPTKHDNSTMKYEMKHDEKINYIELKSESPVKREYEENVQSDI
FT                   TTESLEPPRRVSKLQRDLMTKDFFLNNAKSIEIKLQESDPIFALPRLFSTGSCGWYCFQ
FT                   VFTIFQEFRRSRSLLPSWIQLHRYFSTQPYTFLKNFQSSEVKTGPTNFPHLLIIFIISI
FT                   FHISHLYFNFCIFWSIF"
FT   misc_feature    915477..915545
FT                   /note="1 probable transmembrane helix predicted for TA13685
FT                   by TMHMM2.0 at aa 273-295"
FT   CDS_pept        join(916074..916471,916548..916905,916948..917803,
FT                   917847..918946)
FT                   /locus_tag="TA13680"
FT                   /product="DNA replication licensing factor, putative"
FT                   /note="chr2.C.cand.232 - DNA replication licensing factor"
FT                   /db_xref="EnsemblGenomes-Gn:TA13680"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74456"
FT                   /db_xref="GOA:Q4UEN3"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN3"
FT                   /protein_id="CAI74456.1"
FT                   /translation="MQGFAKLGIENVDEYEQDMLDDAVYELDPKDRRAAERRMRFRDRA
FT                   RTRGTEGDRAMHKQLWRKILDMADEEFEDNLFARISERVTKRRTDFATAEAEAPDISRL
FT                   ESAKAVLHSNPNEVTFDEKYQQAIDSCFRYFLYRFKLSDDAPNYYYKSKISTMIREDKT
FT                   VLRVAAQHLLQFHCENVITWLEFRPSDVLPVLHDCLTFEVSKLKEELYKKRYCKVAITD
FT                   WPFTTQLGLLRSSELNTLIRVSGIKVTMPLAILINIIGIVIRRGSVLPRLRVLYLKCNS
FT                   CDNTLSELPIYFSDTIKPVFPKRCPYCRSPGFTVDRINTEYTDYQKLTIQEPPSSVPAG
FT                   RTPRQKIVILTGDFVDSVKPGDLVDVLGTYKTRYDLGLNIKHGFPILHTELEANNIERQ
FT                   EDSLSFELTEEDISEIKRLSRDPCIRERLIASVAPTLWGHKTAKASVLCALFGGVPKGI
FT                   LSTLNSANTGSGAGGHRIRGDINVLLVGDPGLGKSQLLQYVHKTANRSVLTTGKGASAV
FT                   GLTAGVRKDPITGTLRHNFVREWCLEGGALVLADEGFCVIDEFDKMTDKDRVSIHEAME
FT                   QQSISISKAGIVTSLRARCSVIAAANPKFGRYEPALTFKENVDFSDPILSRFDLIVVLR
FT                   DIPNIEEDLLLSEYVVTNHQLLHPRLDNVEDYENVLKRLQNTLLSSNIVEPISTDLFKK
FT                   YVYYARKNIKPMIGQEYYSQIEGKLSGVYSRIRQRTFGGGYPLTLRHIESIIRISEANA
FT                   KMRLSNVITSEDVDVAIAMLLESYISSQKYSVATRLSMEFTRYRALFTGNDELLTQLLK
FT                   GSLQHQLQVQLRKQYVNQMHHTDGTDVDMENMENIVGMESNISVMLFIKICNRYKFGED
FT                   QVNRWMHSSQFKKHFKLYHDQNGNQLITSTLT"
FT   CDS_pept        complement(join(919057..919239,919271..919355,
FT                   919387..919443,919495..919619))
FT                   /locus_tag="TA13675"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.392 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13675"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74457"
FT                   /db_xref="InterPro:IPR031731"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN2"
FT                   /protein_id="CAI74457.1"
FT                   /translation="MLNDDRKCSKDLNEYYKCLSGSGRDPSKCQTQEIALRKCSTTDKE
FT                   NDYCLNELLELYRCTKKPDANGCANEFLLFRECNRPGGPEILVKDEMYKVNLKHLDKYN
FT                   LSSNVICPVNPPKRSMKNISKLLEQMKQVCGFKNFQEKFTPQVKS"
FT   CDS_pept        complement(join(919843..919884,919905..920126,
FT                   920174..920267,920346..920476,920528..920706,
FT                   920726..920833,921155..921191))
FT                   /locus_tag="TA13670"
FT                   /product="ubiquitin fusion degradation protein (UFD1
FT                   homologue), putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA13670"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74458"
FT                   /db_xref="GOA:Q4UEN1"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="InterPro:IPR042299"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN1"
FT                   /protein_id="CAI74458.1"
FT                   /translation="MIQENNLLKNPYAHTSNYRCFSVSFAGRESMEQGNKSIFHSLIFS
FT                   FSLILLPQSALHELASRNISWPMMFEILNPKNYKRTNGGVLEFISEEGTCNIPYWVIFY
FT                   TIDLVMSNLGLNEGDIVTITNVSLPKANWVKLKPLNEDYWDISNPRAVLENALRNYATL
FT                   TVGDVIPIHYIQTVYLFQIMDLKPAKACSIIETDMEVEFDMPAPEPKEEEKAMETDPEP
FT                   VIGKRLDGKTPRLIKQNVDTVNKTPWKNKLPNGIRLIWLLVFHIVVEI"
FT   CDS_pept        join(921279..921435,921498..921563,921604..921659,
FT                   921709..921805,921872..922017)
FT                   /locus_tag="TA13665"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.233 - hypothetical protein"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13665 by TMHMM2.0 at aa 23-40, 47-69, 74-91 and 104-123"
FT                   /db_xref="EnsemblGenomes-Gn:TA13665"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74459"
FT                   /db_xref="GOA:Q4UEN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEN0"
FT                   /protein_id="CAI74459.1"
FT                   /translation="MDYDEELRDTLKSDLFGSNSSHLMFMSVLILLSSGLHIYLSNIGN
FT                   SIANFILGFLTIFFIFNPSVVLIISLMTYSITLSSTLCLLLVITIIKQKVWTSHLNRKI
FT                   QLFLYLYDILISFVIFSILNKIWRSPCNMSNDVLPNWYYNELELNKQNIWMPFTGVGNT
FT                   LFKPNDNFNI"
FT   misc_feature    join(921345..921398,921417..921435,921498..921547,
FT                   921560..921563,921604..921653,921739..921798)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13665 by TMHMM2.0 at aa 23-40, 47-69, 74-91 and 104-123"
FT   CDS_pept        complement(join(922084..922210,922277..922438,
FT                   922506..922588,922618..923786,923832..923918,
FT                   923987..924143))
FT                   /locus_tag="TA13660"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase,
FT                   putative"
FT                   /EC_number="2.1.1.32"
FT                   /note="all_bases.C.cand.390 - N2,N2-dimethylguanosine tRNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13660"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74460"
FT                   /db_xref="GOA:Q4UEM9"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM9"
FT                   /protein_id="CAI74460.1"
FT                   /translation="MMSESLIKEGLAVVNGRGADNKPLFYNPPQVFNRDLSLIVLKTFI
FT                   LQEKDKIKSDPKFGTFVGVNILESLAATGIIIIEYTRIRGIRYLKELDDLVGMVTFNDL
FT                   DRKSAEMILKNLELNAIPRNKFRVTCCDANFLSNVLTPAPDISKHFLMSNNIYKIPVGS
FT                   FNSTDNITNILKHYNASVDKFIDLLSVNSNPTTTNGVDTNTNVMDEDCINRNIVDIIDL
FT                   DPYSSATSYIDSAVKCVRSGGMLLITSTDMPTLCGNNPLVSFYKYGGSSFKSPFCHELS
FT                   LRILLYSIMLTASKYKRVIEPLLSCSIDFYVRVFVKVVYSPEMCKKVGENSGIVLMCVK
FT                   CHSYHVLNLCNDYITVNRSINLDDSRVENAKRRRKEDFELSRTCQECGSRIKIGGPIYT
FT                   GPLHNLNFVQSTLNTLHNINSNITNTTGNGTIDGTKNTKATKDTNNIESNDGAENGITM
FT                   YKRLRGLLTTINEEVDVPLYYSISDLCQIWSLTTISPILFKEVLRSLGYKVSNFHRDPN
FT                   SIKTNAPNQVVMDIIRTHAKNTGKTTNHAFFNKPIQTIGIDLDKKVEKTKDVPRWFPNP
FT                   TSHWGPKKMHKTTSTSLK"
FT   CDS_pept        join(924794..925976,926055..928789)
FT                   /locus_tag="TA13655"
FT                   /product="calcium-transporting ATPase, putative"
FT                   /EC_number="3.6.3.8"
FT                   /note="chr2.C.cand.234 - calcium-transporting ATPase"
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA13655 by TMHMM2.0 at aa 69-88, 98-117, 216-238, 271-288,
FT                   309-331, 1049-1071, 1156-1178 and 1193-1210"
FT                   /db_xref="EnsemblGenomes-Gn:TA13655"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74461"
FT                   /db_xref="GOA:Q4UEM8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM8"
FT                   /protein_id="CAI74461.1"
FT                   /translation="MLEEEKLKLLESPHVYDSSEVLKHYSVNLDYGLNDEQVILHRELL
FT                   GSHSFLKPKKLSLLHLFIQQFDDLLVKILLSAAIVSFFFTCFDPHETKNISSFIEPIVI
FT                   LFILILNALVGVWQEANAEKALDALKKLQPTLTTCLRNGVWTTFDTENLVVGDIVKVKN
FT                   GDKIPADLRLVKVLSTALLVEQSQLTGESLLIYKTTEALDKSEKTCDLQTKRNILFGST
FT                   TVCSGTGIGVVVAVGMDTEIGTIQSAVIEASTENTTTPLQKMLHDFGNSLSKAISVICL
FT                   LVWLINVKNFNDPAHGSIIRGSIYYFKIAIALAVAAIPEGLPAVITTCLALGTRKMAKK
FT                   NAIVRKLPSIETLGCTTVICSDKTGTLTTNKMTTVVVNLFNQQNKLRYIHMPHQGDGIR
FT                   VTMGGFGENGMYVAQSFDGPVENLTHTFLKCASLCSDVTFSTLHHKNNRKLSRFSSSGM
FT                   DDDGLVLEGEPTEVAIIEMVNNLGKFLTQCDSSHLDQMGQVIFSSPVEENNSSNIKKMK
FT                   RWKKNLLQNNNLVNRSRSDSPNSHANTNSSAESNTNTNTELVNDVETDDGMSKVRNETS
FT                   TLKKGQLTGRAGQTVPIPISALYRKYLIKEATLEFCRSRKMMSVICTHSGSCVGNSSGG
FT                   KGSGRSNKNKMYLYSKGAPESILEVCTSYMLPDGSVNKLSKSEKTEILDHVKQLANEAL
FT                   RVLAFSYRSASQKDLDLYNTLLHSSPNTTTNANDTMKNNSVFSKIEKDMVFLGLVGIMD
FT                   PPRPEVKDSISKCMRAGIRVIMITGDNKLTAEAIARKVGIIKIPLSISNPSLSLSPANA
FT                   NFCGSPKFSYANPKFSYSSPKFGHASPSNSRFGGSPKFSGLLHGGSLFSSLTGKEFESL
FT                   TQDAQRKLLTTSCLVFSRTEPKHKQSIVSILKDLGEIVAMTGDGVNDAPALKMADIGIS
FT                   MGINGTEVAKEASDMILADDNFKTIVSAIEEGRCIYSNMKAFIRYLISSNIGEVVSIFM
FT                   TAMLGIPEGMLPVQLLWVNLVTDGPPATALGFNPPDPLVMKKGPRHRNDKLIDRTTLLR
FT                   YMVIGLYVGLATCGIFIQYYVFGISPNEGNTLISLKKLMNWGNCMNWEEFHSSLIYDMS
FT                   NSCEYFTVGKVKASTLSLTTLVILEMFNALNALSEDSSILKVPPWSNPYLICAIFFSIL
FT                   IHCFILYIPFFSSLFNVVPLDVYDWKWVLIWSFPVLIIDECFKLCKRSYKKYSKPSLQS
FT                   NQAVSEDKHDSFDNNNLNNQNMNGENLHGDEMWMSGSTDLSFGERLTNSLTSLLDKVAT
FT                   SFSNSASYDLSNQEKELAPQY"
FT   misc_feature    join(924998..925057,925085..925144,925439..925507,
FT                   925604..925657,925718..925786,928016..928084,
FT                   928337..928405,928448..928501)
FT                   /note="8 probable transmembrane helices predicted for
FT                   TA13655 by TMHMM2.0 at aa 69-88, 98-117, 216-238, 271-288,
FT                   309-331, 1049-1071, 1156-1178 and 1193-1210"
FT   CDS_pept        929200..929859
FT                   /locus_tag="TA13650"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="chr2.C.cand.235 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13650"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74462"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM7"
FT                   /protein_id="CAI74462.1"
FT                   /translation="MPSCKVKKPAEHRVELKDNKPVLYMRNDKNEEWSNVTHTNYQVEL
FT                   LKFVDGVFCENTYLECDFNLLGSVFEIIFNFICSAVKYDERFIWSYWVDPFQGYPSSLL
FT                   FDVVQNTLNLTFKNGNTTALDMRKYFITGKGTDNCGGEFQYVRFNRTVSAVYARESNLN
FT                   YLKFGENIVWARKSHEPHPVSFIFQSNSQVVIVSKNRFTTCTFQNYQWLQTITYTN"
FT   CDS_pept        complement(join(929924..931206,931275..932631,
FT                   932717..933465,933531..933666,933734..934069,
FT                   934127..934513))
FT                   /locus_tag="TA13645"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.285 - hypothetical protein, conserved,
FT                   mal8p1.134, contains 5 x SMART SM0239 C2 Protein kinase C
FT                   conserved region 2 (CalB), transmembrane domain"
FT                   /note="1 probable transmembrane helix predicted for TA13645
FT                   by TMHMM2.0 at aa 1395-1414"
FT                   /db_xref="EnsemblGenomes-Gn:TA13645"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74463"
FT                   /db_xref="GOA:Q4UEM6"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037721"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM6"
FT                   /protein_id="CAI74463.1"
FT                   /translation="MGDVMYYIKVDIHEVKDVLYKEESTEREIIPNVFVEASFKDYSNY
FT                   TQTKEHSSNAFFNASFNFTPKLSPSEFERGRIIVALYHKEGIASYKKLIGHHAFSLPLI
FT                   YSKQQHCIHRSWVKVFNPNFPTHNAGSMLVSISVSAPGDKPAVFKDDDLSGQGLGTDIA
FT                   QTGIRFNKVPEMNLKNYMLYLNVVCGRDFMLKNLSYSEIRPSVRLSHFGIFEETPPMND
FT                   NTNPEWQTTLYIPCLTPSFDETVTVEFYNGTELLQFESIDLVHLINNGFPPKWINIYSK
FT                   GVGNQNSNLLGGILKFFSDSTSSLTDYFGRILISASAEQVQTLYVKGIKPCRSISLPPI
FT                   QERKIAVDIYEIVSLDHKYRFIEVIISQGIFSTKSRVFQLKNNGSYEINDITGRLQVFE
FT                   PSFSCTSRTIYSYIIIWLISCNNGIANDDGDLCDFFIYVNSLSDGTCERVSWARVPYEK
FT                   VKNSETKPMWILLSSFANEPIDLFNILLSFEVSSNIAGFERKERIKYNLARYNFRCMIY
FT                   EAFQLPCLETNCYPSSYIEVELSGVNIKTGLARDSTNPYYFCSREEEVYLPTNLLLAPN
FT                   INISVFYEQSSVFSRPRLVCTGQYSLTNVPREWTWAPQWLKLRSLLNPMHKPRVLVAFE
FT                   LIPSAELTRSPESFPFFEDIVPSTRSCILTLVLLGIRTFSLLENPRVQIRFKGYDTFID
FT                   PECHSHKTANGHNSHNSGNLGEGFDILNVTGKATSGSYGNWNFLTTHVINLELPKRMHH
FT                   HSCLDLQVICDNSAGPLGSTVLTLNQYFPWLTPTERKLSNEMFRMELIDCFNSSAPSNT
FT                   VNINKNLEDVNNINVEFVDEIDAVSKHKSRFHAIDSNTNINASVNSVDNNCVGNDVTSK
FT                   SKIAMEGHNNIDNITSETTSASDARDTVIRIDEGDEVDKLIDEDELDFEILIDDSMNSL
FT                   MREEISYELEAEMTEEAFQYKKAPILRFNENGIPEVIGILKFIIQIQESSNNRQQQLKQ
FT                   IEIMQREADEKIRRFRSMWDDAKDLVVRAYILEAKGLYTSGLINDSISIKNITGEDLTY
FT                   IWIRNIDDQHTNTGNTINNNNTRSSVNRSMLYPYSIKDLNNGKKGLKPIFNQCYNLSCS
FT                   LPENSILRVSVMSKSALSETIIGTTYIDCEDRFFNARLRELMLGELAPVESRVLRGEEQ
FT                   QMGETISRGVLRMWLEVLRAEDARAKPIQNLGSLDPANYELRVVIWRARCFSDETSEIS
FT                   LYVCGFYQNELGEFVQKTDTHYHSKDKIGIFNWRFKYLVTIPTEYTNLKLQLYSYTLLK
FT                   DEVIGEANIDLGYEFHRVWKKNRLHSIPKFTANLYSLADSSKIVGSVDVEISLLNESDS
FT                   KRYPVGAGREEPNRDPYLPKVNQNRNFVDFAGFGDTFVNFGNKIISGIKTTGAIIVVLS
FT                   IFALAIVILIIIK"
FT   misc_feature    complement(929930..929989)
FT                   /note="1 probable transmembrane helix predicted for TA13645
FT                   by TMHMM2.0 at aa 1395-1414"
FT   CDS_pept        join(935215..935384,935439..935512,935567..935655,
FT                   935727..935840,935875..935943,936026..936084,
FT                   936115..936250)
FT                   /locus_tag="TA13640"
FT                   /product="CDK-activating kinase assembly factor, putative"
FT                   /note="chr2.C.cand.236 - hypothetical protein, possible
FT                   cdk-activating kinase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:TA13640"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74464"
FT                   /db_xref="GOA:Q4UEM5"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM5"
FT                   /protein_id="CAI74464.1"
FT                   /translation="MLVFSPFNPEFLVASQGSYTQCAICRCHLTRHSFAPYDMSSFYYE
FT                   NYKEARKRVLQVYNDTRSNFKNTPEYNKYLEDCESINESRLKSIEQELRNYERNNTLRI
FT                   SRNIENQKSEHKKLIRSIVEKEKNFYELVDKGAPFNLWKVDEFIHPLKKSCPNYFTDET
FT                   TVISTSDSKPLNAAIRNDSDIPRKVFTNRIELMESDVAGGYSKGSKICLMLILEIVFEK
FT                   CKSQFDALLLWNII"
FT   CDS_pept        join(936391..936683,936723..936957)
FT                   /locus_tag="TA13635"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.236 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13635"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74465"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM4"
FT                   /protein_id="CAI74465.1"
FT                   /translation="MLKITKKDNLSDCSTDVSEEGKVTLGQVVPDFIEFECTKTKMYKI
FT                   IAESYCIKSPEYSLNWEIRHCKVDLNVKSPLCEGIENKGIKKIKHEATLHTLKPGSEIN
FT                   ENYGKSNQVFGDIKNIKRNVYDDYYMGGRNGGYKPPKVYDLNGKEDLNGSMDIDSINDM
FT                   EDFIKYINSNIV"
FT   CDS_pept        937059..937586
FT                   /locus_tag="TA13625"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.237 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13625"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM3"
FT                   /protein_id="CAI74466.1"
FT                   /translation="MDLEEGRYIIWLENWLNEFSECQYSEPEGRDDHFTVDFSKYASLP
FT                   EISLEIYNSIKSSGLSLEQLSTYINKLGVIISQSDLGAISAQPRSKMAKMFSIIFETSD
FT                   ISNILLESINENSYAYVYLMIRVLFEIILYTESTPVRSFAHSQIVKNKHIINALISLSY
FT                   NPSTIPIHYTGA"
FT   CDS_pept        937654..939615
FT                   /locus_tag="TA13620"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.237 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13620"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74467"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM2"
FT                   /protein_id="CAI74467.1"
FT                   /translation="MMGLEMEEFVINRKVNPIGEIGYPSSNFRQNIFEILVLEMLNNTD
FT                   LNLCCTGIQLLSEVPTIASKSPQILNALFLFLIGPDDELSYLSALSLSKILPLLPEQVS
FT                   LNFVKACYSNAIKSGHNVQRIKNFTLLILSSKQLKNISTYLYRMVWAVIISLDSHTKLS
FT                   YQAKAILTEQKIALILSSTLVSIESQTNLKRHRERLEGLLHQNLNFLTLNPKSDVPNFE
FT                   NNRINLLFIRGLIYGLFLVYFSSEVDKPLIDKMADLTNITINNTLNPHKYVNIDKLTDG
FT                   IDPLLNKKEYFFSFIYYGTCVKLLEFFVKTGNSSVFTQFLDCLKESLKYSSGNVNIIFV
FT                   AKKCLKYLQNPCTILITLFTLIEQHISGLESVSRIKILLALLEIIEYSFLTDKENFAQF
FT                   LSKYNETISNKSLKLIMRPLLQIQNVNYESILSEHDILVHHLYSAVNNETLSETFKTRP
FT                   IVVDFFTGKSYVGDGNLTVVITKPKFSWGSEYSKILKKQIILNFIENEKRVECCDIYSN
FT                   LYKVGNLCLRLGFYNEASSIFSRISFVSEDNYYWLRILYNFSNTCNINGVKKSEDLSSY
FT                   FTKYISSVKNVLGLFKLMKTTNILKSQKQVTKCWDYNLNYHLPNSVLHTFVTLIVCTKL
FT                   GIADLITCLKDKNCIYTH"
FT   CDS_pept        join(939738..940254,940312..940529,940582..940639,
FT                   940762..940937)
FT                   /locus_tag="TA13615"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.237 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13615"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74468"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM1"
FT                   /protein_id="CAI74468.1"
FT                   /translation="MFRLKSMETVYIFSCYQGITTIILQVLNSLEVTKSKSKQKNSCHY
FT                   EEDYFWQYLQEFDPTLEKPDILYILDLFPLKNKRSLFTNIFTSQKLTRKTTSNQLKTRE
FT                   NVAENITAENSMFKMSYSCEDIQTSLETTWLELVGSMRLTSKDSKIHLFHRDVPTLKNI
FT                   YKLLQPLSQGYSDLKFISFLESIIFSEIPTPIGVLKAFPLPFASITATLLVQVRNISTK
FT                   LFQTRGELELQTVKIRGDLKNSKDLKNITHVSILMIFPQLENRKKFVKSLKLIENTVST
FT                   TVLIRVSQETFMNGTLVSVPTDKKMIPRGVPCQVLINQKMI"
FT   CDS_pept        join(941072..941120,941236..942702,942790..943232,
FT                   943302..943759,943793..944138,944170..944354,
FT                   944384..944519)
FT                   /locus_tag="TA13610"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="all_bases.cand.1431 - ATP dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13610"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74469"
FT                   /db_xref="GOA:Q4UEM0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="InterPro:IPR025696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEM0"
FT                   /protein_id="CAI74469.1"
FT                   /translation="MGDPLSMFDVFETEDQREEVEDHTNPLKQGENDKFPNSRNNINNH
FT                   DEDYEFNHLTSPLTSDIKIEKIHSSYNCSHYRVAPVDSKYEPKNITTFAKKYPFTLDEF
FT                   QKRSIESLERDESVLVCAHTSAGKTVVAEYAIAMGLRDGHRIIYTSPIKALSNQKYRNL
FT                   SDEFVDVGLMTGDVTLNPNASVMVMTTEILRSMLYRGSEIVQEMKCVIFDEVHYMRDLE
FT                   RGVVWEETIILIPNKVNLVFLSATIPNYLEFSEWITRIKRIPCNVISTDYRPVPLNHYL
FT                   YMSGAEGIYLILDEDNNFKSSNYNKCLSAGSQNNFRDKESGSRDKRRITSTFKDIENIV
FT                   KLCFDKNLAPCIIFSFSKSDCETSATAVRHLDMTSDEEKKLIDEIYKNAMATLSEQDRL
FT                   LPQNLFMLPLLKNGIGIHHGGLLPIIKEIIEILFQESLLKVLFSTETFSMGLNMPAKTV
FT                   VFTKMKKWDGREVRYISSGEYIQMAGRAGRRGLDTIGVVIIMLDKSDALIDEEVKKIFL
FT                   GKPLNLDSTFHLGYNMLLNLMRIEDTTPEYLIERSFMQFQVKNKSAEISSKLKEAKVKL
FT                   ESLRSQFDSELFLLTSSLHENKEKLEKLNEKMSNIVMNDTKSLNYLNYGRLIYVKNDQV
FT                   WGWAVCISPPKLKLNNPKNLKKYHFDCLYQVNMKGDAMYPSTETCWGRFEVKAFPIDSI
FT                   KKMSQIRITIHEKVDVESQNFQNAMVNKFEQLSKHIQTLGQLPLLHPVEHMKINNQDLT
FT                   HILSYLVDTTLHLIKYLYLKNTKSMSSEIDRLMNEINASPLPMREDYKELFSRYEEYSK
FT                   VRKETEELENQLKECTQIIMKDELRHMKSVLRKLEYVDQFGTVTIKGRIACEINATDEL
FT                   LVSELFLRNFFENMEPEHICASLSCLVNDDRKEGKSPTELKLIDAYNKIREIATEIVDV
FT                   MIDCGIIVDESEYVNRLRPTLMSVVYRWAKGDPFIEILAESSVFEGSVIRCIRRLDELL
FT                   RQLACASRNIGNMTMEQTFLTCISKLKKGIAFTSSLYL"
FT   CDS_pept        join(944883..945029,945113..945165,945246..945357,
FT                   945393..945488,945554..945716,945788..945905,
FT                   945981..946036,946089..946288)
FT                   /locus_tag="TA13605"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.239 - hypothetical protein, conserved,
FT                   DUF 259"
FT                   /db_xref="EnsemblGenomes-Gn:TA13605"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74470"
FT                   /db_xref="GOA:Q4UEL9"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL9"
FT                   /protein_id="CAI74470.1"
FT                   /translation="MDQIRATLAELMGKYEQKEDLDSTKPFTDPDVCRQYLTGICPHDL
FT                   FENTKFYMGECSRIHSEKLRERYQNERKNHFYGYELETLKIIQPMIDDCDKKIARGKAR
FT                   VEEDLVRRKTLDPMIIEEAKKIDSQIQSRMARADELGRNGEVEESFKIVEEVELLKRTK
FT                   LEMLEKGGDASYQSRLKPCDVCGALLSATDSDRRLTEHYSGKIHVGFQKLRDMSKTLSA
FT                   YIQENRHRLNGRGRNGSREYLSERRTRKVLGVSLRGAIAVTGIEAMPIKVIAESGKTIE
FT                   KGREAGPDPYQDQDRDRVLDQDLGIANTGDLVN"
FT   CDS_pept        complement(join(946502..947508,947546..947990))
FT                   /locus_tag="TA13600"
FT                   /product="molecular chaperone, putative"
FT                   /note="chr2.cand.283 - DnaJ domain protein"
FT                   /note="DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13600"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74471"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL8"
FT                   /protein_id="CAI74471.1"
FT                   /translation="MGSENKCSETGVETKKDERTFYSDFWDFVSTSTSQITDLFQFGEK
FT                   DDNYSLTEDYESSKKLFDNYVKRIKDNLNPNVTDDSEEPCEPKLNGNDKPRSGKCIETK
FT                   LYDVLEVHPGATNSQIKSSYRKLALKYHPDKNTSPDAKKKFQEIGEAYRILADDVLREK
FT                   YDNTGSSDMFDMSDLDIDLDIPLFFIMLFGCDLIDEYVGPMKFDHILRYSKVVSKMPSK
FT                   PKIPDNTSMFSNLFNYSGQLSNSTALAVQSDDISNYVNTLQKYREARLATLLRDRINEC
FT                   IKLGEIPESLTQFIESACNEIYVDLIMTSIGWVYENCAESYMNEVDSFMGLGATYSNLQ
FT                   SIGRNLNNGYNMIKSGFTILSVIHQNRNLLRGNIESVEAGCNESSDKKKVLLESFEACL
FT                   DCFMSYLIYDIENTVKEACFKVCKDHDVDQKTRIKRACFMRTLGIKIQEIAESVRTKKG
FT                   TSKGDFNKLIQDTYVRMKVKSEKEN"
FT   CDS_pept        join(949438..949567,949649..950310,950483..950629)
FT                   /locus_tag="TA13595"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.240 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13595"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74472"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL7"
FT                   /protein_id="CAI74472.1"
FT                   /translation="MAWDQSSLLESNQMRCVADSLKPTGSRLENEISYEINGIYIDHSC
FT                   MLTWIANYCGSEYRFDCSNIIEIIDGYYKAEFYLDTKKLLDAPDTLNTYCDTSDILFTD
FT                   YVSDETTKNISKNQINKQNLSKIDSISNASTEIDSLNETNNINTKEKDVPEVSDDKNSK
FT                   IQDNEPDLKTTQAEINEEKSDNQCEKPKDKIPTVQKKPIQTQVPPTSSFNLRSSRTNRN
FT                   ITTSNYYNKDDSRSFNCYSRIHTTKSEVSYSPEVKRRRNSKSEISKKKPEFEVRRGERV
FT                   RKVSIFQDCYIPASRNEWISEVFIGAHKENF"
FT   CDS_pept        951032..954967
FT                   /locus_tag="TA13590"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.241 - hypothetical protein"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13590 by TMHMM2.0 at aa 7-29, 1170-1189, 1196-1213 and
FT                   1264-1283"
FT                   /note="Signal peptide predicted for TA13590 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.901, signal anchor
FT                   probability 0.012) with cleavage site probability 0.378
FT                   between residues 24 and 25"
FT                   /db_xref="EnsemblGenomes-Gn:TA13590"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74473"
FT                   /db_xref="GOA:Q4UEL6"
FT                   /db_xref="InterPro:IPR015894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL6"
FT                   /protein_id="CAI74473.1"
FT                   /translation="MQLIIKSVVLPVILLLQSLNTNVAYLVINGFLLSSNFVKCNKVEN
FT                   DSLDVNSQLNLEILSQKSTLHTQTVDSNVLNKTNTKYTPNNKNTKQNNCEYILCFSDEL
FT                   ELGEPLQLVYPNDDHTELLVDPEVLNHLKTIPGPIYPVAVVGSFNSGKSFLLNLINDNV
FT                   LCKSGLIKDLESSKSNWHNLKFSNILSPEMCSKIFKVSKTPEPETLGIWVYSKPLKITR
FT                   SRLQEKLQNYHEAENIDKYSLKTKKSRESDYQHTKLLRNKSDPYEDESLSETVNVLLFD
FT                   VEGFNSHKNIFRYDEAIFSIVSLICAEIVYLSPRTLNSSDLLLMEDLIKCSLQSKISNL
FT                   YKIYTGLEGFEHEKEEIFQYFFKMFENKNLTFLINEFKFTPEQALSNLVNLLRAPRRDL
FT                   PLHEFFFYKNQKINIGNYDFRADFVKKIKHKVDKDESSKDKLPVKREYSPTKDDQQTIA
FT                   SSNKNVCSTDSPEQIDVKFSRFGYIFHMMFNSVNISTLPSTSSGIFSRIFDTDETKTPK
FT                   DNETNTFEKYFERLGHFKFELFLRALRNPLLKHCSVDESTSTCHMSGRDLAEIVNFSMK
FT                   ILSMNKFYKLATNLTSNEWIKITENDAFDRLVKVLRLSRLLMIQNDLSHNYKDILMKFI
FT                   TGKKYHIDLENLEQNMDDGQKNKSELIVRRSPIPSMSLFEKYSFKLRNEFLELLLKTFE
FT                   NEGLSTDFKDAWSSLASEFDSFSEEASEKLSETIKEHCGRVSEEVFGVLDDKVEQVRLP
FT                   ALPSKLKFLHFFKDEFKRRFILLVDSEETEFEDTETQTYDKLVETKKEHSLFYDSVCES
FT                   VLSDYLNKLDEKISELLDTNQKMIDHHFSSVYSKALNHFRSNFSRVDENYELPIEEPLS
FT                   RSTTLIKEAQNILMTNLGEFHALEFLVSEVKNKLNMALNQEMEVFKTNYHKRCHQKLDN
FT                   MQNHYLNNYAVFLNSFAPLPTSPELIHMYHEFLKHVSKEELFRVYCTDYMDIDKRHNKL
FT                   EQKLNDKLKEMLAENVKIASEALEPDFQLFDKYLLTQVNNSRFYNVFRYNAKKYASYKI
FT                   TPKFVYTKLNLGLDQLSIKCPIEDLGLKVLYSQESRRILPRKGPTTPKRGFNSRFTSDS
FT                   YRMGLGINPGTESDFNFEDLRAKFIRMNRTNIHYKFVDGIVGRYMDTHMLEFKKMFLNN
FT                   HCKAIVLVCSIILLGLSTLSFSLAQKGFDRLLFAILGFGSYSFLVGMETTKRNLRRFLE
FT                   FLKRVLKKVMLAFLKVLKRLLNKLFALLAAYITKLFVKLGFMYTFLIGFLSAATLYVYS
FT                   KYVSYRRKKSQEYCNIKVPTKLLKNLT"
FT   misc_feature    951032..951103
FT                   /note="Signal peptide predicted for TA13590 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.901, signal anchor
FT                   probability 0.012) with cleavage site probability 0.378
FT                   between residues 24 and 25"
FT   misc_feature    join(951050..951118,954539..954598,954617..954670,
FT                   954821..954880)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13590 by TMHMM2.0 at aa 7-29, 1170-1189, 1196-1213 and
FT                   1264-1283"
FT   CDS_pept        complement(join(955000..955126,955205..955320,
FT                   955363..956106,956163..956441,956506..956635,
FT                   956735..956751))
FT                   /locus_tag="TA13585"
FT                   /product="chromatin-binding protein, putative"
FT                   /note="chr2.cand.282 - SKIP/SNW domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13585"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74474"
FT                   /db_xref="GOA:Q4UEL5"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL5"
FT                   /protein_id="CAI74474.1"
FT                   /translation="MSEYTRKRATLLVKPQWDDVIKHESKGSFSLVEHSTANNNNNAVS
FT                   DTVLTLSLQYDSEGRPMYEQVITQNVRKGKITYTKPSDQKEKSFTSDQLMRPSDETVKE
FT                   NLEKTKEALQIALSSKNSKIVTKSESEVFRYTPNQKSDVGQRLIKMTTKVIDPLEPSNI
FT                   RHKKMPANPPSPPPPVLHSPPRKLTKEDQMNWKIPPCVSNWKNQKGYTLPIDKRVQADG
FT                   RRLREVVINDKFASLSESLFIAERTAREEVRMRNEIIREEKLKEAKKREEELRELAAKA
FT                   REERHQLYSKSHSKDESRDRDHRRRHKDRDSDEEREELLRIEAERRRELEREWRIEKNI
FT                   KKRRTGERDISEKIALGQAKPTKITDLYDSRLLQGDAGISSVSSYIYLIFGFDGGDDEV
FT                   YNVYDKPLFADRSTANIYQHSKERFQKSTGDMNLASFANADRGVQRNTPVEFVKDSDPF
FT                   GFEKLLEKVKKT"
FT   CDS_pept        957862..958899
FT                   /locus_tag="TA13580"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.242 - ring/PHD finger"
FT                   /note="ring finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA13580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74475"
FT                   /db_xref="GOA:Q4UEL4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR039396"
FT                   /db_xref="InterPro:IPR039398"
FT                   /db_xref="InterPro:IPR039399"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL4"
FT                   /protein_id="CAI74475.1"
FT                   /translation="MNFYSAHDCESKYTVGDEGSPKQKEYKTNEESESYENNSSSDSSY
FT                   LSSHNGPVIYAICDVEDDGKIRNENHNLNRRLILSLLNDQNVLRGDFLRRYQIEEEEAF
FT                   YVTRVTCRHISLFPNKSRWWHKGQVKYGYRINNLNKEIVSKTFIPVFEPVEDKACPICL
FT                   EDLICDLISLKGCLHIYHRNCFLDYATKTKKPNVVCPLCNCVSLTGKGPSPPGKMSWNV
FT                   KKDLKLLSNGTFITTIEIKYKMKSGIQLRWHPNPGKPYRGVFKKAFLPITADYLFILRM
FT                   LIMAFLDGQTFRVEDSMEDNCGSIEWNGIEHKTNLEGGIEKGGFPDNNYKSRVIENILS
FT                   KGLTI"
FT   CDS_pept        959287..961914
FT                   /locus_tag="TA13565"
FT                   /product="DNA helicase (SGS1 homologue), putative"
FT                   /note="chr2.C.cand.243 - helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74476"
FT                   /db_xref="GOA:Q4UEL3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL3"
FT                   /protein_id="CAI74476.1"
FT                   /translation="MEFKLEPISLNTTVKNNYNEYFDTLSKNVDFGNSEEIDHSKCVNT
FT                   YEAPYTILLSEFLEFTRKSANLPEPALVPFTRRKVVSVDYFRDYEHYEPKNRVERGYTN
FT                   DKFGSSNHNNSSYSSNNYDNSQYNTQYNNHSNENNYSFFNLANQTTYNVSDLDLKDLVY
FT                   TGTEWEEEFEWSSLVRQINEKIFMNKSFRQNQLPAINCILSNNDTFVIIPTGGGKSLCF
FT                   QLPAVYDTLTGRGSTTIVVMPLLSLIGDQIKRLNKLNINCRAIFGDLKLSEKISIFNDL
FT                   TKIGPHSCTDIDTYMSINHKNTDDISILFITPESLMGSKLLLENLLIMHSRNKISRFVI
FT                   DEVHCVSQWGNDFRPHYGQLGMIRKNFPDVPILALTATATEYVTKDVITKLMLRDVVIF
FT                   KSDFNRKNLEYVVVEKSKHFKVAINQLVKLIQQFEDSCGIVYCLSCGEAERVSAELSRV
FT                   ITCFHYHAQLSTIVRTNVYNDWINDRIKVIVATIAFGMGIDKKDVRFVVHFSVSKSIEN
FT                   YFQESGRAGRDQKKSTCILMYNYHDIQRHILLNSPLHVQPSKFTPTTTNEFDNKIDKIL
FT                   VMMDYCEEKFLCRRFMLLGYFGQKFTSKCLLPCDNCKALYYNNSDSPINPTSEDKGYTV
FT                   KNCISHAEYICRNMTSMNHLTLITLHKLLMNNTKTETKSNFLLNGYLHKNGFDSHSSMI
FT                   LLKKMMIHKLLKERIVKLQGLTYPIFYIQPGPNYRDNLKFMSTIYIPTKKDTTNRKKRP
FT                   SAPRPKKEPKDKAPKTLGPKVEKKRPKKESPKEGDDTPTKPRKSSGGTPRKPRKKSEDT
FT                   PTKPKKSSGDTPRKPRKKSSDTPPKPRRKSNSSPRKPKLNSDDSPSEPKRKRLKLQKPS
FT                   SPIL"
FT   CDS_pept        complement(join(962021..962857,962923..962987,
FT                   963049..963325,963439..963522))
FT                   /locus_tag="TA13560"
FT                   /product="centromere/microtubule binding protein, putative"
FT                   /note="chr2.cand.281 - putative centromere/microtubule
FT                   binding protein, belongs to the trub family of
FT                   pseudouridine synthases, contains PF01509 TruB family
FT                   pseudouridylate synthase (N terminal domain), PF01472 PUA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74477"
FT                   /db_xref="GOA:Q4UEL2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL2"
FT                   /protein_id="CAI74477.1"
FT                   /translation="MNKNKVFLIKPEANSPPIDTSNWPLLLKNYDKLNVRTGHYTPMPH
FT                   GSSPLCRDMKNYMKYGYINLDKPANPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGVLL
FT                   VCLNRATRLVKSQQSHGKEYVAVVKFHSSPESGAKIEKVLAELTGSLFQRPPLISAVKR
FT                   QLRVRTIFASKLLDYNEQEDLALFWVKCEAGTYVRTLCIHMGLLLGTGAHMQELRRIKS
FT                   GNISEYDNMVTMHDVLDAQYLYDTTADESYLRYVVSPLEQLLTGYKRVVVKDSCVNAIC
FT                   YGAKLMIPGVLRFETNIELHDEIVMITTKGEAIALGIAQMTSAVIATVDHGIVAVIKRV
FT                   IMDRDTYPLRWGYGNRSTEKKRLISLGLLDKDGKVNENTPQSWKNNEGYLPKLTGTPTN
FT                   HENGTEISDVEMEPNVKRVKV"
FT   CDS_pept        964437..971852
FT                   /locus_tag="TA13555"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.244 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74478"
FT                   /db_xref="GOA:Q4UEL1"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR024557"
FT                   /db_xref="InterPro:IPR032191"
FT                   /db_xref="InterPro:IPR040398"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL1"
FT                   /protein_id="CAI74478.1"
FT                   /translation="MSKFDSPSEKAGVPQSATFSSESCLGKYTQMRDRLKKLLSPKNSD
FT                   DLYELLLLLKNSHLFGSETVTKIDTLFSEIAICTPEDDLTHVELADCFVSTLLSYIDDE
FT                   YFIDLLQNIILHTRNNSLILSCENRLFELVFVLGMDVTVDKLRNPLGLVYVILKSSVSF
FT                   NSKFVSNRVSQDESRINVGYLLTSQIYNSMLSPSSPYAYNFNSNFEQNEVYSYISSLKL
FT                   DNRNLKEFLNKECFGKICEQIVYYCGDFANSVKFLENLVKICKFIHSKDVSGSKNYRSL
FT                   TVSILTQRFTNPIFQADLILTFLENMYHELLSQDFKDFYHFSINFPSTFGFNLKNPFNA
FT                   QFNDKASTEGQSQSDHESDEYKHDEDSSYDYSEDNMLKSDLFFNLFPAAQEEDLIEVYW
FT                   ILETDILFALFHSMRSSDHSDRFYPLFLSLLKEAKNPSIFSRAIIFKLALVWSDYMNAG
FT                   RCNYNPISLKIVTMNQDFWFLFQQTLCTIVPKSVLLNEVKQFKDDFKDKRCESLFDFIL
FT                   NIAIHTDSDCFFIVLLELLRCFEYDVDILKYSVQMFQSTLLEFFKHNRVRFSRGLLEIV
FT                   CFCRQHFDWGFMTMLVHSIDALITGDSDKFAKISLSDAMIDYLSWKLQLETDINRNLLD
FT                   SDSSILSQLSDAEDQRELSNNGEEPSNQDGELNNEEVSVVRFQISTNIIAEMFYILYHL
FT                   TGPNEVLLQLFFMYNQHLKSLSSYNILLLPLYRGMDHRIKRGLQLEEHEDQVLEDQTLE
FT                   EEDKGPDLTVPGLSKLDFMDKTQFALGPNKDIYGYLLLNEDSELTTTHVVTLIFSGKMA
FT                   KNVLNAVKLLNSEDGARPQQILNLILRKFVNKLQQLFMVNVNDSFCLHMSKPSAEEELL
FT                   IKNLRILSSFLSGLISLHINSDHIDSIYMIFMTLLECLRSETVFLIEFSFLTFNNIKNL
FT                   FSYPHFTREFLSDPKVTKFYPNLVKNYKSISSTDSVSEIETNLDDNIANGVVDHMGEDG
FT                   VDNVEVGLEEFDKCIRDKGGIVIIKEPDLPSAPVSVGGTSGLGTTPSHMPISSVPTPTG
FT                   PLPSVGFEVLSGICSNIDYNGPKIYPLFYHEQCLMTILNVGIDDFFNTLKLQIDVPENT
FT                   NDSVNAFTFSGPQFVQTVESLVHMGNLDWLFFLVLRHAVIKGESSFTEITNLLQTLGPK
FT                   MCDYFVRFLSFSVNLFLKYLRSCRALLVYKKILLVCASLLGHFTIARNKPLLTKHLNLK
FT                   QLLSFSYEKGMLSIAVPFVCRLMTYVVKSKIFKLPNPWTFCVLSLLNEIKNVKNLKQIL
FT                   VLEISNLIVLLMAPKNQQQTSPIHTSQSTSNLFSLSSGPTKSASMYNLPTGASQSVVQS
FT                   PANLNSVMKSNMVGGNASIGSHIKELLKHRVLGEFDQSCRFSSNIWSNSNETKLNIPPI
FT                   HNDIKVLLKRKIIINSKLITTTNLSINNTVAVNNNTGALNNNTIAHNNTGTVNNNNLPI
FT                   NNNNSVMVPKENLQMSQKESGVINLVMSMDLYKLILNAIESCYRESIFIIEKIVPICVS
FT                   TCGVLSKIDFSTDTSIDTLKRCLTSMTTGLSTSLVNVLCKEVLLSILSYEIYQSLLNHY
FT                   TQVTSGNLNTVNMGETCPIFDCIWLEYISQILARDNLALVCALVEQLTLELMGRSLDEM
FT                   ISSWPTSSTSSSSISSILYNQFLSTLHTNNNNSGYYVNTANLRNTDDLSLLYKKYLTLV
FT                   PSSIARVERTEKRPGLRFPDFFIVPPIESIPTNLVICKFEEFEQRLKESAKYLLMYPPI
FT                   VPMANCKFLYKCESSSLLLLSFLPKNHQIFTLLWSIHYIVVKATNITECYEMILNRVVK
FT                   NLVDSKAVSIPSLVNEVELTLLEMLCVDNANLVNITTALLPNLTFNKLVLFLRFKLIKI
FT                   PALDIYLCNSGDLEFVTKMVYRLIVDSNYITLKELPLSLKFLSKFDKNTLIHSVGEPTK
FT                   LNIILSKLFNQPIPNTGNINNMSSNNTMANNTGMTMDRLISLRLLFMNRVYIRNRCVVQ
FT                   TEVSKKHINMFMEFLNCESDSDVDLFFINFNENPIDHFITSALLLTLFISYQSQQFETV
FT                   ERVEKMDHKRLMKFDGIPRVTYGSPNLEYVPAFCKLVNGFIQTDVFILQKVLHILLSVL
FT                   YKNCCFPVFFKVIQNFIFNTNYTFSAHVSISHFLLYCNPTEMTSFAPFWVQLATSKQLI
FT                   QSLIQSPVEWYTLSQLIKYTLIYYTTAISQRTTQKDGKDTVIDTLLDNILNILLYLLQI
FT                   CPEFICGYYLSFCEVTSSVRFRNIFTFSTPKNVKCSNPATATEISETSPLSFVNHIQYI
FT                   IQKPTLKGLTDTFIAEPSDRLVPMILKELQSEGILIYYTLYLGYTLPLLISKIGLTNAN
FT                   TSPGSDCNPNSVISMRVINCYLLLEKLVVQSKSKLLVSSMLLHARYPNLVTIRFISIFK
FT                   NLFERAENVQELIITCILERLLVKPHPWGVVHLLFQLVKFKKFWNFIQHNKHFEEQLKK
FT                   IKTLYMS"
FT   CDS_pept        join(972375..972989,973047..973072,973102..973288,
FT                   973451..973567,973598..973705)
FT                   /locus_tag="TA13550"
FT                   /product="autophagy-related peptidase, putative"
FT                   /note="all_bases.cand.1438 - peptidase C54 domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74479"
FT                   /db_xref="GOA:Q4UEL0"
FT                   /db_xref="InterPro:IPR005078"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEL0"
FT                   /protein_id="CAI74479.1"
FT                   /translation="MSNVVRENVNVLYNKRLESRFGILFTYRYGLEYKFPRPINFKRRR
FT                   LFNIFSPLNLSNGIVTIDSDKGWGCVLRSTQMAISQALLNLVLGPEFSVEQLEIRNRTP
FT                   RNRKIDQSLLNIDTFEKLLNGLLDLDGVSAVSVILAQFYDDLNAVFSIYNFVIADYVLK
FT                   TCTKFLHFGPTSAALCASKIINDLNLPINSIAFPDGVFHISDVREILEEKRNLLVWVSN
FT                   KKKLDRIERECVRSMFRLSQFNGIIGGNLFNKSYYIFGTTNKRLYYNDPHLYCKKAFRS
FT                   LEYVDIFRDFTSRRVKSMNWRYFNASFTLLFLFKDRDDFQDFLENTFERKSIVESFPFE
FT                   FITYGDLTFN"
FT   CDS_pept        join(973907..973985,974057..977247)
FT                   /locus_tag="TA13545"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.246 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74480"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK9"
FT                   /protein_id="CAI74480.1"
FT                   /translation="MGVDRDSKDFKISQSVQPLMRNNLTFHYGNFEANSDDRSTMSTTN
FT                   QSHESNQMNRPNLSNGSNLSSGGCEMIRSTESNEPNPINSSGPPKYDPPGPKKQDNTPN
FT                   SPTERLNNTSNCSLGKVNNMPNSVLESNANHSPDASVNGTYKRKLRMSDFEMWRYSYHL
FT                   VKNGHSILAPEPSQRSRSYRDLILQEMNWMAVDYYQERRWKSHIAKELSNSITTSIIDR
FT                   KRLKRDWPAKICSYNIEQFWINIKLITTGTINSINHHKSVKINGVNGNSESSVGNGNNR
FT                   EIGIVLSSGLMDYCSRVVLGKSVDFRNEDIVEDVPKRRTELLALTVPVYKNVNTNSVNI
FT                   AKKEVVDATVNQMLVLGAELYPQLHRPPDDEIDVFTLPALNPKHEYDYNTLLLLLHSLN
FT                   STMYASVRDSAMGLPKPATTTSTTPTGLSSLLPIRRIPRDEIDPLSLSVNYRDFIDNAP
FT                   VQTPHPQKLVLKWEEPTLNESDFELLDSWLLESRCWPLISIALNLRSSSGGLLRREFSP
FT                   KACKEAFYRMSKPPRGLVNSSKKLLSPKQSKTILSFINPPPKTFKFIPIISSDRMSSTR
FT                   SGSPISEPNTWVESGIKNIFGEVCSYIRDKSSLYTYSTSLTSKKESFFSRFKSPEAKPD
FT                   KKLLLKLVNKVDASAHKNELLMVPHNVKVEASLSLNPNNHIFPQELLNFMLSNVQSQRA
FT                   NNVEQSNDVTSKTRYLLSGNEKYGASHRFSSLNSAVTLATSVSSYDNVVRNFAYSELST
FT                   RINKQLRIGFLGIPTKMFLYSLFYCGRIKPDYRVRRVALSIATLGKFIPPPHLLYGKMF
FT                   DPDINLILTKSRPTSYEKQRSKSVENQETFTSELVQNYSKEIYLSTNTKPDENNVPSLL
FT                   ASFTQVSLSKGKVCNQSSFSPKKIVRKPTEYIGLGNASNASSTPTERKRHVGSMDTTPR
FT                   HKARQIAEIQSTSEPTSIYRTRQDIMIRRQMPQPHMQHYHPYSVPMVYPMNSANSMQNM
FT                   NMNNMGNMGNMNNMGNMNNMNTMGGMSMMGGHHMNSQMEQPMNMNSMPNMNSMTNMGSM
FT                   GNMNPMGNMNHKMYNLQNTQMQHFQEDNYHFRFDQRPNSHP"
FT   CDS_pept        complement(977369..985339)
FT                   /locus_tag="TA13540"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.277 - hypothetical protein, contains 2
FT                   potential PF00027 cyclic nucleotide binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:TA13540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74481"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK8"
FT                   /protein_id="CAI74481.1"
FT                   /translation="MDKDKRIDKGLVLPTLLDYKVMEDFRRTLLKRPYEYLEDGNYDVY
FT                   LKDNKKTKDEKETHVSVHRKELIKIYSDLLELIKRKQKHINSQFVNPKFDIARHNFKCI
FT                   CKNSIKFQDYHFKSASPPPSEPELKAKPSVKMPEVAEERLTVKQKSVTPELNEDNYEKG
FT                   YIESSARTEETEQAESKSLIDTYFGLKSKEYSPPLPEKVKSTKLVDKRAKGVTFSALES
FT                   MQKTGTLPESVQKSDSLVESIQKVGSLAESVQKMESLSSESYAESMERKDTYKVEDLMQ
FT                   MPSLNIEALHPSESMESSIESIKVRPKPREKSVKDAKTVDKQVEQIVQKVDQDVHKEVI
FT                   DLQKSSLLNNQEVEMRNDLLHLLESVAVFSDLPKERLLELSSHFKLRSFFANTSIILAG
FT                   EHPKEFYIVASGTVSSYVYDPSDSEDTYRLAYLSSDYFGESFIIDDTPSDEFYIADTHV
FT                   TLQAMNSKLFKTLLADQFNAFKCRLTELKHYSSYGAHRLGTGKILTTRFGTTRLGTGKF
FT                   GNTKFGTVRLGTKIGTSVNLDRFMTDEKEVKAYTVLGKELLVFMKNFYFFTKCEQMNKL
FT                   AKKVTYQEYCNKEILEEVAKGNGLFMIFKGKISMQIYEQSNNRQLELLCFAPNSYFFNF
FT                   KPKSETVSNILDRKSLVVTENVKLLYLAQKYVQKCLADSLPQMTTYLENLYKSRYIHIS
FT                   TVGDKVTSTSTSSGDEDSEDSVHEGVPDKSVSSSEVSESSGDDAASLSESPTPSKDLSD
FT                   SPEPSKESTESVNYIEPTLEDSESIKESTDSIKESTETVKESTDSIKESTESVKDSELN
FT                   VEDSDSIKESTDSIKDSESTPEDSELNVEDSESTPEDSEQTSDSVSEDGLIVSRRSFEN
FT                   AMDVSIRGSTYRSEKLESSRSGSIHTRQKFESSRSGSIHTSEKLESSRSSKLDSSRTYL
FT                   TSDSSVLNKIASRRSFEDPADVSIRGSTYRSEKLDSSRSSSSLPSKSGIMLDNGRIVSR
FT                   RSFEDPVDVSIRGSTFRSEKLDSSRSSRVEPKESSRSSLSSGREHFMDKIMRKMESYKS
FT                   LIYSSDTPKTTSKDVSAREVTDDSVKESVKDELDYEMIRRNTLMASHVLISDTDLTSRT
FT                   SSNEKPESSEHVLSEHFTSSRVSSGRPLSKTLSSEQVEPVVNIIESVVESLETFEDENR
FT                   EREQNLFDSIKESDVGSVASDVKFIFNLPNLEGDESVRKLNLESQEVSEKLDSSRVDGN
FT                   DNFVSIKTLPMYNNLNIDLNKEPEVKYVEHHSLDEAVEASENMFEDEMEQMSDKIVQRQ
FT                   TSSSFLLTSNSINYGDASAEKIARLEALDKLISKNYPTVQDSINTVVEVIRLRSLNTHS
FT                   SITPPVLTPSVHSLYNDLELENGDQLKKDIPEEKAEKLDELGSKSPSLDISEIPNLKKI
FT                   LSKVHEMYVGQEEQEQSVSGSKFSSIDDVYIHLNNIEKLYSKSYSTEMNALGPQVDNVP
FT                   KPQADVVEGVKMETMDSVYGLDSMYKSSDDVMIEKVSEETKLEDAKPQVDVDESVKMGS
FT                   MDSVYGLDSMYKSSDSMFELETLYKQTSNVLNKSLSDEIYDTDQDEVLEQTEPQDTLLT
FT                   TISKSFNTITQEFTVDNITKKLSIDDITDKFTLDNITEGMSIDGIAEKLSVDGITEKFE
FT                   GITLDNLSREISNIGEEISGMLSSKSTLKSGSDAAEIAGVEEAEEEQGTSVFESSKLMI
FT                   SSIFDNITIYPSKTMTPTESSEQTQLEPKEEQEEEKDEGYGEVELSENNVFIDKYNLVR
FT                   RISLDSSSYVSSTSSTERTTSDTGGQQLENSSGEYTQPNQTIEYSDGSSLLNFPAGQIL
FT                   ESMDSVSLDMDNSLEETSVDNSASLDTSVMDTSVVDMDNSPKDSGDASYLTSDKGLHSS
FT                   VESFGTDAYSESFHSSDSSDSVTMDNSVVLDNSVTVDNSVTIKESQESSDYSESELTSS
FT                   STIRSEVEKVTNTTSVSEDNRSLCSSLNTTTDTSTTSVHSSDRSTITDSSANTSLTESV
FT                   SVSDSVDTSLTESFSSRRTSMDSDFQDSTDINNASPFSGLSDNSSIVYSKQFSDFNESQ
FT                   SDQQELEQDEELNEEEEEDYEEQKYEDEEMEEEYAETDETVGSYEEEEEEYDEEMILNI
FT                   KNLFISTLKNKYKSIGASFNAMDLECTGMVTCEVFLSFIEKLGIGAIDHREQNLMFELL
FT                   KEDNKDYITVASFYRFSGECVTTLAELNQHFISIFGSSRMAFERFFTTLTKATMCSRVD
FT                   FEYILTQVGIPEKDANVLFDALDVCENDSVSVFTILKILVGDWDRETALEYEEKINTNF
FT                   NRLLTYLTPEADNFNSEFTRTLSSQFFDQGLDCSLVNDSYEEFYIDRELFYFDELYSLI
FT                   SSRPEFSQVSLPQKRFIISLFNIITFGPSAASSDSEEDSNPSEQCSEEDKMEQVDLICS
FT                   NEYDVPLIALISGTADVSFEGITYPKHVKFTGPSFPNYEQFIQSAQVYTTPEPIPTNKT
FT                   PCNYNITVSNSQSKSQGRENVVGIMPLTSFIYNVVPLLNERSRRLPVMLQFLKTVPSFS
FT                   VYTDEELDNIVVACTVRQFKLHETVIKTGEVPTHFYLIFNGSVTITNEFNFQFKTVSKG
FT                   NFFSTFDIVNNQLNTFTVYANCTLVLLSWERSEFFRVFTKYATLLDNDSCNMDDFQNQI
FT                   SQKSIDKKVSFAETP"
FT   CDS_pept        complement(join(985552..985833,985868..986027,
FT                   986237..986382))
FT                   /locus_tag="TA13535"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.378 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74482"
FT                   /db_xref="InterPro:IPR010875"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK7"
FT                   /protein_id="CAI74482.1"
FT                   /translation="MNSKNTCLCVDKLNQLHNTIHTELVDCKDKVWNFKIASLTKERDS
FT                   LLLRNEDLRSKLTDLQSKIASDPFMARRYQELCNIKPSENLENTDISQVYKQLYTYQDL
FT                   NNELKDRLSLEQMNSMSWKHKFYDLENKISSQISELLQLTQSGNCVESTDYAKFKTEHY
FT                   SKVAKEALELLKQAKNRIEGDRYSNFLHSYII"
FT   CDS_pept        986662..988896
FT                   /locus_tag="TA13530"
FT                   /product="phosphate transporter, putative"
FT                   /note="chr2.C.cand.251 - phosphate transporter, signal
FT                   peptide"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA13530 by TMHMM2.0 at aa 7-26, 46-68, 89-111, 145-167,
FT                   180-202, 230-252, 485-502, 531-553 and 715-737"
FT                   /note="Signal peptide predicted for TA13530 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.634, signal anchor
FT                   probability 0.363) with cleavage site probability 0.220
FT                   between residues 23 and 24"
FT                   /db_xref="EnsemblGenomes-Gn:TA13530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74483"
FT                   /db_xref="GOA:Q4UEK6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK6"
FT                   /protein_id="CAI74483.1"
FT                   /translation="MASSHPELLWILIATGISCCLLAVSIGSNDVANAFSTSIGSGTLN
FT                   LRSAIAIAFIFEILGSIFLGGTVSDSIRARILKISAFADAPRDLALGMLSSSLGSFIFL
FT                   AASSFIGIPVSTTHSLLGALAGFGVACGRLSGVRWIELLYIVISWFIVPIISVIASATF
FT                   YIIIQELILKRRESFNVMLNFHWVFNIIFSVPLSIFISYENSVLRSSIGSFAESYRAWF
FT                   HRSKWNKFLSVLIVLSVFTALSSIVSYTVLHFRLKDNWSYIESLYNIDPSITRSNKKNS
FT                   RKFRLKKHRFNTNSGKDTQSDLEQEASKKDRSHDIENPEESCSAPENKESKNYTNKNSP
FT                   STSVSKNFKEGQESEDEKTPKNKQDKSEGGNSTDSSQEDYSMDDSMTRTDSSIHRFLTG
FT                   IKSAFVTSFNKSRSFTNTNIHLDYHEQTSIDSIKSNTGRHSSSVNCVNKSRSNTSGLSD
FT                   RRKNLSRYKKVVVPTEIKKTQNHMAQTAFSAIQIVGASIAIISQSSNDTANAVSAFATI
FT                   YFLYMDGINEEVKATPWYILMIGGFLMGIGLTFFGYKVIKTVGLNITRVTPSRGYTIDC
FT                   SSGTIVLILSYLGVPISSTHVAVSSILGVGMVQHLPSYNKQYSFIYTDEKSSDLDPKNE
FT                   TTNNDTREISGQRNLDSANADTHHTSGENGNPCRSVSGVGTTPSVINFYAPREKGLLGF
FT                   FRSIFSRITTRHVNFGLYRKIFITWIVTIFSTGLLSAIIFLVFKLFYTFS"
FT   misc_feature    986662..986730
FT                   /note="Signal peptide predicted for TA13530 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.634, signal anchor
FT                   probability 0.363) with cleavage site probability 0.220
FT                   between residues 23 and 24"
FT   misc_feature    join(986680..986739,986797..986865,986926..986994,
FT                   987094..987162,987199..987267,987349..987417,
FT                   988114..988167,988252..988320,988804..988872)
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA13530 by TMHMM2.0 at aa 7-26, 46-68, 89-111, 145-167,
FT                   180-202, 230-252, 485-502, 531-553 and 715-737"
FT   CDS_pept        complement(join(989058..990308,990401..990979,
FT                   991036..991127,991166..991244))
FT                   /locus_tag="TA13525"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.274 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74484"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK5"
FT                   /protein_id="CAI74484.1"
FT                   /translation="MENSYGSVSSKKHEFEEQTDLKDENNDEDGAPVDSFPLGKLQEVE
FT                   AELAQIVSTGIQDTSFMCKSEYCVMIREYTDKLFPEPQTDDFGVDVRLKNVVRALGEGS
FT                   VLPLSELVNALKMSLGSFFDLGPDDKLYKLVPVFLSRKNLGEPYVNLSGIVRSECKRRD
FT                   CMWIWESPTLEVFPHALLDQVRSSREARNLISRRYKALSKLKNCIITEDLKGQQMALET
FT                   LNSLDRKMLLDKERKERIDFKRKSLDKRKNEKMKAQKTNSNMLLSWLKVQKSEETSESR
FT                   KDTYSPMLPPKEPTRNICIECSDKQRTDLENILEPLSDFSEPDDHLFTKLHSFNEINNA
FT                   VKPGVKEENAEIFKISNLHRDVWTRFHTYLEMNRQFYVETNENLIWVDDPLNNVEQANH
FT                   NSTCLKPSRHCRVFTMYDNAWKRPPMRYLVGRSSSLVTRFNQITPDPNVDYCVDSDEDW
FT                   FERYDADDVELTEEEEEEEEEEDQEWIVQDSPKPREFSTGVFDTDLSKCVKVFCMYKNW
FT                   HWIIDGKPVCDQFSSKETALENGIIITHSEYGFGFEGYTSNPIVDLMRNLRGTKITMSR
FT                   SDVEDLLRLCHGKHTRKEDLIAIFKESKPFASMSEIKNKFKKYMTRLKIDDKPHRWMVT
FT                   PEAAKLFNIRKELDQILTHQLNTEILSEPFF"
FT   CDS_pept        join(991924..992142,992194..992488,992547..993979)
FT                   /locus_tag="TA13520"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /note="chr2.C.cand.252 - ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13520"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74485"
FT                   /db_xref="GOA:Q4UEK4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK4"
FT                   /protein_id="CAI74485.1"
FT                   /translation="MESDNTDSAEVELTSYKFDDLDINDKTKKVLKAKGYVYLTKVQSK
FT                   VLPLALSGKNLVIQSPTGSGKTLCFLLPAVKHLFDEGYSGNLPIDANLLGCICLAPTRE
FT                   LASQIALQMKDLANPLKLNSGCCIGGVRDKYDKKNANRLHILTGTPGRILALLSSQSLP
FT                   ETHNIKILIMDEADRLIDVGFRDDIISIVDFLPNDLQFLFFSATIKSSLKELCDILLKN
FT                   VSYELVCLGSDSDGISESNLRQELVLMSPKLKLSALFYILSNNQNKRIIVFLSTCKLVR
FT                   FSYEVFKRLIPAVPMTELHGKQSQNKRLTQFTRFAAKQNHGCIFTTDIAARGIDFPAVD
FT                   IVVQFDLPDSLNTYTHRVGRSGRLSVEGFRNYGRTIMLVSDHESDFIKLLKTHSANNNV
FT                   KGNTVVHDVSKLMVPLIEKREGYVTRKLQAILAKESWIKEMAQRALVAHLRYVTTRSLL
FT                   RPNNNQIIEEINQLSISMGLPYSPNIQLTNGNSNDTEVPSVKKSKLSKLKDKIKQKKLK
FT                   NVIDTEELDQKKESDEQVDDVLYLSKSCVNDDIDLYTKSAKDPEREVKKQLTSSRNKLR
FT                   LNRRGIAKIRGVVTLKEAEQNHVIFSDDEAEDESGDKSDYISKLQSEISKNDQFDKVNY
FT                   NQIKREAKKAKHS"
FT   CDS_pept        complement(994148..995962)
FT                   /locus_tag="TA13515"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.273 - hypothetical protein, conserved,
FT                   pfl1085W"
FT                   /db_xref="EnsemblGenomes-Gn:TA13515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74486"
FT                   /db_xref="GOA:Q4UEK3"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK3"
FT                   /protein_id="CAI74486.1"
FT                   /translation="MDMNYSNTNEMGNVYALPVPNTADFGAKNMVAAPQMLDYSNMAQF
FT                   QNYSQPQFYYNQNNCVDGDMNATYNSFNNYSYYNANNGYEYMSQQVTDYPNCYGVNGYE
FT                   MSETSLANPVSNMSESVLAANESSKTPAYTYNDLTLLPFSSGSQFNNQFGSTEIDTSNI
FT                   TDEFCGLHYNTPDQASEYNFGEECKNEWNAECKNLSMVKLDHMSDNLKSLDFDFKKTNE
FT                   DDSESLANASTCENTPIMRPSRPSPPQSPMTTQLVPQTPVNHLPVPSMADVQDLSETQF
FT                   YPPQYFNYAPYQANFAAQYDMSQFNNTMNGYNTMPAYDMSAYNTMNGYDMSAAQGMVGY
FT                   SNGMGYNNGPVMDGLNESIIEIANEIANNVQYLPDKDSNGKYSLDKNHPIHCVWRDVNR
FT                   GHCSWRCRWWENGKRLSKNFNVKRFGEFEAMRMAITMKIRNSTPVERIQLLKEQREAVR
FT                   NQLNLYGSFPNSTNYATSNFNFESNFNDSNINKVMNDNKKLQKENWERLSWTYLKTNKC
FT                   DDSNHITIICRLCSKTTRCSRTRNLQQAHIMHLIRMHKNPWKQYIDPNGLTKMCKLALD
FT                   NLYERYQFTPNHQWVLRPGINRPEPTFL"
FT   CDS_pept        join(997778..998186,998273..998520)
FT                   /locus_tag="TA13510"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.253 - hypothetical protein, conserved,
FT                   pfl1090W"
FT                   /db_xref="EnsemblGenomes-Gn:TA13510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74487"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK2"
FT                   /protein_id="CAI74487.1"
FT                   /translation="MGSKCTKLSDKSVSENDPPQNQNEGVEGDESVLEQKSYDFNELDN
FT                   IQEDDLGSVEENELEEDEAEMKPLESRMSTKNSNVSQDSGLDPGLLPFQNSITTLTNQN
FT                   TSTFSQKNSSLSLNSQNSGMYGLNTNEEPFNEYELNKNNGSNKSLDAYASTQDSNEFTD
FT                   PTVVMQTFTPFDMKKTDELASFLVSRCGLGLQKDHNPQNCKICQTVDLSDAPLIA"
FT   CDS_pept        complement(join(998737..998842,998885..999083,
FT                   999113..999152,999262..999396))
FT                   /locus_tag="TA13505"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.C.cand.374 - hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA13505
FT                   by TMHMM2.0 at aa 21-43"
FT                   /note="Signal anchor predicted for TA13505 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.890) with cleavage site probability 0.001
FT                   between residues 36 and 37"
FT                   /db_xref="EnsemblGenomes-Gn:TA13505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74488"
FT                   /db_xref="GOA:Q4UEK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK1"
FT                   /protein_id="CAI74488.1"
FT                   /translation="MYSPFHKLLMKSQGSFINRPLVSYYFILSYYYSLLASTIGFFSTL
FT                   FYSRSVYHTGKVGERVPTLNAVREVEELLKHHGFLNDGTPEEAYNAQNYLDTFSFDFKN
FT                   VMKNKEEKLKTSTISSDGDTTFVTDDCPIGDDDDDFSLSDLDEFVSLMQNCKMEE"
FT   misc_feature    complement(999268..999336)
FT                   /note="1 probable transmembrane helix predicted for TA13505
FT                   by TMHMM2.0 at aa 21-43"
FT   misc_feature    complement(999289..999396)
FT                   /note="Signal anchor predicted for TA13505 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.003, signal anchor
FT                   probability 0.890) with cleavage site probability 0.001
FT                   between residues 36 and 37"
FT   CDS_pept        join(1000178..1000210,1000279..1000368,1000404..1000472,
FT                   1000538..1000596,1000627..1000714,1000748..1000815,
FT                   1000865..1001187,1001253..1001317,1001346..1001492)
FT                   /locus_tag="TA13500"
FT                   /product="cAMP-dependent protein kinase regulatory subunit,
FT                   putative"
FT                   /note="all_bases.cand.1445 - camp-dependent protein kinase
FT                   regulatory subunit, 2 x cyclic nucleotide binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:TA13500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74489"
FT                   /db_xref="GOA:Q4UEK0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEK0"
FT                   /protein_id="CAI74489.1"
FT                   /translation="MASSENFEFDEAMKLARARPRLSVSAEVFGDNHSKSKVVIPNYEK
FT                   TPQEQAKIMEMIKRCFLFSGVNSSGLDLLVKAFDFKTANPGDVLIKQGDDGDKLYLIES
FT                   GTVEVTRKNATGQEEFLCNLTAGDYFGELALMYNSPRAATVVAKTEMHLWTLDRTTFNH
FT                   VVRMAVIKKREKYDSILSKLDLFKKVNPYDRCRLADALVERTFEDETVIKQGEPGSSLF
FT                   MVLEGQAESFVENKLVKSYNPGDYFGEIGFILKKPRASTVKAKGKCLFVELERENFINL
FT                   LGPMEDVLNKNIKNYKKVLEELKLENKHLKSL"
FT   CDS_pept        complement(join(1001550..1002571,1002666..1002837))
FT                   /locus_tag="TA13495"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.271 - signal peptide, transmembrane"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA13495 by TMHMM2.0 at aa 13-35, 45-67, 148-165, 175-197
FT                   and 214-231"
FT                   /note="Signal anchor predicted for TA13495 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.010, signal anchor
FT                   probability 0.977) with cleavage site probability 0.003
FT                   between residues 22 and 23"
FT                   /db_xref="EnsemblGenomes-Gn:TA13495"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74490"
FT                   /db_xref="GOA:Q4UEJ9"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ9"
FT                   /protein_id="CAI74490.1"
FT                   /translation="MIDDFYSSFCMFCIGFLSLSISFFISTFTLLQHLLHYTSHRLQRY
FT                   IVRILVFLPIYGVITFILLLIPKLFDLLSMLRNIWEGFLIHSFLFLMLEYCGGETACGE
FT                   AISKNPSVIRHLWPLSLIHFFSLNEDIPLNVGFVKRCKMCTIQYVISRLVFSLLLIGVH
FT                   ISGNKWSGTLSFFSSLILSISLYVALYSLALFYFAISRHPALAKANSLTKFFSLKLCFA
FT                   FSFYQGLILDLFMRVSFDRSVRIKSFVVLVETIIFALVQHNAYRVTEFYQPPNQIDTTG
FT                   MTKLESLTRYLQFCLDDLRTMKTSEGMGTILSSAGKALDMSDFFTDTYYNISDKYKEHS
FT                   IFVSHNVIDSDIVLDTNSQEVKDVEMNTVDNFADFQKVKDEIDNDERCNEISKLEFI"
FT   misc_feature    complement(join(1002051..1002104,1002153..1002221,
FT                   1002249..1002302,1002543..1002571,1002666..1002705,
FT                   1002733..1002801))
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA13495 by TMHMM2.0 at aa 13-35, 45-67, 148-165, 175-197
FT                   and 214-231"
FT   misc_feature    complement(1002772..1002837)
FT                   /note="Signal anchor predicted for TA13495 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.010, signal anchor
FT                   probability 0.977) with cleavage site probability 0.003
FT                   between residues 22 and 23"
FT   CDS_pept        1003252..1004436
FT                   /locus_tag="TA13490"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.255 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13490"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74491"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ8"
FT                   /protein_id="CAI74491.1"
FT                   /translation="MLLLSKILTNWLKLPDFSCLNSNRPLFLYLYSKSNLLNSDFSEIF
FT                   SKDNKIVDSLEKQGIECYSEDISSIPCKLIDKFEVTTVPSILGIRNGSKVGQIVKGSGL
FT                   ESFLALSNRLKNEENPTESELVTNLKDLISHGNPKDIRVNISFIKNNFVRELEVNPNLF
FT                   RLFSQGSILSHNNNEYSLETLKSDLSTLDSFLNQVEDSKSSYIITGKLITQIPPEMELL
FT                   VDKYYSLLSGFKRLSAITRGLKKVYLLKVKILELISVKYFIEKNMEKSVKFALDSYKLN
FT                   VDLLQRDMITLDEFHSCETKEVLESLLFLLDPYDLSSLETRAELENILGPRLLNEIPVS
FT                   KRPLGGVTKKRRGFGGRYIWQGIHYRPKRYKPKNLKQYLNEWRCVHDSNPPSFN"
FT   CDS_pept        complement(1004534..1005469)
FT                   /locus_tag="TA13485"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.270 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ7"
FT                   /protein_id="CAI74492.1"
FT                   /translation="MKSVDEKDVKSSIRNKIIEKIQKNAEERRENAVDNSVELSKSEYS
FT                   DVNEVLKANKILESKYNETFESLTKVREIVLQLSDQILDKEFRITQLEKKLHESEKKIK
FT                   NHREDLRAYDDKFKELWARAKEEKEVLENQIKRLCEIIKGKDSEILLLSTENSRLTTEV
FT                   RDYKKKNKELLGQLDLTCDSLSLIIKETSEREKMLNSLEEELKRKQVERQGLYLNEINR
FT                   NKKLYINIKVKENMMSQIIKEKNNQINALSSEIKVLREKLDRISNTFSELSGSNPKQNK
FT                   TLAITNDKIQCTVSSPCNMKMVNGTAKIII"
FT   CDS_pept        complement(join(1005614..1006821,1006890..1007005,
FT                   1007042..1007118,1007172..1007371,1007462..1007831))
FT                   /locus_tag="TA13480"
FT                   /product="DNAJ-like sec63 homologue, putative"
FT                   /note="chr2.cand.269 - DNAJ-like sec63 homologue"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA13480 by TMHMM2.0 at aa 23-45, 103-125 and 225-247"
FT                   /note="Signal anchor predicted for TA13480 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.891) with cleavage site probability 0.000
FT                   between residues 44 and 45"
FT                   /db_xref="EnsemblGenomes-Gn:TA13480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74493"
FT                   /db_xref="GOA:Q4UEJ6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR027137"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ6"
FT                   /protein_id="CAI74493.1"
FT                   /translation="MSQFRDTFTRGSKKDSVLSYDDFASRIFTSGFILCFLIPITIYLL
FT                   KKWLSWKRPKLPAKLRLSDVHIESKKHPCVKCECSFCKTRRAEESKKSLKFTDHFTFSR
FT                   LFQLIILATFWWIVIYLISGINPDDNIKRFDPFELLGLSTDASKKDIQKAYRHLSLKYH
FT                   PDRNPNDPEMSAHFVLITKAYRTLTNEVSRMNYAKYGNPDGPGMMKIGIGLPRFLVDEN
FT                   NQIVILSLFFLLLLIVAPSLFLWYYRTQKNITASGIQLETLQLIYYSLNENTRHKSLPE
FT                   VYSCSSELSSIPYHSSEETELRKYFHVLSDYKRKNISSETFRNFLLLMCHLNRVEDLSP
FT                   KLKRSLNEVLKYSMLITHCMIDVALSKSWLITFRSVIDFRRGILQGLLTRSESFYQIPH
FT                   FTEYEINHVGRGKTSSKNIEQYVKTDFKTKKGLNNLTESQKQDVEEFCKYFPSVTLEVK
FT                   VYVEDEDEIYEGDLVTVEVKLRRNNLKDKELIGPIHAPFFPYVKYEQYYILLTFPLNLN
FT                   KDKDSTNHVHTNESKVNGVVTLDTVDEVKSNDWENNLLLNFSMTSSREAEIVEKMQILA
FT                   EKVGQNTVCVTAINDSYFGAEFSVLKKFYVNPLNMQKRYEAFKIHPEDMKLDEDVNPIT
FT                   KMIGELLTAESSDEEEVEYIE"
FT   misc_feature    complement(join(1006912..1006980,1007367..1007371,
FT                   1007462..1007525,1007697..1007765))
FT                   /note="3 probable transmembrane helices predicted for
FT                   TA13480 by TMHMM2.0 at aa 23-45, 103-125 and 225-247"
FT   misc_feature    complement(1007700..1007831)
FT                   /note="Signal anchor predicted for TA13480 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.891) with cleavage site probability 0.000
FT                   between residues 44 and 45"
FT   CDS_pept        complement(join(1008063..1008956,1009011..1009238))
FT                   /locus_tag="TA13475"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.268 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74494"
FT                   /db_xref="GOA:Q4UEJ5"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="InterPro:IPR033979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ5"
FT                   /protein_id="CAI74494.1"
FT                   /translation="MNSSSGCLFKIKWTNFLGHKVPYLLQNNDGECPLICFVNVLLLRR
FT                   RLELSKDLNVISFKSLCSYISSLLPHASPEWVASVLDTLRGGLLFNCKFDSTRAFIDSD
FT                   PEQLFLSFDIPIKHGWIPDPIVYGPITNLNYDQLLEMLAVFQSEQECSSFGESKLESSL
FT                   EDSKLDDKTEKNLEDDDKVGNNLENEHEEDSKLDEETKLEQDLKNLKLTNTDEEGKTEP
FT                   VVEEQLNNVKSEVDEEKVNNTTEEKKEDKGGNKSELDDYVANLAMEFLETYATQITEYG
FT                   MRVLKEEIPEGSLVALYRNNHFLVATCNKGQLFTLVTDSAFYEHRCVWESLENCEYFDE
FT                   NFQHYVQTSREVKPKKVKFIDKVKRVFRRKQRN"
FT   CDS_pept        complement(join(1009558..1009666,1009767..1009846,
FT                   1009882..1009947,1010014..1010117,1010175..1010370,
FT                   1010438..1010555,1010605..1010642))
FT                   /locus_tag="TA13470"
FT                   /product="vacuolar ATP synthase subunit d, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="chr2.cand.267 - vacuolar ATP synthase subunit d"
FT                   /db_xref="EnsemblGenomes-Gn:TA13470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74495"
FT                   /db_xref="GOA:Q4UEJ4"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ4"
FT                   /protein_id="CAI74495.1"
FT                   /translation="MSSLSVLLIPSRMNLQNLKQRRHNAHLGYSLLKRKSDALTSKFHR
FT                   LLRATVQGKERLVEGLKDATYSLANAVWSAEDFKSLVIESVGRPSVTLKLRGENIAGVL
FT                   LPVFSLHTDPTVDLFANLSLSSGGSAIQSVKTTHLAALDILVELASLQISFIILNEEIR
FT                   MTNRRINALDNVLIPSIDRNLEYIRRELDEMEREEFYRLKMIKKHKEREESEKETEPRQ
FT                   YQSFFDPVDDDIVV"
FT   CDS_pept        complement(1010919..1011575)
FT                   /locus_tag="TA13460"
FT                   /product="40S ribosomal subunit protein S6, putative"
FT                   /note="chr2.cand.266 - 40s ribosomal subunit protein s6"
FT                   /db_xref="EnsemblGenomes-Gn:TA13460"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74496"
FT                   /db_xref="GOA:Q4UEJ3"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ3"
FT                   /protein_id="CAI74496.1"
FT                   /translation="MKLNLANPFTGMQKTMEIDDEKKLLPFFERRMGTEVPGDSIGDEF
FT                   KGYVFKISGGNDKQGFPMMQGVLTPTRVRLLFKKGMKCYRPRRKGEMKRKSVRGCVVSS
FT                   QLSILNLVLVKKGPQEVPGLTDQEAPRRLGPKRASKIRKLFNLGPNDDVRKFVVRRKIE
FT                   GRNKTKAPKIQRLVTAQRLQRKRRLLKQAKEKAKRNKEVLREYRKLMHEYRSKNK"
FT   CDS_pept        complement(join(1012356..1012686,1012787..1012791))
FT                   /locus_tag="TA13455"
FT                   /product="hypothetical protein, conserved"
FT                   /note="One 3-prime exon possible"
FT                   /db_xref="EnsemblGenomes-Gn:TA13455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74497"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ2"
FT                   /protein_id="CAI74497.1"
FT                   /translation="MTLTPTLLWAQTKDDLYLTVELSKPSDLKVDLTDEAFKFYAKKDG
FT                   NVYEFDFKFFKPVKSSDYKTKDQRFLEFKVPKSEPESWTTLNSCGKKHYIKCNWDKWYL
FT                   FLHIFSD"
FT   CDS_pept        join(1013344..1013414,1013448..1014261,1014344..1014564,
FT                   1014598..1014874)
FT                   /locus_tag="TA13450"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.256 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74498"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ1"
FT                   /protein_id="CAI74498.1"
FT                   /translation="MSIFYFLNGNNLFFYFRNCIKLSSYTSQKCSSRSNFSNYIGSTPS
FT                   SKSVSTDVSHLNVNIPFNITSQPNQIYKLLLDNPYKFDIFTTLKYVEILQTSKLSDPRI
FT                   VNILSQQLLCNLDKLTTARAMSRFFRVLEPSSHLTNDFFNTLISYIYEKKIYPELNLPR
FT                   VWTSYFKFLGSNRIYHKELYQDLVSLYNLYLNLFLSSSDPETTGDIVPKKRLQESIATV
FT                   NWCLCICRFKDHTLYETVKKIIKTHKLDTSTLVRIYWSFSILNLPTTDLSEINQLLNQT
FT                   LENNSLYKLSHINQIYTILKSPSFSNGLSESEQQERNQLIETCKEYLINSKYSKNGKII
FT                   SKSQKLVSDFLIRQNIPHQLEILTSDLSSVDIYICLNDEKIILEVDGPTHFIRNLDDPS
FT                   ETRKIGPCHFKEKLLKENGFVFISIPPIHSDTQNIKQIDEYYKELLQNSGSAHLNEIMK
FT                   YN"
FT   CDS_pept        complement(join(1014954..1015220,1015254..1015841))
FT                   /locus_tag="TA13445"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.264 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74499"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEJ0"
FT                   /protein_id="CAI74499.1"
FT                   /translation="MEGYRTNRSTTKSQAQNPPKQATLLQKPGNIKSSNPPSKVSNPDS
FT                   TQSNSSGTRLVYNKDQNTQDSFSGKLKPGDEVRTKRARTAKPDDEKTVKNPEAISPVRT
FT                   DNEDLINGLALQRQWDEKPDIDNLSNSLLNLYQKLESKDRSGLADLRAKIFLSSLRVRS
FT                   KSISYLNFTGSRLKSVIKFSKHLNLKYNTVNYNVPRIEKHYLALCKYYQRKRGLNEVYE
FT                   KLSSVVSKLPGVKQAQQTAEELAVNKAKTLEKIAKIKEQIQAQKDQINEITQSLSNILD
FT                   EES"
FT   CDS_pept        1016042..1016944
FT                   /locus_tag="TA13440"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.257 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13440"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74500"
FT                   /db_xref="GOA:Q4UEI9"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI9"
FT                   /protein_id="CAI74500.1"
FT                   /translation="MDENIDDNDFNKSDNDNTDDLNKNTGEPGNSSDSPFNINDSNNTD
FT                   EDLNNYNVENDQTNDDRDPQTDNLPNDDDIVGLFEDSDENVDDSIKTEGMSQSPTRREV
FT                   EPVEQEQSPVYETEIISATLPLLPRPGRNENLVVCKFPPTLMVCDVNDIRNYLRSNPHI
FT                   LENPPNPNNLSILLYDIKTKSNNSFPKEGQSSNQNVRSNSKIVAWDDNTVTLFVGTVPL
FT                   DVEFQSEVSFLFEDSNFDLKPVHAEVDTRLQTRFSNLLKNKMIKQKHTKRQKMEVTFLS
FT                   DAIQSQYKIQEVILFFINF"
FT   CDS_pept        complement(1017257..1017523)
FT                   /locus_tag="TA13435"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.263 - score = 6.31"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="1 probable transmembrane helix predicted for TA13435
FT                   by TMHMM2.0 at aa 31-53"
FT                   /note="Signal anchor predicted for TA13435 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.964) with cleavage site probability 0.000
FT                   between residues 46 and 47"
FT                   /db_xref="EnsemblGenomes-Gn:TA13435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74501"
FT                   /db_xref="GOA:Q4UEI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI8"
FT                   /protein_id="CAI74501.1"
FT                   /translation="MEDYQKWTRREVKEKRKVEYRFFPNRTPGQTFFVSVLMGFSVMGL
FT                   AYMILEISKKLQEKKANKLKFQRNLSKTYIPMESVSKLIINVP"
FT   misc_feature    complement(1017365..1017433)
FT                   /note="1 probable transmembrane helix predicted for TA13435
FT                   by TMHMM2.0 at aa 31-53"
FT   misc_feature    complement(1017386..1017523)
FT                   /note="Signal anchor predicted for TA13435 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.000, signal anchor
FT                   probability 0.964) with cleavage site probability 0.000
FT                   between residues 46 and 47"
FT   CDS_pept        complement(1017777..1019273)
FT                   /locus_tag="TA13430"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.262 - transmembrane"
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA13430 by TMHMM2.0 at aa 20-42, 100-122, 134-156, 166-188,
FT                   201-223, 252-274, 287-309, 359-381, 401-423 and 433-455"
FT                   /db_xref="EnsemblGenomes-Gn:TA13430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74502"
FT                   /db_xref="GOA:Q4UEI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI7"
FT                   /protein_id="CAI74502.1"
FT                   /translation="MAPHSCTKEANANYDGDACSLLMSAYILAGLAMMLNIRLSYSSAP
FT                   YALIRFGLPENLFSVFVRRMASALELWCLPSMALGNVMDLCYKKAGSEPDKQKKFFWII
FT                   VPSIVTQWLNFLTYVLLLVVYLMGGDQGRLTTFYFVIAISGVVFGINMTLVYSADFYYI
FT                   PVYIAGENCFPALTSFIHYLATLIFGNRRKWNSDYIIVYIDIGVAIIISFVAAVVWTVG
FT                   YLIEHDTATGYDQMYHIHANTFDGNLNWYQISPFLMIVVGMGLVYAIYPGIAPGMIVPF
FT                   YLIDKIEMGLLIATIFPPVIIAILRIRAKSWSPQHNIYHKGGDARNGFQLWKPYQLHVA
FT                   SGSACDDAAEAKPENQVHAYLWHFFDILFVIKIILAAIFIYSLHYRDSGLSRSIVNQPK
FT                   MSTFLSITFYMCHEILLAVGFSGFIGNNGGDLILIPQYIGALFMIFLAFYSEGYIIEYK
FT                   SHNPAHRSTTGMTRWIPFCFWVSVTCKIIYPISRRSSTRI"
FT   misc_feature    complement(join(1017909..1017977,1018005..1018073,
FT                   1018131..1018199,1018347..1018415,1018452..1018520,
FT                   1018605..1018673,1018710..1018778,1018806..1018874,
FT                   1018908..1018976,1019148..1019216))
FT                   /note="10 probable transmembrane helices predicted for
FT                   TA13430 by TMHMM2.0 at aa 20-42, 100-122, 134-156, 166-188,
FT                   201-223, 252-274, 287-309, 359-381, 401-423 and 433-455"
FT   CDS_pept        complement(join(1019482..1019664,1019726..1020045,
FT                   1020087..1020267,1020428..1020783,1020835..1026889))
FT                   /locus_tag="TA13425"
FT                   /product="SfiI-subtelomeric fragment related protein family
FT                   member, putative"
FT                   /note="hypothetical protein, conserved Theileria family,
FT                   signal peptide"
FT                   /note="Signal peptide predicted for TA13425 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.980, signal anchor
FT                   probability 0.003) with cleavage site probability 0.675
FT                   between residues 19 and 20"
FT                   /db_xref="EnsemblGenomes-Gn:TA13425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74503"
FT                   /db_xref="InterPro:IPR007480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI6"
FT                   /protein_id="CAI74503.1"
FT                   /translation="MFNFYILLVIISGLWCGTGENILKKKADNVKDKYELVVGSAYKEL
FT                   AKQGAYSSVVTKIEKGEEITNPDDLKVKDVYEAYNNLKTEYDGMLNLIKLAYYEEKLKE
FT                   AVESQPTSSSRGSPSAGTSPAGGQTSTTKSQNQSASSSSQSRSSQSSSQPASSGSKSTP
FT                   TTPTSGGTQPSGAGSTPTSQSQSRSSQSSTQSARSGSQSQSVKTASQPTTPSSGAGTSA
FT                   SPSGSTQPPKAGGTSSPTTQTSSTPASQTPTSQSSSQSTGTGTSAGQVSKSPTPESQPE
FT                   SSSSETDQSSSGSGSGTDGTVVTKSIEPTKVTLDIDSSQGTSQFGYSKSDKINTFTVKD
FT                   EHVFSKVNKGTDAVWDSKGGDCGTKVIFIDENKKYVSILLTNSMFLLFHLESGQWKDIT
FT                   STRHHIDKLKFFGDSDNPLTKNDYTVTIADYSYRFTFKAGVNCSKIKYADDDLWKNTDD
FT                   PEYSTITAFDLGLISNNFFVKNKTKFKKLDFNPTQAKGGQSTTPVSEVITATTVPQTSL
FT                   AKLAEPAPEKVAVTVIAPTNRPRPKKTPKGATGPRTAITLNIADKASNSAVEFKEDYQK
FT                   NVMVFSSKEKYVFNKIVKIDGSETVIWQAKDQTEHFHTVYVDGLGTFSKTKNMSLHLCN
FT                   GNFIHLNGSDSGPWSESPAVVDLDVRISNSNIKVDYFQKDNFRIYVAKPGYTIRKVMKS
FT                   KKCSSDCICSPKVIWEAQSEHALKVVLMGSKKEPKHLSVMLESGELTLLFKSGKGQPWD
FT                   DVTSSRNKITDLKMYAMAEGKSMELHRGHYSITLFNEFYGYLFHEGVGCVKVTHKGKNI
FT                   WDLKEEGDFGCLKGVFLDLKSNKFNVMNDDDRYWVCEEVRKVNPVTLDVSSKASTDDFD
FT                   YTVDHNRKINIYTSKGNAMFNQVIKTSGSNCCGSRCCGSETVIWEASDPQNYASKVFAD
FT                   GVGACSSTKNVSIYLLNGDILHFNEGDNVWQKSGNKIILDVDKTSSTIGYDFVHHGETR
FT                   TFTTKPGYLFKTVMLSSSWTWLVCGSSCCKSGCLSDHIFWEAQTDDECSTKVTVYGVKT
FT                   TVTNINIFLKNNEVKHFHKADGKWVSKTSIVLDIEKNKDNDLFEYRSTRNFGHFNPMAN
FT                   LTIEKIVKTYKSNCCASACCGSACCGSIDELVIWTAQPDDHGLKAVLMGSGKDEKFLSI
FT                   LLQSGNFVLLRKCGKGECWEDITQEKSDFSGIKMYSLEEGTSNYHQLTDTDYDPIIFES
FT                   RYGYEFKEGVKCVKITYNNSILWNHTDDPEFGYLKGLYLDLPKDQFSVTNLKDQTKQLT
FT                   KAKRTLVSLDIENTQSTNQFSYTDQNGVITYKVKPGCLFVKISKGTKDVWESINNVCGK
FT                   LVRTMTINGVKYLAILLDNNMFKIFKESDDDWQDITKDSHDVTKLKFIGENDLVLTSSD
FT                   YNVTIVDLSYTYIFNDGVECRKVKLGDLEVWKHSDDPGFSEIRKFRLGLISNNFYVLNN
FT                   KNESKKIDYKPTPETTAVITKVSVTKPAVPTKVTLDIEKTQSTSQFEYTDHNGVVTFTS
FT                   KDSHLFDKVSQGTTLIWESKTDVCGTLVRTKTTKGVKYLVVLLTNNMFTLFHLEDDEWN
FT                   DITSDRHDVTNLKFLGENDAELSKTDYTVTIVDLSYTFLFNTGVSCKKVKLGDDEVWKD
FT                   TDDTKFADIKSFSLGLASNSFFVKNQSDEVKKIEKKAEAPEPTPPEDTAPVTTPVTAPE
FT                   PTPVTPTPEETATETKPEEEPETPPEAEEPAPEPPVTETPPVTIPETKPVISLKAPEPE
FT                   AEQVVTPVAKPFALDIEETESTNEYDYSDKNGVVTYRVKPGHGFNKVTQGIWGIWESTD
FT                   LYGRLVRTKVFSNNERFLAIIFYNNTFNLFRKSEGSNTWKDITDKRLYVTKLRFLSHSD
FT                   HVLTNVDFTVSFVDFFYSFNFRNISKCLKVTYGENVVWKHTDYFDFSDITTFYFGIISN
FT                   RFFVRNRYGRFIKLEKELEASRTAVPTQQPAQPVKQQAEESTEAEDSSPTTPTDSAKQQ
FT                   ATPEETAEPNQSAEPVSSEQSTPPTSIPVPIESIEQFDRVTEAYDNLSKLDKYKQLLNS
FT                   AQEKIAAGHSASGLSESEPVVKDVYDAYTNLKDLYNKILNFTKISHYSTQLDIAINTSS
FT                   VNAKDVITNFNAVAAVYNQLDELNKYNGNLNGNIVDTAQKLSAGEKAGYEWDTSENKLK
FT                   NTDDEDRLIQNKRQKYRCIIVPSMLTMWSTNFNTGSSSQSPQGRLTAGTKFSNLNNDDE
FT                   GARAKNLWHIQPPDKIEMVLLIATFFPPVIVALLNRGVFGPDAKARSPKTCPDKSGGGM
FT                   GGWRKYTPQYCGSSSTESYSYTHFILENHIVTDEVVLLPMQLIYALLKVLLDFYSVCYI
FT                   TEYEKNDPSECPTEGMTR"
FT   misc_feature    complement(1026833..1026889)
FT                   /note="Signal peptide predicted for TA13425 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.980, signal anchor
FT                   probability 0.003) with cleavage site probability 0.675
FT                   between residues 19 and 20"
FT   CDS_pept        complement(join(1026918..1027345,1027384..1027519,
FT                   1027551..1027688,1027720..1027887,1027979..1028037,
FT                   1028093..1028279,1028338..1028434,1028495..1030904,
FT                   1030951..1031065,1031133..1031336))
FT                   /locus_tag="TA13420"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.260 - hypothetical transmembrane protein"
FT                   /note="transmembrane protein, putative"
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA13420 by TMHMM2.0 at aa 109-131, 317-339, 980-999,
FT                   1052-1074, 1084-1101, 1129-1151, 1191-1213, 1225-1247 and
FT                   1267-1289"
FT                   /db_xref="EnsemblGenomes-Gn:TA13420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74504"
FT                   /db_xref="GOA:Q4UEI5"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR039720"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI5"
FT                   /protein_id="CAI74504.1"
FT                   /translation="MEYLNEPTVQQILGNDLYSYFKESDENAEKVYFTDENAKNKESDS
FT                   ENSVVKIGLTTKQAIDRIISKLTEILSNYNDKIKLKDLFPELVQVDIALNATALLINIG
FT                   KMFANVYWEFVLEFLLLLFWLILNVYVKILFKVSKVYRKRNRLLEILHFLKFEFTYPNP
FT                   ESDTKKYNIDPSSSDFISVYRDYDWVRLPRNILVEGDVYKLRINETFPCDSLLILNVNN
FT                   NDLVTHNEIYREGERCNFVGTPVENEHFLDGTFVALSDSFLKYINYYLFHDHSDYQPNL
FT                   ELPRRESSWFRNNQEETKIIWNYNDNYIFLNNNNKIVIVIIIIVTLILNLMWAILYNVE
FT                   SKFSTIITMYRLLIMLQFVGLDPFSKLSELWGNVKLMAIFDLYQENMLKDLNPVRSVSS
FT                   SKSLLSSSIFGSESSDMMLSEVKISFMQVNKVLRLGLFDELSLIRRLSTITLLSFIDDV
FT                   GILLNSYQSLQEISIISKNTQNTTISSHLHESIHHHENSQQDDGVFIRLSTTDERDSAL
FT                   NMANILGNVFEQDVVEDTDELLILDIYNDIDLYGKDNSAFINDYELNNKNLLKPLVFSI
FT                   ALTSILNINMYRSSLFNSYMSMLINNELASYTNCLCNLNTVFNFRRYYLKHFKLLKFIV
FT                   INTSGITYSTDIKSGALDSNDDSIVIYFYRDLNKRVIQMLIKCRITILNDCKLNFYNGN
FT                   VIKPLNRALRRKISDLNVQWLSNGIGSFLYLYKPISIDDYNILQVLLPFSTIYNNFKTP
FT                   PTTNVGNTGPATAPYTATAQTGTETGFGTRRKNNKLMFLYRHNSLYYKYKGINIYKLSN
FT                   KFKNTISSEALAHKDIILGSFIGEMLKSYIKNSILLGIVGIKYEANKEINSKINELHKS
FT                   GIRFVYFSKHNEKHTRIIGSLFGLEISWNSMISLSTSETSSYINQEGHIVLPNGIDNIR
FT                   QHIKYVDDIPLQVSLFCNCNYENIIEMFNILNENNENIMCIGSGLNSNNFYLFSNAYLA
FT                   FAISLNYHPLCKFCKCKRWQGVSRQHVIVESRSEIINEGDSLFELLFELFKESRNTSTN
FT                   IQEAVSFMLLSYYTIITMYFIQSLLSLTSVFNNFDLILIMYFYIPLISITLLNNPIMDK
FT                   IMEQLPNKIESSNIYYKYYFRIYSRIVVFALFTMATHYINIFYVNNHLNATFMLNNQPC
FT                   KNFFHYPKTHCMNLLSKHLNYSQYVWLIQNFTSIVFVIFLIISSIFWIQKYTFLGISCF
FT                   LNYHWLFISFLICFVHVGIVSLRLYLNPIEDFKVIRILITNSSLSLLFIVPILLIDQAI
FT                   KLFIIKDKNTQQKFLQLLFSTKLGTWSPK"
FT   misc_feature    complement(join(1026993..1027061,1027119..1027187,
FT                   1027221..1027289,1027445..1027513,1027626..1027679,
FT                   1027738..1027806,1028109..1028168,1030207..1030275,
FT                   1030831..1030899))
FT                   /note="9 probable transmembrane helices predicted for
FT                   TA13420 by TMHMM2.0 at aa 109-131, 317-339, 980-999,
FT                   1052-1074, 1084-1101, 1129-1151, 1191-1213, 1225-1247 and
FT                   1267-1289"
FT   CDS_pept        join(1031490..1031581,1031635..1031758,1031799..1031867)
FT                   /locus_tag="TA13415"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.260 - hypothetical protein, conserved,
FT                   pf13_0296"
FT                   /db_xref="EnsemblGenomes-Gn:TA13415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74505"
FT                   /db_xref="GOA:Q4UEI4"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="InterPro:IPR017089"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI4"
FT                   /protein_id="CAI74505.1"
FT                   /translation="MSAYDRFNIHAQLEHLQSKYQGTGHVDNTKWEWVLNIQRDTLSSH
FT                   CGHLTRLAYFSIVENEPIFRIKHRFLQSMAKPVTNIKVKPQLDPQLNHK"
FT   CDS_pept        complement(1031953..1032993)
FT                   /locus_tag="TA13400"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.259 - hypothetical protein, signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:TA13400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74506"
FT                   /db_xref="GOA:Q4UEI3"
FT                   /db_xref="InterPro:IPR013947"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI3"
FT                   /protein_id="CAI74506.1"
FT                   /translation="MDDDYNVLFITLLNNCLSRCIIDYNCLNKQLINNEGSNVVLRNLL
FT                   IQFTRVQREIFLKLKVIFDLTKYEKGINKLLQEINTDYFNQNVVQNLNRNLLTLTNQIN
FT                   APPPNIKLSVDLYNNLRYERMPSMMSEIAKSVNTFPTIKYSDEEINSCIFNIKLHFLIH
FT                   FQQYKMSYSDKVDPVAEQTESGNGGSPVGEIRFINNICNYRRSNYFDVEILFDFKRYQI
FT                   IHVTVLGQTANSPTLMAYLNQVLNTRSGNVFMVLDNAIMNYVNKLILQNLYKQTQAYYS
FT                   AGHVVFNYDYSEDKLEVHCFKDMPSLLEFSVNENNMPEFKINNTFKEFAYDIDLNYYIK
FT                   QILPDS"
FT   CDS_pept        join(1033029..1033255,1033298..1033526,1033567..1033857)
FT                   /locus_tag="TA13395"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.261 - hypothetical protein, conserved,
FT                   pf11_0163"
FT                   /db_xref="EnsemblGenomes-Gn:TA13395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74507"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI2"
FT                   /protein_id="CAI74507.1"
FT                   /translation="MCIEKNHFYIHSYMNLAKNIIIRNRRFIFLDFYKFYSNSKGDSIH
FT                   KIPDSQNHSGLIEYKFNWGIGNTYTEHSKTRVGRKFVKNPKVVTISSDYFNIEEEFERC
FT                   KVVFDEVNEQWEVLWIEFNKLNGKPFPISKYGIQTSKLKSIEFANFINDKLKNTNSVHT
FT                   SDTNKAYNSKEIESSNSVNGEHTSSDRTCVPEDSKDSNKENNIIFDNVLQCWVGLGRRG
FT                   SRPICRAFSADYHGYEKSKELSKNKV"
FT   CDS_pept        join(1033920..1033968,1034004..1034140,1034172..1034225,
FT                   1034256..1034333,1034363..1034428)
FT                   /locus_tag="TA13390"
FT                   /product="hypothetical protein"
FT                   /note="all_bases.cand.1453 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13390"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74508"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI1"
FT                   /protein_id="CAI74508.1"
FT                   /translation="MSALRYKIKNCVQYYPVRSKLWKGSKFNFLFFYFINFDISEIQYN
FT                   RMKLGEWPPPNSSPLHPIEPWGKQLFVFNTTLNGNNEALLCITDSTRKPLIYFYREDFQ
FT                   ALKLYIEKIKEELERLESAAKVV"
FT   CDS_pept        complement(join(1034650..1035434,1035477..1035990))
FT                   /locus_tag="TA13385"
FT                   /product="Tpr-related protein family member, putative"
FT                   /note="chr2.cand.258 - conserved hypothetical transmembrane
FT                   protein"
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA13385 by TMHMM2.0 at aa 21-43, 58-80, 87-109, 119-141,
FT                   148-170, 174-191, 211-233, 248-267, 280-302, 317-339 and
FT                   352-374"
FT                   /db_xref="EnsemblGenomes-Gn:TA13385"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74509"
FT                   /db_xref="GOA:Q4UEI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEI0"
FT                   /protein_id="CAI74509.1"
FT                   /translation="MSGQNNECGKNGEKTKKIIAYMLVGFSLFNTLLIGMNGSPFSLNR
FT                   FKIPGKYYSLYVSRLHNCMELACFVGVVLGNLYILPYGEQCGYISIAINWSSFIVNIVL
FT                   LVSYVTGGENGHLTFFYWTLAASATIYGFNLQFIYKLGGKCMPYFMVAIPISSVSTSLI
FT                   HYIVLGIFVEITISIIFTCLTASMWSVVYAGENGTESQGSGNGFQSHVISPILMTSVAL
FT                   SLIYVYYPGIAPGLLVDFIYVHKIDIVLMLVVPIPSMVIAVLSHYKMGPDNNWQGKTYW
FT                   HGFLVFIVSMIVCSILFTISLHYPQSSVSRSIVNRPFMTGFLTILFYISHEIMLAVGFP
FT                   SITENWDSTAATGNGLLSGTGVIIFVLLGEGYITEYKRHDPSKWPTDGMTTRTAFSYWM
FT                   SRSFANALENVKRIFTLDVRRDILKSVRKIELI"
FT   misc_feature    complement(join(1034827..1034895,1034932..1035000,
FT                   1035043..1035111,1035148..1035207,1035250..1035318,
FT                   1035376..1035429,1035481..1035549,1035568..1035636,
FT                   1035664..1035732,1035751..1035819,1035862..1035930))
FT                   /note="11 probable transmembrane helices predicted for
FT                   TA13385 by TMHMM2.0 at aa 21-43, 58-80, 87-109, 119-141,
FT                   148-170, 174-191, 211-233, 248-267, 280-302, 317-339 and
FT                   352-374"
FT   CDS_pept        complement(join(1036531..1036854,1036894..1037097,
FT                   1037150..1037323,1037377..1038052,1038085..1038183,
FT                   1038266..1038490,1038555..1038662,1038728..1038861,
FT                   1038896..1038925))
FT                   /locus_tag="TA13380"
FT                   /product="RNA processing protein (crooked neck family),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA13380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74510"
FT                   /db_xref="GOA:Q4UEH9"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH9"
FT                   /protein_id="CAI74510.1"
FT                   /translation="MPPFDPSKLQVKNKMPAAVQITAEQILRDAVEWQTKEVKTTKQTI
FT                   ADEEELNFYKAQKRKEFEDTLRRQRHHIGTWIKYAVWEANQQEFRRARSIFERALLVDP
FT                   NNPSLWLRYIETEMKNKNINSARNLFDRVVCLLPRIDQFWFKYAHFEELLGNYAGARSI
FT                   YERWMEWNPEDKAWMLYIKFEERCGELDRCRSIFNRYIENRPSCMSFLKLVKFEEKYKK
FT                   VSRARSAFVKCVEVLDPELLDEDFFIKFANFEQRQNNIEGANSVYEQGLKLLDKTKSEK
FT                   LYDNFISFQKQFKNEFIDDLISVKKRNEYEGDIALNPDNYDTWFNYIKLEESILENMLK
FT                   TCSDEKLEAQKDRIVQVYERAIANLPKDNNRKLWRRYSYLWIFYAFFSELQLDSKERAE
FT                   EIYLKSLQILPRDFSKIYIYLSQLYLRMGDLKKMRSVMGNAIGLCKKEKIFETYSDIEL
FT                   KLGNIDRCRIIFTKYVEIYPYNYKSWLSYINFELLLNEINRVRKLCEYAIEMEQMNNPE
FT                   AIWNKYISIEKNYSYSNVISLYKKLLQKTQHIKIYKEYSKYEYENGNNEKGREVIEEGI
FT                   KLYKDSSVERSKLLYHLVEMEKKYGNEQTVQNAKKRLPKKILRKRKLENDQEVDDIIYV
FT                   FPDDKTNTKILENALKWKKQQK"
FT   CDS_pept        complement(join(1038986..1039066,1039096..1039191,
FT                   1039250..1039348,1039440..1039679,1039741..1039881,
FT                   1039915..1040038,1040072..1040144,1040184..1040300,
FT                   1040329..1040467,1040562..1040627))
FT                   /locus_tag="TA13375"
FT                   /product="diacylglycerol kinase, putative"
FT                   /EC_number="2.7.1.107"
FT                   /note="chr2.cand.256 - PF00781 Diacylglycerol kinase
FT                   catalytic domain (presumed), PF00609 Diacylglycerol kinase
FT                   accessory domain (presumed)"
FT                   /db_xref="EnsemblGenomes-Gn:TA13375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74511"
FT                   /db_xref="GOA:Q4UEH8"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR037607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH8"
FT                   /protein_id="CAI74511.1"
FT                   /translation="MRHVFIYVNPESGGRNAYHFIKQGVRSLELSKPEPLTLHISSIFE
FT                   GESGNKPGFIKLREFLNNDEPEQPVFVITAGGDGTLTWVVSEVEKHSINPDLLCFGIIP
FT                   YGTGNDFARALKWDKFRNLKPFEDNMKPLISYLSRLVKSDPVKHDFWDVFLTLNPGGSF
FT                   NKINSKTRLKENIMDKDGNLVESMKFKMGNYFSIGTESRIGRGFDRRRTRYSCSNKLRY
FT                   LIEAFKKTFMGLVYVNKQIDKVVYGEDEEVMFVTDSKEKELPVLLKSASLVVLNIPSFS
FT                   SGIDPFSISSEIGIKNVSQEFKKELLMANQVMGDKKMEFFCYRDMKDVGLDMLKIGKSK
FT                   RIHVGSGPWKIYFKELSKDEKSYFQVDGEFFQMYQPKLIEIKHYKTINVVK"
FT   CDS_pept        complement(join(1041155..1041337,1041366..1041479,
FT                   1041509..1041684,1041731..1041986,1042034..1042081,
FT                   1042122..1042238))
FT                   /locus_tag="TA13370"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.255 - hypothetical protein, conserved,
FT                   pf14_0682, signal peptide"
FT                   /note="Apicoplast targetting peptide predicted by the
FT                   PlasmoAP tool"
FT                   /note="1 probable transmembrane helix predicted for TA13370
FT                   by TMHMM2.0 at aa 7-24"
FT                   /note="Signal peptide predicted for TA13370 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.622, signal anchor
FT                   probability 0.374) with cleavage site probability 0.415
FT                   between residues 29 and 30"
FT                   /db_xref="EnsemblGenomes-Gn:TA13370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74512"
FT                   /db_xref="GOA:Q4UEH7"
FT                   /db_xref="InterPro:IPR012430"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH7"
FT                   /protein_id="CAI74512.1"
FT                   /translation="MMLLKILLQFLVFLVYMVFLFRYIKIARAGRKYLKDITAASCVPD
FT                   SKNNGKIVHINCRLDKSVVNYVGKEFWSNIYSHNGIFVETKVEIFQWVPRERMTGKFYS
FT                   GEFVDHLLPSNIFYKNPNFIPNVGGSGRVYAKQIKIGGYIIGREWFVNLNNKSKLKVDD
FT                   DEWYEPSSSVPPVEISNLNTQVFNDFLYTGDIINPKIGDIRISFYGSEDIEFSVIGRQT
FT                   GTLLGEYQLKPVEFLNKKMVLVAGKFYDKQELQDYIFSQISKTNIEILRIVLILLLSAL
FT                   VYEEIKSEKVYLLKIN"
FT   misc_feature    complement(1042152..1042238)
FT                   /note="Signal peptide predicted for TA13370 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.622, signal anchor
FT                   probability 0.374) with cleavage site probability 0.415
FT                   between residues 29 and 30"
FT   misc_feature    complement(1042167..1042220)
FT                   /note="1 probable transmembrane helix predicted for TA13370
FT                   by TMHMM2.0 at aa 7-24"
FT   CDS_pept        join(1042492..1042500,1042537..1043028)
FT                   /locus_tag="TA13365"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.262 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74513"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH6"
FT                   /protein_id="CAI74513.1"
FT                   /translation="MSRRVRYVEIREDCEHCMECELCQGYYTNIEVCECCECDNYGNSC
FT                   NLRFENFKRPELENNGVYRQNGLDCGCKRVEFQEEGKMCRISNLKNQVKNKPLRFCKRE
FT                   VSCLMKKLNNIISVFPLSRGCEDTEIIAKPIKAGYRPANHLKEKVPVIKISTPRINRQN
FT                   RIR"
FT   CDS_pept        1043138..1043875
FT                   /locus_tag="TA13360"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.263 - hypothetical protein, signal
FT                   peptide"
FT                   /note="Signal peptide predicted for TA13360 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.000) with cleavage site probability 0.701
FT                   between residues 17 and 18"
FT                   /db_xref="EnsemblGenomes-Gn:TA13360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74514"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH5"
FT                   /protein_id="CAI74514.1"
FT                   /translation="MMIKIFLLILAFNFGLATDELECVGYSLDSNIRDTRIRSLKKINL
FT                   LVVKVSDPKKYVLGTVKIGNLVEDGDCKYKSRHVVVDTSKPQKIVRVLTEYGTETKVSE
FT                   YVEVSPKTYRVLEKTSFDLDLNDEYLHENVHSYFDPNHDVRVIKAKDELHDHKIGRVTI
FT                   NGHVIDDIPESLERIVYIWDSEEGTRHLKIDTHLKDNRIVSSKFEEDSPGSGNFIKKKT
FT                   CGSILNPYGCWDEFLDWKNGASL"
FT   misc_feature    1043138..1043188
FT                   /note="Signal peptide predicted for TA13360 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993, signal anchor
FT                   probability 0.000) with cleavage site probability 0.701
FT                   between residues 17 and 18"
FT   CDS_pept        join(1043985..1044063,1044140..1044555,1044590..1044688,
FT                   1044718..1044862,1044931..1045166)
FT                   /locus_tag="TA13355"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.264 - conserved hypothetical protein,
FT                   jmjC domain, PF02246 Protein L b1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74515"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH4"
FT                   /protein_id="CAI74515.1"
FT                   /translation="MREVPSIPRDSDFRDLIKDSIPFKISGYTSDDLGSCLEEWKPERL
FT                   SSILSERRVSVHVSSEPNLNFVAKNFKYEYMTFSDLFWRIKESQKCLNGDREYLYYRSL
FT                   GERPRKDPSNLSSVHPYLEETFKLPAEISRILDDSSSSIHSTVFRISQPGVELWTHYDA
FT                   LDNFLVQIHGSKLVILFPPSTLHKLSITDTSSPYRNICKLDMDSANSELLSAYKLAYKT
FT                   VLNPGDVLFIPAAWSHGIHSLFPEDDSEEIKTCISVNLFFSDGQVEYASKNVYGNEDPA
FT                   PMKRACDLLQKDFLNLSLQLPVHLQKAFWSKVASISLQYLNNL"
FT   CDS_pept        complement(join(1045229..1045849,1045910..1046038))
FT                   /locus_tag="TA13345"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.254 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74516"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH3"
FT                   /protein_id="CAI74516.1"
FT                   /translation="MSLSFDSYHGHSPVYSNFNEYKGDANSDTNLNYSENSNDLSAKIN
FT                   DNSLVELTLNLERERETYLEAVAVLHDQLRESHEQCQQLVNSHAELTRELEAEVDDGWK
FT                   EAKHWQDKYYKSCRIMKAAGIDVNKYPNLSVVGSPENEATNISSVSTNVNELNDYPAEN
FT                   FNGTWVYTLSDNFEDLETLANIHSLSNNNFPLTEAEAKMREKVKNAWINLKTPRRFSNQ
FT                   YHVPEYMRESNSEPLSKILELLKYVDY"
FT   CDS_pept        complement(join(1046292..1046511,1046616..1046676,
FT                   1046706..1046823,1046862..1046986,1047046..1047125,
FT                   1047186..1047257,1047290..1047362,1047402..1047534,
FT                   1047571..1047687,1047730..1047819,1047877..1048101))
FT                   /locus_tag="TA13340"
FT                   /product="DNA polymerase delta small subunit, putative"
FT                   /note="chr2.cand.253 - DNA polymerase delta small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TA13340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74517"
FT                   /db_xref="GOA:Q4UEH2"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR040663"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH2"
FT                   /protein_id="CAI74517.1"
FT                   /translation="MGNERLDCEFVESYSERFITTGEGYKSQYYLRSVSKLQSLKKLLL
FT                   ETIKTRWTNVKIDDSDPEAYKLVESINYVKGKCVVIGTIFKQMKNHPSPLDEYIQKFDI
FT                   KVEQRLEYTDDDDYLFLEDHTQRLVLVGNCLNPHKFVSGLVIAVRGYMNDENKFVTEDY
FT                   ILPEVPDTLALYNIKDEEKFIALTSGLELSGKDLNYKSLLLLQNFILGECNSEYNKRLV
FT                   RLVVAGNGIGRCDIESLERSDIFYAQLASSVNVDLMPGTTDRPMDPTNSNLPQQVINPI
FT                   LMENSKRYGTFRSTTNPYFFSIDGLVIWKGVSSTQFIIDQVRFLGVSGQTVEDMCKFSR
FT                   LSELDALKLIARSRCIAPTGTDSLPIHSEMDVFNLTEDSEYPHVFFTGNCKEYEVGDFG
FT                   TSGTTKLPKLVCVPSFRREPTLVLISLRTLEVTALKLT"
FT   CDS_pept        complement(join(1048198..1048353,1048398..1048485,
FT                   1048518..1048653,1048690..1048774))
FT                   /locus_tag="TA13335"
FT                   /product="(SNARE-interacting) vesicle transport protein,
FT                   putative"
FT                   /note="chr2.cand.253 - hypothetical protein"
FT                   /note="1 probable transmembrane helix predicted for TA13335
FT                   by TMHMM2.0 at aa 130-152"
FT                   /db_xref="EnsemblGenomes-Gn:TA13335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74518"
FT                   /db_xref="GOA:Q4UEH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH1"
FT                   /protein_id="CAI74518.1"
FT                   /translation="MIYQYTTYITYLTCSLSQNNYSFNPPLMLNYIMNNVNDWYINAER
FT                   DEEYGDRTHLLQQSRALDESLSNLAQSRSVLNDTNELGANVMSKLLNQRDSIVRTKQLI
FT                   SETQNIQHETRDIITSIGRSEFYTRVLMYLTVVMLVLAIIFIIIYKVLKK"
FT   misc_feature    complement(1048207..1048275)
FT                   /note="1 probable transmembrane helix predicted for TA13335
FT                   by TMHMM2.0 at aa 130-152"
FT   misc_RNA        1048893..1049023
FT                   /note="U4; Rfam:RF00015"
FT   CDS_pept        join(1049396..1049590,1049632..1049742,1049812..1051599)
FT                   /locus_tag="TA13330"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.265 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74519"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEH0"
FT                   /protein_id="CAI74519.1"
FT                   /translation="MNVIWNQFMYEICERVSKYSDSSRFDDINSFDKVDKFTPTDISLI
FT                   FSSFSHVRRNNKQFYDFLLQSVLRDVAKYTVRDIAVLYNSLAKLSTFNEFVFDSLNKDV
FT                   ALLLNSLLDLRICNLKEIFVKCSLILSSRIKYIENPHTLTLLLYSYSRLIILKDKDKLN
FT                   KPKNLSSPLEPKLTPIIANDYEHIILSDVIITLLSKCSDVLLTMNPTDLLYLYRSYLNL
FT                   LFNSTYVDETNETTTETISSNELNVDGRIYNNILKFYKLNNQILQNKLAFQTRELIILY
FT                   HLLQNTTKRMIDDNDLITFATQEEMKNLKNVIKEELIYRIKQMSVIDSMNFINLLDHSD
FT                   DSLELVFRRLCDKLSREHQWETYTLSQLLMVLEKIKARNCISEDSRNLVAVLISKTPRI
FT                   LKLSDLALISEVSTLFGIKSTALERRLSTIECRCENLTENQIYTFFHTFVSLGFLQFLD
FT                   PILEHLYHVRDPNASADLLLDVSILKFLSLKNINEDIIEHLENNLKNVDLSYIKLLLTG
FT                   LTTQSIDIFGTHELNYISNLKRISFNDIYREFSDDFEEFVAKHDPNVRLGKNIVVNNIN
FT                   LPMAVEINNKQIAIVLLFDDFYRTNKKMLKLHKYVQLRLLKHLGVGYMCFDLIDYYTNE
FT                   NKPNLLANLLKNLYNEASGVEKVKEHSQPDSNDKVGVNVIIKERNLKKMNNFSRFKLMV
FT                   ANC"
FT   CDS_pept        join(1051987..1053057,1053138..1053848,1053907..1056234)
FT                   /locus_tag="TA13325"
FT                   /product="DNA topoisomerase II, putative"
FT                   /EC_number="5.99.1.3"
FT                   /note="chr2.C.cand.266 - DNA topoisomerase ii"
FT                   /db_xref="EnsemblGenomes-Gn:TA13325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74520"
FT                   /db_xref="GOA:Q4UEG9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR031660"
FT                   /db_xref="InterPro:IPR034157"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG9"
FT                   /protein_id="CAI74520.1"
FT                   /translation="MGKAKTVEERYQKKTQLEHILLRPDTYIGSTELNNQQMWLYDEEK
FT                   NRMVYETIDYVPGLYKIFDELLVNAADVYARQLSDPTLEKMTCIKVTIDRGTGAIVVYN
FT                   DGEPIPIQIHSEHKMYVPQLIFGELLTSDNYDDSEERVTGGRNGFGAKLANIFSKTFTV
FT                   VVGNKKTHKKFKMTWCNNMTKTKSPAHIESYTGPDFVKITFIPDYSRFNLEELDEGTYR
FT                   VLKKRVYDMAGTLGVKVYLNNERIKVKDFKDYVNLYLPEDATEIVKIYEKMYRWEVVIS
FT                   SSEDGFRQVSFVNSINTLKGGTHVSHVVDPLVQSLTKKVNSKNKGGIELKPNQIRNHIF
FT                   VFINCQIVNPSFDSQTKETLTTKIVKFGSKYTMSDKTLNQVLKSKIFDNIISWLHEKTN
FT                   IELKKKMKVAKGNDKLFGIPKLEDANKAGTRYATECTLILTEGDSAKTSCLAGLSVVGR
FT                   DKYGVFPLKGKLLNVREASYKQLTQNIEVQNILKIMGLDITNKLRQDSSGLRYGSIMIM
FT                   TDQDYDGSHIKGLLINMFHNFWPKLIQFNGFIKEFITPIIKVTNKSNNQVHSFFTIEDF
FT                   NNWKQTVDISNYRVKYYKGLGTSSDNEFKEYFGNLNRHIVEFKYVDTVDDDSIDLAFSK
FT                   KRIDDRKKWIQNYVLGTTVDHSIKKLRYSDFINKELIQFSIYDTERSIPSVIDGFKPGQ
FT                   RKVLFGCFKRNLKNECKVAQLTGYIAEHSAYHHGENSLQQTIINMAQDYVGSNNINLLL
FT                   PCGQFGSRKEGGKDAAAARYIFTKLSPLTRYIFLQEDDPILDYQNDDGQIIEPYYYLPI
FT                   IPMVLVNGAEGIGTGFSTFIPSYNPIDIIDNIVNFLDNKDMNDMIPWYRNFKGTVTRNS
FT                   KLGYDIIGNYELNHSINQLVITELPINRWTNDYREYLNSIMATNKEDEGYITDYGDFSS
FT                   NEFIKIKIKLNDSGPDITDDIEKVFKLKTTISTSNMILFDCNKRIKKYNGAIDILKDFI
FT                   TTRVKYYTKRREYMIKQLQLQLQQLSNQIRFINMIINNELVIFRKSKKQIVSELKRLNF
FT                   NTYKPEEEEDEEDNDIEGFNYLLKMSLLSLTLDHINKLNNEYNSKQVQLKELINTTPIQ
FT                   LYKKDLVVLKEQLVQTKQYKPYDKRVKLQPEPIVSEKVPETRRVPSLNGTTPSTNGLTH
FT                   STNGIAVNNSIPHVDIFDLTELEEVDMEKGDEVYGSSQYEDNFQLSQLELSQVNPEEFT
FT                   QSNTEDSSQYIPEFSSQTSEKEPNPLEKYSTSLLDRLNKKYNSNVLTSIINTDEEAKTP
FT                   PSKPIPKQVEKTPAKSSTSNSGKKSTSIKRKISSKLILSSDEDSTPPKPARRTKKPKKI
FT                   IEDEDESESEFELEDDDESEFELDDD"
FT   CDS_pept        join(1056328..1057642,1057673..1057790,1057867..1058881)
FT                   /locus_tag="TA13320"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.cand.1459 - fork-head domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74521"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG8"
FT                   /protein_id="CAI74521.1"
FT                   /translation="METHSEVFKKLGTHVTCALQEVGAQLKFHAKHATNELVSNLDNFK
FT                   TPFCGKLTNEMNCSLFQEPNSNTLRQTQVKTSGNYKFGFEINLVPQDLGVLSVSVSGAD
FT                   VSSFNFTWRRVLYSYECQLDHVSGPTYKLTADDVGTTIAVKCNLKGSDEEAEAEIGPID
FT                   IDVRSKRLIQEALINNTSRHQLYLVEVNSEKVQTGSDYRHFILYLLSEEVVLKPEDNLA
FT                   FNFRTKCRFGTDYPRVTLDLEDELKFYLEFDQSLKYTLRVYNKNQRDSVVLMIRVFHSR
FT                   VLLNNCFENNQTELTRDGRLDLIVNKKTFSLNSVIQRQAMDLSNLILENSRLERELERS
FT                   KQEKSFLELEMKNTIQVFQEQIAKESVNSVPESTRLRVHEETSRHPGTNKFLSRQTTSA
FT                   SGYSDVEPSNNENQGLYMELFSRNASLNEKLSLLTKENSTEKNRLEKQCKCVLKDYEKM
FT                   TSENEQLLSKMGELRSKIKNSEEDSSSVDNEADQHENKDSTDNSYDWKLLETELPISIH
FT                   KKGNDFKSNLVYKPPGWSCISPDPKILEFSIQIISNGVILETVKLGSKSHYILGSLDDC
FT                   DFVYKNPQVSRKHFVLHYTRSNSLVIYDLNSTTGTTVNHKQLLPEKYYLLSLGDQIRIG
FT                   KPGLSTRSYIITGHSIFSEVEDVLQEKLESMRKKKKSDVDKVKIMKKIEKELEKELKIT
FT                   KVEESYYDTSLFLDEYDEYLDENPERHKRKQTVMKKSDILLAILKLQKSEIQILNNWYT
FT                   VLKDATPDNYQLSKESASKIDFELEKVKKKQLKEDKLNFQRDLDRIRGELDHNFKLLRV
FT                   ASY"
FT   CDS_pept        join(1059437..1059532,1059693..1060916)
FT                   /locus_tag="TA13315"
FT                   /product="tubulin beta chain, putative"
FT                   /note="chr2.C.cand.269 - beta tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:TA13315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74522"
FT                   /db_xref="GOA:Q4UEG7"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002453"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG7"
FT                   /protein_id="CAI74522.1"
FT                   /translation="MREIVHIQAGQCGNQIGAKFWEVISDEHGIDSTGIYHGDSDLQLE
FT                   RIDVFYNEATGGRYVPRAVLVDLEPGTMDSVRSGTYGELFRPDNFIFGQSGAGNNWAKG
FT                   HYTEGAELVDSVLDVVRKEAENCECLQGFQVTHSLGGGTGSGMGTLLISKIREEFPDRI
FT                   METFSVFPSPKVSDTVVEPYNATLSVHQLVENSDEVQVIDNEALYDICFRTLKLTTPTY
FT                   GDLNHLVSAAMSGVTCSLRFPGQLNSDLRKLAVNLIPFPRLHFFMIGFAPLTSRGSQQY
FT                   RALTVAELTQQMFDAKNMMCASDPRRGRYLTACAMFRGRMSTKEVDEQMSNVQNKNSSY
FT                   FVEWIPHNTKSSVCDIPPKGLKMSVTFVGNSTAIQDMFKRVSEQFTAMFRRKAFLHWYT
FT                   GEGMDEMEFTEAESNMNDLVSEYQQYQEATINDDEDLDYE"
FT   CDS_pept        complement(join(1061763..1061868,1061899..1062137,
FT                   1062243..1062338,1062369..1062475,1062506..1062621,
FT                   1062655..1062974))
FT                   /locus_tag="TA13310"
FT                   /product="cell differentiation protein (RCD1 homologue),
FT                   putative"
FT                   /note="all_bases.C.cand.356 - cell differentiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74523"
FT                   /db_xref="GOA:Q4UEG6"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG6"
FT                   /protein_id="CAI74523.1"
FT                   /translation="MTIGNFSYMPESSESLNSLRTDSQMLNHQMSIVSTSRPVVSQLQQ
FT                   NNEKILPQLLHQLILDLSIPEKREYALIELSKQRENYPDLAILLWHSFGTVATLLYEIV
FT                   SVYHYLYPLTISMADSTKASNSLSLLQCIASHPQTRQHFLSAHIPLFLYPFLNTASKSR
FT                   RIEYLKLTCLGVIGALVKSDDEEVIVFLLETEIIPLCLRIMETGSDISKTVSIFIVQKI
FT                   LMDDRGLAYVCATAERFYAVTSVLNNMVMGLLESPSRRILKHIVRSYLRLSDNTRARDA
FT                   LRKCLPEPLRKIDPSFYPCLKEEPMLKKWLLQLICNTEPIDENHPM"
FT   CDS_pept        complement(join(1063297..1063997,1064066..1064296,
FT                   1064331..1065348))
FT                   /locus_tag="TA13305"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.249 - protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74524"
FT                   /db_xref="GOA:Q4UEG5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG5"
FT                   /protein_id="CAI74524.1"
FT                   /translation="MVEGLEPRENPNVVPSPVIDELKGTSRPTIKRKTNVRGVLSESFK
FT                   YRHNLNLYRVKKHQKHGHPILPKDVNQAQSNADFQPNVQHIVISDDDEKDMNKGEMDEL
FT                   NEETDVPLDQNEVEMSCTPKPNAVNHYMYSSNSTTNTSNATNNAVHNDILNVVNNSVTG
FT                   ITNSGGGTRLVKKEITKLGRLELLGNIENYVHVNFSNYRQFYDRVGPIRLTSPLSEGLK
FT                   SNHVDISLWNDPGTQLISQNSSKRKVYNIYWLPKIFSNIALRAAIKLVEDCNIRDGRSI
FT                   KREIECHLYMYQRFQAFSRSKNSSSLILQDDWPTVEILGYYLDKKDPGQSVLISRKLTG
FT                   PDFFYIIRSENNSNFAKKITPIYEFNKLDWCITALNRIAQFASVGIRHNDIKPDNIVLD
FT                   VYFDQGVKKVDVKVIDLGAASMENTKEFTGGTPWYESPEQKLLEYYTKKNRNNEMASKV
FT                   TIDVSSDAWGAGLSIVEVLTGKRVVDYIKQPYGIGLLNFKGVPTGSNPFTDSNDENIGV
FT                   NYLWWNVDEYWEVSPELWVREAKKVLGLTCTKCSPANGAESYGNTGELYENIQISQRTN
FT                   FDMSTGREEFQEFYFCNICNSRFDGNVKENICKTVARYVFNSLVVIDPKRRKKVQEVSN
FT                   QLRLFVTKAISYYL"
FT   misc_RNA        1066633..1066741
FT                   /note="U6; Rfam:RF00026"
FT   CDS_pept        join(1066886..1067001,1067035..1067183,1067279..1067452,
FT                   1067504..1067595)
FT                   /locus_tag="TA13300"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.270 - score = 17.25"
FT                   /db_xref="EnsemblGenomes-Gn:TA13300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74525"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG4"
FT                   /protein_id="CAI74525.1"
FT                   /translation="MNDSLNEQLNELGHHVSCLYVSSGEQLDDIFRLQYLLPYSRFVND
FT                   MRGISINVGNFFSSFLPILDSFVIGPTNLINPKDYLSHFNKLSVADLLDISKSDQTISD
FT                   WKDLRNRYLASGINLEDIGLFRSSVELHNDLLQELVNRTSDFDKPQKHSEANRFLQLGV
FT                   SKQRKNKGNNLLH"
FT   CDS_pept        join(1067659..1067725,1067764..1068089,1068116..1068479,
FT                   1068510..1068567,1068599..1068706,1068741..1068776,
FT                   1068823..1068859)
FT                   /locus_tag="TA13295"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.271 - hypothetical protein, conserved,
FT                   mal4p2.40"
FT                   /db_xref="EnsemblGenomes-Gn:TA13295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74526"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG3"
FT                   /protein_id="CAI74526.1"
FT                   /translation="MSLPNWKGLLKWSLSKVDPKRKDEVKQMSKEDLEFLEGALSSVNE
FT                   HEKQVANSVSEVNRISKAFMTSENGENKNKEIEFDKKVLLESMQKLEEYFEEHPSNATS
FT                   LARQGLLESFTLLLKSDDMEVLSSTLSIISCSFSNNESVLEEASKTQLVPNLLKLKNKL
FT                   KDTQLEPRLITAISSSIRNCRRAEQLFVTLGGLSYLKDSLESTNLKTRERAILLFNHFI
FT                   SLDKASRLIMATLNPYKILNLLLPLDPENNGIQFTELSCTLVFLILQKHSNAFTGEELN
FT                   EVSKVLDRELQSLGSLNAVDYEKAKQIEHLLICYPKGGIIFLPFDTVLEI"
FT   CDS_pept        join(1069544..1071189,1071226..1071328,1071358..1071567,
FT                   1071598..1071807)
FT                   /locus_tag="TA13290"
FT                   /product="ABC transporter protein, putative"
FT                   /note="all_bases.cand.1462 - ABC transporter"
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA13290 by TMHMM2.0 at aa 136-158, 178-200, 265-287,
FT                   291-313 and 377-399"
FT                   /db_xref="EnsemblGenomes-Gn:TA13290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74527"
FT                   /db_xref="GOA:Q4UEG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG2"
FT                   /protein_id="CAI74527.1"
FT                   /translation="MYFPDKLYKCIKIYDNTLSIVFTNFNRGNIHNSKRFHHRNVKFII
FT                   KADFKLHNYHTSARNAGNILVQNNFKTLGSQFRGFKPDYTNLLLPSTTLHLNRNLCRFF
FT                   SSNLDKLPTKKYGLSKIMSLLWPSDTRSKLRILFSMVFLLSAKLSLISVPLFLTSLINS
FT                   IIKPPNDSFGIIPKLEMVGVSFPEMYIPYVYLFGFVFSKISSSLFNELRNSLFSTVTER
FT                   SARENASKMFMNIHNLDIDFLIQSKSGEVSAVFSRGIRAISQILRITVFQVVPVILEFS
FT                   LVTALLCYKVGPMIATISSLTVILYLLFTTLVTRRRMIIRKEMADADRKASGLFLDSIT
FT                   NAEAVRYYNSQIKELERYSNQQMDYEKHSVDVQKSLAFLNFGQQFIFNCGLFLSLFLTL
FT                   GDITKGLAKFDNFIIVNTLLFQIGVPLNMIGTMYREVKLSFIDLQKFLDLVGVKPKVYE
FT                   LPEAKDLVLSQGKIEFKNVNYFYPTTENDPHIILDDFSLTIPPGKTIAIVGDSGSGKST
FT                   ICKLLFRFYDPNSGSILIDGQDIKTVTLKSLRNTLGIVPQDVVLFNESIAFNISYGKPD
FT                   ATLDDVMRASKLAGIHDTIMGFPDGYDTIVGERGMMLSGGEKQRIGIARCFLKDPQVLL
FT                   FDEATSSLDFKAESQIIKTFKEMGSNKTTLMIAHRLSSMLIADEIVVFHKGKIVEMGTP
FT                   LELWNKTGYFRQIVNSFNLKSKSDETTR"
FT   misc_feature    join(1069949..1070017,1070075..1070143,1070336..1070404,
FT                   1070414..1070482,1070672..1070740)
FT                   /note="5 probable transmembrane helices predicted for
FT                   TA13290 by TMHMM2.0 at aa 136-158, 178-200, 265-287,
FT                   291-313 and 377-399"
FT   CDS_pept        complement(join(1071922..1072089,1072166..1072547,
FT                   1072601..1072672,1072707..1072766,1072810..1073039,
FT                   1073069..1073265,1073298..1073332,1073406..1073458))
FT                   /locus_tag="TA13285"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.353 - hypothetical protein,
FT                   pf13_0274, DUF254 motif"
FT                   /db_xref="EnsemblGenomes-Gn:TA13285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74528"
FT                   /db_xref="GOA:Q4UEG1"
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG1"
FT                   /protein_id="CAI74528.1"
FT                   /translation="MVFDVYGLTFAGKPLFSSRKESEVSLTFYGTISAIASKVSSLLSD
FT                   YSEQDCLRYVTVGKLHFTYLERGPLCYFSISDNGYSPLIVYKILCVIHLQVVSILTRGV
FT                   ERILIKRPSYDVQNLLGGTQNIIDKLMDNMSGCLGLIEGYAYEALPLSQITRNLLSSYF
FT                   TKFRTDNIISVKKSGDGYNVKDHDFVPNGYFYRYQYTHRIAVVTTAGKLDAYIAFTYGY
FT                   VNYIEPEIGIVCISTSGEQEQFYNISRHLEDSKRLMTESKCLDDLRSSLLATPLEFPSG
FT                   GDLSCEILHLMFYSKKLGQFFSSAFKTSSCGNMTKYILSSYRTVVEFLYNSDYRKSALF
FT                   SYEYLNVYVEYNNDYNMYLATVPWTEITTDFINKIVSYVNKHFNFLFITKIQQISKRD"
FT   CDS_pept        join(1074038..1076455,1076518..1077038,1077068..1077166,
FT                   1077196..1077520)
FT                   /locus_tag="TA13280"
FT                   /product="exonuclease, putative"
FT                   /note="chr2.C.cand.273 - hypothetical protein, exonuclease
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74529"
FT                   /db_xref="GOA:Q4UEG0"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEG0"
FT                   /protein_id="CAI74529.1"
FT                   /translation="MQNGFLKYDEWNDLIWIYNSISPSVTYNISGSLIGLNHEDKTIKH
FT                   IHSLKTNSDAYNIVDDYNCYCGCYDNTINSLGVYEEYLLVGKSKDLYVVSKDGYRVMKV
FT                   LCSSAKEEITLANTMHISCAVFPTTKNDPKIVLSNNSDELYFIDACKGQIKSKLNAQIE
FT                   NSMEYRDKITSISDFMSNQSNSSCYYSYQPEYPTYESPDYSSVQYPTEYKNQDSKYGQY
FT                   TPSTSNDSPSFGEKQTFSFSSIAEKYGDINSIPEFVPSSYSFTHETNENAYEHNNNSNE
FT                   YYTSNSFGYKSANSYGTFGTGYNYQNMPSTKEYVERENGSITLEWILSEMKPSIMLQND
FT                   FVDSTCIGTCSGILHIVDNRINKIVSSVCSHSNPVYSISASNNTIATTSCTLYPCQNTC
FT                   TYPYNTQSSYNSGFMTLFDPVLCLYDIRMMKSFSMVFHRPLSNLFIVPKSDRLFAMSPD
FT                   GKIFDFKISTLEYKMALEPTTGSGFQYGLEVVGNLSGDSLEVFVSDSTYNFESLKLPNE
FT                   LKEDFGYSSEKLPRNLSEIPISENREYNNTPFASMVGTFEGDVAHTFVQMFFFLPKLSS
FT                   IQYHICELSNCITCQIGFGLHNLQVYYDNNKETSKDTTDSKIRKFSNNLLYVTQLQELM
FT                   LIENEPTLKTPIHLFLWVLEKMSNEMYNYYNKNNLKVTTSLIKDLFSFSKKTISRCRNY
FT                   DHVNVVVNVGNYCVDYSESSETPKNNRTVSNNTSFDYCKECNKVVECVIEIEYLSSPNL
FT                   LLIDFINYRVENIPRELVFNDHKYNLECFYFTLPAENLHYRSLACIKLPQNFKTEDYNW
FT                   ILINDGIVMYVDEDDDVFNFTKNCKILLFAIYSKASTEESGEDKNHNENFVGIEEIIPC
FT                   ANVENNIVSIKNRLVPLPYPTKKIPVPPYVLLSEHNIAHNPLAHNKIKTFTPISIHELN
FT                   LIQESNFMFALDIEYVKTDLKNTPVNDSSNEKSSFIVNEDENNYLYSLARVTAIRANDD
FT                   NLHGVPFLDHYILNNKPPKDYNTRFSGIRSGDLELKSSLHWLTTHKLIYLKLRYLIDNG
FT                   CKVIGHGLEQDLRILNICVPSGCVIDTLELFWIPGKRYMSLQFLSYHILNQKIQVSEHN
FT                   SIEDAKTSLHLYK"
FT   CDS_pept        complement(join(1077768..1078149,1078191..1078365,
FT                   1078407..1078703,1078791..1079057,1079088..1079178,
FT                   1079225..1079584))
FT                   /locus_tag="TA13275"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.352 - hypothetical membrane
FT                   protein"
FT                   /note="membrane protein, putative"
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA13275 by TMHMM2.0 at aa 65-87, 102-124, 136-153, 158-180,
FT                   210-232, 242-264, 316-338, 353-375, 395-414, 424-446,
FT                   467-489 and 499-521"
FT                   /db_xref="EnsemblGenomes-Gn:TA13275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74530"
FT                   /db_xref="GOA:Q4UEF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF9"
FT                   /protein_id="CAI74530.1"
FT                   /translation="MAVDNMLTSPLLDEDSSSYSDSFSSSNISQTDRLLLSVDDSIESL
FT                   IDHGRSELNNVDTTTICKNYFYGQLANVMKSAVWWSMIGVLIKNFSSSYYGLSITRSIF
FT                   NLALVMGSFVSNLIAEVVNIRKLLCFTTLCRLMIWSVLVPLFYTLSYFYDKMNYYWVFF
FT                   VGLMLVDGFHISLSNTVDLDYEGIDRMSHQYNILIPDNLHQYMNNVYQLVFDFSFIFIS
FT                   VPISIIILLIDKFTNFDNKFILLFVFNMTFLVLSLASLSFYIFGMPIIRSTNYLAYSRN
FT                   INLTFLTVMDEFCNKLRHVRDGFRIIYSRQYLFRNLLYFSFETSYENSIFLLIIPLICY
FT                   DNLWFADLDVCGMNLFAVCLISMCKLGTSIYGIYVTYKIKNNSNHNLYISRKNTILRCL
FT                   FFSSLSILLLPAVVLVRRYCPIKWASLFVMVLGLFLFFTFTTLPKINYSSILQYNISNH
FT                   PLSYKLFDFVGTFITLVDALVIFSLSYVFRLPNGEVTFSHVLTYTGVIYVVYTVIQITL
FT                   EVFKPL"
FT   misc_feature    complement(join(1077777..1077845,1077873..1077941,
FT                   1078002..1078070,1078098..1078149,1078191..1078198,
FT                   1078256..1078324,1078408..1078476,1078630..1078698,
FT                   1078813..1078881,1078969..1079037,1079050..1079057,
FT                   1079088..1079133,1079167..1079178,1079225..1079281,
FT                   1079324..1079392))
FT                   /note="12 probable transmembrane helices predicted for
FT                   TA13275 by TMHMM2.0 at aa 65-87, 102-124, 136-153, 158-180,
FT                   210-232, 242-264, 316-338, 353-375, 395-414, 424-446,
FT                   467-489 and 499-521"
FT   misc_RNA        1080494..1080687
FT                   /note="U2; Rfam:RF00004"
FT   CDS_pept        complement(join(1080828..1080886,1080918..1080991,
FT                   1081021..1081143,1081173..1081303,1081339..1081505,
FT                   1081544..1081623,1081653..1081872,1081912..1082161))
FT                   /locus_tag="TA13270"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.351 - hypothetical protein,
FT                   conserved, pfb0501C"
FT                   /db_xref="EnsemblGenomes-Gn:TA13270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74531"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF8"
FT                   /protein_id="CAI74531.1"
FT                   /translation="MYFVKYSSNFLISRCSFSNSIISTNINCRTLSYYRNFVEFKPRNL
FT                   FNPPVYLCKSNVVSFYSTRSDKLEKSSNLNHIPNLSSTESDKIETPDDSKPYFVQFDSK
FT                   ALTFDPNHALEYTNRILDDPISDISVSETSKFLLPFPNCDLPRFLEVLTRPFRESYLYE
FT                   PASTMVHLCVERLENDRLTEIFDIGDGYNKRAYFLTLHVWILYRRAMIEIPEGILLKNY
FT                   LLEIFYEVFRHWLRRRKVPEYLFTREYYNTQNHMIKFLLELDKSTEDEDLYPFRLSETI
FT                   RVLMYENDVSQQTLDLLVKYLLRQFFHLFNIDKRYFINAMFLWADVEPICKPARLLKRP
FT                   MLQLIKYGGYRGVDVKKIESQDKKKLT"
FT   CDS_pept        join(1082394..1082791,1082821..1083550)
FT                   /locus_tag="TA13265"
FT                   /product="GTP-binding protein, putative"
FT                   /note="all_bases.cand.1465 - GTP-binding protein, GTP1_OBJ
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74532"
FT                   /db_xref="GOA:Q4UEF7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF7"
FT                   /protein_id="CAI74532.1"
FT                   /translation="MTTKITKDVAKTLSELVSIRNAESFPRYQKPFVDYLRLKCVGGAG
FT                   GSPVENQKRSKKLNGPGYGGHGGSVYFKATHLVSDFIHIESVIKGKSGGNAHGTSRGLH
FT                   ASDTVINIPLGSILRKRVRRDDRTRCIFWHQFLNPDEKLLIARGGRGGLGPSCFKKHDN
FT                   RLAEVGESITLELELRLFNDVAFIGLPNSGKTSLISSLTSYMTRIGPEEGSTTRPHIAL
FT                   IKFLDGVDIRVMDLPPLSQNTDKDMVKKITRHLYRSKLIAYVISAAEDGDHMETLKSLR
FT                   EIVSGSKTFVDSKLEMIIMTKCDMIHRNTLFNLDSLYYKLLDSQPEIPVVATSATHRLG
FT                   LDRCVRTIRDLLYPRNVTYTKRELVESYEIKLLTP"
FT   CDS_pept        complement(1083618..1084553)
FT                   /locus_tag="TA13260"
FT                   /product="oxoglutarate/malate translocator protein,
FT                   putative"
FT                   /note="chr2.cand.243 - mitochondrial carrier protein"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13260 by TMHMM2.0 at aa 20-37, 120-142, 214-236 and
FT                   272-294"
FT                   /db_xref="EnsemblGenomes-Gn:TA13260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74533"
FT                   /db_xref="GOA:Q4UEF6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF6"
FT                   /protein_id="CAI74533.1"
FT                   /translation="MSDYHLPFLPQPMRKYVTPYIPFALGGLSGCTSTLIIQPVDMIKV
FT                   RIQVLASTQNLKSSPFTVFSNILKNEGVLSFYKGLDAACARQLLYTTTRLGLFRTTSDY
FT                   LKKRNNSNTIPFYQKCVLSLFCGGVGAVVGNPADLALVRMQSDLSLPAEHRKNYTGLFN
FT                   TIYKIVRDEGLFNLWKGSFPTVVRAMSLNLGMLSSFEQSKEFLAKYLKEGTLPHLCLSS
FT                   AVAGFFAVTLSLPFDFVKTCIQKESQKGAGYNGILDCIVKNYKQGGVLRFYSSYATYYV
FT                   RVAPHAMLTLILMDTFTRFLKKKDPAQEKK"
FT   misc_feature    complement(join(1083672..1083740,1083846..1083914,
FT                   1084128..1084196,1084443..1084496))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13260 by TMHMM2.0 at aa 20-37, 120-142, 214-236 and
FT                   272-294"
FT   CDS_pept        complement(join(1084881..1085053,1085086..1087042))
FT                   /locus_tag="TA13255"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.242 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13255"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74534"
FT                   /db_xref="InterPro:IPR014939"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF2"
FT                   /protein_id="CAI74534.1"
FT                   /translation="MECFLPSTAFVTRKRTDLTDSCDSTKCVEGSDLNSGSANIGDVYT
FT                   PIGNAGCTGKSDEYLDLPGTVSENESVKKEFSYCNEVNAGVFDSDFADVCKSPRITSVD
FT                   RLNRLKNEFSSKDISNISQFDPTFDDSVSIPVDTLETANSNSGSTSPSTTTPVKSVRSS
FT                   TRRLDVLSSIRTRLDEPHVNISDDETKNPILANSVRRTKGLSSNTADVRRSLQVLGSSR
FT                   CWTDRFENQDPDADSLSATQSPVRSLTSLMNSQADVSDSSFRRPLWESTPNFTPIRSIS
FT                   SFDRLPYHSSKGDSLDRFSNTSVAEMSRMPFNPMSNVTLTREEMCRSKLSGELLVLHKH
FT                   FQNICTVINRSMKRDDKPYFRIFRTLVQRLSRRSFTMDHLRKILWLAPNLISVKWVLIS
FT                   ESFRKKYPTEYKESTDKVYDINIRILRPDLSCCYNNQDYEKACFLFKTILCTWSLKCDS
FT                   ENLVDFDVPMADLPEKNLRSNLSTPIRDTTPLSTNRINTTRMNDTPMRGFTPRMNTTPM
FT                   STPRMNDTPIRDTTPVRSVLRSDLFGCLDNTPCKSYKMAEDSFETSSKRMRTDSISPLS
FT                   VDLLDTPGMNRIRENLKKLAESNQAPDPQNDLKFWIDMRWFTKILLEIIVSDTSPIMKL
FT                   EFLVDFILKYGSRKVTQDQVTRWIDTLSEIDPCILHKGISKFEDYTTVLTINKSASFDN
FT                   ALDYINQKIKTLKSF"
FT   CDS_pept        complement(join(1087476..1088514,1088544..1088757,
FT                   1088787..1089139,1089174..1089238))
FT                   /locus_tag="TA13250"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.348 - hypothetical protein,
FT                   conserved pf13_0018, SM0667, LisH Lissencephaly type-1-like
FT                   homology motif, WD40 domains"
FT                   /db_xref="EnsemblGenomes-Gn:TA13250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74535"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF4"
FT                   /protein_id="CAI74535.1"
FT                   /translation="MKLNISSDDINLLIYRYLIENGYCHTAFSFNKEANISGNPYYVNH
FT                   ADKIPPNALVSFMQKAMIYIYLEYHTDDITGDQILCDETFSFFRKHNCFRKLGQSHGLP
FT                   LSHSMNNSRDRTDNVESHVDKNSTTNEVSSDSLNFDLSKSGFVREDVLETNSSLFQLNH
FT                   PVYVGPPQRRLSDKWQLYGYHKLFEYLDPNLSTVCHFNPLYAGYILKKTENGPSSLYKL
FT                   NEAGKSSICEILLPHAKLASSESDPGVTTSSRWRHDGLVVFSGHSDGNLNLWSLEGHLL
FT                   SSVKVMDSPVTSVGFSGTKAYWSEVQPESESPYYVSAGCKTGDVFVYRVDHNNCLLVNH
FT                   FKQSTCVTDLEWQNNNLLSSMTADGTLTNYNVETGESSQQFVQSKNGVPFMEWDYYGRF
FT                   LAIVDDSDALKVYKPRENHVNGDLSELKGHNGQLIYASWYSGTVEKSSSRICTIAMDKQ
FT                   MIVWDVTSGSSLMSLALDQVPTTVSVCPNDTLVAISSYGNSVKMYALPNLTLSCSFYDK
FT                   TVPTSISWSSDRQHLVYNVFNLQRSLVVPLNTLSSFQSD"
FT   CDS_pept        complement(1089506..1091851)
FT                   /locus_tag="TA13240"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.240 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74536"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF3"
FT                   /protein_id="CAI74536.1"
FT                   /translation="MLSETVCSLCRSNEFSNQDNHNGRCTTPESNNHLRYKILSFGSEF
FT                   NKFNDKKSLNLIKILDLSGDVDKFSDNCSIECEEQNEDEYDINKSTFKKNSYKEEPSVE
FT                   FKPIQNCFKRKDGQTSEETVSGNEEEESKIWGKINGNLNGLFSNKEESSDNEDSIYLTI
FT                   GPYVLQGKKVETRAGENFVILRKVPNHCSCICSDSNSHCNHIAYYEICGVVNQKIEFKS
FT                   RPIIYYTADDNQSDEYYLYQSNFINTNWLILSANDEILNNMLDEQAYFKIINNDSEKNK
FT                   KAVLCILNNTYYIERIELGGTILLYFPMAEVEEAHGDGNLLVIIGSSKYSYNLIRSNPI
FT                   FENLPKTSNIHMSSLLDQTPISDLEISDYILGKNEMYPSYYLYQQDGTLRYMGHYFFGE
FT                   FTIRIIEAIPIYFSKYPDKKKKVTQLTVGEIWDMVNFYPDIFDFVPQEVRNLSTLFQTL
FT                   LKISDVEQTFTTLDECISVAKSEMISELNVKLNLFKMQKLISWCIVSANCHSEINYYQY
FT                   TRYLDNILFNKAFPSYIFDDLIEYMLSFRTDNEQFLDYLKSVEYYYKKMSFSEVSNLFS
FT                   DQNSTQANYNKTFIIFDKSGTELFMMNELDIVYSDLYKLPCLNYEVFKNNTKGLTQLRF
FT                   SYSMNSLLHNCRSPLSLHISFLAEKVVAILDSNRCVLKIYPTVKHEGLRDNLSELFKLK
FT                   RNWHLEVLENKLKHFFKDKPAIDMLTGGPDYHGRLWITKEKNNRNYVNQNVVEEIKNET
FT                   VNMWKKMDGELKSIKEESYIIINWNVPT"
FT   CDS_pept        complement(join(1092748..1092920,1092953..1094909))
FT                   /locus_tag="TA13235"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.239 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74537"
FT                   /db_xref="InterPro:IPR014939"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF2"
FT                   /protein_id="CAI74537.1"
FT                   /translation="MECFLPSTAFVTRKRTDLTDSCDSTKCVEGSDLNSGSANIGDVYT
FT                   PIGNAGCTGKSDEYLDLPGTVSENESVKKEFSYCNEVNAGVFDSDFADVCKSPRITSVD
FT                   RLNRLKNEFSSKDISNISQFDPTFDDSVSIPVDTLETANSNSGSTSPSTTTPVKSVRSS
FT                   TRRLDVLSSIRTRLDEPHVNISDDETKNPILANSVRRTKGLSSNTADVRRSLQVLGSSR
FT                   CWTDRFENQDPDADSLSATQSPVRSLTSLMNSQADVSDSSFRRPLWESTPNFTPIRSIS
FT                   SFDRLPYHSSKGDSLDRFSNTSVAEMSRMPFNPMSNVTLTREEMCRSKLSGELLVLHKH
FT                   FQNICTVINRSMKRDDKPYFRIFRTLVQRLSRRSFTMDHLRKILWLAPNLISVKWVLIS
FT                   ESFRKKYPTEYKESTDKVYDINIRILRPDLSCCYNNQDYEKACFLFKTILCTWSLKCDS
FT                   ENLVDFDVPMADLPEKNLRSNLSTPIRDTTPLSTNRINTTRMNDTPMRGFTPRMNTTPM
FT                   STPRMNDTPIRDTTPVRSVLRSDLFGCLDNTPCKSYKMAEDSFETSSKRMRTDSISPLS
FT                   VDLLDTPGMNRIRENLKKLAESNQAPDPQNDLKFWIDMRWFTKILLEIIVSDTSPIMKL
FT                   EFLVDFILKYGSRKVTQDQVTRWIDTLSEIDPCILHKGISKFEDYTTVLTINKSASFDN
FT                   ALDYINQKIKTLKSF"
FT   CDS_pept        complement(join(1095343..1096378,1096408..1096621,
FT                   1096651..1097003,1097038..1097102))
FT                   /locus_tag="TA13230"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.C.cand.345 - hypothetical protein,
FT                   conserved pf13_0018, SM0667, LisH Lissencephaly type-1-like
FT                   homology motif, WD40 domains"
FT                   /db_xref="EnsemblGenomes-Gn:TA13230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74538"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF1"
FT                   /protein_id="CAI74538.1"
FT                   /translation="MKLNISSDDINLLIYRYLIENGYCHTAFSFNKEANISGNPYYVNH
FT                   ADKIPPNALVSFMQKAMIYIYLEYHTDDITGDQILCDETFSFFRKHNCFRKLGQSHGLP
FT                   LSHSMNNSRDRTDNVESHVDKNSTTNEVSSDSLNFDLSKSGFVREDVLETNSSLFQLNH
FT                   PVYVGPPQRRLSDKWQLYGYHKLFEYLDPNLSTVCHFNPLYAGYILKKTENGPSSLYKL
FT                   NEAGKSSICEILLPHAKLASSESDPGVTTSSRWRHDGLVVFSGHSDGNLNLWSLEGHLL
FT                   SSVKVMDSPVTSVGFSGTKAYWSEVQPESESPYYVSAGCKTGDVFVYRVDHNNCLLVNH
FT                   FKQSTCVTDLEWQNNNLLSSMTADGTLTNYNVETGESSQQFVQSKNGVPFMEWDYYGRF
FT                   LAIVDDSDALKVYKPRENHVNGDLSELKGHNGQLIYASWYSGTVEKSSSRICTIAMDKQ
FT                   MIVWDVTSGSSLMSLALDQVPTTVSVCPNDTLVAISSYRNSVKMYALPNLTLSCSFYDK
FT                   TVPTSISWSSDRQHLVYNVFNLQRSLVVPLNTLSFQSD"
FT   CDS_pept        join(1097202..1097277,1097426..1097652,1097682..1097996,
FT                   1098029..1098197,1098342..1098778)
FT                   /locus_tag="TA13225"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.275 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74539"
FT                   /db_xref="GOA:Q4UEF0"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEF0"
FT                   /protein_id="CAI74539.1"
FT                   /translation="MEFMQVFKYIIHDLTDIIYINLESSDNPSKRRDDSFNIDLILKKE
FT                   RIDNDDFNVIVLHASPEQRLDFIIRQLSFYLSPDNLSIDHFYNSKFKEDSANIGVENVM
FT                   DVKYILSAKRMMEIKATIEDIKKVISENLIPNLSFHDFEGTLYIKLNDPLPKYVGKKPI
FT                   IKKKFGETPETFHVAGPIVKIANIPLDVKEWTLVKQAINNTNKAKVKFISSISEGSCYA
FT                   WLSKTSNLSDLMAEKPLVNGSPINIELINDESEFKKLESVRNFVVRNFGSIKTLLNNLL
FT                   NEVEVGTQLSLESEPGQLVRNFNIITLQLTYILEYHPNSKEKKGGNSRTLFGYEVGTNG
FT                   SRDGKNKKCFKVVTKSLEGENLAHEVYLNNLIFLKDLSITKCLEGLKLVIHTFNRPERT
FT                   DFIKSLSV"
FT   CDS_pept        join(1099057..1099122,1099171..1099233,1099263..1099563,
FT                   1099594..1099675,1099706..1099934,1099968..1100300,
FT                   1100343..1100489,1100521..1100619)
FT                   /locus_tag="TA13220"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.cand.1468 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13220"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74540"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE9"
FT                   /protein_id="CAI74540.1"
FT                   /translation="MDSVSDYFSFLRLNKNTNTSDDKKKTPEPITLAPLRRKLKPDDYM
FT                   SRVQVEDHIIPIWERETEVSEEKKPVEDITMSYSYSLLSFVSRSITEGTVSSYESDHFE
FT                   LLSESDIEENEVRGVYLHELQHMTNTDIPSPEAYPLYIKGLTINGNTVECIDASPYSQQ
FT                   FPVILYEWFIGVEYNSLDRYSPEALYDGKTFKIPFEAIGKYIFCRGHRLVEAQLKVNNM
FT                   FSNSGPYDPHINVFQNSYPNEKKFHNISTLCSAGPVDISNDLALRILENLSEDFSTDCI
FT                   LCYNKDFKSGITYEKSKLLNQVVDVKLQITTKLCIVVSKEDKDRHKIFSIGAFDTKISE
FT                   DEESEDTVSFEQSLEDIVVQDSKHSDTEISFGTYEEKKIKNYFSLKFDDRIQCVTVLYT
FT                   IRAFMAQQKSGFPRDSWSEALDKGDLDFVVKVVREYLSSI"
FT   CDS_pept        join(1100860..1100959,1100999..1101636,1101667..1101913,
FT                   1101946..1102106)
FT                   /locus_tag="TA13215"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.cand.1469 - conserved hypothetical
FT                   protein, pfe1415W, transmembrane, zinc finger"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13215 by TMHMM2.0 at aa 71-93, 113-135, 216-238 and
FT                   253-275"
FT                   /db_xref="EnsemblGenomes-Gn:TA13215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74541"
FT                   /db_xref="GOA:Q4UEE8"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE8"
FT                   /protein_id="CAI74541.1"
FT                   /translation="MDDQNDKIIIDEDFEDTEKNDLDSYRIPTRRTEKDNENEPLLHKK
FT                   RTNSSSKTCFRSMGSADGNNGSRSVFNYLPVIFALFVFSVIYGSFFVYNLKPAINQDLA
FT                   HYGVLSDRIICHTLFIHLFLFLQLVSYVLCMYKNPGNIPDTLEWNLNNKDVNTTSVVYE
FT                   TKRSGARRFCKWCSKFKPDRTHHCKNCGTCVLKMDHHCPWANNCIGWRNYKYFYLTTLY
FT                   SDVISIYIAILLFPTVRQFLNNPLTSFGDLVVIIVAEVLGVVLGLVLTCFLLFHTWLIC
FT                   ENFTTIEFCEKYSGSKHNMDESIWSLGLYNNLKSVLGNNPLLWLIPYDNRKEKGIEFKR
FT                   GERSLESLDDIDQPIMEVNSEFLRMTKDTKQFDPEIGEDSP"
FT   misc_feature    join(1101109..1101177,1101235..1101303,1101544..1101612,
FT                   1101685..1101753)
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13215 by TMHMM2.0 at aa 71-93, 113-135, 216-238 and
FT                   253-275"
FT   CDS_pept        complement(join(1102171..1102400,1102435..1102516,
FT                   1102579..1102632))
FT                   /locus_tag="TA13210"
FT                   /product="vacuolar ATP synthase subunit f, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="vacuolar ATP synthase subunit f"
FT                   /db_xref="EnsemblGenomes-Gn:TA13210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74542"
FT                   /db_xref="GOA:Q4UEE7"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE7"
FT                   /protein_id="CAI74542.1"
FT                   /translation="MDKIKNLVNCKIYIIGDEDTVVGFLLAGVGSKDGLGRTNYTIVTP
FT                   KFTKAQIEEVFKLYVSMDDCGIIIINQHIAEKIRTLLDLHDKFVPTILEIPSKEEPYDP
FT                   SKDSVMQKIKVFFGENN"
FT   CDS_pept        complement(join(1103356..1103446,1103479..1103570,
FT                   1103604..1103665,1103696..1103814,1103845..1103856,
FT                   1103919..1104051,1104087..1104306))
FT                   /locus_tag="TA13205"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.236 - hypothetical protein, conserved,
FT                   pfl1080C, PF01902 Domain of unknown function DUF71"
FT                   /db_xref="EnsemblGenomes-Gn:TA13205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74543"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE6"
FT                   /protein_id="CAI74543.1"
FT                   /translation="MKLLSLISGGKDGIYSILCARRQGHEIVLLGHMTPQDSNTHELDS
FT                   YMFQTIGHNVIESISKCLDIPLLERTIERAPASTKSLDYTPDDQDEVEDLYNLVKEALV
FT                   CFNLSYLNNKSTRWVKNVCSRLNLSSVNPLWERNQRDLIKEMIDEGMEAILIKTCSLGL
FT                   NEKHLGRKISEIYEELLEMENKYGLNVCGEGGEYETLVLDCPIYKKKILIEEHEKIYHS
FT                   KDPYAPTILYVPLKWRLESK"
FT   CDS_pept        complement(join(1104487..1104708,1104739..1104830,
FT                   1104863..1104930,1104961..1105241,1105283..1105465,
FT                   1105499..1105594,1105625..1105727,1105757..1105896,
FT                   1105929..1106000,1106035..1106178))
FT                   /locus_tag="TA13200"
FT                   /product="replication factor A-related protein, putative"
FT                   /note="all_bases.C.cand.342 - replication factor a-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74544"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE5"
FT                   /protein_id="CAI74544.1"
FT                   /translation="MANSYFPIKNITTYTSNWTILGKVVEKSPLKSLKGDNAFLFVDIV
FT                   DKNGDTIRAKFWGLAANKWNDLLEKGNVYTFSKGSVNLSNKKFNNTPHNYEITFGTDGV
FT                   IDPSDELDDINVERNYEFVTLRDIKSTSRDTPFVVDILCFVKSLTPVSVTNTKFNRDTK
FT                   KRLLYVVDDTSYELEVTLWGQMTELPIFDDILDKPVILSQVTIKEWNGGRFGQTSLTTD
FT                   IKLADFQSVRNKDRLSTLEAWYQKAMSENETFKTMKTQTMSSSRDSYEFSTIEDAMTRA
FT                   KGYFTFNCKLRKLFWKNKDGDMRLWYHSCPNCYKKVVEEQENVWRCITCDDSIVTPVLR
FT                   YIVTCVFVDFSGQMVSTVYSDNGKKLLGYTEQELDAMDKEQLKNTLDFDVLHRDFKVSG
FT                   FFKNKTYNGESRNIFNVTNVEEVDYAKETELLLEKMQITYESVENFLSLGNPDSQSSQK
FT                   KTKFDQQL"
FT   CDS_pept        join(1106550..1106802,1106835..1107331)
FT                   /locus_tag="TA13195"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74545"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE4"
FT                   /protein_id="CAI74545.1"
FT                   /translation="MRSYIRLLCKSIFDINTKSFTSCSSTCKTILNNLNNVNKRHNFTP
FT                   RLYLHTNSENLFPLSKRFNENVLKLSDFDDYHNVVYRPLDNDTIHMKDLVVSVFYNRQS
FT                   TASLSVIDSVNRLSSEFPLNTFLLMDSDVVPRSAYDADVQHFPSALLSYGGDLYRDLVS
FT                   EESGYSDKWSNSYKWSFSEEESKSAQSQQCVLPEKFYQSVLRAMNKFNSFDGKNVSAIK
FT                   SRAGTHSYTHGIDTDNLNLKRVGWPTE"
FT   CDS_pept        join(1107608..1108153,1108188..1108537,1108611..1108908)
FT                   /locus_tag="TA13180"
FT                   /product="(SSF, Peter Pan) family member protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TA13180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74546"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE3"
FT                   /protein_id="CAI74546.1"
FT                   /translation="MGKSRKKKSKPSPDHTIDTESPRILVIRRGSVNHEMKQLAQNLRL
FT                   ILSPNCAARLKEGSRQRLRDFTSVTDVLGLTHLIVLSQGSEISYLKIANLPSGPSFTFQ
FT                   INKISLISDIFKHCKNPQSFDSSNYSPLLVLNGFSRGTSKGSDDDGSKDDSSRFDKAMT
FT                   RVTETLNKMISPVDLSTTKIQNCKRVILFHKQNDGTIVLRHYSINLVDCNTPDQVKDLL
FT                   TRKTMKNLINETSDFEHINNYLSSDLTSKKNSSFDSDTDEFVELDNILSQNIIAKNKYG
FT                   VDLERTETSDARNKIGISWRMMFSRDQVRYIALKMFLVKYHRFVKKTQEELEENKKLEP
FT                   EIVKKRKLESERVMKIYEKYVKKAKGATDKEGSENQDPEKEDSVNEQKRSKEKKRKK"
FT   CDS_pept        1109138..1109902
FT                   /locus_tag="TA13175"
FT                   /product="purine nucleoside phosphorylase, putative"
FT                   /EC_number="2.4.2.1"
FT                   /note="chr2.C.cand.281 - nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74547"
FT                   /db_xref="GOA:Q4UEE2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE2"
FT                   /protein_id="CAI74547.1"
FT                   /translation="MEYEDCKLLVRMGVPRDRVHKAVIVSENLYHFDLFPKIGDKYHEF
FT                   NEFLCYKIAEVEVDGEMILLVYHGVSGTAASPILRELLEMGVKIVIRCGKCGSYNPCLV
FT                   NNGDIYICYAAIRDDTVSLAEIDAKYPAVADYDVIDCLVDTAEQLGFTTKMGINYSTDL
FT                   FYRRVCIDDPRDKYTLNNIADTEDNETSTVFVLSSLYGAKAGAVLTVDGSPLFWGNGGY
FT                   AFGEESVEKGIEKTMVIGLKAASVLVKRFCHN"
FT   CDS_pept        complement(1109947..1110717)
FT                   /locus_tag="TA13170"
FT                   /product="purine nucleoside phosphorylase, putative"
FT                   /EC_number="2.4.2.1"
FT                   /note="chr2.cand.233 - nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74548"
FT                   /db_xref="GOA:Q4UEE1"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE1"
FT                   /protein_id="CAI74548.1"
FT                   /translation="MPSSSPYFFNKTNIPPRIGYFKSVIIFGDRSWFDVILPMVDSYIE
FT                   FGDYKNMKSVEVSYKGRKILLYSFGFGFVDLNRVVTESWFLGALYFIFLNFSIPLLPSS
FT                   QIKDKDIFTIYASCRNESGTFAEVDYRYPAVAHPTIVRALRTSSESLGYTLKPQKSVVV
FT                   DGYYEKKVKRPTLMDEIVQTDIELQDWDSSNMLVYSSLRKVKSGILTCVGLKPNLVNMY
FT                   GEFSDFSNYNQQMNLMAKIALEACLLVEPLENNR"
FT   CDS_pept        1110921..1111691
FT                   /locus_tag="TA13165"
FT                   /product="purine nucleoside phosphorylase, putative"
FT                   /EC_number="2.4.2.1"
FT                   /note="chr2.C.cand.282 - nucleoside phosphorylase, PF01048
FT                   Phosphorylase family"
FT                   /db_xref="EnsemblGenomes-Gn:TA13165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74549"
FT                   /db_xref="GOA:Q4UEE0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEE0"
FT                   /protein_id="CAI74549.1"
FT                   /translation="MEYEDCKLLVRMGVPRDRVHKAVIVSENLYHFDLFPKIGNKYHEF
FT                   NEFLCYKIAEVEVDGEMILLVYHGVSGTAASPILRELLEMGVKIVIRCGKCGSYRPSHE
FT                   KSGDLSITYATIRDDNSSLAEIDIKYPAVADFDVIDCLVDTAEQLGIKASLGMNYSTDL
FT                   FYRRVCKDDHRDIYTLYNIADTEECETSTIFVLSSLYGAKAGAIMTIDGSPLFWGNGGY
FT                   TIGEEAVELGIENMTLVASKAASKLSKIYLNNGM"
FT   CDS_pept        1112600..1114912
FT                   /locus_tag="TA13160"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.283 - hypothetical protein, conserved,
FT                   pf10_01831"
FT                   /db_xref="EnsemblGenomes-Gn:TA13160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74550"
FT                   /db_xref="GOA:Q4UED9"
FT                   /db_xref="InterPro:IPR011387"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED9"
FT                   /protein_id="CAI74550.1"
FT                   /translation="MLIPIKHFKMNLFTVHAKNGLYIYKCQQVKSEEGQDPNKNENLQE
FT                   EEKKEPVTSLRAECVWYQDRFARHCICSQNNNLCIVDDRSGLSIVYTKNNLYSDFSMDT
FT                   LRGVGKFKNMYTPLGCKNIKHLQWSKNGTYLVVYFNLTNYSESGLCLEDNLHIWDISKK
FT                   NIIGTFNTKRLSPEQWPVTKWIGSTDNFALCHNHQVGIYSIVSEGSSLKSVKLLLTVRI
FT                   PMVFIVDLSYKPMETSVNTFSDGDNIFMAAFSQPDSSHSPGNLRISTLKLSGDSLSESS
FT                   FSQHELKFTDSAELLWSPSGNYLIILAQSTVDLAGEKYGSTTNCILFSSNGKYISKVNS
FT                   YTTHDARWNPKSDIFILMEGNMPCRITLYNVELETLFEFPNMYRNTIKWNPLGNMVALG
FT                   GFGNLAGEICFWYKKEGANEMEQIVQFKEPCTVISEWSLDSKYFITASTFPRMKVDNFF
FT                   KIFNCEGYLMASEILDECYDVSWFCGNSEDTEFIRPKVRKSLDRKPIYRPKMSLKSTNP
FT                   TSAKPFSKAPGSPLFTMSHQDNTFNMSNTRLVNTFEKNHFDNFNRSFFSGQFGNNSDPS
FT                   TDLFQSFKHIFSLSFINKFDTTYLEQRNNQEQFFNRKEQQVDTRDNFNTSDSQFQNTFD
FT                   NQLINNFQNQMIKPLGNQFINMSDSQPNMSGQMLNVQENQYNNMTDGFFDNLQQVQYEG
FT                   LVDNQQMSYENGLNYTENTSNQLRDDSENVSMFVRLKNQLQSEKMKTRQRTIMNEGQLL
FT                   RLLFEAKNKRKPDSLQS"
FT   CDS_pept        join(1115278..1115688,1115750..1116036,1116066..1116129,
FT                   1116196..1116304,1116337..1116412,1116450..1116621,
FT                   1116684..1116815)
FT                   /locus_tag="TA13155"
FT                   /product="histidyl-trna synthetase, putative"
FT                   /EC_number="6.1.1.21"
FT                   /note="chr2.C.cand.284 - PF00587 tRNA synthetase class II
FT                   core domain (G, H, P, S and T)"
FT                   /db_xref="EnsemblGenomes-Gn:TA13155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74551"
FT                   /db_xref="GOA:Q4UED8"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED8"
FT                   /protein_id="CAI74551.1"
FT                   /translation="MPVLTHTALFVDSNTPKVRIDDFNDKIQDKEHYKELYSFKDKKGR
FT                   NLSLRGDITPQFMNLLTSYYSNKKLQSQNIYKWYTIADCWRYERPGLGRRRNHQQWNAD
FT                   IVGKPFTSQVLLGISDIQVEVELISMLIHFFKSVGLSYEDVVISLNHRNTIPGILALLG
FT                   FSNYSTDWIYQFSKTLDKCKKIPKDEFNELLLDLKFTPDQCSELDKIIENSKTVEELEG
FT                   IFNPEDIRELKQLVDLLAEKGYSNWINIDLTIVRGNDYYTGLVFECFDRNQMHSRSIAG
FT                   GGRYDNYFNNCDPRLTYSAGFGMGNIAIMDLIKQKGLNVKSEQLIDVLVFTPNSTSNNC
FT                   EQKLETDSDQSLLCSKNQRMCLYNLMDLLRSNDLVKALKFGDNCMAKFVLMPLLRDGNE
FT                   FIVLRDMKTGLQVKKYP"
FT   CDS_pept        complement(join(1116931..1117256,1117385..1117561,
FT                   1117599..1117672,1117815..1117963))
FT                   /locus_tag="TA13150"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA13150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74552"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED7"
FT                   /protein_id="CAI74552.1"
FT                   /translation="MIILRNVSYYIILSLIKHVFCASLTNLTTEYSNMSTRIDSTFPKY
FT                   VPNDSDVETCILNNWWDLAKKIVLLSHEQDIDLSSSVRSSVETVQRNSKELLDLLSKHY
FT                   NELDVYFLFFNVLISELTLPFNGLNHQMKCALQVENEVLNVDKDRLEYSGIGTHSGKRK
FT                   KYQVNLHLFNRVVGPETKVTPVSMGRFSITLKKEIPEVWNTLNKMNEKVPNHQIWWEMK
FT                   EKYQEECDKFISEKLDKEL"
FT   CDS_pept        complement(join(1118133..1118915,1118998..1119252))
FT                   /locus_tag="TA13145"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.232 - hypothetical protein, conserved,
FT                   PF00899 ThiF family"
FT                   /db_xref="EnsemblGenomes-Gn:TA13145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74553"
FT                   /db_xref="GOA:Q4UED6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED6"
FT                   /protein_id="CAI74553.1"
FT                   /translation="MSSLKDDPSSRLKALEKMGVVENFDIIHSCTVAIVGVGGVGAVVA
FT                   EMLTRCGIGKLILFDYDDIELANMNRLFYTPKQLGLPKVEAAKETLNVINNNVLIEPIN
FT                   CNICRDYELFYDKIVHGSLTGSQVDLVLSCVDNYAARVTINKACCKADQVWMNSGVSEN
FT                   ATSGQIQTCVPGVTACFLCAPPYIVATKGDESKIKRADVCTASLPTTMGVVAGLLAHNA
FT                   LKYLLKFGEVTNFLSYNSLQEFFPTYSLSYTPDCSEKYCVQRQLEKVEHIKSNNQLNEC
FT                   NNCEETKGEVIHPDNEFEIQVMDAKSFEEVEPTTPEPDSNHVKSNLSLTELRKQLMFAS
FT                   VTKNS"
FT   CDS_pept        complement(join(1119518..1120003,1120036..1120698))
FT                   /locus_tag="TA13140"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.231 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74554"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED5"
FT                   /protein_id="CAI74554.1"
FT                   /translation="MEDNFGAFYTPVLKGVDGNYESFLPQSMLNELPYTGFYNDQTMTT
FT                   DNVSTSGAFQSGNSNMSRQTTLKQPFSPQVLSQQNSFVPLFPQTPYSRGLNLFKRTNSS
FT                   QYRRNSSPFGRSRYIKRNLSNSTSKSNQSNGFQNPIFDTVNYFNSIPFNSLNNMNQLNN
FT                   MNQLNVKEMGSYQYSNASTNVSRINSVNEMSRNGVNNSIRNSFKLRPRKSKRNPNVQKG
FT                   SPLNRAFNKVLTQGFSSINSNFGTSNSDSENFDVNDAVKFFEGLVMFVLGILRTIFGEL
FT                   RSDVIMGMFDGEDPDYNAARSYYYSNMDEKFKCSGLTQRIDYTEAIENEYKRKKTVVEL
FT                   RVEEAPEYVNPHNTDFMNMTEKEFEEFLLSQAFPNNPLSVYY"
FT   CDS_pept        complement(join(1121215..1121313,1121397..1121502,
FT                   1121533..1121764,1121795..1121864,1121894..1121986,
FT                   1122017..1122255,1122313..1122404,1122444..1123440,
FT                   1123519..1123732))
FT                   /locus_tag="TA13135"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /note="all_bases.C.cand.338 - DEAD box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74555"
FT                   /db_xref="GOA:Q4UED4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED4"
FT                   /protein_id="CAI74555.1"
FT                   /translation="MKNTSGKNNSSSGDSIEKEHETDFSSLNLSEIILKWLSHKNFKRM
FT                   TRVQSLCLRAFLKRENDVLVQSCTGSDVFSVIILPTRELSIQVFDIIIDFLQFTHLNMS
FT                   NSINNTAETDKLNMYRIMEKNVYSILMIGGTSVDIEIRDMKKAIENTFVKSFVVGTPGR
FT                   LRHVMDLLSHEFVWTFRNLRFLILDEADRLLEMGFQNDLSNILTYLPKQRQTGLFSATL
FT                   NTGVETLSKLCLHNHIHINTDTPSDTNHINKTYTIPKGLNNYYLILSIEEKLCFLLLFL
FT                   EYLRTTDSTKIVIFFLSCDLVNYYHQILSTLMTCESNLKSKIHNTKSTNTKNTNSNTNT
FT                   NSTTSENSTGNIRIMKIHRKMTSKKRNKSIETFKSNTSDCMNVLLCTDVFSRGIDVPGI
FT                   DWILQIGRAGRAETPGNALLLLTETEESYIQFQKNHSEYWIKLHDLKDKLIENDTKIHI
FT                   IDNKVDLMDDNGVDTVDTRVDKSYLSYLMENPVNKPILLWEKTAIILSYLRLLNSKDRE
FT                   LLLLSSRAFVSYTRAYSEHSLKYIFEKQKLDYGALATSLGVLRIPRVKEILGRKILHFI
FT                   QSNINPKDVPYLDPVKEANRLKQIEQLNTHENGTHDKITHKDKNDKKIKNKVIKDKKIN
FT                   RTRTMKREAKRRIEFDEWNEFRREEALVKKLKKKGFNHKDIENLNQEECEFGEDLELDE
FT                   KSSKRWILRGKKRNKRKKH"
FT   CDS_pept        join(1124216..1124980,1125033..1125245,1125318..1126796)
FT                   /locus_tag="TA13125"
FT                   /product="mitochondrial respiratory chain complexes
FT                   assembly protein (AFG3 homologue), putative"
FT                   /note="chr2.C.cand.285 - ATP-dependent peptidase, PF00004
FT                   ATPase family associated with various cellular activities
FT                   (AAA), PF01434 peptidase family M41"
FT                   /db_xref="EnsemblGenomes-Gn:TA13125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74556"
FT                   /db_xref="GOA:Q4UED3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED3"
FT                   /protein_id="CAI74556.1"
FT                   /translation="MVHPCASHCNVLVYSISSRFLKCFPLSLVRFSKNHPVNFSPKLHR
FT                   LLFCRNCHTLLNRKFITNNSYTINNFNFTKGEFSTQSSSNTNKTTDPNKQLNDQNKESD
FT                   DGNKNFKNEVKEEVKNEVKEDRKDEKIKGEKVFNLSDFKKSYEKDKNDEEFKEEPKSRF
FT                   WRFFDPSTMFAVGLGAIMVLELIDTGVLKNEITFQEFLSKYFIKGYVDRIQVVNKDFCR
FT                   CYLSDLSPIKTPKFVSFRLGSIDAFEQKIDDIQGSMGLHPQNYIPIHYVNEVNFLAEVK
FT                   KITPFVLVTLLLAMGVRKISVKSSSGMDRFLKMGKASPLEGRDVKVNVKFEDVAGMREA
FT                   KCEITEFVDFLRSPKTYESYGAKIPKGVLLCGAPGTGKTLLAKAVAGEANVPFYSMSGS
FT                   DFIEVFVGVGPSRVRDLFEKARKNAPSIVFIDEIDAIGRKRSKSGFNAGSNDERENTLN
FT                   QLLVEMDGFKSSSGVIVLAGTNRADILDPALTRPGRFDRTVNISRPDLEERYEIFKVHL
FT                   KPIKINTSSPVGSDKTAENVDKNAEKNKVMDEFARKLAALTPNFVGAEIANVCNEAAIQ
FT                   AARRKSANGVEMVDFDNAIERVMAGMKKSGDILTPQQKLAVAYHEVGHALVGWFLENAD
FT                   PVLKVSIIPRSSGALGFNQQMPDDSMLFTRDALLDKIAVILGGRAAEDIFIGKITTGAT
FT                   DDLSKVTKMCYAFVSQWGMNKEIGLVSFQRDNTDDPYFYRNYSENTAQLIDQQVRTIIE
FT                   DQYLRVKKMLLGKAELVHKLSKLLYDKETITYQDIVQCVGEREFPIKDKYKPYIEVNCN
FT                   DNVKND"
FT   CDS_pept        join(1127138..1127498,1127585..1127688,1127718..1127813)
FT                   /locus_tag="TA13120"
FT                   /product="hypothetical protein, conserved"
FT                   /note="all_bases.cand.1476 - hypothetical protein,
FT                   conserved, pf08_0079, PF01253 translation initiation factor
FT                   SUI1"
FT                   /db_xref="EnsemblGenomes-Gn:TA13120"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74557"
FT                   /db_xref="GOA:Q4UED2"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED2"
FT                   /protein_id="CAI74557.1"
FT                   /translation="MEEENSESDESKTGADETKSTNGQPLTPLKVEYCRFCSMPYDFCD
FT                   FGDKWETGVCFKECSTRYPEIFPLELMTLDGLGFSTLSLKSKKKTPKQVPQEIFIQKSA
FT                   RTKRKVITSITGLHLFGVKLEQAAKLFSKHFATGANVIKGTPGQSDRIDIQGDVEDPIV
FT                   ELLLSNYPSITEEKITKLQPKMK"
FT   CDS_pept        complement(join(1127929..1128470,1128562..1128742))
FT                   /locus_tag="TA13115"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.229 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74558"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED1"
FT                   /protein_id="CAI74558.1"
FT                   /translation="MVLKKPSSKTNRKKITAKSVHNNFRINFFSQNIELSSAPDEEPPE
FT                   KSKPGRKRLKKSIDSQKNNLVSILKKKGEYVKIKANSERFYQKLTNITTSHDFSQLLIF
FT                   DQDHLESISNTSEVDGISDLYFPVLNNTPTSSYGFVRVNPNSTFGPLINLGEGSLVLTF
FT                   VQVEEERVYFESLNASKLGRAVCNSYSQALVIPNDVFIISNESSDITAKIFLVLSKVKW
FT                   SNVDQVKRGKTVPLSQVT"
FT   CDS_pept        1128983..1129369
FT                   /locus_tag="TA13110"
FT                   /product="hypothetical protein"
FT                   /note="chr2.C.cand.287 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74559"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UED0"
FT                   /protein_id="CAI74559.1"
FT                   /translation="MRTSFLRYAKKAVSQPLSNKPMPGSVSEPVSSYEKFCPLATPTHV
FT                   EGIWRAPRSQGFTKEQFDRAYPDSYKGMKIGLPTPGTFAADHVDPKFDEISPLVWTCIL
FT                   MSPLIVWAIYEFKEEHFPSKTEHH"
FT   CDS_pept        complement(1129406..1131082)
FT                   /locus_tag="TA13105"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.228 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74560"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC9"
FT                   /protein_id="CAI74560.1"
FT                   /translation="MKFIYRLDSVGSPVFGSSETFEIELEETGSARPDQNSVLDSLMTP
FT                   LNTQLSEQTNMKPLDTEDLTSASAHYTLEDFFNTYSQHSHSYSNSDIYTNRDSYTNSEV
FT                   YRNPDTYRTGDSFRNTGVYTNSEVCRKESIEDVCEAGFDFSKLFTMSDESPIENSFQSL
FT                   IDLVRCEIPSNLSSIDPKFKQPNESAYNTVNTLNQYDTGVDSLKQFGMAEGELKNYDVP
FT                   VVKAEPSKTRGKSKKKRSNFVKTILKPKPITTSVKSTNGSNLVSNTAVKNGKKRELVNS
FT                   RRIDYGINDTPENIYDLEWHPGFTRHLGAKGRSALLELVRKVYRQDPEHYKAILQSRNS
FT                   PSSISSLPFYSIPMLWELAHQFGIFKQALTVYKNHCFSKSKSRHNSMKNANSVSSISTS
FT                   VSASSVGSSGSGSGSLVGSDSESLDSEVVASVKKLNPSAPMTTMSGRLIKRSKKMLEST
FT                   DLLDSNDLLTYANIVVTNSNNLVSGGNKATDSLTLKVDLLDTETNTISQLKVKAESETP
FT                   KRNFRNDLGNSWISSPTNSNLNCSNTLNESPLTSPMKRIPV"
FT   CDS_pept        join(1132322..1132459,1132540..1132635,1132703..1134112)
FT                   /locus_tag="TA13100"
FT                   /product="signal recognition particle receptor alpha
FT                   subunit, putative"
FT                   /note="all_bases.cand.1479 - signal recognition particle
FT                   receptor alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TA13100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74561"
FT                   /db_xref="GOA:Q4UEC8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC8"
FT                   /protein_id="CAI74561.1"
FT                   /translation="MIDSVALISRGGLVIWTFSPDPKSNVFIPDNKCSNINKLIQNVIL
FT                   QEKGGDKYACLDGVHFRWNLINSIDSLLFIAYKGIQNTNVLVDLLDKCSKAIVTKLETE
FT                   YSIPNNVNWFLHPIEFNFDNDFKSLLINTNNTTNITNITTSNSTTTTTTNSTNTSTITN
FT                   KKEKIKVMRQWDVKTNVTKRDMDELDYSDKSEPKHTTQSTNQNQLIPKLNTNVFKMNKM
FT                   IKSLMDSVKSMVSRENTNFELLDKFTAQVLKYSGNMMITEESLVTPINILTDKLRSKNV
FT                   AGDICEMICRSVSTHLVGKRTESLRSLSSTVKKALEDSVRRILTPKNPINLIKQVKELN
FT                   ANGSVYSIVFLGVNGVGKSTSLAKVAYLLKSSGFKVLVIACDTFRSGAVEQLKTHTRNL
FT                   GLQLFERGYGKDPSQIAKEGLKYATANQFDVVLIDTAGRMQDNEPLMAALTKLITVNNP
FT                   NLILFVGEALVGNDAVDQLKKFNTAIGKGTDRSIDALLLTKFDTVDDKVGAALSMVYIT
FT                   GKPILFVGNGQTYSDLQPLDVELITKFLLT"
FT   CDS_pept        complement(join(1134199..1134380,1134442..1134709))
FT                   /locus_tag="TA13095"
FT                   /product="nucleoside diphosphate kinase, putative"
FT                   /EC_number="2.7.4.6"
FT                   /note="chr2.cand.227 - nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TA13095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74562"
FT                   /db_xref="GOA:Q4UEC7"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC7"
FT                   /protein_id="CAI74562.1"
FT                   /translation="MEERTFVMVKPDGVHRNLVGEVLKRFELKGLKLVAAKFMMPSREL
FT                   VEKHYSAHEGKPFFDELVSFVGQGPVFCTAWEGPNAVKVGRSLLGVTNPVDSAPGTLRG
FT                   DFGLTLSKNLVHASSCLEDSVAECNLWFKPDEFVTWTPNASKWLL"
FT   CDS_pept        1135044..1136825
FT                   /locus_tag="TA13090"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74563"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC6"
FT                   /protein_id="CAI74563.1"
FT                   /translation="MVKKDNLKMVKKDNLKMVKKDNLKLLNGFAEDFKNLKNKLHLKFI
FT                   RYIDLFTIFFLILNKKLKIHNQTNYNIIVNFLNSITPNTTTTTDTTIDSNDIDDNWNEI
FT                   EELELSICINRFIENVRKKYNFIRENSILQFKPLTFSDFDSCNISIKREPFGLIKTISQ
FT                   HINHSNIITTGNTVNSNNTVNSNNSFNTNNTVTSVLEWDKNKIKKMLMDIINYGISSNE
FT                   IKSKSVLVGVVSPFILNSHDGLISKFRSVRTIGTDEGYDKKWAYNINKELYTSYNYPLH
FT                   TLFQFTSTNTISSSTNSGSPNSSTEVTSTKGTNYTSTDTCTYNCRITDLLCDIIFNIFE
FT                   NNNITQEHMKLIEIIKRNLQENTVNTVNLQENTVNNEEIDEDYEEILMKVSDLKPFPTI
FT                   YWLMNRNLISRVSELEGQGLIKDIESIICSIIEEFSKSQMNRSEFGESEFGKSESDKSE
FT                   FPGSELLRSESHKFIALLILDNIFYMFRRFQFTHPILIESFYNFFVNSEHFTCIENLQD
FT                   INYINFNNKIKSNGNNIQNTLIKGITINKGIRIMNTLRKYGIGGSEDFFHIKCLHTSLA
FT                   YDIAEGSIIGSLIKQFI"
FT   CDS_pept        1137059..1142611
FT                   /locus_tag="TA13085"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74564"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC5"
FT                   /protein_id="CAI74564.1"
FT                   /translation="MIMDELDEIPEIEDNYVLVVDTIRKTDEEIDSQLRLQKNSENPLF
FT                   HQIISFDKTINFHSFIILKKGINFKFKKDKFTIDSQDSTHNTHNCTHSTNSHDSVPDSV
FT                   PQSDESVYEIYSETELLDNDFKVFIKVINEDNYEFKQLNLFECQNSLIFLDTDITNLSS
FT                   TNTSKTTNTSKSTTTTKSTKSKGSKSTKLSINRNLVDSILITGSYSVISYLILGVPNKR
FT                   KLPKLTNCVYYGTGILDLNRHLIARESLCENVIEVSNTFSKLLKENRNVNYKTMNDFVN
FT                   YLTINEEYEKIQNLKKSLNNLIETHKSTDKSDKSSNKSEKSDKSVKSERLIEESYNLLK
FT                   NFINNDLFKEFMDYKTLETVLRICFNQLIYDTENLMYKMFSLLLQDSKLLRNFLNDKLM
FT                   EKQFDKVVTLLFSDKTPLEKKKSILKIILIILSDPYGISKFLESTYTFSYNSFVNNLFS
FT                   SNLTPFYNTIGNDITRIGNNISLYITLSQVETCYNRIKKMELTDFTNLEKFSKLIITSI
FT                   EMINSTMEINGTVEINGTVEINGTVEMVKGSIERNNVSVQMINSSYEIEFVVSCIKELQ
FT                   FIKSISLLYKMIYYQLSELPILIIDVYKIITKTFQFIKKFLQYFYFQDLLIQLYKICSI
FT                   LEIIDGNMGMDSNLGNGKGNGMGMDKGMGKSVSINLSTNLTTNLSNEIMELLLYYRVLI
FT                   LISLTISQGSFDTTVDDLHNLSHEFDNFFKVFNKFLENRLVSNFILKALKSYVILIRED
FT                   SPQALTNKINKNVSILLDLLCNAIVKDNFIVFCLGKRLYNFLDFYLTKFNKLQNNLVVS
FT                   TFNTLKILYTIPTIDTNGIPIIDDIILYITELLQTTNTVLGIVGTDNTVNKVNTDGPVG
FT                   RVNTSNSDGPVGTVGSVNTPNTANTLNPVGPAITPNKVDSVIEFSMLYVKETKLILNNI
FT                   LNMNIGMEWERAKNLGINLQYYNQWRDLNLRIVPPEKLPNHVIYGLGLLVNMGKSTETN
FT                   DKFKKLTESDLLLKLWNYCLGSIMADFHTIVKAEMGSLSSLTGYSWLDNFNSFTKTIVI
FT                   IINLYILSLEIISYDNGSGGNSSVNTGGGYNTGRGYYTVGGYYTDDVDIIEKEVCYIND
FT                   KLLECIIMTSVTMFKLMDNNCELGMECLFRLGNLIKYWYKRFKISRNYILNQLMKYGSA
FT                   LPEFYTGVSFLIIAISPTIPSISITSKLDNSFNSIQFTFLNHTYQVNTVNSTGSSVNNT
FT                   VNTVNSTGNTVNSTGGSVNNIKMLELDIRILIEFICVILMRSQSKDSTIMIMSSYLINH
FT                   YMTSDVILHLFDQLFYNSNLNTRIRLLLVLKNTISSSNTLSNTSTNTSSTSSTSSNTNV
FT                   RLQFRLNYKCLKYLIKLIEILNCKINLKITFQIVSDVILEVVSSFNQIWKEHRTIIHED
FT                   HLNTFLQLLYQSIIYIINILNNIQNSNTKGTVDSEGTEGTMGATGTVGASTVTKDTITE
FT                   NTPTTTTKDTINGDTITNKDMVTDVDDNIEIIMKGLLILDMILKNRFICMNIFYSLMGK
FT                   FDYKKSTDEEVQVQLNTINISNTIVYISKCIQDKLTENTLNNLVSSLYLITSLVLDIRM
FT                   TGTSQDIFIFHLLNLSSELPKSNIFDTLIQSTNSLLTKLTESIKSTESTELTQSSNSSK
FT                   PSNTTKSNGLRLHMIVILMLVRTELEKLKQEMLKEDKFTTLKSIKKSYVTTHKITNSLL
FT                   FKLSNPQESTLKTLLTTCKLYNNSSLWSYITKDPVFIDITTGPIEDTRKDPMNITTERV
FT                   SDNVKNDPMKNITMDPVIEEEDMDIEIDMEEYLTIENWNEFDVELSSNGLDLMSIVNNP
FT                   SLLMDKNTRQKFISAVIKNKHIFNHIIKLHIDIFN"
FT   CDS_pept        complement(join(1142830..1143836,1143979..1144335,
FT                   1144463..1144761,1144798..1145027))
FT                   /locus_tag="TA13080"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.226 - hypothetical protein, transmembrane
FT                   domains"
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA13080 by TMHMM2.0 at aa 124-146 and 153-175"
FT                   /db_xref="EnsemblGenomes-Gn:TA13080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74565"
FT                   /db_xref="GOA:Q4UEC4"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC4"
FT                   /protein_id="CAI74565.1"
FT                   /translation="MNLLELVKKLKETNSLVNTTLSEKLVNKYCNDSKIIFEDHVDRSH
FT                   ALETHLPKFEEVYQMTVIPTLWSDLFSIECDIIAKLMSNHVNKLGIDPNYSNFIQLLSH
FT                   LNSKIHNTTQGIKLSQFLCIPLHTYIYLYIPLYTSIYYYVPLYITMYLYILLCTSIYYY
FT                   VPLYITMYLYILLYMEEKYASGILSNLTVYNDRLNVKVNEDRVYYENCCVELLYLSEKQ
FT                   LLDRPAFIEKWRFKVLKFLKDLSLTFNIDKCTHNLSILFFDYYIHLCTQNYINTPSSVN
FT                   TLDDSNSHLSHDISQEEDLGPFKENEMLKIGTACYLLAAALREHWVDINKDKYLEQAVE
FT                   MSYNAFSTKEVITVQLDIIHRMPKGFTSIYTCMEYGLFYLANIKFNSITHLDQLIHSHS
FT                   IDTGNLRNSCDTGNLRNSIDTRNLHNSNSSGTGYINMNVDELMLSNCFNFMVKSGALPW
FT                   LYHCLSKWDDIYISKNWNRFIPPSRCAAVFVLHMFLTYLNIDSRKDLIWCRRFCHRVFK
FT                   MFFDSDVALWYHVFREILSSFLLNVEKQAGRSTNKNDRVAEARRSAELKRMSEMSFLYS
FT                   LSSSIFNATEAIVNLYHTKLILQYISTNGVELVGLNPKQIQLLLSNIINILIKH"
FT   misc_feature    complement(join(1144467..1144535,1144554..1144622))
FT                   /note="2 probable transmembrane helices predicted for
FT                   TA13080 by TMHMM2.0 at aa 124-146 and 153-175"
FT   CDS_pept        complement(join(1145429..1145761,1145868..1146167))
FT                   /locus_tag="TA13075"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.225 - hypothetical membrane protein,
FT                   signal peptide, transmembrane domains"
FT                   /note="membrane protein, putative"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13075 by TMHMM2.0 at aa 21-43, 58-80, 85-107 and 134-156"
FT                   /note="Signal anchor predicted for TA13075 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.998) with cleavage site probability 0.001
FT                   between residues 46 and 47"
FT                   /db_xref="EnsemblGenomes-Gn:TA13075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74566"
FT                   /db_xref="GOA:Q4UEC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC3"
FT                   /protein_id="CAI74566.1"
FT                   /translation="MANIKQQKWIFKDRSAVVSGMFGIPITFCLLILAILMLGIFIITW
FT                   SIEGKVLVRVIGFNLPVIIKIMSLVSTLALFSFLINSTGVIYFVVFSTLIYFISHSILL
FT                   SGILEFFFKFQEYDKPFMDMTYYHPSNLDFYFVIAICMLRVLLGIPFSYYSLVLFTIRK
FT                   SGGTGFRRIPAFKLEINSLIEQAKILKKRYEYVIKRNAIFEISKSQS"
FT   misc_feature    complement(join(1145594..1145662,1145741..1145761,
FT                   1145868..1145915,1145928..1145996,1146039..1146107))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13075 by TMHMM2.0 at aa 21-43, 58-80, 85-107 and 134-156"
FT   misc_feature    complement(1146030..1146167)
FT                   /note="Signal anchor predicted for TA13075 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.002, signal anchor
FT                   probability 0.998) with cleavage site probability 0.001
FT                   between residues 46 and 47"
FT   CDS_pept        join(1146624..1146679,1146748..1147120)
FT                   /locus_tag="TA13070"
FT                   /product="clathrin-coat assembly protein, putative"
FT                   /note="chr2.C.cand.293 - clathrin coat assembly protein
FT                   PF01217 clathrin adaptor complex small chain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74567"
FT                   /db_xref="GOA:Q4UEC2"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC2"
FT                   /protein_id="CAI74567.1"
FT                   /translation="MIYGIFLQNYQNDTRFSKWYSSFNIKRKKLLEDKIHNELVNRDRR
FT                   WSNVFDLEGMKLVYRQYSGLMICILIDQSDNTLAIYELIHLIVEVLDVYYGDVCELDIV
FT                   YNFNRVHSILDDIVLGGEIIETSKDIIIEKLRSFDKVN"
FT   CDS_pept        complement(join(1147441..1147766,1147815..1148076))
FT                   /locus_tag="TA13065"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.224 - hypothetical membrane protein"
FT                   /note="hypothetical membrane protein"
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13065 by TMHMM2.0 at aa 25-47, 60-79, 83-101 and 121-143"
FT                   /db_xref="EnsemblGenomes-Gn:TA13065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74568"
FT                   /db_xref="GOA:Q4UEC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC1"
FT                   /protein_id="CAI74568.1"
FT                   /translation="MTSFKDKLLSSHRSNIQSTFGGHLNIFFSVLLFNVLDICILGYFW
FT                   FLHFNAVKQFECKAFFIDVIVNTILTFTPLIALIKSSILFYTCKFAGLVAFHSLRLSRS
FT                   NQKLLNNYYISRLGIYLNSVIFCIARLVLIILAVWYALVLEKIRFVGGTGFEKKPASDF
FT                   EEQALEEYLKDKDPSLTLDLNKSHEFILEPTI"
FT   misc_feature    complement(join(1147600..1147668,1147726..1147766,
FT                   1147815..1147830,1147840..1147899,1147936..1148004))
FT                   /note="4 probable transmembrane helices predicted for
FT                   TA13065 by TMHMM2.0 at aa 25-47, 60-79, 83-101 and 121-143"
FT   CDS_pept        complement(1148262..1148615)
FT                   /locus_tag="TA13060"
FT                   /product="hypothetical protein"
FT                   /note="chr2.cand.223 - hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TA13060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEC0"
FT                   /protein_id="CAI74569.1"
FT                   /translation="MDPEIKLIHQLKKETNYQIPIPIPYSTQSTDTTTQSSDSTTNNMD
FT                   SSNNMDTTSNIGTTTNGQDTITTNSTTTTTTNIRNNEIMDEFEMERIKFEDSINLLKDE
FT                   AIFDLYTLRWGHT"
FT   CDS_pept        complement(join(1148977..1151645,1151688..1151973))
FT                   /locus_tag="TA13055"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.cand.222 - hypothetical protein, conserved,
FT                   pf11_0433, TPR domain, DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:TA13055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74570"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4UEB9"
FT                   /protein_id="CAI74570.1"
FT                   /translation="MTRNKIFEYFNESNNDEVLDDYLENCLNLSKMKLRSTVADSHFFE
FT                   NSSSYNIMNNNFTHLNTEYSNMDTDFTNIDTNYTNMDTNCTDFTNLNMNCEITSDLESI
FT                   HEDSVKNIKKNTVDNFDSWESPILNPFYNYSNNNNHKINHTNSSFNHTNHRVNHTDHRV
FT                   NHSTPDSSRIHSNTIDSSTIDSIERNGGLKLLDKLKRIIMDMETEISNKDKKIHELGNT
FT                   ITRLNSLVNSLNEELLESFKNLENVLKDLDKEKLQNKQLKLQIIQLSGLLQSNHNTIIH
FT                   DTIGTRFESHTSSSTTGTITVTGPTTTNGSKDSTVVPGTKATVTTTGDTVTTSTTTTNK
FT                   DMDVDKRFMNKLMKYMYVIDITEILPSIYKGIHENLNVLNSNEFITFIIESIHYDSQIL
FT                   KITLQSIQNNNTNSTNTTFSNTNYGSNTNNSNNSMNNSIYGVYMGFGLPMTNLERKVIN
FT                   ILESNNTVTSMNNTMDNTVSSSKNGIKKGMLMNRILLLTILKSSNMNLVYNYLFEAISC
FT                   DNFRVIEIIFQAVLNKFIDFHLLPNFKQIYKHPILYSNNSFNNPFDIQSYDGSHKGSYK
FT                   GSHSKEYSKGSHSSESYNTKSYPLKSYKEMYNMELMGMERYIYMINYNFESIPMDPITG
FT                   DNLFHILSKHTINTNIKNIHNVNTNVNTNGNRNIKNLMKKIKLFLHYTPYLTLKNKELK
FT                   TPLDICNISMKKEFYYMIIMDLASKGSLSYKNKLYHNALDYYTYAINIFLNPHIYTSVT
FT                   VLGHTSTEGPANKDTTNITNSSKDIGTIGSSTVTKGKGANFTATECTMGKGANFMPMEC
FT                   TTTKDATGAVGASTVMENMIEEMGIKSIGKLYYNKGRTLIHLNRWLECIESCEMCLMYI
FT                   PDYINAYYTLIESYEKLLDWENAASICLLMKDNCGIIDLKRYNKIIEQKDATYFQLLGL
FT                   NNDATDSDIKKQFNTLCKIWHPDKHTNDINITKRCTNQFNRYRFSYGACSSSSS"
FT   CDS_pept        join(1152406..1152420,1152453..1152559,1152589..1152728,
FT                   1152834..1152928,1152959..1153013,1153044..1153360,
FT                   1153617..1153666,1153779..1153931,1154024..1154109,
FT                   1154182..1154238,1154270..1154578,1154715..1154821)
FT                   /locus_tag="TA13050"
FT                   /product="hypothetical protein, conserved"
FT                   /note="chr2.C.cand.296 - hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:TA13050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI74571"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013180"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039678"
FT                   /db_xref="UniProtKB/TrEMBL: