(data stored in ACNUC7421 zone)

EMBL: CR954246

ID   CR954246; SV 1; circular; genomic DNA; STD; PRO; 3214944 BP.
XX
AC   CR954246;
XX
PR   Project:PRJNA15713;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 9)
XX
DE   Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence.
XX
KW   .
XX
OS   Pseudoalteromonas haloplanktis TAC125
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Pseudoalteromonadaceae; Pseudoalteromonas.
XX
RN   [1]
RC   This sequence was made in collaboration between the laboratory Institut
RC   Pasteur (France) and Genoscope (France).
RP   1-3214944
RG   Institut Pasteur and Genoscope
RA   Genoscope;
RT   ;
RL   Submitted (31-AUG-2006) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RC   1. Genoscope, CNRS-UMR 8030, Atelier de Genomique Comparative, 2, rue
RC   Gaston Cremieux, 91006 Evry Cedex, France 2. Genetics of Bacterial Genomes,
RC   Institut Pasteur, 28 rue du Docteur Roux, 75724 Paris Cedex 15, France 3.
RC   Dept of Biochemistry & Biophysics, Stockholm University, S-106 91
RC   Stockholm, Sweden 4. Dynamique, Evolution et Expression de Genomes de
RC   Micro-organismes, Universite Louis Pasteur, 28, rue Goethe, 67000
RC   Strasbourg, France 5. Laboratoire de Biochimie, Institut de Chimie B6,
RC   Universite de Liege, B-4000 Liege-Sart Tilman, Belgium 6. Dipartimento di
RC   Chimica Organica e Biochimica, edificio MB, via Cinthia, Complesso
RC   Universitario Monte S. Angelo, 80126 Napoli, Italy 7. CEA Saclay,
RC   Laboratoire Stress Oxydants et Cancer, DSV/DBJC/SBMS, Bat 142, 91191 Gif
RC   sur Yvette Cedex, France
RX   DOI; 10.1101/gr.4126905.
RX   PUBMED; 16169927.
RA   Medigue C., Krin E., Pascal G., Barbe V., Bernsel A., Bertin P., Cheung F.,
RA   Cruveiller S., Damico S., Duilio A., Fang G., Feller G., Mangenot S.,
RA   Marino G., Nilsson J., Parilli E., Rocha E., Rouy Z., Sekowska A.,
RA   Tutino M.L., Vallenet D., von Heijne G., Danchin A.;
RT   "Coping with cold: the genome of the versatile marine Antarctica bacterium
RT   Pseudoalteromonas haloplanktis TAC125";
RL   Genome Res. 15(10):1325-1335(2005).
XX
DR   MD5; fc8cae7db8affe52e008772380ae8ab2.
DR   BioSample; SAMEA3138224.
DR   EnsemblGenomes-Gn; EBG00001450093.
DR   EnsemblGenomes-Gn; EBG00001450094.
DR   EnsemblGenomes-Gn; EBG00001450095.
DR   EnsemblGenomes-Gn; EBG00001450096.
DR   EnsemblGenomes-Gn; EBG00001450097.
DR   EnsemblGenomes-Gn; EBG00001450098.
DR   EnsemblGenomes-Gn; EBG00001450099.
DR   EnsemblGenomes-Gn; EBG00001450100.
DR   EnsemblGenomes-Gn; EBG00001450101.
DR   EnsemblGenomes-Gn; EBG00001450102.
DR   EnsemblGenomes-Gn; EBG00001450103.
DR   EnsemblGenomes-Gn; EBG00001450104.
DR   EnsemblGenomes-Gn; EBG00001450105.
DR   EnsemblGenomes-Gn; EBG00001450106.
DR   EnsemblGenomes-Gn; EBG00001450107.
DR   EnsemblGenomes-Gn; EBG00001450108.
DR   EnsemblGenomes-Gn; EBG00001450109.
DR   EnsemblGenomes-Gn; EBG00001450110.
DR   EnsemblGenomes-Gn; EBG00001450111.
DR   EnsemblGenomes-Gn; EBG00001450112.
DR   EnsemblGenomes-Gn; EBG00001450113.
DR   EnsemblGenomes-Gn; EBG00001450114.
DR   EnsemblGenomes-Gn; EBG00001450115.
DR   EnsemblGenomes-Gn; EBG00001450116.
DR   EnsemblGenomes-Gn; EBG00001450117.
DR   EnsemblGenomes-Gn; EBG00001450118.
DR   EnsemblGenomes-Gn; EBG00001450119.
DR   EnsemblGenomes-Gn; EBG00001450120.
DR   EnsemblGenomes-Gn; EBG00001450121.
DR   EnsemblGenomes-Gn; EBG00001450122.
DR   EnsemblGenomes-Gn; EBG00001450123.
DR   EnsemblGenomes-Gn; EBG00001450124.
DR   EnsemblGenomes-Gn; EBG00001450125.
DR   EnsemblGenomes-Gn; EBG00001450126.
DR   EnsemblGenomes-Gn; EBG00001450127.
DR   EnsemblGenomes-Gn; EBG00001450128.
DR   EnsemblGenomes-Gn; EBG00001450129.
DR   EnsemblGenomes-Gn; EBG00001450130.
DR   EnsemblGenomes-Gn; EBG00001450131.
DR   EnsemblGenomes-Gn; EBG00001450132.
DR   EnsemblGenomes-Gn; EBG00001450133.
DR   EnsemblGenomes-Gn; EBG00001450134.
DR   EnsemblGenomes-Gn; EBG00001450135.
DR   EnsemblGenomes-Gn; EBG00001450136.
DR   EnsemblGenomes-Gn; EBG00001450137.
DR   EnsemblGenomes-Gn; EBG00001450138.
DR   EnsemblGenomes-Gn; EBG00001450139.
DR   EnsemblGenomes-Gn; EBG00001450140.
DR   EnsemblGenomes-Gn; EBG00001450141.
DR   EnsemblGenomes-Gn; EBG00001450142.
DR   EnsemblGenomes-Gn; EBG00001450143.
DR   EnsemblGenomes-Gn; EBG00001450144.
DR   EnsemblGenomes-Gn; EBG00001450145.
DR   EnsemblGenomes-Gn; EBG00001450146.
DR   EnsemblGenomes-Gn; EBG00001450147.
DR   EnsemblGenomes-Gn; EBG00001450148.
DR   EnsemblGenomes-Gn; EBG00001450149.
DR   EnsemblGenomes-Gn; EBG00001450150.
DR   EnsemblGenomes-Gn; EBG00001450151.
DR   EnsemblGenomes-Gn; EBG00001450152.
DR   EnsemblGenomes-Gn; EBG00001450153.
DR   EnsemblGenomes-Gn; EBG00001450154.
DR   EnsemblGenomes-Gn; EBG00001450155.
DR   EnsemblGenomes-Gn; EBG00001450156.
DR   EnsemblGenomes-Gn; EBG00001450157.
DR   EnsemblGenomes-Gn; EBG00001450158.
DR   EnsemblGenomes-Gn; EBG00001450159.
DR   EnsemblGenomes-Gn; EBG00001450160.
DR   EnsemblGenomes-Gn; EBG00001450161.
DR   EnsemblGenomes-Gn; EBG00001450162.
DR   EnsemblGenomes-Gn; EBG00001450163.
DR   EnsemblGenomes-Gn; EBG00001450164.
DR   EnsemblGenomes-Gn; EBG00001450165.
DR   EnsemblGenomes-Gn; EBG00001450166.
DR   EnsemblGenomes-Gn; EBG00001450167.
DR   EnsemblGenomes-Gn; EBG00001450168.
DR   EnsemblGenomes-Gn; EBG00001450169.
DR   EnsemblGenomes-Gn; EBG00001450170.
DR   EnsemblGenomes-Gn; EBG00001450171.
DR   EnsemblGenomes-Gn; EBG00001450172.
DR   EnsemblGenomes-Gn; EBG00001450173.
DR   EnsemblGenomes-Gn; EBG00001450174.
DR   EnsemblGenomes-Gn; EBG00001450175.
DR   EnsemblGenomes-Gn; EBG00001450176.
DR   EnsemblGenomes-Gn; EBG00001450177.
DR   EnsemblGenomes-Gn; EBG00001450178.
DR   EnsemblGenomes-Gn; EBG00001450179.
DR   EnsemblGenomes-Gn; EBG00001450180.
DR   EnsemblGenomes-Gn; EBG00001450181.
DR   EnsemblGenomes-Gn; EBG00001450182.
DR   EnsemblGenomes-Gn; EBG00001450183.
DR   EnsemblGenomes-Gn; EBG00001450184.
DR   EnsemblGenomes-Gn; EBG00001450185.
DR   EnsemblGenomes-Gn; EBG00001450186.
DR   EnsemblGenomes-Gn; EBG00001450187.
DR   EnsemblGenomes-Gn; EBG00001450188.
DR   EnsemblGenomes-Gn; EBG00001450189.
DR   EnsemblGenomes-Gn; EBG00001450190.
DR   EnsemblGenomes-Gn; EBG00001450191.
DR   EnsemblGenomes-Gn; EBG00001450192.
DR   EnsemblGenomes-Gn; EBG00001450193.
DR   EnsemblGenomes-Gn; EBG00001450194.
DR   EnsemblGenomes-Gn; EBG00001450195.
DR   EnsemblGenomes-Gn; EBG00001450196.
DR   EnsemblGenomes-Gn; EBG00001450197.
DR   EnsemblGenomes-Gn; EBG00001450198.
DR   EnsemblGenomes-Gn; EBG00001450199.
DR   EnsemblGenomes-Gn; EBG00001450200.
DR   EnsemblGenomes-Gn; EBG00001450201.
DR   EnsemblGenomes-Gn; EBG00001450202.
DR   EnsemblGenomes-Gn; EBG00001450203.
DR   EnsemblGenomes-Gn; EBG00001450204.
DR   EnsemblGenomes-Gn; EBG00001450205.
DR   EnsemblGenomes-Gn; EBG00001450206.
DR   EnsemblGenomes-Gn; EBG00001450207.
DR   EnsemblGenomes-Gn; EBG00001450208.
DR   EnsemblGenomes-Gn; EBG00001450209.
DR   EnsemblGenomes-Gn; EBG00001450210.
DR   EnsemblGenomes-Gn; EBG00001450211.
DR   EnsemblGenomes-Gn; EBG00001450212.
DR   EnsemblGenomes-Gn; EBG00001450213.
DR   EnsemblGenomes-Gn; EBG00001450214.
DR   EnsemblGenomes-Gn; EBG00001450215.
DR   EnsemblGenomes-Gn; EBG00001450216.
DR   EnsemblGenomes-Gn; EBG00001450217.
DR   EnsemblGenomes-Gn; EBG00001450218.
DR   EnsemblGenomes-Gn; EBG00001450219.
DR   EnsemblGenomes-Gn; EBG00001450220.
DR   EnsemblGenomes-Gn; EBG00001450221.
DR   EnsemblGenomes-Gn; EBG00001450222.
DR   EnsemblGenomes-Gn; EBG00001450223.
DR   EnsemblGenomes-Gn; EBG00001450224.
DR   EnsemblGenomes-Gn; EBG00001450225.
DR   EnsemblGenomes-Gn; EBG00001450226.
DR   EnsemblGenomes-Gn; EBG00001450227.
DR   EnsemblGenomes-Gn; EBG00001450228.
DR   EnsemblGenomes-Gn; EBG00001450229.
DR   EnsemblGenomes-Gn; EBG00001450230.
DR   EnsemblGenomes-Gn; EBG00001450231.
DR   EnsemblGenomes-Gn; EBG00001450232.
DR   EnsemblGenomes-Gn; EBG00001450233.
DR   EnsemblGenomes-Gn; EBG00001450234.
DR   EnsemblGenomes-Gn; EBG00001450235.
DR   EnsemblGenomes-Gn; EBG00001450236.
DR   EnsemblGenomes-Gn; EBG00001450237.
DR   EnsemblGenomes-Gn; EBG00001450238.
DR   EnsemblGenomes-Gn; EBG00001450239.
DR   EnsemblGenomes-Gn; EBG00001450240.
DR   EnsemblGenomes-Gn; EBG00001450241.
DR   EnsemblGenomes-Gn; EBG00001450242.
DR   EnsemblGenomes-Gn; EBG00001450243.
DR   EnsemblGenomes-Gn; EBG00001450244.
DR   EnsemblGenomes-Gn; EBG00001450245.
DR   EnsemblGenomes-Gn; EBG00001450246.
DR   EnsemblGenomes-Gn; EBG00001450247.
DR   EnsemblGenomes-Gn; EBG00001450248.
DR   EnsemblGenomes-Gn; EBG00001450249.
DR   EnsemblGenomes-Gn; EBG00001450250.
DR   EnsemblGenomes-Gn; EBG00001450251.
DR   EnsemblGenomes-Gn; EBG00001450252.
DR   EnsemblGenomes-Gn; PSHAa2107.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s1.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s2.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s3.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s4.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s5.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s6.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s7.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s8.
DR   EnsemblGenomes-Gn; PSHAa_rRNA16s9.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s1.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s2.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s3.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s4.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s5.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s6.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s7.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s8.
DR   EnsemblGenomes-Gn; PSHAa_rRNA23s9.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s1.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s10.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s2.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s3.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s4.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s5.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s6.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s7.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s8.
DR   EnsemblGenomes-Gn; PSHAa_rRNA5s9.
DR   EnsemblGenomes-Gn; PSHAatRNA1.
DR   EnsemblGenomes-Gn; PSHAatRNA10.
DR   EnsemblGenomes-Gn; PSHAatRNA100.
DR   EnsemblGenomes-Gn; PSHAatRNA101.
DR   EnsemblGenomes-Gn; PSHAatRNA102.
DR   EnsemblGenomes-Gn; PSHAatRNA103.
DR   EnsemblGenomes-Gn; PSHAatRNA104.
DR   EnsemblGenomes-Gn; PSHAatRNA105.
DR   EnsemblGenomes-Gn; PSHAatRNA106.
DR   EnsemblGenomes-Gn; PSHAatRNA11.
DR   EnsemblGenomes-Gn; PSHAatRNA12.
DR   EnsemblGenomes-Gn; PSHAatRNA13.
DR   EnsemblGenomes-Gn; PSHAatRNA14.
DR   EnsemblGenomes-Gn; PSHAatRNA15.
DR   EnsemblGenomes-Gn; PSHAatRNA16.
DR   EnsemblGenomes-Gn; PSHAatRNA17.
DR   EnsemblGenomes-Gn; PSHAatRNA18.
DR   EnsemblGenomes-Gn; PSHAatRNA19.
DR   EnsemblGenomes-Gn; PSHAatRNA2.
DR   EnsemblGenomes-Gn; PSHAatRNA20.
DR   EnsemblGenomes-Gn; PSHAatRNA21.
DR   EnsemblGenomes-Gn; PSHAatRNA22.
DR   EnsemblGenomes-Gn; PSHAatRNA23.
DR   EnsemblGenomes-Gn; PSHAatRNA24.
DR   EnsemblGenomes-Gn; PSHAatRNA25.
DR   EnsemblGenomes-Gn; PSHAatRNA26.
DR   EnsemblGenomes-Gn; PSHAatRNA27.
DR   EnsemblGenomes-Gn; PSHAatRNA28.
DR   EnsemblGenomes-Gn; PSHAatRNA29.
DR   EnsemblGenomes-Gn; PSHAatRNA3.
DR   EnsemblGenomes-Gn; PSHAatRNA30.
DR   EnsemblGenomes-Gn; PSHAatRNA31.
DR   EnsemblGenomes-Gn; PSHAatRNA32.
DR   EnsemblGenomes-Gn; PSHAatRNA33.
DR   EnsemblGenomes-Gn; PSHAatRNA34.
DR   EnsemblGenomes-Gn; PSHAatRNA35.
DR   EnsemblGenomes-Gn; PSHAatRNA36.
DR   EnsemblGenomes-Gn; PSHAatRNA37.
DR   EnsemblGenomes-Gn; PSHAatRNA38.
DR   EnsemblGenomes-Gn; PSHAatRNA39.
DR   EnsemblGenomes-Gn; PSHAatRNA4.
DR   EnsemblGenomes-Gn; PSHAatRNA40.
DR   EnsemblGenomes-Gn; PSHAatRNA41.
DR   EnsemblGenomes-Gn; PSHAatRNA42.
DR   EnsemblGenomes-Gn; PSHAatRNA43.
DR   EnsemblGenomes-Gn; PSHAatRNA44.
DR   EnsemblGenomes-Gn; PSHAatRNA45.
DR   EnsemblGenomes-Gn; PSHAatRNA46.
DR   EnsemblGenomes-Gn; PSHAatRNA47.
DR   EnsemblGenomes-Gn; PSHAatRNA48.
DR   EnsemblGenomes-Gn; PSHAatRNA49.
DR   EnsemblGenomes-Gn; PSHAatRNA5.
DR   EnsemblGenomes-Gn; PSHAatRNA50.
DR   EnsemblGenomes-Gn; PSHAatRNA51.
DR   EnsemblGenomes-Gn; PSHAatRNA52.
DR   EnsemblGenomes-Gn; PSHAatRNA53.
DR   EnsemblGenomes-Gn; PSHAatRNA54.
DR   EnsemblGenomes-Gn; PSHAatRNA55.
DR   EnsemblGenomes-Gn; PSHAatRNA56.
DR   EnsemblGenomes-Gn; PSHAatRNA57.
DR   EnsemblGenomes-Gn; PSHAatRNA58.
DR   EnsemblGenomes-Gn; PSHAatRNA59.
DR   EnsemblGenomes-Gn; PSHAatRNA6.
DR   EnsemblGenomes-Gn; PSHAatRNA60.
DR   EnsemblGenomes-Gn; PSHAatRNA61.
DR   EnsemblGenomes-Gn; PSHAatRNA62.
DR   EnsemblGenomes-Gn; PSHAatRNA63.
DR   EnsemblGenomes-Gn; PSHAatRNA64.
DR   EnsemblGenomes-Gn; PSHAatRNA65.
DR   EnsemblGenomes-Gn; PSHAatRNA66.
DR   EnsemblGenomes-Gn; PSHAatRNA67.
DR   EnsemblGenomes-Gn; PSHAatRNA68.
DR   EnsemblGenomes-Gn; PSHAatRNA69.
DR   EnsemblGenomes-Gn; PSHAatRNA7.
DR   EnsemblGenomes-Gn; PSHAatRNA70.
DR   EnsemblGenomes-Gn; PSHAatRNA71.
DR   EnsemblGenomes-Gn; PSHAatRNA72.
DR   EnsemblGenomes-Gn; PSHAatRNA73.
DR   EnsemblGenomes-Gn; PSHAatRNA74.
DR   EnsemblGenomes-Gn; PSHAatRNA75.
DR   EnsemblGenomes-Gn; PSHAatRNA76.
DR   EnsemblGenomes-Gn; PSHAatRNA77.
DR   EnsemblGenomes-Gn; PSHAatRNA78.
DR   EnsemblGenomes-Gn; PSHAatRNA79.
DR   EnsemblGenomes-Gn; PSHAatRNA8.
DR   EnsemblGenomes-Gn; PSHAatRNA80.
DR   EnsemblGenomes-Gn; PSHAatRNA81.
DR   EnsemblGenomes-Gn; PSHAatRNA82.
DR   EnsemblGenomes-Gn; PSHAatRNA83.
DR   EnsemblGenomes-Gn; PSHAatRNA84.
DR   EnsemblGenomes-Gn; PSHAatRNA85.
DR   EnsemblGenomes-Gn; PSHAatRNA86.
DR   EnsemblGenomes-Gn; PSHAatRNA87.
DR   EnsemblGenomes-Gn; PSHAatRNA88.
DR   EnsemblGenomes-Gn; PSHAatRNA89.
DR   EnsemblGenomes-Gn; PSHAatRNA9.
DR   EnsemblGenomes-Gn; PSHAatRNA90.
DR   EnsemblGenomes-Gn; PSHAatRNA91.
DR   EnsemblGenomes-Gn; PSHAatRNA92.
DR   EnsemblGenomes-Gn; PSHAatRNA93.
DR   EnsemblGenomes-Gn; PSHAatRNA94.
DR   EnsemblGenomes-Gn; PSHAatRNA95.
DR   EnsemblGenomes-Gn; PSHAatRNA96.
DR   EnsemblGenomes-Gn; PSHAatRNA97.
DR   EnsemblGenomes-Gn; PSHAatRNA98.
DR   EnsemblGenomes-Gn; PSHAatRNA99.
DR   EnsemblGenomes-Tr; EBT00001603845.
DR   EnsemblGenomes-Tr; EBT00001603846.
DR   EnsemblGenomes-Tr; EBT00001603847.
DR   EnsemblGenomes-Tr; EBT00001603848.
DR   EnsemblGenomes-Tr; EBT00001603849.
DR   EnsemblGenomes-Tr; EBT00001603850.
DR   EnsemblGenomes-Tr; EBT00001603851.
DR   EnsemblGenomes-Tr; EBT00001603852.
DR   EnsemblGenomes-Tr; EBT00001603853.
DR   EnsemblGenomes-Tr; EBT00001603854.
DR   EnsemblGenomes-Tr; EBT00001603855.
DR   EnsemblGenomes-Tr; EBT00001603856.
DR   EnsemblGenomes-Tr; EBT00001603857.
DR   EnsemblGenomes-Tr; EBT00001603858.
DR   EnsemblGenomes-Tr; EBT00001603859.
DR   EnsemblGenomes-Tr; EBT00001603860.
DR   EnsemblGenomes-Tr; EBT00001603861.
DR   EnsemblGenomes-Tr; EBT00001603862.
DR   EnsemblGenomes-Tr; EBT00001603863.
DR   EnsemblGenomes-Tr; EBT00001603864.
DR   EnsemblGenomes-Tr; EBT00001603865.
DR   EnsemblGenomes-Tr; EBT00001603866.
DR   EnsemblGenomes-Tr; EBT00001603867.
DR   EnsemblGenomes-Tr; EBT00001603868.
DR   EnsemblGenomes-Tr; EBT00001603869.
DR   EnsemblGenomes-Tr; EBT00001603870.
DR   EnsemblGenomes-Tr; EBT00001603871.
DR   EnsemblGenomes-Tr; EBT00001603872.
DR   EnsemblGenomes-Tr; EBT00001603873.
DR   EnsemblGenomes-Tr; EBT00001603874.
DR   EnsemblGenomes-Tr; EBT00001603875.
DR   EnsemblGenomes-Tr; EBT00001603876.
DR   EnsemblGenomes-Tr; EBT00001603877.
DR   EnsemblGenomes-Tr; EBT00001603878.
DR   EnsemblGenomes-Tr; EBT00001603879.
DR   EnsemblGenomes-Tr; EBT00001603880.
DR   EnsemblGenomes-Tr; EBT00001603881.
DR   EnsemblGenomes-Tr; EBT00001603882.
DR   EnsemblGenomes-Tr; EBT00001603883.
DR   EnsemblGenomes-Tr; EBT00001603884.
DR   EnsemblGenomes-Tr; EBT00001603885.
DR   EnsemblGenomes-Tr; EBT00001603886.
DR   EnsemblGenomes-Tr; EBT00001603887.
DR   EnsemblGenomes-Tr; EBT00001603888.
DR   EnsemblGenomes-Tr; EBT00001603889.
DR   EnsemblGenomes-Tr; EBT00001603890.
DR   EnsemblGenomes-Tr; EBT00001603891.
DR   EnsemblGenomes-Tr; EBT00001603892.
DR   EnsemblGenomes-Tr; EBT00001603893.
DR   EnsemblGenomes-Tr; EBT00001603894.
DR   EnsemblGenomes-Tr; EBT00001603895.
DR   EnsemblGenomes-Tr; EBT00001603896.
DR   EnsemblGenomes-Tr; EBT00001603897.
DR   EnsemblGenomes-Tr; EBT00001603898.
DR   EnsemblGenomes-Tr; EBT00001603899.
DR   EnsemblGenomes-Tr; EBT00001603900.
DR   EnsemblGenomes-Tr; EBT00001603901.
DR   EnsemblGenomes-Tr; EBT00001603902.
DR   EnsemblGenomes-Tr; EBT00001603903.
DR   EnsemblGenomes-Tr; EBT00001603904.
DR   EnsemblGenomes-Tr; EBT00001603905.
DR   EnsemblGenomes-Tr; EBT00001603906.
DR   EnsemblGenomes-Tr; EBT00001603907.
DR   EnsemblGenomes-Tr; EBT00001603908.
DR   EnsemblGenomes-Tr; EBT00001603909.
DR   EnsemblGenomes-Tr; EBT00001603910.
DR   EnsemblGenomes-Tr; EBT00001603911.
DR   EnsemblGenomes-Tr; EBT00001603912.
DR   EnsemblGenomes-Tr; EBT00001603913.
DR   EnsemblGenomes-Tr; EBT00001603914.
DR   EnsemblGenomes-Tr; EBT00001603915.
DR   EnsemblGenomes-Tr; EBT00001603916.
DR   EnsemblGenomes-Tr; EBT00001603917.
DR   EnsemblGenomes-Tr; EBT00001603918.
DR   EnsemblGenomes-Tr; EBT00001603919.
DR   EnsemblGenomes-Tr; EBT00001603920.
DR   EnsemblGenomes-Tr; EBT00001603921.
DR   EnsemblGenomes-Tr; EBT00001603922.
DR   EnsemblGenomes-Tr; EBT00001603923.
DR   EnsemblGenomes-Tr; EBT00001603924.
DR   EnsemblGenomes-Tr; EBT00001603925.
DR   EnsemblGenomes-Tr; EBT00001603926.
DR   EnsemblGenomes-Tr; EBT00001603927.
DR   EnsemblGenomes-Tr; EBT00001603928.
DR   EnsemblGenomes-Tr; EBT00001603929.
DR   EnsemblGenomes-Tr; EBT00001603930.
DR   EnsemblGenomes-Tr; EBT00001603931.
DR   EnsemblGenomes-Tr; EBT00001603932.
DR   EnsemblGenomes-Tr; EBT00001603933.
DR   EnsemblGenomes-Tr; EBT00001603934.
DR   EnsemblGenomes-Tr; EBT00001603935.
DR   EnsemblGenomes-Tr; EBT00001603936.
DR   EnsemblGenomes-Tr; EBT00001603937.
DR   EnsemblGenomes-Tr; EBT00001603938.
DR   EnsemblGenomes-Tr; EBT00001603939.
DR   EnsemblGenomes-Tr; EBT00001603940.
DR   EnsemblGenomes-Tr; EBT00001603941.
DR   EnsemblGenomes-Tr; EBT00001603942.
DR   EnsemblGenomes-Tr; EBT00001603943.
DR   EnsemblGenomes-Tr; EBT00001603944.
DR   EnsemblGenomes-Tr; EBT00001603945.
DR   EnsemblGenomes-Tr; EBT00001603946.
DR   EnsemblGenomes-Tr; EBT00001603947.
DR   EnsemblGenomes-Tr; EBT00001603948.
DR   EnsemblGenomes-Tr; EBT00001603949.
DR   EnsemblGenomes-Tr; EBT00001603950.
DR   EnsemblGenomes-Tr; EBT00001603951.
DR   EnsemblGenomes-Tr; EBT00001603952.
DR   EnsemblGenomes-Tr; EBT00001603953.
DR   EnsemblGenomes-Tr; EBT00001603954.
DR   EnsemblGenomes-Tr; EBT00001603955.
DR   EnsemblGenomes-Tr; EBT00001603956.
DR   EnsemblGenomes-Tr; EBT00001603957.
DR   EnsemblGenomes-Tr; EBT00001603958.
DR   EnsemblGenomes-Tr; EBT00001603959.
DR   EnsemblGenomes-Tr; EBT00001603960.
DR   EnsemblGenomes-Tr; EBT00001603961.
DR   EnsemblGenomes-Tr; EBT00001603962.
DR   EnsemblGenomes-Tr; EBT00001603963.
DR   EnsemblGenomes-Tr; EBT00001603964.
DR   EnsemblGenomes-Tr; EBT00001603965.
DR   EnsemblGenomes-Tr; EBT00001603966.
DR   EnsemblGenomes-Tr; EBT00001603967.
DR   EnsemblGenomes-Tr; EBT00001603968.
DR   EnsemblGenomes-Tr; EBT00001603969.
DR   EnsemblGenomes-Tr; EBT00001603970.
DR   EnsemblGenomes-Tr; EBT00001603971.
DR   EnsemblGenomes-Tr; EBT00001603972.
DR   EnsemblGenomes-Tr; EBT00001603973.
DR   EnsemblGenomes-Tr; EBT00001603974.
DR   EnsemblGenomes-Tr; EBT00001603975.
DR   EnsemblGenomes-Tr; EBT00001603976.
DR   EnsemblGenomes-Tr; EBT00001603977.
DR   EnsemblGenomes-Tr; EBT00001603978.
DR   EnsemblGenomes-Tr; EBT00001603979.
DR   EnsemblGenomes-Tr; EBT00001603980.
DR   EnsemblGenomes-Tr; EBT00001603981.
DR   EnsemblGenomes-Tr; EBT00001603982.
DR   EnsemblGenomes-Tr; EBT00001603983.
DR   EnsemblGenomes-Tr; EBT00001603984.
DR   EnsemblGenomes-Tr; EBT00001603985.
DR   EnsemblGenomes-Tr; EBT00001603986.
DR   EnsemblGenomes-Tr; EBT00001603987.
DR   EnsemblGenomes-Tr; EBT00001603988.
DR   EnsemblGenomes-Tr; EBT00001603989.
DR   EnsemblGenomes-Tr; EBT00001603990.
DR   EnsemblGenomes-Tr; EBT00001603991.
DR   EnsemblGenomes-Tr; EBT00001603992.
DR   EnsemblGenomes-Tr; EBT00001603993.
DR   EnsemblGenomes-Tr; EBT00001603994.
DR   EnsemblGenomes-Tr; EBT00001603995.
DR   EnsemblGenomes-Tr; EBT00001603996.
DR   EnsemblGenomes-Tr; EBT00001603997.
DR   EnsemblGenomes-Tr; EBT00001603998.
DR   EnsemblGenomes-Tr; EBT00001603999.
DR   EnsemblGenomes-Tr; EBT00001604000.
DR   EnsemblGenomes-Tr; EBT00001604001.
DR   EnsemblGenomes-Tr; EBT00001604002.
DR   EnsemblGenomes-Tr; EBT00001604003.
DR   EnsemblGenomes-Tr; EBT00001604004.
DR   EnsemblGenomes-Tr; PSHAa2107.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s1-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s2-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s3-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s4-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s5-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s6-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s7-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s8-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA16s9-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s1-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s2-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s3-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s4-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s5-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s6-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s7-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s8-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA23s9-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s1-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s10-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s2-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s3-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s4-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s5-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s6-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s7-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s8-1.
DR   EnsemblGenomes-Tr; PSHAa_rRNA5s9-1.
DR   EnsemblGenomes-Tr; PSHAatRNA1-1.
DR   EnsemblGenomes-Tr; PSHAatRNA10-1.
DR   EnsemblGenomes-Tr; PSHAatRNA100-1.
DR   EnsemblGenomes-Tr; PSHAatRNA101-1.
DR   EnsemblGenomes-Tr; PSHAatRNA102-1.
DR   EnsemblGenomes-Tr; PSHAatRNA103-1.
DR   EnsemblGenomes-Tr; PSHAatRNA104-1.
DR   EnsemblGenomes-Tr; PSHAatRNA105-1.
DR   EnsemblGenomes-Tr; PSHAatRNA106-1.
DR   EnsemblGenomes-Tr; PSHAatRNA11-1.
DR   EnsemblGenomes-Tr; PSHAatRNA12-1.
DR   EnsemblGenomes-Tr; PSHAatRNA13-1.
DR   EnsemblGenomes-Tr; PSHAatRNA14-1.
DR   EnsemblGenomes-Tr; PSHAatRNA15-1.
DR   EnsemblGenomes-Tr; PSHAatRNA16-1.
DR   EnsemblGenomes-Tr; PSHAatRNA17-1.
DR   EnsemblGenomes-Tr; PSHAatRNA18-1.
DR   EnsemblGenomes-Tr; PSHAatRNA19-1.
DR   EnsemblGenomes-Tr; PSHAatRNA2-1.
DR   EnsemblGenomes-Tr; PSHAatRNA20-1.
DR   EnsemblGenomes-Tr; PSHAatRNA21-1.
DR   EnsemblGenomes-Tr; PSHAatRNA22-1.
DR   EnsemblGenomes-Tr; PSHAatRNA23-1.
DR   EnsemblGenomes-Tr; PSHAatRNA24-1.
DR   EnsemblGenomes-Tr; PSHAatRNA25-1.
DR   EnsemblGenomes-Tr; PSHAatRNA26-1.
DR   EnsemblGenomes-Tr; PSHAatRNA27-1.
DR   EnsemblGenomes-Tr; PSHAatRNA28-1.
DR   EnsemblGenomes-Tr; PSHAatRNA29-1.
DR   EnsemblGenomes-Tr; PSHAatRNA3-1.
DR   EnsemblGenomes-Tr; PSHAatRNA30-1.
DR   EnsemblGenomes-Tr; PSHAatRNA31-1.
DR   EnsemblGenomes-Tr; PSHAatRNA32-1.
DR   EnsemblGenomes-Tr; PSHAatRNA33-1.
DR   EnsemblGenomes-Tr; PSHAatRNA34-1.
DR   EnsemblGenomes-Tr; PSHAatRNA35-1.
DR   EnsemblGenomes-Tr; PSHAatRNA36-1.
DR   EnsemblGenomes-Tr; PSHAatRNA37-1.
DR   EnsemblGenomes-Tr; PSHAatRNA38-1.
DR   EnsemblGenomes-Tr; PSHAatRNA39-1.
DR   EnsemblGenomes-Tr; PSHAatRNA4-1.
DR   EnsemblGenomes-Tr; PSHAatRNA40-1.
DR   EnsemblGenomes-Tr; PSHAatRNA41-1.
DR   EnsemblGenomes-Tr; PSHAatRNA42-1.
DR   EnsemblGenomes-Tr; PSHAatRNA43-1.
DR   EnsemblGenomes-Tr; PSHAatRNA44-1.
DR   EnsemblGenomes-Tr; PSHAatRNA45-1.
DR   EnsemblGenomes-Tr; PSHAatRNA46-1.
DR   EnsemblGenomes-Tr; PSHAatRNA47-1.
DR   EnsemblGenomes-Tr; PSHAatRNA48-1.
DR   EnsemblGenomes-Tr; PSHAatRNA49-1.
DR   EnsemblGenomes-Tr; PSHAatRNA5-1.
DR   EnsemblGenomes-Tr; PSHAatRNA50-1.
DR   EnsemblGenomes-Tr; PSHAatRNA51-1.
DR   EnsemblGenomes-Tr; PSHAatRNA52-1.
DR   EnsemblGenomes-Tr; PSHAatRNA53-1.
DR   EnsemblGenomes-Tr; PSHAatRNA54-1.
DR   EnsemblGenomes-Tr; PSHAatRNA55-1.
DR   EnsemblGenomes-Tr; PSHAatRNA56-1.
DR   EnsemblGenomes-Tr; PSHAatRNA57-1.
DR   EnsemblGenomes-Tr; PSHAatRNA58-1.
DR   EnsemblGenomes-Tr; PSHAatRNA59-1.
DR   EnsemblGenomes-Tr; PSHAatRNA6-1.
DR   EnsemblGenomes-Tr; PSHAatRNA60-1.
DR   EnsemblGenomes-Tr; PSHAatRNA61-1.
DR   EnsemblGenomes-Tr; PSHAatRNA62-1.
DR   EnsemblGenomes-Tr; PSHAatRNA63-1.
DR   EnsemblGenomes-Tr; PSHAatRNA64-1.
DR   EnsemblGenomes-Tr; PSHAatRNA65-1.
DR   EnsemblGenomes-Tr; PSHAatRNA66-1.
DR   EnsemblGenomes-Tr; PSHAatRNA67-1.
DR   EnsemblGenomes-Tr; PSHAatRNA68-1.
DR   EnsemblGenomes-Tr; PSHAatRNA69-1.
DR   EnsemblGenomes-Tr; PSHAatRNA7-1.
DR   EnsemblGenomes-Tr; PSHAatRNA70-1.
DR   EnsemblGenomes-Tr; PSHAatRNA71-1.
DR   EnsemblGenomes-Tr; PSHAatRNA72-1.
DR   EnsemblGenomes-Tr; PSHAatRNA73-1.
DR   EnsemblGenomes-Tr; PSHAatRNA74-1.
DR   EnsemblGenomes-Tr; PSHAatRNA75-1.
DR   EnsemblGenomes-Tr; PSHAatRNA76-1.
DR   EnsemblGenomes-Tr; PSHAatRNA77-1.
DR   EnsemblGenomes-Tr; PSHAatRNA78-1.
DR   EnsemblGenomes-Tr; PSHAatRNA79-1.
DR   EnsemblGenomes-Tr; PSHAatRNA8-1.
DR   EnsemblGenomes-Tr; PSHAatRNA80-1.
DR   EnsemblGenomes-Tr; PSHAatRNA81-1.
DR   EnsemblGenomes-Tr; PSHAatRNA82-1.
DR   EnsemblGenomes-Tr; PSHAatRNA83-1.
DR   EnsemblGenomes-Tr; PSHAatRNA84-1.
DR   EnsemblGenomes-Tr; PSHAatRNA85-1.
DR   EnsemblGenomes-Tr; PSHAatRNA86-1.
DR   EnsemblGenomes-Tr; PSHAatRNA87-1.
DR   EnsemblGenomes-Tr; PSHAatRNA88-1.
DR   EnsemblGenomes-Tr; PSHAatRNA89-1.
DR   EnsemblGenomes-Tr; PSHAatRNA9-1.
DR   EnsemblGenomes-Tr; PSHAatRNA90-1.
DR   EnsemblGenomes-Tr; PSHAatRNA91-1.
DR   EnsemblGenomes-Tr; PSHAatRNA92-1.
DR   EnsemblGenomes-Tr; PSHAatRNA93-1.
DR   EnsemblGenomes-Tr; PSHAatRNA94-1.
DR   EnsemblGenomes-Tr; PSHAatRNA95-1.
DR   EnsemblGenomes-Tr; PSHAatRNA96-1.
DR   EnsemblGenomes-Tr; PSHAatRNA97-1.
DR   EnsemblGenomes-Tr; PSHAatRNA98-1.
DR   EnsemblGenomes-Tr; PSHAatRNA99-1.
DR   EuropePMC; PMC1240074; 16169927.
DR   EuropePMC; PMC3719548; 23708132.
DR   EuropePMC; PMC5322152; 28280714.
DR   EuropePMC; PMC6040283; 30050926.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CR954246.
DR   SILVA-SSU; CR954246.
DR   StrainInfo; 764141; 0.
XX
CC   Annotation data relative to COG assignations, enzymatic function
CC   prediction (PRIAM software), TMHMM and SignalP predictions, and synteny
CC   results (Syntonizer software) are available in Psychroscope database via
CC   MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage/psychroscope.
CC   Each annotation includes a confidence level as follow:
CC   1 : Function experimentally demonstrated in the studied organism
CC   2a : Function of homologous gene experimentally demonstrated in an other
CC   organism
CC   2b : Function of strongly homologous gene
CC   3 : Function proposed based on presence of conserved amino acid motif,
CC   structural feature or limited homology
CC   4 : Homologs of previously reported genes of unknown function
CC   5 : No homology to any previously reported sequences
CC   6 : Doubtful CDS
CC   7 : Gene remnant
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3214944
FT                   /organism="Pseudoalteromonas haloplanktis TAC125"
FT                   /chromosome="I"
FT                   /strain="TAC125"
FT                   /mol_type="genomic DNA"
FT                   /note="Genoscope sequence ID : PSHAa"
FT                   /db_xref="taxon:326442"
FT   gene            118..1542
FT                   /gene="dnaA"
FT                   /locus_tag="PSHAa0001"
FT   CDS_pept        118..1542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PSHAa0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and other genes;
FT                   binds DNA at DnaA boxes, binds cardiolipin and other acidic
FT                   phospholipids, binds ATP"
FT                   /function="3.1.1 : DNA replication"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12742018, 12864864, 12941279, 14523560; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85115"
FT                   /db_xref="GOA:Q3IDF0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF0"
FT                   /protein_id="CAI85115.1"
FT                   /translation="MMCGNKNYISGSLTVYLSVWQSCLYVLQDELPSQQFSMWVRPLQA
FT                   ESTEDTLTIYAPNRFVLDWVREKYLNRINELLVEICGVEAPELRFDVGSKPLLNAQPVS
FT                   VAGTQSAPTTQAKQQSRQPKPVVEPAPKSEYKSNIKENYTFDSFVEGKSNQLAKAAATQ
FT                   VADNPGAAFNPVFIYGGTGLGKTHLLHAVGNGILANKPDAKIVYMHSERFVQDMVKALQ
FT                   NNAIEEFKRYYRSVDALMIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKE
FT                   IEGVEDRLKSRFGWGLTIAIEPPELETRVAILMKKAQQSKINLPHEVAFFIAKKLRSNV
FT                   RELEGALNRVIANANFTGRPISIDFVKEALRDLLALQDKLVTIDNIQRTVAEYYRIRIS
FT                   DLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKVKSLRDES
FT                   HEIKEDYQNLIRTLSS"
FT   gene            1556..2659
FT                   /gene="dnaN"
FT                   /locus_tag="PSHAa0002"
FT   CDS_pept        1556..2659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PSHAa0002"
FT                   /product="DNA polymerase III, beta-subunit; processivity
FT                   clamp of DNA polymerase III"
FT                   /function="3.1.1 : DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12028381, 12100549, 12511510; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85116"
FT                   /db_xref="GOA:Q3IDE9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE9"
FT                   /protein_id="CAI85116.1"
FT                   /translation="MQITISRQQFLKPLVQVSGAIERKHTLPILSNVLLAVENGQLSMT
FT                   GTDLEIELVASVFVGDDIADTKLTLPAKKLLDICKSLPDGSDLTLSLQEHQLLLTSGKS
FT                   RFSLTTLAAEDFPNLEQWDGEVEFQLTRLELRKLLESTHFSMANQDVRYYLNGMSFEVD
FT                   NTDIKTVATDGHRLAIAQKQLKQSLNTQRQLIIPRKGVQEIMRLMVADEELVTIQFGAN
FT                   HIRIIDIEFTFTSKLVDGRFPDYRRVLPRGGDKVITANREWLRSAFQRVSILSNEKFRG
FT                   VRLNLSNGLLKITANNPEQEQAEEVVEVGYEGADLEIGFNVSYVLDVLNTLKTEDVLFT
FT                   LADSNSSALIEGAGDEEAMYVVMPMRL"
FT   gene            2675..3769
FT                   /gene="recF"
FT                   /locus_tag="PSHAa0003"
FT   CDS_pept        2675..3769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PSHAa0003"
FT                   /product="gap repair protein with nucleoside triP hydrolase
FT                   domain, part of RecFOR complex that targets RecA to
FT                   ssDNA-dsDNA junction"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10585965, 12718760, 12769856; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85117"
FT                   /db_xref="GOA:Q3IDE8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDE8"
FT                   /protein_id="CAI85117.1"
FT                   /translation="MSLSHLSLKYFRNIEALTLEPVNGVNIIYGENGSGKTSLLEAIYY
FT                   LSHGKSFRTSKHKSIIAHQQEQFVIHGRKAIHDLSIPIGISKTQAGETNLKIQGKASRK
FT                   ISELAQLMPVQIITPESYSLFFGGPKERRKFLDLGLFHVEHEFFFLWQSFNKVLKQRNA
FT                   LLKSKPKNYFDQIKFWDKEFVRLAEQINKLRMAYISRFKQQFFDKMCAELTLIRDLEIS
FT                   FNAGWKESESLSDALELNFERDARQGFTSKGPHKADFSFSVAGSSVENIFSRGQLKLLL
FT                   YALKVTQNSLIESETDKQSILLIDDLPSELSEDTKEKVGQLLAHCSSQIFISSILSESI
FT                   SAVVEPMQRELQMFHVKHGNLITR"
FT   gene            3782..6208
FT                   /gene="gyrB"
FT                   /locus_tag="PSHAa0004"
FT   CDS_pept        3782..6208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PSHAa0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /function="3.2.1.1 : Regulation"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8982450, 11125132; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85118"
FT                   /db_xref="GOA:Q3IDE7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE7"
FT                   /protein_id="CAI85118.1"
FT                   /translation="MSENYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NSIDEALAGHCDDIFVTIHLDGSVSVRDNGRGIPTSIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLKLTIRREGKLHEQTYSHGVPDAPLAVIGDADTT
FT                   GTELRFWPSDQTFTNLDFHYDILAKRLRELSFLNSGVSIILNDEREENKSDHFKYEGGI
FT                   RAFVEYLNRNKTPIHKGVFHFTHTREEDGIVVEVSMQWNDAYQENIYCFTNNIPQRDGG
FT                   THLAGFRSALTRTLNNYMEKEGFNKKAKTTSNATGDDAREGLTAVVSVKVPDPKFSSQT
FT                   KDKLVSSEVKSAVEQAMAEKFTEFLLEHPTDAKIVVGKIIDASRAREAARKAREMTRRK
FT                   GAMDLAGLPGKLADCQEKDPAQSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVE
FT                   KARFDKMLSSQEVATLITALGCGIGRDEYNPEKLRYHRIIIMTDADVDGSHIRTLLLTF
FT                   FYRQMPEIVERGYIYIAQPPLYKVKKGKQERYIKDDPALVEYLTTLALNNATLYTSTDA
FT                   SGIEGEALEKIVHDYQNTVKVIERLKRKFPNTVMNRLIYQSELKKEDLSDEAKVIAWTK
FT                   ELVDDLIDRDEDATIFQAATEHDTERNLYYPVVKIRQHGVDKAHVLHYDFIASRDYQRI
FT                   AVTGVNIANIITEGAYIQRGEKTQPVDNFVDALEWLIAESKRGLYIQRYKGLGEMNPSQ
FT                   LWETTMDPDARRMLQVTVEDAVAADQLFATLMGDQVEPRREFIEQNALRVVNLDV"
FT   gene            6349..7251
FT                   /gene="glyQ"
FT                   /locus_tag="PSHAa0005"
FT   CDS_pept        6349..7251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PSHAa0005"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7556056, 12572618; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85119"
FT                   /db_xref="GOA:Q3IDE6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDE6"
FT                   /protein_id="CAI85119.1"
FT                   /translation="MQKYDVKTFQGLILALQDYWAQQGCVIIQPLDMEVGAGTFHPQTF
FT                   LKSIGPEPMSSAYVQPCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLAA
FT                   VGIDTLTDEVRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGEI
FT                   TYGLERLAMYIQGVDSIYDLVWADGPLGRVTYGDVFHQNEVEQSTYNFEHANVEDLFAQ
FT                   FDKCEAESQKLIEANLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKAC
FT                   AQSYYDKREALGFPLCKDK"
FT   gene            7254..9323
FT                   /gene="glyS"
FT                   /locus_tag="PSHAa0006"
FT   CDS_pept        7254..9323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PSHAa0006"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6374618, 7556056, 8944770; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85120"
FT                   /db_xref="GOA:Q3IJ28"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ28"
FT                   /protein_id="CAI85120.1"
FT                   /translation="MSAQNLLVEIGTEELPPKALRKLAEAFAANLTAELETLELAHQGV
FT                   SWYASPRRLGLRVIALDAKQQDKEVEKRGPAIKAAFDADGNPTKAAMGWARGCGIEVKD
FT                   AQTLETDKGAWLLHLAKVAGQETKTLMVDVINKALAKLPIPKPMRWGANKTQFIRPVHT
FT                   VTILLGDELVTGEVLGKQVSNQLQGHRFHHPEKITINHADDIFDVLKSAYVIADYEQRK
FT                   AQIRAQIEAAAKAINAVVAMDEDLLEEVTSLVEWPVTLTATFEEEFLAVPAEALIYTMK
FT                   DDQKYFPLLDQNGKLLNKFLFVSNIESKDPSVVISGNEKVVRPRLADAQFFFESDKKKT
FT                   LESRLESLDSVLFQKQLGTLKDKSARISELAGYIAQQLGADKELAQRAGLLSKTDLMTE
FT                   MVMEFTDIQGVMGMHYARFDGEAEDVALAQNEQYMPRFAGDSLPTNLISCAVAIADKFD
FT                   TLVGIFGIGQAPKGDKDPFALRRAAIGALRIMVEKELPLDILDLVAKSQTLFGDKLTNL
FT                   NVSTDVFEFMLGRFRAWYQDEGIEVDVIQAVLARRPTKPVDFDRRVKAVSHFRTLDAAE
FT                   ALAAANKRVSNILAKNDITSEGNVDESLLTDDAEKVLAAQVAKFATELAPLYASGNYQE
FT                   ALSQLAGIRQSVDSFFDNVMVMADDEAVKQNRLALLSQLSGLFLGIADISVLQK"
FT   gene            9419..9871
FT                   /locus_tag="PSHAa0007"
FT   CDS_pept        9419..9871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0007"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85121"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ27"
FT                   /protein_id="CAI85121.1"
FT                   /translation="MKSPIKRILTLALVSFLTACSTQITLDDVLPQQKLDRTVYLRGDF
FT                   TLWDAEPQYQFTQVARSLYQAEVKFSTPGKVYEFKIADADFSEGYNCGYSDTQPAGQKL
FT                   TLGQPAVADCNTIYNYFSYTPAIKGTYIVSIDYSNYDKPQVTITKK"
FT   gene            9961..10914
FT                   /locus_tag="PSHAa0008"
FT   CDS_pept        9961..10914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0008"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ26"
FT                   /protein_id="CAI85122.1"
FT                   /translation="MNNYIEYCYLENDKPSYERIKLTESDLSECINKYRVFSRKLEIEN
FT                   LFDVLIEEFKTFKSLLTMAQLSQEFSHFSEVHAYIENQKARTKLNISYLSILNTGKLVL
FT                   DRLYNKRDNFSIINDIDQSLLPELLIERERIFKENQYYVLCCNLRNLCQHKMLPVNRLT
FT                   LKYPSKSTYGNGVITKFQIPLVLSAMEEAERIKLLRGLNSAFIDELLKSDLVDLNRAID
FT                   GYFEGIFDLMIKLRTLVNKSVTETEDYFSKLLDQNINLNMKRLLGPPALVVNNEKEFHL
FT                   DFEWFRVAHYLEEKNNLYFKSANLIRTQYIEAPSST"
FT   gene            complement(10927..11166)
FT                   /gene="sirA"
FT                   /locus_tag="PSHAa0009"
FT   CDS_pept        complement(10927..11166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="PSHAa0009"
FT                   /product="small ubiquitous RNA-binding protein"
FT                   /function="3.2.1.1.2 : Regulatory proteins (RNA
FT                   interaction)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11080457, 11244064; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85123"
FT                   /db_xref="GOA:Q3IJ25"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ25"
FT                   /protein_id="CAI85123.1"
FT                   /translation="MSFNNPDHQLDAIGLRCPEPVMMVRAAIRKMNDGETLLIIADDPS
FT                   TTRDIPSFCTFMDHTLVAKDAEQAPYRYVVKKGL"
FT   gene            complement(11474..12643)
FT                   /gene="fadA"
FT                   /locus_tag="PSHAa0010"
FT   CDS_pept        complement(11474..12643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="PSHAa0010"
FT                   /product="3-ketoacyl-CoA thiolase; (thiolase I, acetyl-CoA
FT                   transferase), in complex with FadB catalyzes EC 2.3.1.16"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="2.3.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8446033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85124"
FT                   /db_xref="GOA:Q3IJ24"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ24"
FT                   /protein_id="CAI85124.1"
FT                   /translation="MNNPVIVDCIRTPMGRSKGGVFKNKRAEDLSAHLMKGLLDRNPAV
FT                   DPASIDDIYWGCVQQTLEQGFNVARNAALLAGIPHSVPAVTVNRLCGSSMQALHDAARA
FT                   IMTGAGDTYLIGGVEHMGHVPMTHGNDFHPGLATSIAQAAGSMGLTAEYLATLHGISRE
FT                   QQDEFAYRSHQRAQAATVEGRFRREILAMEGHAADGSLILVEDDEVIRPETTVEGLSKL
FT                   RPVFNPASGTVTAGTSSALSDGASAMLVMSEAKAKELGLPIRARIKAMAVAGCDPSIMG
FT                   YGPVPASKKALAQAGITIDDLGVVELNEAFAAQSLPVMKDLGLMDVVDEKVNLNGGAIA
FT                   LGHPLGCSGSRISTSLIHLMEDKNVRYGLATMCIGLGQGIATVFERVQD"
FT   gene            complement(12648..14807)
FT                   /gene="fadB"
FT                   /locus_tag="PSHAa0011"
FT   CDS_pept        complement(12648..14807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="PSHAa0011"
FT                   /product="multifunctional 3-hydroxybutyryl-CoA epimerase,
FT                   delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase, enoyl-CoA
FT                   hydratase (N-terminal); 3-hydroxyacyl-CoA dehydrogenase
FT                   (C-terminal)"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8446033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85125"
FT                   /db_xref="GOA:Q3IJ23"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ23"
FT                   /protein_id="CAI85125.1"
FT                   /translation="MLYKSDSFEVSFIKENIAEFKFCATASVNTLSQQTLSDCATALKQ
FT                   LAANTDIKGMIFTSDKEHFIIGADVFEFLPIFTRSEAELVTWIKEATDVFDAIEDLPFP
FT                   TLSAVNGLALGGGCEWVLATDYRVASETAQMGLPEVTLGIMPGFGGTVRLPRIIGADNA
FT                   MMWITSGSTNRAADALKVGAFDAVVSADKLIESSVSTLELAIAGKLDWQAKRNVKLQPL
FT                   KLNRVEQGMSFAMAEGMVMAKTKGHYPAPVMAVKTIKAAANCTRDEAMAIENANFAKLA
FT                   GTPEVAAQIGIFLADQYIKGKSRKLAKQSDVEIKQAAVLGAGIMGGGIAYQSAYKGTPI
FT                   IMKDIQQDALDLGMGEASKLLGQKVKRGHMSMEKMLGTLSKIKPTLNDSDLQSADIIVE
FT                   AVVENPKVKQAVLAELEKTMPEGTVLTSNTSTICIDLLAEALDKPENFCGMHFFNPVPK
FT                   MPLVEIIRGAKTSDKTINAVVDYALKLGKSPIVVNDCPGFFVNRVLFPYFAGFSKLVVE
FT                   GANFAKVDKVMENVFGWPMGPAYLLDVVGIDTAFHCTGVMADGFPERMARADKDPVTIF
FT                   ANEKRFGQKNKAGFYKYETDRRGRLKKSHDETAIELLKPITEAEKAFDKQEIIDRCMIP
FT                   MLNEVLLCLQEGIVASPQEADMALVYGVGFPPFRGGAFRYLDQTGLANFVATADKYAHL
FT                   GAIYQVSEQTRQWAEEGRVFYKVEG"
FT   gene            15000..16886
FT                   /gene="slt"
FT                   /locus_tag="PSHAa0012"
FT   CDS_pept        15000..16886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="PSHAa0012"
FT                   /product="secreted lytic murein transglycosylase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8765311; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85126"
FT                   /db_xref="GOA:Q3IJ22"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ22"
FT                   /protein_id="CAI85126.1"
FT                   /translation="MKKYLLNAMAAVFIFPLHCVEANIDNDAFLDAEKKVRYGDYQDFK
FT                   MAISNLDHPLKPYVEKVYWQRHPDIKHQAEIEDYLTIYQHTPLEWPVRKAWLSYLEKHN
FT                   KKAAYIRNYRKTSDTELTCTYLDYQLDLGAPEKAIFNQVTDLWTVGKSQPKACDGLFSL
FT                   WRKKGYMSKEAVWQRVTMAAEGGTQSLLPYLKTLLPSNEGYLADLYLKVRRDPSAAAGL
FT                   YRYKNKSVKEGQIALYGVKRLIWRDKELALKAWEKLEQIFTYSDAAKADVYYTFALSLA
FT                   SSGHKQASFWLNKVPKDRQDSKLIQWQLGNMLKTQDWEGIAAFFTGKDNLSLGQQYWLA
FT                   YSYAKRGEQQKADAIWKTVAANRDYYGFLAAARLGLPVDLNNQPLVVDQALVNKVKNAP
FT                   GYKRAKAFYELERFTSARREWNYLTNTSSDEEKLAASILSTELGWHDSTIFTLAKIKAW
FT                   DNVEQRFPFAFQDVFERYSKRSKIDVAWSIAIARRESSFAPDARSSANARGLMQLLPST
FT                   ADYVNKGSVSSRRLYQPQTNIRLGTRYLQYLKKKNHGNEILATASYNAGYHRIKRWLPD
FT                   EAIPAELWIELIPYRETRDYVKNVFAYRQVYHTRLHREGNILAPLLEMKMGG"
FT   gene            17005..18327
FT                   /gene="pepQ"
FT                   /locus_tag="PSHAa0013"
FT   CDS_pept        17005..18327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="PSHAa0013"
FT                   /product="Xaa-Pro proline dipeptidase"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.13.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6336737, 372108; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85127"
FT                   /db_xref="GOA:Q3IJ21"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ21"
FT                   /protein_id="CAI85127.1"
FT                   /translation="MDKLAVLYAEHIATLQQRTRTICEREGLEGLVIHSGQAKRQFLDD
FT                   MYYPFKVNPHFKAWLPVLDNPHCWIVVNGSDKPKLIFYRPVDFWHKVPDEPRDFWAEYF
FT                   DIELLLQPDQVEKLLPYDKANYAYVGEYLEVAQALGFSVMNPEPVLNYFHYHRAYKTQY
FT                   ELECLRNANRIAVDGHKAARDTFFNGGSEFDIQQAYLMATRQSENEMPYGNIVALNENC
FT                   AILHYTHFEAKAPQQHNSFLIDAGANFNGYAADITRTYDFKKQGEFAELVQAMTAAQIE
FT                   LGTGLKPGMLYGDLHVECHNRVAQILSDFDIVKLPAEEIVERKITSTFFPHGLGHHLGL
FT                   QVHDMGGFMADEMGAQQAAPEGHPFLRCTRIIEKNQVFTIEPGLYFIDSLLGDLAQTDN
FT                   KQFINWQKVESFKPYGGIRIEDNIIVHEDSLENMTRNLALD"
FT   gene            18379..19020
FT                   /locus_tag="PSHAa0014"
FT   CDS_pept        18379..19020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0014"
FT                   /product="conserved protein of unknown function, putative
FT                   GTP-binding domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85128"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ20"
FT                   /protein_id="CAI85128.1"
FT                   /translation="MVYNLVHQRMSEYKYPAADVFHQEEIKKSTFIVHIAHTPDLSSAK
FT                   AFIKSIETKYADARHNCWAHVAGKPGGSHVYGFSDDGEPNGTAGKPMLNVLMGSGLGEV
FT                   TAVVTRYFGGIKLGTGGLVRAYGGTLNNALANLSTINKVPSIELIGSSEYSMQGVIEQL
FT                   LKTKYQVLNIDKQFTANIEWVITIDSRQATQAIKDIFDLSHGAVELTIKE"
FT   gene            19070..20521
FT                   /gene="trkH"
FT                   /locus_tag="PSHAa0015"
FT   CDS_pept        19070..20521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="PSHAa0015"
FT                   /product="potassium transport protein, requires TrkE (Trk
FT                   family)"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85129"
FT                   /db_xref="GOA:Q3IJ19"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ19"
FT                   /protein_id="CAI85129.1"
FT                   /translation="MQFRTIIKILGQLVALFSITMVPPAIVSLIYKDGGGVPFVLAFIF
FT                   SVTIGLMAYYPNRHEDGDLKAREGFLIVVLFWLVLGAFASLPLIFLQEPNLSLADAVFE
FT                   AFSGLTTTGATVLTGIEYLPKSVLFYRQQLQWFGGMGIIVLAVAILPMLGVGGMQLYRA
FT                   EIPGPVKDSKMTPRIADTAKHLWYIYVSITLACTLAYWIAGMDWFDAISHAFSTVAIGG
FT                   FSTYDASMGHFDSPVINFICVFFLIIAAINFSLHYAAVASRNISVYIRDPEFKVFLCIQ
FT                   LALVVICFTVLSSHEVYANGDETLDQALFHAVSISSTAGFATDNFSAWPLFLPILLIFS
FT                   SFIGGCAGSTGGGMKVVRVFLLYLQGVRELNRLVHPRAIYSIKLGSKALPDKVVEAVWG
FT                   FFSAYALVFIIIMLALMGTGMDNITAFSATAACLNNLGPGLGDVASHYGSISDGAKWLL
FT                   TIAMVFGRLEIFTLLVLFTPTFWRG"
FT   gene            20561..21232
FT                   /locus_tag="PSHAa0016"
FT   CDS_pept        20561..21232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0016"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85130"
FT                   /db_xref="GOA:Q3IDH6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH6"
FT                   /protein_id="CAI85130.1"
FT                   /translation="MPTTNLEKLHQIMSGAMVDLEILTPTASKRVKTEFIGLLENRFII
FT                   LNYPSSKRLPTASDYLHDGVMVVVRALIEGSGGQVIAFRQQIMSVASHPARLLFINYPK
FT                   QVQLFDLRSQTRIPTLLSAKLKLSDDRILDGVIKDISLTGVKFDLKDKTQAENIKGMQC
FT                   SIILDSSNKQVKDFQGEICSVKEHVQGAYCGIKLLASEEEMKSFMGDHFIDPSILQSET
FT                   E"
FT   gene            21700..21912
FT                   /locus_tag="PSHAa0017"
FT   CDS_pept        21700..21912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0017"
FT                   /product="putative secreted calmodulin-like protein"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85131"
FT                   /db_xref="GOA:Q3IDH5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH5"
FT                   /protein_id="CAI85131.1"
FT                   /translation="MKTLNKTLALIALASSSAAFAASDFDALDVDGNGAISQSEAAVDA
FT                   ELMSIFSELDTDQNGELSKEEFSKA"
FT   gene            22062..22274
FT                   /locus_tag="PSHAa0018"
FT   CDS_pept        22062..22274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0018"
FT                   /product="putative secreted calmodulin-like protein"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85132"
FT                   /db_xref="GOA:Q3IDH4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH4"
FT                   /protein_id="CAI85132.1"
FT                   /translation="MKQLNKALALIALASSSAAFAASDFDTLDVDGNGAISQSEASVDS
FT                   DLIAQFAELDTDGNGELSKAEFANY"
FT   gene            22343..22555
FT                   /locus_tag="PSHAa0019"
FT   CDS_pept        22343..22555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0019"
FT                   /product="putative secreted calmodulin-like protein"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85133"
FT                   /db_xref="GOA:Q3IDH3"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH3"
FT                   /protein_id="CAI85133.1"
FT                   /translation="MKVLNTSLAILVLASSAAYAAVDFASFDTNGDGVISQQEAAANTQ
FT                   LVKIFDQLDTDGNGELSKEEFAKVQ"
FT   gene            complement(22631..24007)
FT                   /gene="trkA"
FT                   /locus_tag="PSHAa0020"
FT   CDS_pept        complement(22631..24007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PSHAa0020"
FT                   /product="Trk system; major constitutive K+ transport
FT                   system; potassium transport inner membrane protein subunit;
FT                   six transmembrane channel"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10214935, 10490030, 11301020; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85134"
FT                   /db_xref="GOA:Q3IDH2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH2"
FT                   /protein_id="CAI85134.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGEQNEITVVDIDGNRLRELQDKYDL
FT                   QGVAGHGAHPDVLRRAGAEDADMIIAVTSSDEVNMVACQVAYSIFNTPTKIARIRSEQY
FT                   LKYREKLFHNDDLPVDHYIAPEALVTKYIRRLIDYPGALQVLQFADGMLSLVAVKAYYG
FT                   GLLVGYALSTLKQHIPNVETRVAAIYRQGKAIKPLGTTIIEADDEVFFIAATKHIRAVM
FT                   NELQRLERSYKNIMIAGGGNIGAGLARSLEKNHSVKLIERSKERAEQLSEMLDNTIVFC
FT                   GDASDQELLSEEHIDQVDVFIAVTNDDEVNIMSAMLAKRMGAQKTMVLIQRSAYVDLVQ
FT                   GGDIDIAISPQEATISALLTHVRRGDIVNVYSLRKGAAEAIEAVAHGDENTSKVVGRTV
FT                   RDIKLPAGTTIGAVVRNDDVLIAHDDTIIMSGDHVIMFLIDKKHINIVEKLFQVSAIFL
FT                   "
FT   gene            complement(24095..25390)
FT                   /gene="rsmB"
FT                   /locus_tag="PSHAa0021"
FT   CDS_pept        complement(24095..25390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="PSHAa0021"
FT                   /product="16S rRNA m5C967 methyltransferase,
FT                   S-adenosyl-L-methionine-dependent"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10026269; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85135"
FT                   /db_xref="GOA:Q3IDH1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH1"
FT                   /protein_id="CAI85135.1"
FT                   /translation="MSNVPNVRALAAETLYNVVDKGASLNQELPFASQGLPPKDKALLQ
FT                   QICYGVLRYLPSLENYCQHLVEEPLKGKRRIFQFLLYVGIYQLQHMRVPPHAAISETVN
FT                   ALQQLRALGLKGLINAILRSFQRQQLELEEKAKLIPVCLYNHPNWFIKQVKEAYPDSWE
FT                   DLLAENQQQAPMWLRVNQAQYSTQEYSDMLTANDIEHTLNPDFIDGIKLAKPRDVFSLP
FT                   EFDTGACSVQDAAAQLAARFLEPKDDDTILDACAAPGGKTCHILELADAEVLALDSDAT
FT                   RLERVKQNLTRIGLGADLQCGDASQPHTWWDEKQFDRILLDVPCSATGVIRRHPDIKWL
FT                   RRASDIADLAALQGDILDSIWPLLKPGGTLVYATCSVLPQENQQQVAKFLANNNDVEHI
FT                   PLHDKDTPTTPGLQLLPGESDGFYYAKLVKKI"
FT   gene            complement(25383..26348)
FT                   /gene="fmt"
FT                   /locus_tag="PSHAa0022"
FT   CDS_pept        complement(25383..26348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PSHAa0022"
FT                   /product="10-formyltetrahydrofolate:L-methionyl-tRNA(fMet)
FT                   N-formyltransferase"
FT                   /function="3.3.6.2 : Chemical modifications"
FT                   /EC_number="2.1.2.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 769821, 769822, 98518, 8112305, 8887566; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85136"
FT                   /db_xref="GOA:Q3IDI3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI3"
FT                   /protein_id="CAI85136.1"
FT                   /translation="MTQPLRIIFAGTPDFAARHLQALIQSEHQIVGVYSQPDRPAGRGK
FT                   KLKASEVKELALEHNLPVFQPQSLKTEDALNELTRLNADIMIVVAYGLILPKAILDAPR
FT                   LGCLNVHGSILPRWRGAAPIQRAIWAGDEQTGVTIMQMNEGLDTGDMLHISRCPISATE
FT                   TSASLYTKLADLGPGALIDTINNLANGKITPEPQNDAAANYAKKLSKDEANIDWSMSAA
FT                   QIERNIRAFNPWPVCFTQMGGQPVKIYQAHVVEQSSSQPDNNGRVLSSDKNGVIVGCGE
FT                   HALCITQLQPQGKKPMAINDFLNGRSDWVTPGTILGENNE"
FT   gene            complement(26385..26888)
FT                   /gene="def"
FT                   /locus_tag="PSHAa0023"
FT   CDS_pept        complement(26385..26888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PSHAa0023"
FT                   /product="N-terminal methionine peptide deformylase"
FT                   /function="3.3.6.2 : Chemical modifications"
FT                   /EC_number="3.5.1.88"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9374870; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85137"
FT                   /db_xref="GOA:Q3IDI2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI2"
FT                   /protein_id="CAI85137.1"
FT                   /translation="MATLEVLRFPDERLRTIAQEVAHVDDQVRVIIKDMLETMYDENGI
FT                   GLAATQVNIHQRIVVIDVSEERNEPLVLINPQIIKKDGTTVSEEGCLSVPNSYAKVDRA
FT                   ETVTVAALNEQGEEFVLDADELLAICIQHELDHLQGKLFIDYLSPLKRQRIRKKLEKEA
FT                   KFAE"
FT   gene            27007..28128
FT                   /locus_tag="PSHAa0024"
FT   CDS_pept        27007..28128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0024"
FT                   /product="conserved protein of unknown function ; putative
FT                   LysM domain protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85138"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI1"
FT                   /protein_id="CAI85138.1"
FT                   /translation="MKSPLIAIIVALGAAFSTYADVLKIKKDAPKQYVVKKGDTLWDIS
FT                   GVYLNEPWLWPELWQLNPQINNPHLIYPGDALALIYDAQGNPRLVINKAYRKLSPQGRI
FT                   TPKGKNAITTLPLEMIRPYITYEQAINSDDIKAKPYILGANENTKTQTLGHILYVKGDL
FT                   KLHQAYAIYHKGKPYLDPETGRVLANRAAYVGMARAFRKGDAANGEPASVRVESVKREI
FT                   KQGDFLLPAMEGQMLPAYFNMHRPTQAVLGYVIASPSDSREFSTMDVVVLNLGSEQQVE
FT                   VGHVLDIERQSPSVIDGPRGPRYTEDSSRFEKLISNANEFFGAEPDDGSTVWKMPKEKV
FT                   GELIVFKVYDNVSYALITKNQHPIRVGDIAVIH"
FT   gene            28157..29245
FT                   /gene="smf"
FT                   /locus_tag="PSHAa0025"
FT   CDS_pept        28157..29245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="PSHAa0025"
FT                   /product="conserved protein of unknown function ; Smf
FT                   protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85139"
FT                   /db_xref="GOA:Q3IDI0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI0"
FT                   /protein_id="CAI85139.1"
FT                   /translation="MDQSSGKLAHWLAFYMCKGLGIKTLLALSKNHSLESLFGLSHQQL
FT                   LQLGLSANQATNLLHTNWQQITHYEQLILHNNITVISIFDAAYPEDLKQIASAPLLLFC
FT                   KGDVSFLTSPQIAIVGSRNATPTGLEIAAEFAYQLTLAGITITSGMARGIDGAAHKGAL
FT                   AGSGKTIAVLGTGVDIYYPKQHKLLTNQVLEQGLLVSEFLPGTAANAHNFPRRNRIISG
FT                   LSLGVLIVEAEIKSGSLITVRYALEQNKEVFAVPGSIKNPLAQASHFLIKQGAKLVENV
FT                   SDILDEVSFAYQSGFLTPEQSTQTNKDSQCEVLNSIGFEVTSVDDIVRRAQWPIDKVQA
FT                   RLLDLELDDQIERVLDGYIRVC"
FT   gene            29531..30004
FT                   /gene="smg"
FT                   /locus_tag="PSHAa0026"
FT   CDS_pept        29531..30004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="PSHAa0026"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85140"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDH9"
FT                   /protein_id="CAI85140.1"
FT                   /translation="MFEVLMYLFENYIHNDAGLFIEPNELTDELLRAGFNQAEIFKALD
FT                   WLEQLAELQHSDTSPYLITDSPQTMRIFTDHECKMLDVQCRNFLMFVERIGVTNGITRE
FT                   MVMDRLAALDKSFIGLDDLKWVVLMVLFNIPGAEVACEQMEDLIFDQPGDLLH"
FT   gene            30253..30828
FT                   /locus_tag="PSHAa0027"
FT   CDS_pept        30253..30828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0027"
FT                   /product="putative DNA topoisomerase; C4 zinc finger domain
FT                   protein"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85141"
FT                   /db_xref="GOA:Q3IDH8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH8"
FT                   /protein_id="CAI85141.1"
FT                   /translation="MSKIDHSLFSANKHALEKEYEICPQCGSELVIRNSKSGPFLGCAS
FT                   YPKCDFIRPLAHHDSSEIKVLEDSACPQCSKQLVVKNGRYGMFIGCTGYPECHYIANEN
FT                   EAKQNEEPLPSCPKCKKGRLVSRSNKFGKIFYSCDCYPSCKYTLNNKPVEQSCPECNWP
FT                   LLIERKMANSTVLQCPQKSCMHKLAATE"
FT   gene            30853..31416
FT                   /locus_tag="PSHAa0028"
FT   CDS_pept        30853..31416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0028"
FT                   /product="putative double-stranded RNA-binding protein with
FT                   unique protein fold, with YrdC/RibB domain"
FT                   /function="3.2.1.1.2 : Regulatory proteins (RNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85142"
FT                   /db_xref="GOA:Q3IDH7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDH7"
FT                   /protein_id="CAI85142.1"
FT                   /translation="MSDQSTIAAAITCLAQGEVILYPTEAVYGLGCDPDNQQAVERLLA
FT                   IKQRPVEKGLILIADNYGQLLKYVDDAKIPMDKRADIFSSWPNAITWVMPAAKNTPKWL
FT                   TGQYDTIAVRVTNHPTVKRLCQEFGKPLVSTSANLSGQNTVLSIAEAKSQFTEQIGYYV
FT                   DEPLGGNTQPSTIKDAMNGKVFRG"
FT   gene            31394..32368
FT                   /gene="hemF"
FT                   /locus_tag="PSHAa0029"
FT   CDS_pept        31394..32368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PSHAa0029"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="1.3.3.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8349542, 10485293, 12975365; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85143"
FT                   /db_xref="GOA:Q3IDI8"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI8"
FT                   /protein_id="CAI85143.1"
FT                   /translation="MAKYLEVNMQSKLLEQVKAYFMALQDTISQGLEAADGKAKFIEDN
FT                   WQRSEGGGGRTRVITNGNIIEQGGVNYSHVFGASMPASATAHRPELAGRSFHACGVSLV
FT                   IHPKNPHIPTSHANVRFFIAEKEGEQPIWWFGGGFDLTPFYPVLDDVVHWHQVAHDLCA
FT                   PFGDELYPKYKTWCDEYFYLKHRDETRGVGGLFFDDLNELGFEQSFAFTQAVGNGFLEA
FT                   YLPIIERRKKDEYTAQQRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPL
FT                   ARWEYNYTPNAESAEAKLYQYYLRPQQWLSTQPNDLIARECQL"
FT   gene            complement(32430..32867)
FT                   /locus_tag="PSHAa0030"
FT   CDS_pept        complement(32430..32867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0030"
FT                   /product="putative hemoglobin-like oxygen-binding protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11900532, 11796724; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85144"
FT                   /db_xref="GOA:Q3IDI7"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="PDB:4UUR"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI7"
FT                   /protein_id="CAI85144.1"
FT                   /translation="MIKRLFSKSKPATIEQTPTPEKTPYEILGGEAGALAIANRFYDIM
FT                   ATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQD
FT                   LRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH"
FT   gene            32922..33746
FT                   /gene="aroE"
FT                   /locus_tag="PSHAa0031"
FT   CDS_pept        32922..33746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PSHAa0031"
FT                   /product="5-dehydroshikimate reductase"
FT                   /function="2.2.1.1 : Aromatic amino acid family"
FT                   /EC_number="1.1.1.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85145"
FT                   /db_xref="GOA:Q3IDI6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI6"
FT                   /protein_id="CAI85145.1"
FT                   /translation="MDKYAVFGNPIKHSKSPAIHKQFAISLGEQIDYRAILAPIDNFEK
FT                   TVSNFFAQGGKGANVTMPFKEQAFAMADELTPLAKIVGAVNTLKKQADGTLLGDNTDGI
FT                   GFVSDLLANNVSITGKRILIIGAGGAARGVVLPLLDHQPQEVVIVNRTAEKAQNLAKLF
FT                   AQHGNVSGYGFNNLPENDYALIINSTSSSMNDELPALDQKHITNCEVAYDMFYSLQNTI
FT                   FMNWVAQYNSKTKLLDGSGMLVGQAAQAYYVWRNKMPAILPVVNALKQGALT"
FT   gene            33743..33997
FT                   /locus_tag="PSHAa0032"
FT   CDS_pept        33743..33997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0032"
FT                   /product="putative unknown membrane associated protein
FT                   YrdB"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85146"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI5"
FT                   /protein_id="CAI85146.1"
FT                   /translation="MNQAIQFIDRLEFREPAHQLVFFAQVNGMLVECVIAVSSLGLTDE
FT                   SHATSYFEKNRFDYEERAEQLIEDESYNSAGQIEVSLIS"
FT   gene            complement(34002..34541)
FT                   /locus_tag="PSHAa0033"
FT   CDS_pept        complement(34002..34541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0033"
FT                   /product="putative carbonic anhydrase/acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85147"
FT                   /db_xref="GOA:Q3IDI4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI4"
FT                   /protein_id="CAI85147.1"
FT                   /translation="MTIRSYKGVIPSFNASVYIDESSVLVGDITLGDDSSVWPLVAARG
FT                   DVNYIRIGERTNIQDGSVLHLSRATKSNPEGYPLIIGDDVTVGHKVMLHGCQLGNRILV
FT                   GMGAIIMDNAIVEDNVIIGGGSLVPPNKRLESGYLYVGSPVKQARALTEQELTFLKVSA
FT                   DNYVLLKNEYLSDDVI"
FT   gene            35140..36667
FT                   /locus_tag="PSHAa_rRNA16s6"
FT   rRNA            35140..36667
FT                   /locus_tag="PSHAa_rRNA16s6"
FT                   /product="16s"
FT   gene            36745..36821
FT                   /locus_tag="PSHAatRNA1"
FT   tRNA            36745..36821
FT                   /locus_tag="PSHAatRNA1"
FT                   /product="tRNA-Ile"
FT   gene            36933..37008
FT                   /locus_tag="PSHAatRNA2"
FT   tRNA            36933..37008
FT                   /locus_tag="PSHAatRNA2"
FT                   /product="tRNA-Ala"
FT   gene            37315..40203
FT                   /locus_tag="PSHAa_rRNA23s6"
FT   rRNA            37315..40203
FT                   /locus_tag="PSHAa_rRNA23s6"
FT                   /product="23s"
FT   gene            40347..40463
FT                   /locus_tag="PSHAa_rRNA5s7"
FT   rRNA            40347..40463
FT                   /locus_tag="PSHAa_rRNA5s7"
FT                   /product="5s"
FT   gene            40991..41923
FT                   /locus_tag="PSHAa0038"
FT   CDS_pept        40991..41923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0038"
FT                   /product="putative lipoprotein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85148"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ46"
FT                   /protein_id="CAI85148.1"
FT                   /translation="MSNIKAWKLLSLFCLFAVLMGCQSKEEQLQKTIQESIKKAEVELS
FT                   QLGTALDNGSLRNALLLKEYGVQLKNQQPELSKVVDVITLDATRQGALYSGLTQRLKDI
FT                   KGTYLIPPYEDTLHSIDLLREAAKPTLFSDALTDPINMLADMSKGNLARIGAISQQAEG
FT                   AGVGNQMVGNPNYGNWQSNSNGTSFWQWYGMYRILGDVFNRVEYGSWSRGRKYSYYNDY
FT                   GRTRYSSPKQIKAQSTLETRTRQSYQRQGKQFTSPYASKKTGASGLSRSSYTPPKSRSS
FT                   YSRSSSYSNNSGSVRNSGSRTSRGVSRGK"
FT   gene            41950..42849
FT                   /locus_tag="PSHAa0039"
FT   CDS_pept        41950..42849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0039"
FT                   /product="conserved protein of unknown function , putative
FT                   integral inner membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85149"
FT                   /db_xref="GOA:Q3IJ45"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ45"
FT                   /protein_id="CAI85149.1"
FT                   /translation="MYEFNGITMWSLQALAIDFAIIVLLFVSLKYIKGWVSNLHANDEI
FT                   TERDNFAFGISFAAGLVALAIVLTGVSSGAFAVSLQQEALQMLGYGALAILLIKLGHFF
FT                   QDKVALRKVSLHSEIVKGNVTAAVIDFGHVVSVAIVIRSALLWVATDGWHGLPIVVAAF
FT                   VIGSLVLLLVSQYRVQLFKRTNKSGDCLQQAIIDGNLAVGIRYAGFLIGSALAITAATG
FT                   IAPYVADNINASLLYWAISAVVSLLVFIILHLVTIKIILSGCDISDEVNRQKNVGVAAI
FT                   SAALSFAVGITMATLLGA"
FT   gene            42854..44575
FT                   /locus_tag="PSHAa0040"
FT   CDS_pept        42854..44575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0040"
FT                   /product="putative spermine/spermidine synthase family
FT                   protein"
FT                   /function="2.2.2 : Polyamines biosynthesis"
FT                   /EC_number="2.5.1.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85150"
FT                   /db_xref="GOA:Q3IJ44"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ44"
FT                   /protein_id="CAI85150.1"
FT                   /translation="MSSTIKSPSKFSLLGHDILLITVMAVLAGCGLIYEYLLSHYAGRV
FT                   LGSVESAIYAMIGTMIVAMGIGAFLARWFKDAFTAFAWLESIIALIGMGCILAIAGVIA
FT                   VSYSLPHMFSSIFNLPPDVVLNGYVFQKLQEWSRFLPYVFGLILGLFIGMEIPLIARIR
FT                   QHVYGRFLENNAGTIYGADYIGAGIGAAIWVSIMLSMPIMQAAAWTALFNIIAGLAFLW
FT                   RYHTYVRFAKLLLACHLLLLVLFAFILVLGSSWMDNLSNVLYKDKVIYSQATKYQHVVL
FT                   TERLSKNQPQPITDLYLNGRLQFSSVDEQIYHSMLVYPAMLASNRHERVLIIGGGDGLA
FT                   LRDVLKWPVSKVTLIDLDGQLLNLFGHKDAEFTSPEDISQRLLSLNSKSMHDPRADIIV
FT                   GDAFLEVEKLLDQAKQFDTILIDLPDPNHPDLNKMYSDYFYNHVRQLLAPDGAMAVQST
FT                   SPYHAKKAFLSIAKTVKAAGFEYVEQYQQNIPSFGQWGWTIATKMGQSASGRINDVTAM
FT                   PIPSRWISKEYLLASFIFPNNYFEHIKDIEVNRLGSGQLYDYYRTAWQIESELYKN"
FT   gene            44655..45068
FT                   /locus_tag="PSHAa0041"
FT   CDS_pept        44655..45068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0041"
FT                   /product="conserved protein of unknown function; similar to
FT                   E. coli YjfI"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85151"
FT                   /db_xref="InterPro:IPR019231"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF17"
FT                   /protein_id="CAI85151.1"
FT                   /translation="MELNELSIKLASFETEGANFESFLIANPGEQDVLQVIVDENDELP
FT                   IFVTQTQEQLLCISYLFDEDEVKPELRNELNETLLRLNVPIPLSAFAKIDNKYAIFGAL
FT                   SVNSSLDDITHELVTLADNAIDALEAVTMYLND"
FT   gene            45093..45785
FT                   /locus_tag="PSHAa0042"
FT   CDS_pept        45093..45785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0042"
FT                   /product="conserved protein of unknown function; similar to
FT                   E. coli YjfJ; could be a phage protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85152"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF16"
FT                   /protein_id="CAI85152.1"
FT                   /translation="MSILKKLFTAVRGGAREAGEAIVDKNGIRIFEQEIADAQNALHRA
FT                   KKSLTEVMAKEMQTKRKISAVDASIAEHEAYAGQALEKGNEALALEIAEKIGEFEAEKA
FT                   ENEQVLSGFSNHIVALKQQVKEAEKSIKENQRQLTMVKTTESVQQATMAVNSTLNTNSS
FT                   SMTSARQSLERIKQRQQDRQDQLGAAKELEADVNGDDLKAKMAEAGIGDSSPKSADILA
FT                   RIKAKQNS"
FT   gene            45860..46498
FT                   /locus_tag="PSHAa0043"
FT   CDS_pept        45860..46498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0043"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85153"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF15"
FT                   /protein_id="CAI85153.1"
FT                   /translation="MFNFFKSKKEPERQLNHASELKKGDMFTVIDSFAYPAWLKGQTLR
FT                   VIDIQTYQYQHSSDTEFVLESDSGQVVFLQIEQEDGEQWANFSIKVQRDEVEDIFGLDQ
FT                   FARIFDEESLTHITVQNIPERFTQFLANSYQQSESPFVCYFHNKDYRNQALPRYEQEGG
FT                   ELCEMICLESDDKGFGLNIEIWDGGETEVSLTLTRPITDIVDLFPGDAK"
FT   gene            46537..46815
FT                   /locus_tag="PSHAa0044"
FT   CDS_pept        46537..46815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0044"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85154"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF14"
FT                   /protein_id="CAI85154.1"
FT                   /translation="MRATQMAFDLSSEVQKSIKKQAIDQELTPSDMIRKILGLDVKSKK
FT                   TRQRLSFNLNDDEIAQLASRFDVQSDDKRVVKQRVAELLIAHTKKIK"
FT   gene            46871..47056
FT                   /locus_tag="PSHAa0045"
FT   CDS_pept        46871..47056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0045"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85155"
FT                   /db_xref="GOA:Q3IF13"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF13"
FT                   /protein_id="CAI85155.1"
FT                   /translation="MNIILIAYLLIFALFGTAASYFVRFIYAYWVLNKMPMHYIIKAGI
FT                   CLVMVVIISALIPYLG"
FT   gene            complement(47082..47486)
FT                   /locus_tag="PSHAa0046"
FT   CDS_pept        complement(47082..47486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0046"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85156"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF12"
FT                   /protein_id="CAI85156.1"
FT                   /translation="MSCLPSAIKLSIVSIATSILLLSGCASTTSSSNDHGTSLASLNSQ
FT                   LNDIVSNNSCTASFQCKVLEVGARACGGPSKYTVYSTLNTQQEQAEQIAQQITAQENTL
FT                   NKAQGLTDCPSVLEVQSLCINQQCQPFEIK"
FT   gene            complement(47497..48018)
FT                   /locus_tag="PSHAa0047"
FT   CDS_pept        complement(47497..48018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0047"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF11"
FT                   /protein_id="CAI85157.1"
FT                   /translation="MRTPLLAIFLPLCLTACLDNPVAETEKTTASEATTPSQQKLQQLQ
FT                   KSNKAELHAPAEKLSNTAMKTVTLDDIKTAKNELNTLIANKQCDSSTQCQVEAVGSRAC
FT                   GGPSSYIVYSTTTATTEQVTALSKKITTFESNYNAQNQMVSICQHLTAPSTQCVENKCV
FT                   KLEGSAVSVF"
FT   gene            complement(48132..49508)
FT                   /gene="fumC"
FT                   /locus_tag="PSHAa0048"
FT   CDS_pept        complement(48132..49508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="PSHAa0048"
FT                   /product="fumarase C (fumarate hydratase Class II)"
FT                   /function="2.1.2.1 : TCA cycle"
FT                   /EC_number="4.2.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9045798, 11133938; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85158"
FT                   /db_xref="GOA:Q3IF10"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF10"
FT                   /protein_id="CAI85158.1"
FT                   /translation="MTQFRTESDSMGELQVPANALYQAQTQRAVNNFAISGLAMPKQFI
FT                   TALAYIKQAAAQSNFELGHLSKTKAKAIEQACQEIIDGSHYEHFPVDIFQTGSGTSSNM
FT                   NANEVIATLASRLGDESIHPNDDVNMGQSSNDVIPTAIALSSAINVVYELLPSLEKLSQ
FT                   HLEHKKAEVGAIVKTGRTHLMDAMPVTFGQTLSAWQTQINHAAAGIRHSLERVCELAQG
FT                   GTAVGTGINADPQFAPLFAKNLSANVGIRFTPSSNFFYNIGSQDAIVALSGQLKVLAVA
FT                   QMKIANDLRWMNSGPLAGLGEIELEALQPGSSIMPGKVNPVIPEAAAMVSAQVIGNDAT
FT                   ITVAGQAGNFELNVMLPVIAYNILQSIELLANSAQALGDKAIASFTVNQLNIDKALAKN
FT                   PILVTALNPVIGYEKAAKIAKQAYKEARPIIDVAEQETDLSRSELEKLLNPSKLTQGGL
FT                   "
FT   gene            49800..50390
FT                   /locus_tag="PSHAa0049"
FT   CDS_pept        49800..50390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0049"
FT                   /product="conserved protein of unknown function ; putative
FT                   methylase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85159"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF09"
FT                   /protein_id="CAI85159.1"
FT                   /translation="MIKPFSQACENNKQPILAQLKPVLANAKTVLEIGSGTGQHSVYFA
FT                   QQLPHLQWYSSDRAINHEGINLWHRDVNLTNLHVPLELDLNNAWPIDKVDAIYTANTFH
FT                   IVSWQLVEHFFAGVKQHLNDQGIVCIYGPFKYKGEFTSQSNNDFNRFLIERDPLSGIRD
FT                   FAAVELLAKQAGLTLISDIAMPANNQLLIFKRQ"
FT   gene            complement(50367..51506)
FT                   /locus_tag="PSHAa0050"
FT   CDS_pept        complement(50367..51506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0050"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85160"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF08"
FT                   /protein_id="CAI85160.1"
FT                   /translation="MATFSHQWFSSINQIERAHWQRLFGDEPFTQHAFLYALEQSQCVN
FT                   QQSGWQPYHLAIFEGENIIALAPGYLKSHSYGEYVFDWAWAEAYEKHGLEYYPKWLCGV
FT                   PFCPIEGSRIAIEHSNPSLVYKYITELLNLHSKEQGWSGWHVNFCNLAQATHLTEQHAM
FT                   LRVGVQFQWFNKGFTCFDDFLNTLNSRKRKSLKKERSKITQQNITIEWLQGMQITPEIM
FT                   QLFCEFYQRTYLKRSGHLGYLNMPFFKLLHALMADKLVIMLAKKEDAIIAATLSLIGAD
FT                   TLYGRYWGASEEVDSLHFELCYYQGIEFAIKHNLSCFHSGAQGEHKIARGFAPVLTYSA
FT                   HHIVDNNFSNAISDYLKRERQHINIYKDQCSALLPFKNQ"
FT   gene            complement(51509..52879)
FT                   /locus_tag="PSHAa0051"
FT   CDS_pept        complement(51509..52879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0051"
FT                   /product="conserved protein of unknown function ; putative
FT                   secreted esterase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85161"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF07"
FT                   /protein_id="CAI85161.1"
FT                   /translation="MNNNSVFLKIFLTCMLSFLPHLAVAENCIAQASDFEFIKKSKQQG
FT                   LLRYTKDHHQAYFDYQARAPFNSYLNHAYQYISVANPRAAMPCPVFTQTYQQLVTQGSR
FT                   KPNPTIADIIAPFELKHSQSKKAVLLVHGLTDSPFTYHDLAQVYYQQGYTVRTILLPGH
FT                   GSAASALQDVDLQQWQQAVRYAIERTTQDFDEVILGGYSTGAALLIDYAITQALSSKIT
FT                   ALMLFSPGSEPHNKQGWIAKWLDLIPFLNWIDKDADVDFAKYESFPLNAAAASYDAMSL
FT                   VSIKNLSKRPALALPVFSVISDIDATIDSHATLKLLNALHNTNLSRYKKLDTLVLYGSS
FT                   TILPPNFAADYRVLNPQCASEACLKIHGISHIAIVNSPQNPHYGISASYRNCGSFIGGE
FT                   KLYKTCKTTKSPQLGERTAANLKQYPTLQRLTYNPFFPELKKQISTFIKNVEHAQGK"
FT   gene            complement(52869..55586)
FT                   /locus_tag="PSHAa0052"
FT   CDS_pept        complement(52869..55586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0052"
FT                   /product="hypothetical tryptophan-rich sensor protein"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85162"
FT                   /db_xref="GOA:Q3IF06"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF06"
FT                   /protein_id="CAI85162.1"
FT                   /translation="MKNFNSKYYSSVFYIIFSLAYFFVGVILTKLTFDSQIIPVWLPAG
FT                   IALVGCFVWWWRFIPALFLAALAFNLNFFANTTHEMVLVGNSLNEAMYIAFGVVLQAMV
FT                   GAAILKFWLGHPLRLKKRQNIIYFIVVVGVLVSLISANFGVFALSQFNAMYSADNHWKN
FT                   TTYWWLGDILGVLIATPFLLSLLPEKSDNYNISVLPTLSVCCILFVSVAATTQLYDSES
FT                   RINAIKIAEREVQVIENSLYRYTNRSIIAVQSLASQVQSSPTLSQQDFNQYANTLLAKH
FT                   SFIKALSWNVKIPSHQRQAFSKEISSIYNLNYDVIGEPLEPNDPLVIVKYIAPFNSNQK
FT                   AIGFNVYSNPDRKASLLNPAIKYQPVGTKIIQLVQTEHSDAAYLLFAPVYSQSNEKETI
FT                   KGYATGVFLVPQIIKQAITEQQSKMFSIAIYEDINKPAFYSNSNNLNVAQGSKLISFNV
FT                   DFGGQQWIVKLALKDAFLAQHNNQLTLLLLILQVVVCSLILLILLLFNQQQIALTRQVA
FT                   ERTYSLAQAKKQSDLANRAKSQFLANMSHEIRTPLNAVIGFSSLARKEDDANTLIDYLD
FT                   KINSSSKSLLNLINDILDISKIESKRLVLERIPFDLTALIQRINTMFEQSAASKAIVWK
FT                   INSNIPKDTWFVGDPMRLEQIMLNLCSNAIKFTNAGSVTLNVDTQLIAPNKAQLTIAVI
FT                   DTGIGIKATQHEKLFSAFTQADNSTSRQFGGTGLGLAIAKELSVLMNANIALHSELDKG
FT                   STFTFTLEIETVKAQDPLIKPTDNTNIAALKILVAEDNPVNQMVIKAMLGSLKIVPQVV
FT                   ENGELAVNIIKKQHFDLVFMDCQMPVMDGYRATALIRQFKTAEELPIVALTADVMPEDK
FT                   AHAQAVGFNQHLAKPLELIKLTECLAQYAVVYEQ"
FT   gene            complement(55661..56116)
FT                   /locus_tag="PSHAa0053"
FT   CDS_pept        complement(55661..56116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0053"
FT                   /product="putative transcriptional regulator (LRP/AsnC
FT                   family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11230123, 12458218; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85163"
FT                   /db_xref="GOA:Q3IF05"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF05"
FT                   /protein_id="CAI85163.1"
FT                   /translation="MLDKKDQQLLIALQANARMSVADLASHISLSDTPCLRRIKKLEQA
FT                   SIITGYHAAINPKALKLNVLVYAFVRLNQNSASAARQFEQHVEKLTHVLECSVISGSYD
FT                   YLLKIIAHDLESYEQFVKHQLGSLSCIANIESTVVLKQSFSKKQLPL"
FT   gene            56254..57423
FT                   /locus_tag="PSHAa0054"
FT   CDS_pept        56254..57423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0054"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85164"
FT                   /db_xref="GOA:Q3IDE5"
FT                   /db_xref="InterPro:IPR015029"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE5"
FT                   /protein_id="CAI85164.1"
FT                   /translation="MSTHTAIFDRWIRSAFPQINSELEQLYWQQDDKANVEGLGEPLKQ
FT                   QLKDEGNALISNLLAEGNTDEGFDSAFDLLGNVGLFMAACRRHEITEPSRETTSPLVEA
FT                   SALAMHIGASIGVTPRFATAHLTTHNKALNGTYKRFTNLPDEKLFIDYNTQGILAYKRA
FT                   SDALLKILPLGISHPTCAELLKVAKQALIDVIESNNALYTQLDTERFFNCVRPYYKPHR
FT                   VGNEIYRGANAGDFAGINVIDMLLGLCSANEPSYSQMLVDKFLYMMPEDQQILREAMRM
FT                   QSFMDDFLQAQQYKDNDWFKYHAKLFIQVCKLHGDTAIGHHNQLVEKFIAQPSKQMQQQ
FT                   HMSKVTASGPPLHVLLDSLEKLRDKRASAKRDDIKTRYDDINLLKQWIK"
FT   gene            57425..58549
FT                   /locus_tag="PSHAa0055"
FT   CDS_pept        57425..58549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0055"
FT                   /product="putative pyridoxal phosphate dependent enzyme;
FT                   may have an iron-sulfur cluster"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85165"
FT                   /db_xref="GOA:Q3IDE4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE4"
FT                   /protein_id="CAI85165.1"
FT                   /translation="MNQHDFCMAEGCYLLSHSVGRPLKNSQQHLAAHYFSPWESSNKEP
FT                   WQQWLPAVEQFNTALGQLFNAPSEQFCPQVNLSSGLTKLLMSHPRLQQKNCKVLMTQSD
FT                   FPSMGFAMQKALPKCAQITFIPEHENLTDITVWQRYLTDNIDLVFISHVYSNTGVQAPV
FT                   HDIVALSKKTNSLSIIDVAQSAGVIPLDLTALNADFMIGSSVKWLCGGPGAAYLWVNPQ
FT                   QIAVCEPKDVGWFSHQNPFEFDINHFIYNKGALKFWGGTPSVVPYIIAANSIAYFAALG
FT                   IDKVRSHNLAMLALIQQQLGKYVVSPTQQHQCSGTAILNFNMQQQHVLNELNSAGISVD
FT                   ARKLGIRVSPHIYNSADAIHKFIAVIKKAIKVVD"
FT   gene            complement(58533..59021)
FT                   /locus_tag="PSHAa0056"
FT   CDS_pept        complement(58533..59021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0056"
FT                   /product="putative RNA binding protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85166"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE3"
FT                   /protein_id="CAI85166.1"
FT                   /translation="MIRVILLSICLTAPTFSLAENITVYKCVIKGVPTFSQLPCALDAQ
FT                   AITLKNINVTTAYSDTTASSKITDTSVDDYLKTQQINRDIKRYQLAIKQYQQQYTEKKQ
FT                   QIDYMTQDKANRLGASSIANAIATKTSALKQSYDALIGQAQQQIEALNQQKEQLSQQP"
FT   gene            complement(59328..59420)
FT                   /locus_tag="PSHAatRNA106"
FT   tRNA            complement(59328..59420)
FT                   /locus_tag="PSHAatRNA106"
FT                   /product="tRNA-Ser"
FT   gene            complement(59478..59568)
FT                   /locus_tag="PSHAatRNA105"
FT   tRNA            complement(59478..59568)
FT                   /locus_tag="PSHAatRNA105"
FT                   /product="tRNA-Ser"
FT   gene            complement(60483..61412)
FT                   /locus_tag="PSHAa0058"
FT   CDS_pept        complement(60483..61412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0058"
FT                   /product="putative integral inner membrane protein;
FT                   putative exporter"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85167"
FT                   /db_xref="GOA:Q3IDE2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE2"
FT                   /protein_id="CAI85167.1"
FT                   /translation="MKSAALYITTVLIWGSTWLAIEFQLGDIAVELSLFYRFAIAALLM
FT                   WLYVAYKKPKMRFNLVDHGFFVLLALFNFGLNYLMLYWAQNHLSSAMTSIAFSMLLVMN
FT                   IVNTRLFFGKPISKRIYTGAVLAILGITCLFWPQLQQLNLSNSAFVGLLLALGGTFVAS
FT                   LGNMVSVRNSRKQIGVLQGNAWGMLYSAIGLALYVFISDVQFNFTAPTSYWLSLLYLSI
FT                   FGTVIAFACYFALLKNIGPEKASYVIVLFPLVAVTLSSFYEGFEWHANTFAGFSLVLLG
FT                   NAIVLTPTKRINAFLANRAVARRGSVPS"
FT   gene            61514..62959
FT                   /locus_tag="PSHAa0059"
FT   CDS_pept        61514..62959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0059"
FT                   /product="putative transcriptional regulator YdcR (GntR
FT                   family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85168"
FT                   /db_xref="GOA:Q3IDE1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE1"
FT                   /protein_id="CAI85168.1"
FT                   /translation="MILKAVSHQGHEFLYQQVIQLIRDMSAQQALLPSEKLPSLRKMAS
FT                   NLNISIPTVKQAYQALEDQGVIEAREKSGYFLKAVNMASSLPKRVKLSREPVIVNKQAL
FT                   IEQVYTAIHQAHVVPFGVANPVAAAPTDKALARNMRRVMTLAGSSAINYGPLDGYAPLK
FT                   KQLIHRYLNFGIGINMDEMVITNGAQEALAIALKCVTKPGDVVAIESPCYHGIIELIES
FT                   LGLKALEIPLCPDNGIWLNDLAQALNEHDIKACLFSTAISNPVGSFMPDKNREQLVELV
FT                   ESHNVVLIEDDVYGDLYFTPKRGTPAIAYSKKGLVLSCSSFSKTAAPSYRVGWLIAGKF
FT                   AGQARRYKRALSCSTSLINQWTLSEFVFSGEYDRNLKVLRQRLRTNKEHMRRCLQQAMP
FT                   KGTRISDPQGGCVIWLDLGCEYDSQKLFSLALEVGISITPGLIFSASNKYKSCIRLSYG
FT                   VQWSEQIEQAIVTLGKLTLLAKK"
FT   gene            complement(63081..63875)
FT                   /locus_tag="PSHAa0060"
FT   CDS_pept        complement(63081..63875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0060"
FT                   /product="putative secreted protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85169"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE0"
FT                   /protein_id="CAI85169.1"
FT                   /translation="MKKLLLMSTLICAPAVVAHNDNDSTVSFNNEQCNVEFKNDVRIKP
FT                   DELEIFTANKQTMQFNTNGNLTINGESVALNHSQQKALTQYSDSLRTQLPEVANIALEG
FT                   VKIAGVALQEVANAFNIDGLDNISSLMDDIKLEVQNTFYQQDTFVMDQQSFNQFGENFE
FT                   QQFEQQIETAVESAVMQSMGSILVALGSELLGSGGDMQAFEQRMENMGTQIEEKVEQHA
FT                   DALEKRANALCENFANIAKQEEQLVVQVPELKGYQLFSFKQN"
FT   gene            64159..64449
FT                   /locus_tag="PSHAa0061"
FT   CDS_pept        64159..64449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0061"
FT                   /product="doubtful membrane bound protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85170"
FT                   /db_xref="GOA:Q3IDD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD9"
FT                   /protein_id="CAI85170.1"
FT                   /translation="MALNCIALYVSNILILPIIAIIKSLVGLKHFMEWVVGKTFSYDAL
FT                   DDDFVEDEYEMLGRNQHDKNKQKVKKKLEDYLEQKRLRKNLGEDDLSDYTD"
FT   gene            complement(64576..65067)
FT                   /locus_tag="PSHAa0062"
FT   CDS_pept        complement(64576..65067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0062"
FT                   /product="glutathione peroxidase possibly involved in
FT                   repair of phospholipid hydroperoxides"
FT                   /function="2.4.3 : Other"
FT                   /EC_number="1.11.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11418106; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85171"
FT                   /db_xref="GOA:Q3IDD8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD8"
FT                   /protein_id="CAI85171.1"
FT                   /translation="MHKFHQLSATSLQGNTINFSEFAGKVVLIVNTASKCGFTYQYESL
FT                   QALHNKYASQGLVILGFPCNQFNQQEPGDAQQIEQGCLINYGVNFLMAAKVEVNGEHAH
FT                   PVFRYLKSTQPGFLTRKIKWNFTKFLIAADGSPIKRYAPFTKPEKLELTIQKALQQSNK
FT                   "
FT   gene            complement(65159..65455)
FT                   /locus_tag="PSHAa0063"
FT   CDS_pept        complement(65159..65455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0063"
FT                   /product="putative transporter protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85172"
FT                   /db_xref="GOA:Q3IDD7"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD7"
FT                   /protein_id="CAI85172.1"
FT                   /translation="MTTILLMACITFFTRYLFLHRALPFKVGPKMQQFLSFSAPAVLTA
FT                   IWVPIVFLNDDGINLNWQNPYLSAAIVAIIVAYKTHNIYYTTIAGMGLFLILN"
FT   gene            complement(65455..66117)
FT                   /locus_tag="PSHAa0064"
FT   CDS_pept        complement(65455..66117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0064"
FT                   /product="putative amino acid permease"
FT                   /function="1.2.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85173"
FT                   /db_xref="GOA:Q3IDD6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD6"
FT                   /protein_id="CAI85173.1"
FT                   /translation="MLPLCLAVIPWGILCGSLAIQNGFTALETQAMSLLVFAGSAQLVA
FT                   IELIAGNTPLLTILFTTFIISSRHFLYGLAVRHKVIDQPLRWRLPVSFVLTDELFAFSH
FT                   HPKAYRTKIRLIYALSAGFSFYIAWNLWTFIGIVAGTMLPDLTHLGLDFAIAATFIALV
FT                   IPGVKSLASLVTVIVAGISATLFKSTGFELWLVSSALLAMSAGYFTARITAKKERNL"
FT   gene            66290..66949
FT                   /locus_tag="PSHAa0065"
FT   CDS_pept        66290..66949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0065"
FT                   /product="putative cytochrome"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85174"
FT                   /db_xref="GOA:Q3IF97"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF97"
FT                   /protein_id="CAI85174.1"
FT                   /translation="MFKVKVWDGFVRSFHWLLVFSIAVLYFSIEEGMIELHFIAGFFTL
FT                   ALILTRLIWGIIGSKTAKLSALIHSPQAVITSLKANKTPLGHSAPGSYMVLLFFILIIT
FT                   QLVSGLMSSDGILTDGPLAQYVSSSTVDFANWLHSLNFDILLYAIGLHVLAIVIYKIKG
FT                   KPLVKAMITGTKQQPNEKPAILTKAPWLAWVVFLILLVVLMTTWGSEPLSYLLNLG"
FT   gene            complement(67014..67466)
FT                   /locus_tag="PSHAa0066"
FT   CDS_pept        complement(67014..67466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0066"
FT                   /product="conserved protein of unknown function ; putative
FT                   cytochrome c'"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85175"
FT                   /db_xref="GOA:Q3IF96"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF96"
FT                   /protein_id="CAI85175.1"
FT                   /translation="MKLKQVFIGALLSTCALSVSANSAFKEPSDAIEYRQAAFSMLSVQ
FT                   ISDMGAMLKGKIPFDADKFKARANNAAALAKMPWEAFYEGTDKGDTAALAAVWAENDTF
FT                   MKKATAFQQYADELAVAAQSGDKAVIGKAFGAWAKGCKDCHTQFKD"
FT   gene            complement(67561..68031)
FT                   /locus_tag="PSHAa0067"
FT   CDS_pept        complement(67561..68031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0067"
FT                   /product="putative integral membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85176"
FT                   /db_xref="GOA:Q3IF95"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF95"
FT                   /protein_id="CAI85176.1"
FT                   /translation="MDNEVINILSMAKVIQTAVAPVFLITGIAATLGVLSNRLARITDR
FT                   ARLLERRLKVSTDDDFNLSLTTELRALLKRSRCIHLAFSLSVLSALLVCAVVMLLFLSH
FT                   IQSVNLGVTIGSCFVAAMALLIFAFMSLLCEVFLATRSMRRGMIFADVDIND"
FT   gene            68256..71720
FT                   /locus_tag="PSHAa0068"
FT   CDS_pept        68256..71720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0068"
FT                   /product="putative serine secreted endoprotease, subtilase
FT                   family"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85177"
FT                   /db_xref="GOA:Q3IF94"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF94"
FT                   /protein_id="CAI85177.1"
FT                   /translation="MSKNIIKKTAIATAVSSAFIATLASASNLPTANITYQKAEAVKEQ
FT                   VADKKEPSAHMIVLRATTSVDAYVAGTYQQSNNREITANIEQLQDTMTLELNSLDFDAK
FT                   IIGKTKILAPTLIVQASAEALAKIAKDSRVAKVLPMFDSELHVAASSDYINAKPLIVDG
FT                   IASGKGQRVAVLDTGIDYTHQAFGGAGTVEAYLAAQADPTTVAWPQGVVKGGYDFINED
FT                   ADPIENDPANSPATGAPTNHGTSSSNSVNGIAPDVELYVYSVCGGGCPSAAQAAALEAA
FT                   MDPNGDGDISDRVDVMNMSLGGEFGDTYTGGGTQYLIQRAVELGVNMVISAGNDGDNPF
FT                   RIGGPSTTPNALSVGAMTHPTTEIGVATGTIAGVEGDIQPSSFGPQEAYTITGADIELV
FT                   YPDANQNGCVAFAADVDFTGKAVLIDRGACAFTDKVLNAQINGAEFVMIANNTDDGTPA
FT                   PMGGFDAAVTIKNVGINFAAGAALKAQLAAGGPATFDISIDIKTTSGAVATFSSRGPSM
FT                   DGLLKPEITAPGTSIDVAAAGTQTGTNPVSGTSFSGPITAGAVAMIREAHPDRNAFEIK
FT                   ATIMNAANLNVTNEPLAINPASELAPISMIGAGLVDVAKAVNLPVAAWVNNAKFNTKQA
FT                   ALSFGLESMTETASLTKTVTVKNFSADAKTYNLRTEARYQSDIDTAAISWDFPASITVP
FT                   AGQAINFDVVLTVDPAKLPEWNLNNPFSAEEVAARSAALTSVEFDGALVFDDASTDTDH
FT                   DLHLVYHAMPKAATELSVSSQIVDSEMALVVTNSGQTEIMPQAESIVAVGVEKTFAEAE
FT                   FNILATTFSAFNAEFCDSGIFVTSSIQLRDPLTHTFQAGYRLEIDTDNDGVADQFMTNL
FT                   NDRGRDTAFPGRSRTLIGETDGAGNDSWAWGTPLYHSAGEDTITFSGCSELLNIDGTLL
FT                   GEQMNFKASVGYAAYQSGVFTETDSVTGSTVFGMQPQVAFTSLETGEAVTTLKPGEKAV
FT                   VTASGPFALTQASGLDVVKVMAAADLEVPDVSAPALVGGEFTVSEDAANGTVVGALTVT
FT                   ESEFDLAISEYFVQSNTHQGLGVDADGQVVVTNTALLTGDSSAQIQVVAIDTRGNVSEP
FT                   AIVTVSITKVVPPPVVVTPEPEKKSSGSLAWLLLTAPLAFMRRRKQK"
FT   gene            71799..73973
FT                   /gene="ptrB"
FT                   /locus_tag="PSHAa0069"
FT   CDS_pept        71799..73973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="PSHAa0069"
FT                   /product="oligopeptidase (protease II)"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.83"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1447164; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85178"
FT                   /db_xref="GOA:Q3IF93"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF93"
FT                   /protein_id="CAI85178.1"
FT                   /translation="MKHIPCVLAISSLAILSGCNQAPEAVQTNVISTTAEQLPQVVAPI
FT                   AKKVPHAMTIHGDTRIDNYYWLRDDERKAADVISYLEAENSYTNTMLAHTQAQQAKLFA
FT                   ELKGRIQKDDDSVPIKKGDYYYSSQTRGNNEYTTYVRSSDFSGANQQVILDVNELAKAH
FT                   DYYAVSGLDVSPNGNLMAYGEDTLSRRIYTVKIKDLSTGRLLQDTLEGTSGNLVWANDN
FT                   KTLYYIKKDLQTLLGYQVYRHTLGTPQANDELVYEETDSSYYTGLSKSKDGTEIYIWHS
FT                   SSTASGMSVLSANNVKAMPQRLIKRQANLEYSISKLGESYYIVTNLNAVNFQLMKVAIN
FT                   KAHDQANWQALIPARDDIKLEGIELFNDYLVYQQREMGQSRQIIRNLSTNQEQLLSFND
FT                   SAYTISAYGNNDINSNKLRVYYTSMTTPGSSYDINLKTTDKTLLKQQAVLGNFNVDNYA
FT                   SERIFINARDGVKVPVSLVYRKDKFKKDATNPLLQYGYGSYGATMDPTFSSARLSLLDR
FT                   GFVFAIAHVRGSQMLGRPWYDDGKLLTKKNTFNDFIDVTKALVEQKYGAKDKIFAQGGS
FT                   AGGLLMGAVANQAPELYKGMVAAVPFVDVVTTMLDESIPLTTNEYGEWGNPNEKEYYEY
FT                   MLSYSPYDQVSKQAYPNMLVTTGLHDSQVQYFEPAKWVAKLRDYKTDDNKLLFKIDMEA
FT                   GHGGASGRFKRLEDTALNYAFMLDLMGIKE"
FT   gene            74144..74509
FT                   /locus_tag="PSHAa0070"
FT   CDS_pept        74144..74509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0070"
FT                   /product="conserved protein of unknown function ; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85179"
FT                   /db_xref="GOA:Q3IF92"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF92"
FT                   /protein_id="CAI85179.1"
FT                   /translation="MHDEQQLEPVKKDDRTWAMLCHLSALSGFIVPLGSVIGPLIVWLI
FT                   KKDDMPIVDVHGKKALNFQITMMIAYFVCFLLMFVVIGVILLPIVAIFSFVMVIIAAVK
FT                   ANDGKEFDYPLSLNLIK"
FT   gene            74593..75027
FT                   /locus_tag="PSHAa0071"
FT   CDS_pept        74593..75027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0071"
FT                   /product="conserved protein of unknown function ; protein
FT                   similar to E. coli YqaA"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85180"
FT                   /db_xref="GOA:Q3IF91"
FT                   /db_xref="InterPro:IPR020143"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF91"
FT                   /protein_id="CAI85180.1"
FT                   /translation="MLYLTLFISAFISATLLPSSSEVVMVAMMTQGKVNLLLLWLAATL
FT                   GNVLGSCVNYWLGTQVLRFKDKSWFPVSEQGLEKAQKQFNKYGVYSLLFAWLPIVGDPL
FT                   TVIGGIFKVRFSTFLLLVTLGKGARYLAVIALTLGVEKLI"
FT   gene            complement(75066..75422)
FT                   /gene="folX"
FT                   /locus_tag="PSHAa0072"
FT   CDS_pept        complement(75066..75422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folX"
FT                   /locus_tag="PSHAa0072"
FT                   /product="D-erythro-7,8-dihydroneopterin aldolase"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="4.1.2.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9651328; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85181"
FT                   /db_xref="GOA:Q3IF90"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF90"
FT                   /protein_id="CAI85181.1"
FT                   /translation="MANAIINVTNLRLRTFIGFNQEEREKKQDVVINLEIHYPAHDACK
FT                   TDEVDQALNYKVITKEVITLVEQGDFLLLEKLVAEILAVCHSHPSVHYAKARVDKPHAL
FT                   RFADSVSLTLDWAK"
FT   gene            complement(75426..75980)
FT                   /gene="folE"
FT                   /locus_tag="PSHAa0073"
FT   CDS_pept        complement(75426..75980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="PSHAa0073"
FT                   /product="GTP cyclohydrolase I"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="3.5.4.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10049741, 14642352; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85182"
FT                   /db_xref="GOA:Q3IF89"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF89"
FT                   /protein_id="CAI85182.1"
FT                   /translation="MHNELKQGYENIITAVGEDPNREGLLDTPKRAAKAMEYLTQGYRQ
FT                   TLEEITNNAVFTSDADDMVLVQDIELYSMCEHHLLPFTGRCHIAYIPNGKVLGLSKFAR
FT                   IVDMFARRFQIQEQLTHQIAKAVEEVTGATGVGVIVEAKHMCMMMRGVEKQNSSMRTSV
FT                   MLGNFRADPKTRNEFLQLIKG"
FT   gene            complement(76007..76726)
FT                   /gene="folM"
FT                   /locus_tag="PSHAa0074"
FT   CDS_pept        complement(76007..76726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folM"
FT                   /locus_tag="PSHAa0074"
FT                   /product="putative alternative dihydrofolate reductase,
FT                   NAD(P)-binding domain"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="1.1.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14617668; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85183"
FT                   /db_xref="GOA:Q3IF88"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF88"
FT                   /protein_id="CAI85183.1"
FT                   /translation="MTPPILITGAGQRIGLALAKHFIAQGQPIIITYRTRHAAVDLLEQ
FT                   QGAVCIYADFSTDDGISTFIKALKEHTNSLRAILHNASSWDCEANNANFAQLFDNMMRI
FT                   HAKTPYLINLLCAELLLNYQTEMNTPADIIHLTDYVVETGSPKHVAYAASKAALDNLTK
FT                   SFSAKYAPNIKVNSVAPSLIIFNEHDDEQYRAKTLKKSLMGIEPGCQEIINSIDLLLHS
FT                   HYITGRAIPVDGGRHLK"
FT   gene            complement(76850..77686)
FT                   /gene="nadE"
FT                   /locus_tag="PSHAa0075"
FT   CDS_pept        complement(76850..77686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="PSHAa0075"
FT                   /product="NAD synthetase"
FT                   /function="2.5.11 : Pyridine nucleotides"
FT                   /EC_number="6.3.5.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8195100; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85184"
FT                   /db_xref="GOA:Q3IF87"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF87"
FT                   /protein_id="CAI85184.1"
FT                   /translation="MRAEIMAAMKVQPVIDVNAEISRRVNFIKARLIAAHATSLVLGIS
FT                   GGVDSSVCGRLCQLAVNELNQEQSTTDYKFVAVRLPYGVQADENEAQLAVDFIQPSSRM
FT                   TVNIKPATDALHEQTMAAIVGNGESLPEQEKIDFIKGNVKARQRMIAQYEIAAFCQGLV
FT                   VGTDHSAENITGFYTKFGDGACDLAPLFGLSKRQVRALGSTLGASSVLVNKAPTADLES
FT                   DRPGLTDEEALGLSYEQIDDFLEGKPVTQQVEQTLSAIYQRTQHKRQPVPTIYDEL"
FT   gene            complement(77760..78389)
FT                   /locus_tag="PSHAa0076"
FT   CDS_pept        complement(77760..78389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0076"
FT                   /product="conserved protein of unknown function similar to
FT                   YceH of E. coli"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85185"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF86"
FT                   /protein_id="CAI85185.1"
FT                   /translation="MQLSANQQRIIGCLLEKQSTTPEHYPLSLNALTNACNQKSNRAPV
FT                   LNLTDSEVQIALDELINARLVTIDEGLSGRVNKYDHRFCNTEFSSLKFSAQQRAIICLL
FT                   LLRGAQTPGELKTRCARLANFNSVDDVELALNKLIESDIVTKLAREPGKRDCRYMHLLG
FT                   EQPISEITRPAEQATDELKSEELNELLAEVDELKTELQKIKAHLGL"
FT   gene            complement(78431..81793)
FT                   /locus_tag="PSHAa0077"
FT   CDS_pept        complement(78431..81793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0077"
FT                   /product="putative sensor protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85186"
FT                   /db_xref="GOA:Q3IF85"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF85"
FT                   /protein_id="CAI85186.1"
FT                   /translation="MSPMNNSKNNKVHNFKLTFWLSLTLIVLVSVVLDRINYNREKDAH
FT                   RLQILSEVSTYRAQLEAILVSNIQLIRGLGVAVAAEPNLQQARFAQIAAPLFETSNELR
FT                   NIGGAPDMVINMIYPLAGNEQALGLNFLDNEAQRIDAIRARDTNKIVMAGPLTLIQGGS
FT                   ALIARVPVYKADKSFWGLLSVVLDLEKVYANAGINELEKQYNVAIQGRHGLGTKGDFFY
FT                   GEPAIIEQDPLEFSLSFQGGNWQLYVAPKKGWSPVSSSIWPLRVAIIIICGLLIWAFLF
FT                   FLKMFNRQQQNEKMLEVMSDLALVGAWSFNLENKQAYWSDMTKKIFKYSPDEQPQWPKD
FT                   LGYFKPGKSREKAAKLIERAIKFGESYEAELEVIDAKGNIIWVLVHGEAEHKNDRCIRI
FT                   FGSLQNIDTRKKIELENNKISLFNEALASLTVNDQILNGQLSQSKGVITQAICQALNVD
FT                   QASIWLFSDNRTQLKPIAFHNINTTTNNNNEPWLQKDIPDFFEAIEHKAIFSAADAQQC
FT                   PILMPIKEHYLKPLKINAMLCAVIPAGSGIIGMVCAEQCNTTRAWAHNEESFLIAVAAL
FT                   VGSLYSSQKRIETEQQLVTAKETAEQAVAAKSEFLASMSHEIRTPMNGVLGMLNIVKNT
FT                   KLDQQQMHHIELAQSSAQSLLNIINDILDFSKIEAGKLDIEKIQFNLPRLLGEVVESFA
FT                   LKAEQNNTILILDATLITVSEIVSDPNRLRQILSNLISNAVKFTFDGKIVVTAKIDETT
FT                   DGTSLVCSIIDTGIGIKPEKHSTLFDSFTQADTSTTRQYGGTGLGLAIVKQLCELMGGE
FT                   VSVTSMLNEGSTFSFSIKIKPKLSKQQDLPSHLIKNKHILIIDSCLLNSTIAKKQLIIW
FT                   QANANTLTDYTAVSAYFKDQATTTLDAILIDYYFFEQAPQSQITEVKNYLAKHSCKLII
FT                   MAPMSYSKDDSTLSLKVDSMIFKPLTPSDLFDSLANDKYIEQQQQQAQLQNKLTETPLV
FT                   NTNEPQVLLVEDNKINQVVAGALLKQAGISFDIAENGREAIKQLNEQPANTYQLILMDC
FT                   QMPEMDGYQATKAIRNGDSGKHYQNITIIALTANAMQGDKEKCLAAGMNDYLSKPLDFS
FT                   ALHPKLQQWLGTQ"
FT   gene            complement(81911..83671)
FT                   /locus_tag="PSHAa0078"
FT   CDS_pept        complement(81911..83671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0078"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85187"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR041080"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF84"
FT                   /protein_id="CAI85187.1"
FT                   /translation="MTDKTFIKGKDRDLESSISTMQNKLKALNINIEEALWLNPVANCY
FT                   SVHIRDQDCGVMFTNGKGANDKASLASALGEYFERLSCNYFFADFYLGEEFAHAEFTHY
FT                   PTEKWFTVTNDEVPEGIMDESLWDYFDPERELNASHLFDFNSGNVKRGICTVPYTRQSD
FT                   NQDVYIPVNVIGNIFVSNGMSAGNTKFEARVQGLSEVFERAIKSRIITEGLCLPIVPEE
FT                   VVKLYPKIYEACEELRSHGFHLRIADASLGGKYPVMSVTLIHPADGSVFASFGAHPSFE
FT                   VALERTVTELLQGRRLDQLDVFQPATFDNDEVASPENTELHFIDSSGLISHDFFRAKAD
FT                   FDFVHWDFSGTTEQEYNFCTDLIHSMGHDIYIMDYTHLNVYACRILVPGMSDIYPVDEL
FT                   IWRNNNEGAKFRETFLSLDQYDVEQWMEIYDSLEEAGHSDIIRAAEFIGLVTDPDTSWD
FT                   TLRIGELKAHLCLAAGNEEAIDWVDWILHTGQVNEDAMRHFRCLKAILEIKYDDEREYA
FT                   DYQDALGLMFGTANVTLAIEIAEGRKLFNGLTFPGLSLTGFTKHAALLDGYRKLHVAKQ
FT                   QHWAREVSDS"
FT   gene            83828..86161
FT                   /locus_tag="PSHAa0079"
FT   CDS_pept        83828..86161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0079"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85188"
FT                   /db_xref="GOA:Q3IF83"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF83"
FT                   /protein_id="CAI85188.1"
FT                   /translation="MFKVIKRLLLLVVVLGLAGTAVVYGVLSLSLPALDGKGHSEAINE
FT                   PVIISRDVLGQAVIKAQSHNDAAYGLGYAHGQDRFFQMDLLRRNAAGELSEIFGKAALA
FT                   LDKKMRFHQLRKRSQVILKNLPESDKQLLKSYAQGVNEGLAQIGYSSFEYLLTGAQQRP
FT                   WQSEDSLLIIFSMYLDLQSATFERDQALIQIEQQYGKHMLKFLTQPSQYQAALDGSQLA
FT                   PYSAGIPKLPIPKQQTQQSSTVQSSTPAMYAFNSFAASQERGSNNWAVTGALTTTGAAM
FT                   LSDDMHLAMAVPVIWYKAQLNYVHNNVKTQVTGVSLPGAPAIVVGTNNHIAWGFTNGYI
FT                   DTADWVALTSNNKTWQVDEQIALPNNEAETYTLTLSEYGPVKYINGQAYALSWAAHQSY
FT                   AVNMQLLQLEQATEVDDALAIASDVGIPVQNLIVVDSQGSAAWKLMGGIPGRKTPSELS
FT                   VKSTDYSPLWLQNEAQRPVVKNPVSGRIWTANSRVVSAQDNERFGNGGYSLGARATQVR
FT                   DRLFEKQKFVEDDFYQLQLDNQARFLIPWHALLLKQLKADEGNNAAYISAVENWQQCAC
FT                   ASSVGYTLIKHYRDEVINITFSTLQQSLSEKNGTLSYVRRDLEPAVWQLINAQPSSWLN
FT                   PQFSTWEQQLQGAFSQTIAKLSTQYGNNIQGWQWGKVNELVIEHPFAKQIPILARFLNM
FT                   PKTPGFGDSYMPAVQGRSFGASQRFIVQPGHLENAILTVPGGQSGHPLSNFYRAGFSQY
FT                   INAENTPLLPQALVHQIIISPKGK"
FT   gene            86306..87157
FT                   /locus_tag="PSHAa0080"
FT   CDS_pept        86306..87157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0080"
FT                   /product="putative secreted hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85189"
FT                   /db_xref="GOA:Q3IDS0"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS0"
FT                   /protein_id="CAI85189.1"
FT                   /translation="MKKLLPALITGLLLSSAAYADESVVKTQKLSEHIYMLLGQGGNIA
FT                   VSVGDDGIYIIDDQFAKLSSDIKKTISDLQPGSTEFVINTHHHGDHTGGNENFAKAGAH
FT                   VIAHDNVHKRLVAEHGEGSDFLPRISFSHDLKLHFNNEHAHVMHYQHAHTDGDAVIFFN
FT                   KANIVHMGDIFFNFGSLPFVDVDSGGSVDGILAAVDDVVKQIDDNTKVIPGHGPLSDRS
FT                   GLVVYRKLVQKAKDVMLKAMQNKASLEQVLNADPLAELGLEYASWLPKERVTTLFYRSL
FT                   KQ"
FT   gene            87246..88817
FT                   /locus_tag="PSHAa0081"
FT   CDS_pept        87246..88817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0081"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85190"
FT                   /db_xref="GOA:Q3IDR9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR9"
FT                   /protein_id="CAI85190.1"
FT                   /translation="MTVEKTHLEICNLTKEQYPQIKTLMDQAYPDLGGAWPSHTIFRLI
FT                   DQFPEGQIGIVDDGVLVGLALSVQVDYARFSNPHTYEDIADGHDRVFSDTAGDALYGLD
FT                   VAISETHRGMRLGRRLYDARKELCRQYNLRAILAGGRIPRYYNHSNEMTPMEYIAKVDQ
FT                   KELYDPILSFQLANDFQVKRLLKKYLPEDQESVGYATLLEWNNILYEPTDTVINIVKSI
FT                   VRVGAVQWQMRKVESVEEMLKQVEYFVDTVSDYQSDFILFPEFFNAPLMGLTEQVNQTE
FT                   AIRNLAEYTETFKNAMSRMAIEYNANIITGSMPVADGDKIYNVSYLCHRSGKIDEQRKI
FT                   HITPHEQNDWVIQGGDKIAVFETDAGRVGIQICYDVEFPELSRIMAKEGLEILFVPFWT
FT                   DTKNSYLRVRHCAQARAIENECYVVIAGSVGNLPEVESLDVQFAQSAVLTPSDFSFPHD
FT                   ATLNEATTNTEMLLFSDLDMDKLKILHSEGTVRNLKDRREDLYDIMLKKVSDDKKVSAD
FT                   KQKSSF"
FT   gene            88953..89261
FT                   /locus_tag="PSHAa0082"
FT   CDS_pept        88953..89261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0082"
FT                   /product="putative exporter protein (SMR family)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11948170; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85191"
FT                   /db_xref="GOA:Q3IDR8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR8"
FT                   /protein_id="CAI85191.1"
FT                   /translation="MYLIIAGLLEIGWPIGLKISQQSDSRWLGIGIAVAFMVVSGFMLW
FT                   LAQRDIPMGTSYAVWTGIGAAGTFIVGILFYGDAATFGRIAGVLMIICGVITLKISH"
FT   gene            complement(89331..90173)
FT                   /locus_tag="PSHAa0083"
FT   CDS_pept        complement(89331..90173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0083"
FT                   /product="conserved protein of unknown function ; putative
FT                   integral inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85192"
FT                   /db_xref="GOA:Q3IDR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR7"
FT                   /protein_id="CAI85192.1"
FT                   /translation="MQAWRNALQSKLSSNVSVAGVTLSRFIVAGPIAAVYLYGLYQYQD
FT                   TAMPSFNNAFWGFIIGASIMQILATGLMVKLFKMNNYAVGAGLAKSEALVAAILGVLFF
FT                   GSALTLLGWLGVFLGAIAVLLMSGITSIKRFDAKTALLGLACGTCFALTSLWVREGSLN
FT                   SGLLFPHSAAWVLLFVISLQTLILLGYLLLKEPHTLSKLWQYKGTTVAISIFSCVGSIG
FT                   WFSAMSLQHVAYVKTLGQIEVFFTILIAVLWLKQPLKKQDSAGLLLIAVAAILVMLPN"
FT   gene            90432..90815
FT                   /locus_tag="PSHAa0084"
FT   CDS_pept        90432..90815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0084"
FT                   /product="putative membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85193"
FT                   /db_xref="GOA:Q3IDR6"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR6"
FT                   /protein_id="CAI85193.1"
FT                   /translation="MTILIACALLAIVMPYLARIPAVIELNKLGGYDNKHPRQQQTQLT
FT                   GLGARALAAHQNCFESLAVFAVALAVVLGTNNVNAVTETLAMSHIVARVLFCAFYYLNL
FT                   DIMRSIMWFVGISTAIAMIAVSF"
FT   gene            complement(90852..91541)
FT                   /locus_tag="PSHAa0085"
FT   CDS_pept        complement(90852..91541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0085"
FT                   /product="putative ribosomal RNA pseudouridylate synthase"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11720289, 14659742, 14730022; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85194"
FT                   /db_xref="GOA:Q3IDR5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR5"
FT                   /protein_id="CAI85194.1"
FT                   /translation="MSTKIRLAKYIAHAGVCSRKQASRLIDEGAVIVNNRPANHIDHVD
FT                   EQDQITVNGQIIKGTAELIYFAYHKPVGIDCKLDQNDPASLYHHLPTITRVYPIGRLDK
FT                   DSRGLLILTNDGELCNQLIHPDFHQPKRYLVSVNKSIDAEFCTKMAAGVPVDKQITLPC
FT                   SVEKIADKQFSIILKQGLNRQIRKMAHYCGYKVIDLYREQISELTLQTLNLAQGQYIAI
FT                   NKSDIIK"
FT   gene            complement(91554..91739)
FT                   /locus_tag="PSHAa0086"
FT   CDS_pept        complement(91554..91739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0086"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85195"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR4"
FT                   /protein_id="CAI85195.1"
FT                   /translation="MHIIDTLTPLIFIKLKIIKPTAAYKNAYSVAPNTKFIAIYPPSVM
FT                   FTWQLCYNLLHTFAND"
FT   gene            91721..92131
FT                   /locus_tag="PSHAa0087"
FT   CDS_pept        91721..92131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0087"
FT                   /product="putative acetyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85196"
FT                   /db_xref="GOA:Q3IDS5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS5"
FT                   /protein_id="CAI85196.1"
FT                   /translation="MYQLYANNDDCLNQALRQKIVAFNSAHFDAERMSIGYQFLDAQEE
FT                   LVAGISGCVFGNWLQINWLWCSELVRGNGLATKLLVALEAAAVELGATRGQLDTLDFQA
FT                   KPFYEKHGYQVKYQLNNYPRTGTRYFMEKSLI"
FT   gene            complement(92146..92502)
FT                   /locus_tag="PSHAa0088"
FT   CDS_pept        complement(92146..92502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0088"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85197"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS4"
FT                   /protein_id="CAI85197.1"
FT                   /translation="MTLSDYLEKLANEPKSIEFTDTMAIIDTHYRFTPCAFNNHGLLSA
FT                   ASENNGSCKIFAFAKLNQLSKQNTLDCFGQFYHQDVLNNPKGSDHMNIRTFMLAPEVTP
FT                   FLGVTFTGEPLKAI"
FT   gene            complement(92582..93286)
FT                   /locus_tag="PSHAa0089"
FT   CDS_pept        complement(92582..93286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0089"
FT                   /product="putative enzyme with a phosphatase-like domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85198"
FT                   /db_xref="GOA:Q3IDS3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS3"
FT                   /protein_id="CAI85198.1"
FT                   /translation="MIRFNRAIAPVSVLSFDLDDTLYDNRPIIKAAVQAQTDYLNTLPG
FT                   YQHQGLQQWLHCRDCALQQQPKLIEDVTQWRLQTLGLLLAKQGFNADDAKHFASAAYKV
FT                   FAQARSNITVTDDVLNLLDKLATRFTLIAITNGNADVSQFNLNNKFNLVLQAGLHGKAK
FT                   PHNNLFDQAATHLQVPHKAILHIGDSLDSDVQGANNAGCQSVWLNNQAANYTYKGLADI
FT                   EITNINALSHLI"
FT   gene            complement(93298..94245)
FT                   /gene="xerC"
FT                   /locus_tag="PSHAa0090"
FT   CDS_pept        complement(93298..94245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="PSHAa0090"
FT                   /product="site-specific recombinase"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10760161; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85199"
FT                   /db_xref="GOA:Q3IDS2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS2"
FT                   /protein_id="CAI85199.1"
FT                   /translation="MSDNPAPNISDLSDNWRTPITLFSDYLKFERQYSAHTVNQYVSQL
FT                   GFAALYFSKLCDDWFSVQGEHIRRYSMALRSKQLSGRTISLKLSCIRSLYKFLKAKNIA
FT                   KQAHYHNPAVGIKGPKFAKPLPKNLDVDQMARLLEIPDDEPLAIRDKAMMELMYSSGLR
FT                   ISELVGANLQDISAANGEILVRGKGNKERLIPVGSKALNALKKWLIIRPQFANPDEVAV
FT                   FLSSKKNRISVRQVRLRMQEWGIKQGISSQVHPHKLRHSFASHILESSGDLRAVQELLG
FT                   HSSLSATQVYTHLDFQHLAKVYDNTHPRAKKRTD"
FT   gene            complement(94242..94853)
FT                   /locus_tag="PSHAa0091"
FT   CDS_pept        complement(94242..94853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0091"
FT                   /product="conserved protein of unknown function conserved
FT                   in bacteria"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85200"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS1"
FT                   /protein_id="CAI85200.1"
FT                   /translation="MSELNAQQVVDYLQHHPDFLIQHPELLAQLELQQQAQGATSLVHI
FT                   QQRQLREHNTLLKNQIASMNKYAAQNEQVYRLFSLCHQQLCSNNDFDALASNLQDIICS
FT                   NPDISDCRLVKYDTKYAQLVEHRLSNSGHYLGRINQQERDLLFSDTAQSTAIYLIGDIN
FT                   KPIAILAFASNNANHFEPAQDTLFVLDFVVALQSRLLELA"
FT   gene            complement(94850..95680)
FT                   /gene="dapF"
FT                   /locus_tag="PSHAa0092"
FT   CDS_pept        complement(94850..95680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="PSHAa0092"
FT                   /product="diaminopimelate epimerase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="5.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3283102, 3031013; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85201"
FT                   /db_xref="GOA:Q3IEW3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEW3"
FT                   /protein_id="CAI85201.1"
FT                   /translation="MLVNFSKMHGLGNDFVVIDNITQNVFLSRDQIIKLADRHFGIGFD
FT                   QLLMVEAPYSPDLDFHYRIFNADGTEVEQCGNGARCFARFVRMKGLTNKHKITVSTKSG
FT                   NLTLYIEKDGQVTVNMGHPNFEPSKIPLKATKRELTYIIRTEEHTVFSGAVSMGNPHCV
FT                   LEVDDITTAQVDILGPLLENHERFPQRANIGFMQVISKEHIKLRVWERGVNETLACGTG
FT                   ACAAMVIGFIQNKLISTVQVDLPGGSLQIRWNGEGHPVRMTGPAEHVFDGQVAL"
FT   gene            complement(95744..96997)
FT                   /gene="lysA"
FT                   /locus_tag="PSHAa0093"
FT   CDS_pept        complement(95744..96997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="PSHAa0093"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10625645; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85202"
FT                   /db_xref="GOA:Q3IEW2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW2"
FT                   /protein_id="CAI85202.1"
FT                   /translation="MDFFNYKNNQLFAEDVSIASIAQQYGTPCYVYSRATFERHYLAFA
FT                   NATKNHKSLVCYAVKANSNIAVLNILARLGSGFDIVSKGELARVIKAGGDASKVVFSGV
FT                   AKTADEIAYALKLGIKCFNVESVSELERISEVACELNLAAPISIRVNPDIDAKTHPYIS
FT                   TGLKENKFGIDIQTAVSVYQHAASLPGLNIIGVDCHIGSQLTETRPFLEALDKLLTLID
FT                   ELKACNIELTHLDIGGGLGVTYNDEQPPHPSEYAAQVTERLVNYRHLELIFEPGRAIAA
FT                   NAGVLVTQVEFIKQNQDKYFAIVDAGMNDMLRPALYQAWQKIIPVSVRDDETPTHNFDI
FT                   VGPVCETGDFLGKDRELALKQGDLLVQRSAGAYGFTMSSNYNSRPRVAEIMVDGSQHHL
FT                   IRERETIESLYQGEKILP"
FT   gene            complement(96998..97192)
FT                   /locus_tag="PSHAa0094"
FT   CDS_pept        complement(96998..97192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0094"
FT                   /product="putative small periplasmic lipoprotein"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85203"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW1"
FT                   /protein_id="CAI85203.1"
FT                   /translation="MKAIHTSQFKQLLISTVLLSALAGCGQSGPLYLPEQKAEQNKPQD
FT                   VANPATQTEQTNTPKKQEQ"
FT   gene            97340..97663
FT                   /gene="cyaY"
FT                   /locus_tag="PSHAa0095"
FT   CDS_pept        97340..97663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="PSHAa0095"
FT                   /product="putative CyaY, involved in iron scavenging and/or
FT                   transfer to heme"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7567469, 8874804, 10908679, 14653404;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85204"
FT                   /db_xref="GOA:Q3IEW0"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEW0"
FT                   /protein_id="CAI85204.1"
FT                   /translation="MTDHEYHQLAEALMFTIEEQVDDCEADLDYESAQGILELIFPDNS
FT                   KIVINKQAPLHQVWVATKFNGHHFELRGDKWIDNRSGAEFWQFINEASTRQAGQDVKWQ
FT                   SSL"
FT   gene            97645..98316
FT                   /locus_tag="PSHAa0096"
FT   CDS_pept        97645..98316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0096"
FT                   /product="putative phospholipase/carboxylesterase family
FT                   protein"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85205"
FT                   /db_xref="GOA:Q3IEV9"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEV9"
FT                   /protein_id="CAI85205.1"
FT                   /translation="MAIIVMSLEFVEYPAQGEHKATVIWLHGLGDSGEGFAPVAPQLQL
FT                   PNELGLRFIFPHAPVQPVTINGGMEMRSWYDIKSIELDKRADEQGVRDSAAKVEQLINQ
FT                   EIANGIAADKIILAGFSQGGVVALHLAPRFEQKLAGVMALSTYMCVPEKLADEALHTDL
FT                   NIFMAHGSQDNVVPPSAGKSAFEVLTALSMDVSWQEYPMAHQVCAEELQAIRHWLIARL
FT                   S"
FT   gene            98339..99244
FT                   /locus_tag="PSHAa0097"
FT   CDS_pept        98339..99244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0097"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85206"
FT                   /db_xref="GOA:Q3IF66"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF66"
FT                   /protein_id="CAI85206.1"
FT                   /translation="MSQKIVIKANVKREPQESVTTLTYEWNWRRIVSISMLLLMTSAAV
FT                   IYGLTSAVSAEQDEHPNEPEDRVLAQSNDISQRAVTSLQTTQVELNTSATVASQNSESE
FT                   LLVAPINLVAEQKVAEPDKVAAAELPVIPQAEIKNNSPEPVNIEQVPTTDLLVDTDVAA
FT                   ISDTALSSTQGFAPLAQLASVALGAQIDTDKISRAVLTRKVSKREPVNVFAADIRLSQF
FT                   DETLSFFSELKNLQGQQVKHVWFFEDDIVAEIELDITSSRYRTYSTKNIMDSQIGQWRV
FT                   DVIDEQGQLIAQKEFRILAD"
FT   gene            99281..100219
FT                   /gene="hemC"
FT                   /locus_tag="PSHAa0098"
FT   CDS_pept        99281..100219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="PSHAa0098"
FT                   /product="hydroxymethylbilane synthase (porphobilinogen
FT                   deaminase)"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.5.1.61"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8117733, 8874804; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85207"
FT                   /db_xref="GOA:Q3IF72"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF72"
FT                   /protein_id="CAI85207.1"
FT                   /translation="MTQTTNIVRIATRKSALALWQAEFVKAQLEHYHPGILVELVPMST
FT                   QGDIILDTPLAKIGGKGLFVKELEQAMLEGLADMAVHSMKDMPVEFPEGLTLHTICERE
FT                   DPRDAFVSNNFANIDELPQGAIVGTSSLRRQCQIRASRPDLKIHDLRGNVNTRLAKLDS
FT                   GQYDAIILAAAGLIRLEMKDRIRAYIEPEVSLPANGQGAVGIECRTDDEAIKALLAPLE
FT                   HSETRIRVNAERAMNRHLEGGCQVPIGAYALVNGDQVHLRGLVGAIDGSEILRDEVSGH
FT                   VNDAEKLGVELAKMLLAQGADRILAEVYRDA"
FT   gene            100219..102069
FT                   /gene="hemDX"
FT                   /locus_tag="PSHAa0099"
FT   CDS_pept        100219..102069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemDX"
FT                   /locus_tag="PSHAa0099"
FT                   /product="uroporphyrinogen-III synthase HemD (N
FT                   terminal)/Uroporphyrin-III C-methyltransferase (C
FT                   terminal)"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="4.2.1.75"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3062586; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85208"
FT                   /db_xref="GOA:Q3IF71"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF71"
FT                   /protein_id="CAI85208.1"
FT                   /translation="MLNILITRPQGKGAALAQQLEQAGYQASLFPVLKIEYLTPDSIEL
FT                   SPLTNADKIIFVSQDAVLALSELKPDINIKAQFYGVGQQTADTIYEVFGVRAAVPKQHD
FT                   SEGLLALKSLADVDSCNIVLVKGIGGRPDIAKTLKQRGAFLNNCVVYQRTPIDPEPNNW
FT                   IDHWQSQNVHGIVITSNAAVDAIFKNLAAPQRQWLQQCRFYVASERIGAYLQQHQVSSA
FT                   NIHIAAGASDNAMFTCINQQGSKMSEQSVPSTVDKAAQKTTNATANNGKATAKSDTLKA
FT                   TDKADNTKQRVSKVGSLALIISLIVASGVGFEFYQKLNASKTQSLAVNQLNEQNKLLQQ
FT                   ELQALKLAQANLQQTLLTSEQKVTAAMRESTTKNQQELKAALQQAQQQGSSLNPQEVTS
FT                   LQRMAEFKLWAENDYQGTSAVLKRLDALLSDHPGTITVRQAITQDIQTLDAIKPIAVEA
FT                   IYLQLSSVLKNIDELVFNAVNLPEEVAKIDDKVLSEDLSDWQQNLKNSWDQFLDGFITI
FT                   RHREGVAIEPLLSEQQRHLVNQRVKLYITQAQDALLSKHASVYFAALSEAKRLVAEYFK
FT                   QDDDVTKMVLKSLSNLEKEQLNFNPKVNLQSTQQVKEWAK"
FT   gene            102066..103172
FT                   /gene="hemY"
FT                   /locus_tag="PSHAa0100"
FT   CDS_pept        102066..103172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="PSHAa0100"
FT                   /product="putative HemY (Uncharacterized enzyme of heme
FT                   biosynthesis); by synteny may be involved in heme
FT                   biosynthesis or transport"
FT                   /function="5.2 : From other organisms"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12864856"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85209"
FT                   /db_xref="GOA:Q3IF70"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF70"
FT                   /protein_id="CAI85209.1"
FT                   /translation="MIGLIILIIALVVVLAAAPFLLDEKGYVLISFNNTTIEGTIVSFA
FT                   VLTIAVLVVSYLTYKLVRYLFSIYRNTKHSFFARSQGRKQAAIEQALWSVINDDYAQIE
FT                   QALSSKVPDQYQDIRLALLAKAALANNQTDKALEYLFDINPEQQLKVAKLWLASGNSSA
FT                   IESQLRVIAESKKATALELKIYTEVLVQQQHFSALEAFLPRLLRKKVLTNEQWHRVFNA
FT                   YFASFPVDEVTAKYKQLPKKLHSYAYSAYLTQMAAAGQLSVIENDLIKMVKHEEQHAQL
FT                   ANILSKATTANARKLQTSIQDRLKKDEQNNSLLLALACLANAQGDYDLAARVFDKALNN
FT                   ENKKQYMQQAKLSYEKSAQLDKALVLYK"
FT   gene            103222..105912
FT                   /locus_tag="PSHAa0101"
FT   CDS_pept        103222..105912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0101"
FT                   /product="putative sensor protein; similar to LuxQ in
FT                   Vibrio harveyi, similar to ArcB sensor in E. coli"
FT                   /function="1.3.1 : Sensors for chemicals"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85210"
FT                   /db_xref="GOA:Q3IF69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF69"
FT                   /protein_id="CAI85210.1"
FT                   /translation="MKGLFKLSFSLACAYFITGYFSNLLLAIDGFAVASWPPAGIAVAS
FT                   FLLWGRKSFLGIFVGALLTSLIHLDNVVDILNWQVFFQAAAIAIAVVFQAWLGAQIIIK
FT                   VIKAPLDLSSLKHSVQSLIIAGPVCCIIGASVGTSLLVFNNIIAQHAALDSFIAWWIGD
FT                   SIGVLIFTPLMLAAFNYSVMRYRLQVILPSLLIYILISVSFYGAASVKKEKNIQKQEIK
FT                   TLAVQDSITHKLDEISAHLALLATFFSSSEDVNFKEFRQFTAKQLSYSEEILAFEWVPY
FT                   VPKSALLEYQQMTQLADVEHFFVKEKSPTNQWQAVAERDVYYPIRYAYPLKGNEDAIGF
FT                   DLASNDFMQEALNKSKTLNEMVISQPVKLVQNQAELGVLFLHPVFGSMETEDDFKGFAV
FT                   AVVSLKKLSQSLLFDHENLVTASFLDINNTNNTHAIYIANNESMDLLKSYQLLIGNRMW
FT                   QVELHEPLVTTSWLIYWLAQIVGMLFVWLLVAFLISVTGTNVQIREQVARQTRTLRQEK
FT                   QKADEASQIKSQFLANMSHEVRTPINGIKGLHYLALQQNDWQQARTYIEQADGALGVLL
FT                   RVLNDLLDFSKMEAGKLDLMQEPVDIGRLAEEVINLIQFEVSVKSLEIKLDYDKNTNLM
FT                   INTDAIRLKQVLLNLLNNAVKFTAQGSITLKIWQSKTMTYLSVSDTGIGISKEAQKKLF
FT                   RPFAQADNSTSRQYGGTGLGLSICKKLVELMGGAIDLKSTAGQGSTFTFSLPLNSPLPK
FT                   VEKSEQSFSDVDIENVSFANSAVLLVEDNPLNQHVATAILKTKGCVADIANDGFAAIEM
FT                   LTEKSYDIVLMDIQMPKMDGLQATKVIRNELGLLDLPIIGLSANAHDDDVKKALACGMN
FT                   SYITKPIDANILFKALWHYLAAIEK"
FT   gene            106040..107041
FT                   /gene="add"
FT                   /locus_tag="PSHAa0102"
FT   CDS_pept        106040..107041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="PSHAa0102"
FT                   /product="adenosine deaminase"
FT                   /function="2.3.1.4 : Salvage of nucleosides and
FT                   nucleotides"
FT                   /EC_number="3.5.4.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11330670, 11440125; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85211"
FT                   /db_xref="GOA:Q3IF68"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF68"
FT                   /protein_id="CAI85211.1"
FT                   /translation="MINRKLPLLDIHRHLDGNVRAQTILELGRQFNITLPADNVAALIP
FT                   HVQVIDPEPNLMAFLQKLDWGVTVLGDYDACRRIAIENIEDAQAQGLDYVELRFSPYYM
FT                   AQSQGLHPQGVVEAVIDGIKSATKGANVKANLIGILSRTYGVKVCQQELDALLAFKDDL
FT                   VAVDLAGDEIGFPGELFVEHFKQVHDAYLAATIHAGEALGAPSIWQAINELGASRIGHG
FT                   VKAIEDIELMNYLRDKRIGIESCLTSNIQTSTVNDLAQHPLKQFLDHGILACINTDDPA
FT                   VEGIEIEHEYLVAAPQAGLSQADIEKAQANALEIAYLSYSDKKALLTMASTR"
FT   gene            complement(107138..107548)
FT                   /locus_tag="PSHAa0103"
FT   CDS_pept        complement(107138..107548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0103"
FT                   /product="conserved protein of unknown function ; could be
FT                   a dehydrogenase; putative inosine binding site"
FT                   /function="5 : Similar to unknown proteins"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85212"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF67"
FT                   /protein_id="CAI85212.1"
FT                   /translation="MLNTKVKDFMQHKLPNITPDTEMTTAIAELQKFKLLGAPVFDSNK
FT                   FLVGFISEQELLKPLMQSSYFCDGVVKVSQLMQTEVVTVNGDTNIIELAEQMRPGKPKN
FT                   YPVVDGEKVIGMISRADILKALYDNYLACQTH"
FT   gene            complement(107724..108437)
FT                   /gene="fre"
FT                   /locus_tag="PSHAa0104"
FT   CDS_pept        complement(107724..108437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fre"
FT                   /locus_tag="PSHAa0104"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /function="2.5.14 : Other"
FT                   /EC_number="1.16.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10960098, 12054743; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85213"
FT                   /db_xref="GOA:Q3IDJ9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ9"
FT                   /protein_id="CAI85213.1"
FT                   /translation="MQTLKAEVVAISPLTEFVHKVILKPQQPVSFEAGQYMHLVLSEND
FT                   KRAFSIASRPSQCDQIELHIGASGTDTYAMQSLEHLRNALNEKQLIEIEAGLGISQLRL
FT                   QCERPIILLAGGTGFSYAKSMADHLAEISCDRPVLLYWGVREESALYAHREMQVWADSH
FT                   KNFQFIPVVENPSPDWQGHTGYVHKAVMQDIVSLAPYDIYMAGRFDMIGIVRDDFIAHG
FT                   AIRENMYADAFAFIK"
FT   gene            complement(108538..110004)
FT                   /gene="ubiD"
FT                   /locus_tag="PSHAa0105"
FT   CDS_pept        complement(108538..110004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="PSHAa0105"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxylyase;
FT                   ubiquinone biosynthesis, third step"
FT                   /function="1.4 : Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /function="2.5.4 : Menaquinone and ubiquinone"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9658014, 11029449; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85214"
FT                   /db_xref="GOA:Q3IDJ8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDJ8"
FT                   /protein_id="CAI85214.1"
FT                   /translation="MKYKDLRDFIDLLEKRGELKRITQEIDPYLEMTEIADRTLRAKGP
FT                   ALLFENPKGYDIPVLANLFGTPKRVAMGMGQEDVSELREVGKLLAFLKEPEPPKGIKEA
FT                   LGQIPVYKQVLNMPAKEVKKAPCQEVILQGDEVDLTKLPIQHCWPGDAAPLITWGLTVT
FT                   KGPYKKRQNLGIYRQQLLGKNKIIMRWLSHRGGALDFQEWCKENPGQPYPVSVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSKTEVVKSISNDLQVPASAEIVLEGYIMPGEMAP
FT                   EGPYGDHTGYYNEVDDFPVMTVTHMTHRKNPIYHSTFTGRPPDEPAILGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRMAIVTMKKQYPGHAKRVMMGVWSYLRQFMYTKFVIVCD
FT                   DDINARDWEDVIWAITTRMDPARDTTLIENTPIDYLDFASPVSGLGSKMGMDATNKWPG
FT                   ETNREWGEPIEMDKATKDRVDDIWQSLNIL"
FT   gene            complement(110165..110446)
FT                   /locus_tag="PSHAa0106"
FT   CDS_pept        complement(110165..110446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0106"
FT                   /product="conserved protein of unknown function, possibly a
FT                   lipoprotein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85215"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ7"
FT                   /protein_id="CAI85215.1"
FT                   /translation="MKALLIIALTVLGLSACNEPTINTRYLCNQKEATLSVINEQTAAL
FT                   TLNNNTYQLSREKSASGNKYINKNVLFWSKDSEAMLIIEGTKYHCLQQ"
FT   gene            110587..111492
FT                   /locus_tag="PSHAa0107"
FT   CDS_pept        110587..111492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0107"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85216"
FT                   /db_xref="GOA:Q3IDJ6"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ6"
FT                   /protein_id="CAI85216.1"
FT                   /translation="MAGTNLLTLLDDITVLLDDIATMSKVATKKTAGVLGDDLALNAQQ
FT                   VTGVAAERELPVVWAVAKGSFLNKAILVPAALLISVWLPWLITPLLMLGGLFLCFEGAE
FT                   KVFAKFLPHDDKSESEGDKLDLVEYEKQKVKGAIRTDFILSAEIIVITLGTVAAATLIN
FT                   QALVLCVIAIIMTIGVYGLVAGIVKLDDAGLYLLNQSKLSANKFKEILGKGLLAAAPRL
FT                   MQFLAFAGTVAMFLVGGGILVHGIKALHHIQIAVTNYGQTIVGTTGEVLAPLIFDGLLG
FT                   VIAGLVVVLGHLAYLKIFKK"
FT   gene            complement(111581..113656)
FT                   /locus_tag="PSHAa0108"
FT   CDS_pept        complement(111581..113656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0108"
FT                   /product="putative TonB-dependent receptor; putative outer
FT                   membrane bound protein involved in iron chelated transport"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85217"
FT                   /db_xref="GOA:Q3IDJ5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ5"
FT                   /protein_id="CAI85217.1"
FT                   /translation="MKLSPLFIALLASTTASVYANATDIEHIEVKGSYFNDYKVDNANG
FT                   AMRTSASLLDTAQSVTVITDTIVNEQLATTLGEVLTNDASLTPGSKQRNREVFNLRGFE
FT                   LSSSTGYLRDGHQHWSHYQQPIEILQQVEVIKGPSSILYGQSGPGGLVNMVTKKPTSQT
FT                   LFKASADVDQHGSTRFMLDAGGALTESEDLRARGILVKQDVDYWREYQNGENRERDRFL
FT                   GALIVDYDISDNALVRVHYDRTDDEAGLDTGAWIDSNANVIGDDKTIRDMSWAFTDITV
FT                   ENLGVDLEVFLTENWQVKLGYNEQTFERQRFESAPRKPSNFIEGDSYASRPYDRFDDWQ
FT                   FKTAFVDFIGEFETFGIQHQFLIGANSLDYYYGQLKTNAESFDFSAGQNEPFRPAISYK
FT                   TDDTVSSSAYDYYGIYMQDLISFSPEWQLSLGGRYDKQSKENSNNESFVPKVGVLYHPN
FT                   ASATIYASYSEGFEPQNETLVNTNDVNNGMKLDAITSEQKEIGIKWQLFDDRLMLSGAL
FT                   FDISKTGTLVSEDLVNPVDNITSITTQAGEQRHKGFELAAQGAATDRLFVMASTMYLDA
FT                   NYERDATLQGKRPTDAPKWSASLWTRYELNDVIALNAGAFYEGERFADNANTVTKDAYT
FT                   RVDVGATYKINLNNTDVNLRLNIENLFDTNYLAGGGLNNVTIGEGASVRLAAQFSF"
FT   gene            113841..115229
FT                   /gene="dbpA"
FT                   /locus_tag="PSHAa0109"
FT   CDS_pept        113841..115229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PSHAa0109"
FT                   /product="putative ATP-dependent RNA helicase; putative
FT                   cold-shock protein; could be specific for rRNA folding"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12460566; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85218"
FT                   /db_xref="GOA:Q3IDJ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ4"
FT                   /protein_id="CAI85218.1"
FT                   /translation="MTTTAFSSLALPSGLVDNLSTLGYTHMTPVQAQSLPPVLAGKDII
FT                   AQAKTGSGKTAAFSLGVLAKLNVKRFRIQSLVLCPTRELAEQVAVEMRKLARGIHNIKI
FT                   LTLCGGVSIGPQIGSLEHGAHIIVGTPGRVDDHIRKGTLRLDDVETLVLDEADQMLDMG
FT                   FQDTLDAIIERIPTNRQTLLFSATFPRAIEAVAKRVLSNPVMVKVEEEQAKSTIKQYFY
FT                   KMDNNKQRYPTLKLLLLKFTPQSCVVFCNTKVETQQLCDDLVDEGFSAVSLHGDLEQRD
FT                   RERTLIHFSNKSASILVATDVAARGLDIDDMDMVINYHLAHDTQTHVHRIGRTGRAGKK
FT                   GIACSIYGEAEAFKIAQIGDHYERDVIPEPMPSFSLLEKPPYKPEMVTLMLDSGKKQKV
FT                   RAGDILGALTGKDGIAGRQVGKINVLDNVAFVAVERNSSKPALRKLTEGNIKGRKIRAR
FT                   RLTC"
FT   gene            complement(115260..115787)
FT                   /locus_tag="PSHAa0110"
FT   CDS_pept        complement(115260..115787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0110"
FT                   /product="putative DnaJ-class molecular chaperone"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type mc : molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85219"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021059"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ3"
FT                   /protein_id="CAI85219.1"
FT                   /translation="MVHTLAAELQQRKMINTLDVAPDRDLFKRNFLIMNALYQLQQQIM
FT                   PKQQLLISGLQIQLITTASNTLIKNTDPLRDYYLDWQNFETSSAEIDTLLTQFWQRFTK
FT                   HSKSAQIIDLDTHKQLLIKWQLSQQSTLKEVQKRWRQLALQCHPDKAVGNAEKFKQLKG
FT                   EYEQLRASCSVD"
FT   gene            115918..118746
FT                   /locus_tag="PSHAa0111"
FT   CDS_pept        115918..118746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0111"
FT                   /product="putative membrane bound sensor or esterase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85220"
FT                   /db_xref="GOA:Q3IDJ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ2"
FT                   /protein_id="CAI85220.1"
FT                   /translation="MQGWLQRFFFVGFMAVCSIFSTLSFSVTPADLFEQFKSAESWSDK
FT                   QSFASTLLTKKNLPHQQRIAIYSDLAELAFNANDLPHALEYYKLLESSITFNELPDLYF
FT                   RAIKMQGVVLYYQGFVQQAVVDYSRALGLAIRLKGSLKQANLLSNIGLAYFDMYNMELA
FT                   LDYYQQAKLIYEKEGSAQDKADILHNIAGIYIRLSRYESALEMYREVLKVFQQLGDEDG
FT                   VAQVYGNMGVAYTESKQYQLALHYNQLALRYYQSINNAFQLSTKHANLASINLHLNKFD
FT                   VALYHAKAAQQFALDAGNKSLLAAALHVLATAQFAQGDIENAKTTSEHSIALAKEYKNG
FT                   MRIKDGLGIEALIYSSLGDFKQALQLHQQYVDYQRSINTEEASKAVSIFQTQFEADKLN
FT                   QEIKQLKQQQHLQQLEISKRSQLTILLGIVAILILITVIAIYRRRIESNAKLQLTEQVE
FT                   QRTLELQSVAQELREANDVKSQFLANISHEIRTPLTAILSQTDDLINGLYDPEQLQDEL
FT                   KVIQRQSEHLKSLINDVLDLSKIEANRLELSISCFDIVQVLNDIHGMFSVQAKAKNLSL
FT                   VFDNQLGDELYTRLDLTRVKQILINLCANAIKFTHSGQVTIVANNTEQGLVLTVKDTGI
FT                   GMNTAQLKLIFECFSQADNSISRRFGGTGLGLSLSQQLAAMMGGYISVQSEFKKGSQFS
FT                   FFVPCVPVDKSECAVTAKDNINGDYKALSAKVLLAEDHDDNRRLISRYLRAMGLDVIAV
FT                   ENGEQAVEQCLKEYPDFVLLDIQMPIMDGITAFELLRQCGYEQPIFALTANAMSHEIEQ
FT                   YLALGFTDYLAKPIDKEKFYSTIAEHLASIKNEQNSTSVNIDMSDLVTSFKQSLSIESE
FT                   LISQHFNSGDFVALQKDSHRILGAAQMFKLCDIADAAKALDDACKSPEEVQNIAVLVDK
FT                   LQALFLHYKEHG"
FT   gene            complement(118846..120105)
FT                   /gene="rho"
FT                   /locus_tag="PSHAa0112"
FT   CDS_pept        complement(118846..120105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="PSHAa0112"
FT                   /product="transcription termination factor Rho; polarity
FT                   suppressor"
FT                   /function="3.2.1.4 : Termination"
FT                   /EC_number="3.6.3.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10966472, 12887917; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85221"
FT                   /db_xref="GOA:Q3IDJ1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ1"
FT                   /protein_id="CAI85221.1"
FT                   /translation="MHLRELKDKSIKELVDLAESMGLENVARLRKQDIIFAILKSHAKG
FT                   GENIFGGGVLEILQDGFGFLRSSEASYLAGPDDIYVSPSQIRRFSMRTGDSISGLIRPP
FT                   KDGERYFALLKVNEVNFDKPENSRTKILFENLTPLHANERFRMERGNGSKEDITARVLD
FT                   LASPIGRGQRGLLVAPPKAGKTMLLQNIAQSITHNHPDATLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHKPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLNRKIAERRVFPAIDFNRSGTRREELLTKPDELQKLWILRKIVHDMSEIDAMEFL
FT                   IDKLSMSKTNDEFFDSMKRQ"
FT   gene            complement(120291..120617)
FT                   /gene="trxA"
FT                   /locus_tag="PSHAa0113"
FT   CDS_pept        complement(120291..120617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="PSHAa0113"
FT                   /product="thioredoxin 1, redox factor"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85222"
FT                   /db_xref="GOA:Q3IDJ0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ0"
FT                   /protein_id="CAI85222.1"
FT                   /translation="MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSE
FT                   VAEEFDGRVTIAKLNIDQNAGTPPKFGIRGIPTLLLFKDGQVAATKVGALSKTQLIEFL
FT                   ENNL"
FT   gene            120724..121986
FT                   /gene="rhlB"
FT                   /locus_tag="PSHAa0114"
FT   CDS_pept        120724..121986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="PSHAa0114"
FT                   /product="ATP-dependent RNA helicase with nucleoside triP
FT                   hydrolase domain, putative cold-shock protein"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14981237; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85223"
FT                   /db_xref="GOA:Q3IDI9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI9"
FT                   /protein_id="CAI85223.1"
FT                   /translation="MTDKKFSDFAIAPEVVAGLTESGFEYCTPIQAKCLPFICEGRDIA
FT                   GQAQTGTGKTLAFLTATCHRLLQSSKAPSKHPRALIMAPTRELAIQIHKDAKILAPHCN
FT                   LNLGLVYGGEDYEKQRAQLEKGVDILIGTTGRLIDLYKQGCYTLNEIEVVVLDEADRMF
FT                   DLGFIKDIRYMFHRMPDTSKRLNLLFSATLSYRVQELAFEHMTNPEHVQIEPDVKTGKR
FT                   IQEELFHPSQEDKIKLLLTLIEEEWPEKAIIFANTKHSCETVYAWLKADGHRVGMLTGD
FT                   VNQKKRQSILAEFSKGDLDFLVATDVAARGLHIPEVSHVFNFDLPDDCEDYVHRIGRTA
FT                   RAGASGHAISFACEQYAYNLHEIEEYIDHSIPLSHYDKTALLDDLTKPTIHRKRNFSTG
FT                   PRNRSNNSGRRPNNSYQKGRS"
FT   gene            122098..123525
FT                   /gene="gppA"
FT                   /locus_tag="PSHAa0115"
FT   CDS_pept        122098..123525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="PSHAa0115"
FT                   /product="Guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase (Guanosine pentaphosphate phosphohydrolase)
FT                   (pppGpp-5'-phosphohydrolase)"
FT                   /EC_number="3.6.1.40"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8394006; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85224"
FT                   /db_xref="GOA:Q3IDD5"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDD5"
FT                   /protein_id="CAI85224.1"
FT                   /translation="MLIAKSIAGGLQTIGRVKRKVRLAAGLDIDNVLSSEAMHRGWECL
FT                   ALFAERLQDIPKQNITIVATATLRLASNADVFKAQAEKILGHKVNVISGELEARTIYKG
FT                   VAHTSSCTGSQLVIDIGGASTEVIIGKNFDALLYKSLNIGCVTYLERYFKDCKLSNANF
FT                   NTAIKAARTVIDEIASEYKVKGWQIASGASGTVQAIQEIMIAQNLDELLTLEKLYTIKK
FT                   QSIAYKTIAALDLPGLSEDRRLVFVSGLAILIALFESLEIEKMGLAGGALREGVLYSML
FT                   PELHNSDIRKRTIDGFIDRYHVDQKQASRVASLVLNLASEVNESWPIKALNGLPLLTAV
FT                   AQLHEIGLLIEYKQYHKHSAYILKNTEMPGFSQSEHKVIVAVAKGHRSDLQKGYFDSLG
FT                   ANSVLAQYLVRLIRIAVILCMRRQDDVLPEFAITVKDDVLNLQFENDWLKNHPLMASEL
FT                   QQESKQQAKLGWKLIVN"
FT   gene            124066..125593
FT                   /locus_tag="PSHAa_rRNA16s7"
FT   rRNA            124066..125593
FT                   /locus_tag="PSHAa_rRNA16s7"
FT                   /product="16s"
FT   gene            125895..128784
FT                   /locus_tag="PSHAa_rRNA23s7"
FT   rRNA            125895..128784
FT                   /locus_tag="PSHAa_rRNA23s7"
FT                   /product="23s"
FT   gene            128928..129044
FT                   /locus_tag="PSHAa_rRNA5s8"
FT   rRNA            128928..129044
FT                   /locus_tag="PSHAa_rRNA5s8"
FT                   /product="5s"
FT   gene            complement(129336..131405)
FT                   /locus_tag="PSHAa0121"
FT   CDS_pept        complement(129336..131405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0121"
FT                   /product="conserved protein of unknown function ; putative
FT                   acetyltransferase domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85225"
FT                   /db_xref="GOA:Q3IDD4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD4"
FT                   /protein_id="CAI85225.1"
FT                   /translation="MQDYKLYKKQLIQLEQQLAGAHHRQLVLVTGNDNWCYELTNSLVQ
FT                   NTNTLTLSKHCALKNAQWPAHIHQILGQEFTHAIYDGFSGLYPDKLAAIAGTVRAGGVL
FT                   FVLLPELGNLNNWQDPALKSVQSHGHSNQYSLFNQRFSSIIKSLPALHYSEEFGCINNN
FT                   YNYVLHSNIDFEPQKNCVAQIVKVAHGRANRPLLINADRGRGKSAALGLAAAKLADKNV
FT                   IICATQFRATHSSFKHLAAQLNVNYDPLQKQLANMQYIAPDALLNELPECDVLLVDEAA
FT                   AIPVPMLLSMLAHYPRIVFASTLVGYEGNGRGYTIRFSQYIKNHYKASKVITLDEPLRF
FT                   AKHDPLEQHIRSLLALDAQYQETNSNKSQIPKHSEVTQQQLVTDEALLCQVVALLALAH
FT                   YQSSVNDLRQLLDAPSQRIFISKIDKQLVGVCLIAIEGGLSEELTEQVISGERRPQGHL
FT                   MAQTLAQLSFNSDFLTHLSARVVRIAIDPSSHNCGLGKALLSYSESQVKEQCTWFGASF
FT                   GATAQLLKFWQSLGFNAVKLGYQRDKSTAEHATLVVKSLNAPQQSLQSLIKQFQYELFY
FT                   GLLSHFKSLEWQLVSTLLRSFNDEVIASDTLRLFTQQLSSNRFTISPTLWRLISQSPAA
FT                   MTKLASNQQQLLIQTVLQHHTDEQLIKNLNLNGKKQLEQQFRNTTNILAKQLSS"
FT   gene            complement(131383..133548)
FT                   /gene="uvrD"
FT                   /locus_tag="PSHAa0122"
FT   CDS_pept        complement(131383..133548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="PSHAa0122"
FT                   /product="DNA-dependent ATPase I and helicase II; highly
FT                   similar to PSHA_1_2804"
FT                   /function="3.1.1 : DNA replication"
FT                   /function="3.1.2 : DNA recombination"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12527299, 12788954; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85226"
FT                   /db_xref="GOA:Q3IDF8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF8"
FT                   /protein_id="CAI85226.1"
FT                   /translation="MDVSQLLDGLNDKQRDAVAAPLQNMLVLAGAGSGKTRVLVHRIAW
FT                   LMQVEQASTYSIFAVTFTNKAAKEMRTRVEETLKAPVGGMWIGTFHGLSHRILRAHHRE
FT                   AKLPEAFQILDSDDQLRMIKRLLKSMNIDDKKWPAKQFGWYISAKKDEALRPKDIQAYD
FT                   INEQMMLRVYAAYQEACDRAGLVDFAEILLRSYEVLKNNPTLLRHYQQRFAHMLVDEFQ
FT                   DTNTIQYAWLKLLAGDSNSIMIVGDDDQSIYGWRGAKIENIKRFLTDFSAETIRLEQNY
FT                   RSTATILKASNALIQNNSERMGKSLWTDGNEGEPISIYAAFNELDEARFVSSKLRSWLN
FT                   AGNALQDAAILYRSNAQSRVLEEAMLQEGLKYRIYGGMRFFERQEIKDALSYLRIIGNR
FT                   QDDAAFERVINTPARGIGDKTLSHIRDCARAESLPLWYAAKAIVEQQHLSGRASGAVSK
FT                   FVELVEHIEDKISDLTLHEQAKYVIQTSGLMAMYQAEKGEKGRARVENLEELISACDQY
FT                   ELPEEEEYSSPLQGFLAHTSLESGEGQAEEHEDAVQMMTLHSAKGLEFPLVFMVGVEEG
FT                   MFPSQQSNEESGRLEEERRLCYVGMTRAMDKLYISHAESRRLYGQEKYHTPSRFLREIP
FT                   EDCVEEIRIKTQVSRPPAAGRFSASVSHAAFEDSGFNLGQRVLHAKFGIGTVLNYEGAG
FT                   AQSRVQVNFDDLGSKWLVTAYARLQAI"
FT   gene            133863..134081
FT                   /locus_tag="PSHAa0123"
FT   CDS_pept        133863..134081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0123"
FT                   /product="conserved protein of unknown function ; putative
FT                   unknown membrane associated protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85227"
FT                   /db_xref="GOA:Q3IDG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG4"
FT                   /protein_id="CAI85227.1"
FT                   /translation="MSGQGSGGNVIAALCNIFFPGLGQLVQGRILAALIFAILFFGGAA
FT                   LWFLIVPGIIAAIVYVWAIIDAARYRS"
FT   gene            134118..134564
FT                   /locus_tag="PSHAa0124"
FT   CDS_pept        134118..134564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0124"
FT                   /product="conserved protein of unknown function (similar to
FT                   E. coli YacL)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85228"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG3"
FT                   /protein_id="CAI85228.1"
FT                   /translation="MALFCFLASAAIYVYNCATNDLKAIRMEYQFIRDPISGLRIKISS
FT                   EHAIIGRWLNEEIGKDKIAMVQALIASVSSSFEPLTLKGQEIDLILTKDEALFEAHALH
FT                   QDSEDLMAYQDDDLMLEENGLSSGCGFEDFIDLINSWHEFTTSR"
FT   gene            134671..135294
FT                   /locus_tag="PSHAa0125"
FT   CDS_pept        134671..135294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0125"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85229"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG2"
FT                   /protein_id="CAI85229.1"
FT                   /translation="MSANLNKLVVMLEMQNAMNTKVHDQWFSQGFDWYRAIWVECAEML
FT                   DHYGWKWWKKQTPDTEQVILELVDIFHFGLSLRIDGITSYEKIAKQLELELSTAHQADD
FT                   FKQTLEVLAASAVADKTFNAAAFAGCMAQIGMNIDDLYRGYVGKNTLNFFRQDHGYKDG
FT                   SYIKVWGGQEDNEHLVEVVKSLNTEHADFAKLVYEGLEARYPTK"
FT   gene            complement(135310..135957)
FT                   /locus_tag="PSHAa0126"
FT   CDS_pept        complement(135310..135957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0126"
FT                   /product="putative hydrolase, contains a phosphatase-like
FT                   domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85230"
FT                   /db_xref="GOA:Q3IDG1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG1"
FT                   /protein_id="CAI85230.1"
FT                   /translation="MLNWSKIDTVLLDMDGTLLDLHYDSHFWLNVIPQQHALAKNISFE
FT                   AAQADISKRYQAVSGKIQWYCSDYWEQQLNLPIMELKRQSKHLIKVRDDVPYFLTELKK
FT                   AGKELILLTNAHPECVMLKFEQTAIDNYLDGVVSTHEYGVSKEQQSLWQQVQSDLGFNK
FT                   SRTLFVDDSVPVLNAARQYGIEHLLAVANPDSQQPHNDIADYLNVTDYRKLI"
FT   gene            135981..136592
FT                   /gene="nudE"
FT                   /locus_tag="PSHAa0127"
FT   CDS_pept        135981..136592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="PSHAa0127"
FT                   /product="ADP compounds hydrolase nudE"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9452430, 11567017; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85231"
FT                   /db_xref="GOA:Q3IDG0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG0"
FT                   /protein_id="CAI85231.1"
FT                   /translation="MIKHNCHDSKLTPMTQKKHPIPPQILSNKVVAKSRLFTVESLELK
FT                   FSNNEERQYERIRGGGRGAVMIVPLTKDNELLLVREYCAGTNDYQLGFPKGLIDPGETP
FT                   EQAANRELKEEVGFGADYLKRLKAVSIAPSHFNTTMHIMVAKQLYSQTLPGDEPEPLVV
FT                   VKWPLTDWRSLLTQDDFTEARSVAALLLLDQYLASGVIDE"
FT   gene            136585..137370
FT                   /locus_tag="PSHAa0128"
FT   CDS_pept        136585..137370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0128"
FT                   /product="carbohydrate phosphatase; putative CysQ protein
FT                   duplicate"
FT                   /function="2.1.3.1 : Carbohydrates (other than glucose)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85232"
FT                   /db_xref="GOA:Q3IDF9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF9"
FT                   /protein_id="CAI85232.1"
FT                   /translation="MNKLLEPCILLAERAGDAIMAIYKNGDIGKEQKLDNTPVTKADLA
FT                   ANDVLVAGLEALAPNIPIMSEETPIPALADRQHWQRYWLLDPMDGTGEFILESGDFAVN
FT                   IALIENNQPVLGVIHWPTKGVTYFASADNGAFKRKNGSDKQIFVASPDNLTVAVSRRQK
FT                   IEAVSQYLNAQFTTVALGSCSLKACIVAEGKADCFLRIGPTGEWDTGASQIIVEQAGGS
FT                   ITDAEFNPLTYNQRESTENPDFIVMGHPDWEWQKMINPH"
FT   gene            137523..137599
FT                   /locus_tag="PSHAatRNA3"
FT   tRNA            137523..137599
FT                   /locus_tag="PSHAatRNA3"
FT                   /product="tRNA-Met"
FT   gene            137795..137871
FT                   /locus_tag="PSHAatRNA4"
FT   tRNA            137795..137871
FT                   /locus_tag="PSHAatRNA4"
FT                   /product="tRNA-Met"
FT   gene            138045..138121
FT                   /locus_tag="PSHAatRNA5"
FT   tRNA            138045..138121
FT                   /locus_tag="PSHAatRNA5"
FT                   /product="tRNA-Met"
FT   gene            138548..139162
FT                   /locus_tag="PSHAa0129"
FT   CDS_pept        138548..139162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0129"
FT                   /product="putative membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85233"
FT                   /db_xref="GOA:Q3IDF7"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF7"
FT                   /protein_id="CAI85233.1"
FT                   /translation="MTELYHWFDLIGVAVFAISGTLVAYEKKMDGFGVVVLATVTAIGG
FT                   GTVRDVILNVPVFWLHDQSYFAAILAAILLTTRLINKQRTIPHYNLQIADAFGLAFFAV
FT                   MGTQKALLAGMPDMTAVIMGVITGCFGGLIRDVLAREIPMLLKGELYATTCIAGGIVYT
FT                   LCINFSLIVEVAMILSMLMTLLLRFAAIKWGIVLHVFKYPD"
FT   gene            139196..140707
FT                   /gene="yifB"
FT                   /locus_tag="PSHAa0130"
FT   CDS_pept        139196..140707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yifB"
FT                   /locus_tag="PSHAa0130"
FT                   /product="putative regulator"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85234"
FT                   /db_xref="GOA:Q3IDF6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF6"
FT                   /protein_id="CAI85234.1"
FT                   /translation="MSLARIYSRAQVGINAPEVIVEVHLGNGLPAFHIVGLPEASVKES
FT                   KDRVRSALENSKFGFPDQRITVNLAPADLPKDGGRFDLAIAVGILVASGQIVCSDIHKY
FT                   EFYGELALNGEIRGVNAILPSVLAAKEQDRCCFLPLANDSLASLVNGVKRKAVSSIAEV
FT                   WGDLLNQQPLPLNIQYPDCTQAPDFLLDLSDVKGQPGAKRVLEIAAAGGHNLLFLGPPG
FT                   TGKSMLAQRMATIMPTMSDDEAIATAALYSIIGQSIDLTNWRQRPFRNPHHTCSAVALV
FT                   GGSSNPKPGEISLAHNGVLFLDELPEFERKVLDSLREPMETGTVTISRVARQMEFPAQF
FT                   QLITALNPSPTGCHNDKRATPDQVMRYLSRVSGPFIDRIDLQIELPRLTSVELQSSKPE
FT                   ETSAVVRARVEAAYYLQLKRQGKVNARLNNKEMSIHCDLASTELQFLARASEKLALSPR
FT                   SYHRIIKVARTISDLKGAERISLDELKEALNYRAFERLLAQLTKY"
FT   gene            complement(140704..141423)
FT                   /locus_tag="PSHAa0131"
FT   CDS_pept        complement(140704..141423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0131"
FT                   /product="putative response regulator in two-component
FT                   regulatory system"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85235"
FT                   /db_xref="GOA:Q3IDF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF5"
FT                   /protein_id="CAI85235.1"
FT                   /translation="MTIHVLLVEDDELLVKRIQNHFTNTEFTIEVDPTGADALSTIRSR
FT                   VNLRGAFSLAIIDIVLPKRDGLQLAKELNTLTDIGVILLSSRDSQADRIAGLAQGADDY
FT                   ICKPVDLLELELRMRALYKRIAHLNSDNDKNDDNGEEFIEYADFKLHPDNRTLITATGA
FT                   ESRLTEAEHKVLICLIGNAGKATSREKISEEIGQPDWSPNDRTVDVLIGRLRKKLNDEK
FT                   DQKRIVTVRGKGYMLSI"
FT   gene            complement(141653..144154)
FT                   /locus_tag="PSHAa0132"
FT   CDS_pept        complement(141653..144154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0132"
FT                   /product="putative secreted hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.4.19.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85236"
FT                   /db_xref="GOA:Q3IDF4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF4"
FT                   /protein_id="CAI85236.1"
FT                   /translation="MKLNALWRHSNKLFKHSFALFTLSSLSFAAFAAPLDKSKIQFIGP
FT                   LAENMQLKPFQTAQSDSIISNLLPQLQLPVANFSVFDKKHSWQPFNKINALTLGGLQAL
FT                   KFNIETTRFSQGTLTLKGIEQGQLFINGELQKADNSSYKLALNNGSHTAIIVAQQVANW
FT                   HDVILDFAPKTPSDNITLSTSQTKRLSAKQLFDAPTISGLSLAPNSEHYITTTRRFNDK
FT                   TLNQANNVTELKNTDNQTLYRFEAEQPSNLIWSPDNRFLVYLLNGELKQLNRKNLSIKT
FT                   LSTRLEGASGFTFYNEHSVIFSWSNPASDKGNDKLTKHYKGLQDRWSYARSVSQVYMLD
FT                   TQSGLIKTLSQGPLSHSFEDFNNKRGKLLMSRPVVAMQASTHPETELVELDLKSNKLTS
FT                   LGKFKTFNQAKYANKDVYVVAGPDFKNGAGRALPKEMLANNYDGQLYLLTDGGKNVKAL
FT                   SKQFDPAIGRLSVLNNGDALLKVTEHDTQPLYLFDLSKQRFKKLNTGLDIVEQFSYSNE
FT                   RNIEILLSGTTASSPQQLKRFNISKNTAKIVWDSKPLSYANTYIPTLEEFNFTNKNGVE
FT                   ISGRVYIPNNLDKTKKHPALVYYYGGTSPVTRGFTGRYPFNLWAANGYVVYVIQPTGAT
FT                   GFGQKFSAQHVNAWGNYTSDDIIAGTQAFLNKYNYVDSKKVGNLGASYGGFMTMHLATK
FT                   TDLFSASISHAGISNLTSYWGEGWWGYLYSGEASKNSFPWNNPELYSKHSPVFYADKVT
FT                   TPMLLIHGDSDTNVPVGESLTMYTALKLLNKDVELIEYKGANHQIIARDQRFDWWNTML
FT                   AYFDKKLKNEPQWWDYLYPND"
FT   gene            144239..145315
FT                   /locus_tag="PSHAa0133"
FT   CDS_pept        144239..145315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0133"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85237"
FT                   /db_xref="GOA:Q3IDF3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF3"
FT                   /protein_id="CAI85237.1"
FT                   /translation="MTLLIVYMVVAIVISFLCSVMEAVLLSISPSYVALLRKKQPVLAK
FT                   QLEKLKNNIDQPLAAILTLNTVAHTAGAAGVGAQAAIVFSDAAVGVASAVMTLFVLVFS
FT                   EIIPKTLGANYWRVLTPSVTYGLRFLVILLKPFVWLAQKLTNLMGPKHDQAYYIRQEIE
FT                   AMADIGTESGALHQDESEIIRNLLHFRHAKLCDLMTPRTVIFKVHKDLTVNEYLNLHGS
FT                   SSFSRILVFDKDTDDIIGFVHKNDIMLACHRLGSDYKISKLVKPIYTVPSSQNASSLLQ
FT                   TLLTDRTHICLVVDEYGDVQGIVTLEDMIEALMGLEIVDERDQSTNMRAVAKQRWHKRL
FT                   ANSKNLVTEEDKHPRGDN"
FT   gene            complement(145329..146612)
FT                   /locus_tag="PSHAa0134"
FT   CDS_pept        complement(145329..146612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0134"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85238"
FT                   /db_xref="GOA:Q3IDF2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF2"
FT                   /protein_id="CAI85238.1"
FT                   /translation="MRIYYFYSNTHYALKGITVKKVVPNILVVDDSKAILIVMEAILAE
FT                   LDMSETITTCLSATKALEKVKRDINYFDAIFTDLNMPEMDGMELIRHLGELNYQGAIII
FT                   ISEMEHKVISLAANLAKQHNAHLIGNISKPVQLTQVGSLLNKVAYLNSHTLIKEPAISK
FT                   TELINALKNDEITPFYQPKICINTSKIKSAEVLARIVSNTDGSIILPARFISLAEQHDL
FT                   INEITFALFEKATSDFENIKEQLGQNLKLAFNLSPMQLNDLSCPNKLLLILKLNQLKPS
FT                   DIIIEITEQHALSSLSQLETLNRLRMHGFGLSLDDFGVGFTNMSQLKNLPFTEIKIDRT
FT                   LISNIETDQFSQVVVSSLIDITNQEHLELVAEGVERPEELAYLRHYKTRLAIQGFLFSR
FT                   PKSKSEFIDWAQYWIKVTGNTINYKPPS"
FT   gene            146735..147751
FT                   /locus_tag="PSHAa0135"
FT   CDS_pept        146735..147751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0135"
FT                   /product="putative metalloprotease; probable metal binding
FT                   site"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85239"
FT                   /db_xref="GOA:Q3IDF1"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF1"
FT                   /protein_id="CAI85239.1"
FT                   /translation="MIRIELKLADQPFTLMVSGQKVVQIFHSQQAITFDNPRDNYYQFT
FT                   FDNKLIGIDSSLVNEQSISLFVNDEFATQLALPAATGGETKKGWLGLAALGFKLFKSAK
FT                   VIKVVLAGASVAGYAWLFSIEFALMLIACLVVHEYGHVRAMQYFGIKTKGIYLIPFVGG
FT                   LAVSDDKITTRWQDVVISLMGPAFGLITSVLSLVLYYATEMEIFAGVAVLSALLNLFNL
FT                   LPILPLDGGHVLKSISFSMRSWVGLSVCLLGVLFGLWLSYTFGLMLLVFFLFIGALEIV
FT                   FEWRGRHTSHLMPLDKYGQGFSAVMYALVVAGHIAVMMHFADSENPILSLPMKILSS"
FT   gene            complement(147810..149120)
FT                   /gene="atoE"
FT                   /locus_tag="PSHAa0136"
FT   CDS_pept        complement(147810..149120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="PSHAa0136"
FT                   /product="putative short-chain fatty acid transport protein
FT                   (scFAT family)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /function="1.2.8 : Other"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85240"
FT                   /db_xref="GOA:Q3IF33"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF33"
FT                   /protein_id="CAI85240.1"
FT                   /translation="MLNKIATPFTKLVERYLPDPFIFVILLSVITLVIASVFTPTTGIE
FT                   VLQAWGDGFWNLLSFAMQMLLVLITGYMLASTPPISKLLEKLATFANTAPKAIILVTLI
FT                   SLLASWLNWGFGLVIGALFAKAIAKHTRVDYRLLVASAYSGFVVWHGGLAGSIPLTIAT
FT                   EGHFLQSSMGIISTEQTLFAGFNIAILVGLFIIMPLVNRYMLPSAEESVYIDPALLKST
FT                   SPAIINITRPAQHLEQSKLLGITIGLLGLIYLGYYFLVAGGGLNLNSVIALFLFLAITL
FT                   HQTPHNLLNSLQQAIPSGAGIVIQFPFYAGIMAVMVDSGLAQQISSGFIAIADADSLPF
FT                   FSFISAGLVNMFVPSGGGQWAVQAPIVIPAAQALGADISRVAMAVAWGDAWTNLIQPFW
FT                   ALPVLAIAGLKAKDIMGFCVVQLFVTGVFISLMLSFY"
FT   gene            149300..150370
FT                   /locus_tag="PSHAa0137"
FT   CDS_pept        149300..150370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0137"
FT                   /product="putative potassium channel"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85241"
FT                   /db_xref="GOA:Q3IF32"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF32"
FT                   /protein_id="CAI85241.1"
FT                   /translation="MPVIFKRLVLLVRAHIDQLSWQAVALAILTHMLLTWGLLYIANEQ
FT                   ALTSLTTFFYYYTVTTSTVGYGDFSPTTDLGRWVVALIQIPFGLALFGVLLGKTGQTIT
FT                   YLIRRAMTGDKNFAHSSNHIIIFGWHDTRTKKMIDYILADTKRTERRILLAVTEQMEHP
FT                   FLSNESVDFVRLSSFTDLEELKRVAISYADKVIIDGQDDDQTFTTALRISRLVKDDCHI
FT                   SAHFLDETKVDMLLEHCQNVECSSVKSAEILVRSMQDPGSSRVHEELLSILHGDTQFSL
FT                   AIPEQSKEMEFGTLFHHFKHQHDAILLGVAHNLSAQNMDLNPPLDYKINAGDILHYIAV
FT                   ERVLSREVDWPALAKA"
FT   gene            150367..150570
FT                   /locus_tag="PSHAa0138"
FT   CDS_pept        150367..150570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0138"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85242"
FT                   /db_xref="GOA:Q3IF31"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF31"
FT                   /protein_id="CAI85242.1"
FT                   /translation="MNEVIFLIILLIAYILPVVIVLNSKRTQGHEKNAWLIGIVFFSWL
FT                   GLIMYLAIVPKHGRKKRQNKKP"
FT   gene            complement(150651..151682)
FT                   /locus_tag="PSHAa0139"
FT   CDS_pept        complement(150651..151682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0139"
FT                   /product="conserved protein of unknown function; similar to
FT                   a protein from a plasmid"
FT                   /function="4.6.1 : Plasmid-related functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85243"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF30"
FT                   /protein_id="CAI85243.1"
FT                   /translation="MKLLYWLDEWLTLSCDEQQAKLPMSGGDLLGDVYVKYDFIDINKP
FT                   LLFTFSPAGTDVQEQDLHADFAPWGYHLAQKQNVNVIAFQHLGKSNWFRNRNLIFFLEQ
FT                   LSPLLTSFKTRLGYGLSRGGFAVGAFAKLLKLDQVLLFHPVSTKNKSLVPWDDRSSTDI
FT                   AQQYDWEGSYADLDLGNAQGYIIYDPTNRIDRLHAKRYKQLNHLRVFGMGHGTHATYLN
FT                   KFGFYKQVAVDFMRHQQIDIAQFRLQTKTLRFKEDYYKRLNKANKKSAHRLELLSTAHN
FT                   ILIDEKTAHVQEHQASIDIQPLIDVALKHQEQHPDDAIQLLEVAKQLAPNDPLVKHKLK
FT                   ELE"
FT   gene            complement(151869..152330)
FT                   /locus_tag="PSHAa0140"
FT   CDS_pept        complement(151869..152330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0140"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85244"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF29"
FT                   /protein_id="CAI85244.1"
FT                   /translation="MAYWLFKTEPDAFSIDDLKNAQNQTTLWEGVRNYQARNFMRDEVK
FT                   VGDLVMIYHSSCKLVGVVGIAVVTKAAYQDPTQFDLSSDYYDAKATSDNPRWVVVEVTY
FT                   QSHLDSLVSLKEIKANPRITDIALKKGGRLSIMPVTKSDWQIITHMAEE"
FT   gene            152407..153264
FT                   /gene="tesB"
FT                   /locus_tag="PSHAa0141"
FT   CDS_pept        152407..153264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="PSHAa0141"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="2.4.1.2 : Degradation"
FT                   /EC_number="3.1.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1645722; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85245"
FT                   /db_xref="GOA:Q3IF28"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF28"
FT                   /protein_id="CAI85245.1"
FT                   /translation="MSQVLDDLLSLLTLEEIEQGLYRGQSQDLGFGAVFGGQVMGQALS
FT                   AAKETLPEGRIVHSLHSYFLRPGDATKPIVYDVEAIRDGKSFSTRRVSAIQYGKPIFYM
FT                   TASFQGAEEGLSHQATMPDVPLPEELRSSLEFYKENAEQIPAAIRNQFISEMPIEIRPV
FT                   TFHNPFKPEAMEPVKHIWFKANGEMPDDQRIHNYLLAYASDFEFLPTALQPHGVSFMQP
FT                   NMQVATIDHAMWFHRPFRMDDWILYSVDSPSASSGRGLVRGQFFDRQGNLIASTMQEGV
FT                   MRQR"
FT   gene            complement(153368..155806)
FT                   /gene="plsB"
FT                   /locus_tag="PSHAa0142"
FT   CDS_pept        complement(153368..155806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="PSHAa0142"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="2.3.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7929384, 10231527; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85246"
FT                   /db_xref="GOA:Q3IF27"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF27"
FT                   /protein_id="CAI85246.1"
FT                   /translation="MRIVNYCLNVLSAGVSRLLVRSKVLPEKPTEQYELNSKNPTFYIV
FT                   RLNSRFDLAALARVCKRHGLPDPREQQVLGTQRLDRFIGIENPPPLIGDIAKPTNALAQ
FT                   GKQIIDHLLSSGQKDVQVIPVTILWGRAPGKEKPGLSTLITHSLTPSWFRKLFVVLFSG
FT                   RDNFIRFSQPLDLSLLVDEKADVNELPQKLLRVARVHFRRQKLAATGPKMPSREQLFNS
FT                   LLASPTIKKAIQDEAKAKNISQAQARQNAVKLLNEIAANYSEAMIRVAERFLTWLWNKL
FT                   YNGIDIKYTEQIHELTNKGHEIIYMPCHRSHMDYLLLTYAIYHQGLVPPHIAAGINLNF
FT                   FPAGGIFRRSGAFFIRRSFAGNKLYSAVFKEYLSQLFIKGYSVKFYTEGGRSRTGRLLP
FT                   PKTGMLAMTMQAMLRGIDRPISIVPVYIGYEHVMEINTYLKELAGNDKKGESIFGIFKA
FT                   IKNLKNYGRGYLNFGDPISINQYLNDNQPNWRDDIHPTDVQKPQWLGPQVANLADQVMV
FT                   KINNAAALNAVNLLAMILLVNDKHALSKPKLLAQLDFYLRLQRDASYSNKVTAPEETPE
FT                   QLLTHALKLNKFDVISDEFGEIIAINDKEKTLFNYYRNNILHLFAVPSLIALHLFREKT
FT                   TTVSKCQQLVAAFYPLFAKEWYLRELDEDYITRILANFVDQNLIELDGDNIHITNTNDC
FT                   LAKLDMLGKALNFTLQRYAIVIGFIQTSNGIEKAELERESQVLAQRLGTLHGIKTPEFF
FT                   DKKVLVSFIDNLRAQSLITDGDAGLIGSVQLCETYMHLKALLPARVWQSISDIVQGQCK
FT                   "
FT   gene            156245..156556
FT                   /gene="rpsJ"
FT                   /locus_tag="PSHAa0143"
FT   CDS_pept        156245..156556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="PSHAa0143"
FT                   /product="30S ribosomal subunit protein S10 (NusE protein)"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10383769, 10498727; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85247"
FT                   /db_xref="GOA:Q3IF26"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF26"
FT                   /protein_id="CAI85247.1"
FT                   /translation="MSNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   FERFTVLTSPHVNKDARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG"
FT   gene            156584..157219
FT                   /gene="rplC"
FT                   /locus_tag="PSHAa0144"
FT   CDS_pept        156584..157219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="PSHAa0144"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9813114, 11847124; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85248"
FT                   /db_xref="GOA:Q3IF25"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF25"
FT                   /protein_id="CAI85248.1"
FT                   /translation="MALGLVGRKVGMTRIFTEDGVSIPVTVIEATPNRIAQIKSEATDG
FT                   YNALQVTAGTKKASRVNKASAGHFAKAGVEAGRGLWEFRLNGGEGDFEVGAELTVELFN
FT                   EINKVDVTGTSKGKGFQGGVKRWNFSMQDATHGNSLSHRAPGSIGQNQSPGKVFKGKKM
FT                   AGHMGAERVTTQNLELVRVDAERNLLLVKGAVPGAIGGDVIVKPAVKA"
FT   gene            157237..157842
FT                   /gene="rplD"
FT                   /locus_tag="PSHAa0145"
FT   CDS_pept        157237..157842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="PSHAa0145"
FT                   /product="50S ribosomal subunit protein L4"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 13130133; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85249"
FT                   /db_xref="GOA:Q3IF24"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF24"
FT                   /protein_id="CAI85249.1"
FT                   /translation="MELAIKDASGGLEVSEATFGREFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRSEVSGGGKKPWAQKGTGRARAGTIRSPIWRSGGVSFAAKPQDHSQKVNRKMYRGA
FT                   IKSILSELVRQERLIVVESFALAAPKTKELVAKLKELELKDVLIVTEEVDENLFLSARN
FT                   LYKVDTRDVAGIDPVSLIAFDKVLITAAAVKQLEEALA"
FT   gene            157839..158141
FT                   /gene="rplW"
FT                   /locus_tag="PSHAa0146"
FT   CDS_pept        157839..158141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="PSHAa0146"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1960726, 12756233; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85250"
FT                   /db_xref="GOA:Q3IF23"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF23"
FT                   /protein_id="CAI85250.1"
FT                   /translation="MIREERLLKVIVAPHISEKSTIAAEENNTIVFKVAKDSTKAEVKA
FT                   AVEKLFEVEVTGVRTLNVKGKTKRTGARFGRRNDWKKAYVTLKEGSELDFVGGAE"
FT   gene            158157..158981
FT                   /gene="rplB"
FT                   /locus_tag="PSHAa0147"
FT   CDS_pept        158157..158981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="PSHAa0147"
FT                   /product="50S ribosomal protein L2"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3892488, 7556101, 3298242, 11013226; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85251"
FT                   /db_xref="GOA:Q3IF22"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF22"
FT                   /protein_id="CAI85251.1"
FT                   /translation="MALQKCKPTSAGRRHLVKVVNSDLHKGKPYAPLLEKNSKSGGRNN
FT                   NGRITVRHIGGGHKQHYRLIDFKRTKDGIPATVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGLKAGDAIQSGVDAPIKPGNALPMRNMPVGSTVHNVELKPGKGAQIARSAGAYVQ
FT                   ILARDGQYVTLRLRSGEVRKVEADCRATLGEVGNAEHMLRSLGKAGANRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGAKTRKNKRTDKFIVRRRTK"
FT   gene            158985..159275
FT                   /gene="rpsS"
FT                   /locus_tag="PSHAa0148"
FT   CDS_pept        158985..159275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="PSHAa0148"
FT                   /product="30S ribosomal protein S19"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3892488, 348496, 3279034, 12244297; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85252"
FT                   /db_xref="GOA:Q3IF21"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF21"
FT                   /protein_id="CAI85252.1"
FT                   /translation="MRNSHATFSQEGSFYRPTLLKKVEKALESGDKKPIKTWSRRSMII
FT                   PNMIGLTIAVHNGRQHVPVFITDEMIGHKLGEFAPTRTYRGHAADKKAKKR"
FT   gene            159289..159621
FT                   /gene="rplV"
FT                   /locus_tag="PSHAa0149"
FT   CDS_pept        159289..159621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="PSHAa0149"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11468402, 13130133; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85253"
FT                   /db_xref="GOA:Q3IF20"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF20"
FT                   /protein_id="CAI85253.1"
FT                   /translation="MQALAKHKFASGSAQKARLVADQIRGLPVDRALEILAYSPKKAAV
FT                   LVKKVLESAIANAEHNEGADIDELRITTIFVDDGPTMKRIMPRAKGRADRILKRTSHIT
FT                   VMVSDS"
FT   gene            159634..160335
FT                   /gene="rpsC"
FT                   /locus_tag="PSHAa0150"
FT   CDS_pept        159634..160335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="PSHAa0150"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2459390, 2657655, 6380588; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85254"
FT                   /db_xref="GOA:Q3IF19"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF19"
FT                   /protein_id="CAI85254.1"
FT                   /translation="MGQKVHPTGIRLGISKPWVSTWYASSKDFSAQLFGDHKVRTFLTK
FT                   ELKTASVSKIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRQAVTKIAGVPAQINIS
FT                   EVRKPELDAQLVADGIASQLERRVMFRRAMKRSVQNAMRIGSKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEALTTYGIIGVKVWIFKGEVIGGLPLVQEQEKPAK
FT                   RAPKKAKKSAK"
FT   gene            160348..160761
FT                   /gene="rplP"
FT                   /locus_tag="PSHAa0151"
FT   CDS_pept        160348..160761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="PSHAa0151"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85255"
FT                   /db_xref="GOA:Q3IF18"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF18"
FT                   /protein_id="CAI85255.1"
FT                   /translation="MLQPKRTKFRKTHKGRNRGLAQNGNKVSFGTFGLKATGRGRMTAR
FT                   QIEAARRAMTRHVKRQGKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAEIQPGKVLY
FT                   EMEGVSEELAREAFDLAARKLPFKTTFVTRTVM"
FT   gene            160761..160952
FT                   /gene="rpmC"
FT                   /locus_tag="PSHAa0152"
FT   CDS_pept        160761..160952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="PSHAa0152"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85256"
FT                   /db_xref="GOA:Q3IFM4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM4"
FT                   /protein_id="CAI85256.1"
FT                   /translation="MKASELKDKSVEELNTELLGLLREQFNMRMQASTGQLAQTHTLRT
FT                   VRRDIARVKTVINQKAGQ"
FT   gene            160952..161209
FT                   /gene="rpsQ"
FT                   /locus_tag="PSHAa0153"
FT   CDS_pept        160952..161209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="PSHAa0153"
FT                   /product="30S ribosomal subunit protein S17"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11985624, 12051911, 14654705; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85257"
FT                   /db_xref="GOA:Q3IFM3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM3"
FT                   /protein_id="CAI85257.1"
FT                   /translation="MSDKIRTLQGRVISDKMEKSFTIAIARYVKHPIYGKFIRRTTKLH
FT                   VHDENNEVQAGDVVTIRECAPISKSKSWTFVAVIERPKQA"
FT   gene            161631..163445
FT                   /gene="cysJ"
FT                   /locus_tag="PSHAa0154"
FT   CDS_pept        161631..163445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="PSHAa0154"
FT                   /product="sulfite reductase, alpha subunit (flavoprotein)"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.6.2.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85258"
FT                   /db_xref="GOA:Q3IFM2"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFM2"
FT                   /protein_id="CAI85258.1"
FT                   /translation="MLLGQLNAAASPLSQEQVQKLQGLVAELNPIQQAWVSGYLAANAN
FT                   TAALGGAVGAAPSAGEAVALTILYGSQTGNAKGVAAKLKAQAESRGLAVKLVSMADYKP
FT                   TALKKEKFITVVVATYGEGEPPEDAEALHEFLTTKKAPKLDGVKVAVIGLGDSSYEFFC
FT                   QTAKDFEQRLNTLGAETIYQRADLDVDYEDEATTWITGALDAFEPDLKAQQGSSGGQVI
FT                   AMPFAGSTTVASQYTKQNPFAAELGLVQKITGRDSTKDVRHVEISLEGSDISYIPGDSL
FT                   GVYFLNDEARVDELLTHTQIDAASLVKVADEQLSIRDALIEKLELTQSYPGFVEKYAIA
FT                   TGTPQLLKLVEDKAAMHQYIEPRQIFDVVAQNPAKLDAQTLVDCLRKLQARLYSIASSQ
FT                   SEVEDEVHLTVALVEFDAFGREHLGGCSGYLARRAEEGCKVKVFSEHNDNFRLPTNDET
FT                   PIIMVGPGTGIAPFRAFLQERDARGASGKNWLFFGNPHFTQDFLYQVEIQGYLKSGLLS
FT                   KVDVAFSRDQAEKVYVQDKLRSNSKAIFEWLEAGAHFYVCGDANNMAKDVHQTLLEIIK
FT                   ENTGKSDEDAQQYLKDLRSANRYQKDVY"
FT   gene            163494..165191
FT                   /gene="cysI"
FT                   /locus_tag="PSHAa0155"
FT   CDS_pept        163494..165191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="PSHAa0155"
FT                   /product="sulfite reductase, beta subunit, NADPH-dependent
FT                   hemoprotein"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.8.7.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85259"
FT                   /db_xref="GOA:Q3IFM1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM1"
FT                   /protein_id="CAI85259.1"
FT                   /translation="MSEQDKNVKLSDNERMKRESNFLRGTIATDLKDEITGGFTADNFQ
FT                   LIRFHGMYQQDDRDIRGERAKQKLEPLHNVMLRARMPGGIIKPEQWLAIDKFAEEKTSY
FT                   GSIRLTTRQTFQFHGVLKPNIKGMHQLLDSVGIDSIATAGDVNRNVLCTTNPVESELHQ
FT                   EAYEWAAKISEHLLPKTKAYAEIWLNGEKAETTEEPILGSNYLPRKFKTTVTIPPNNEV
FT                   DVHANDLNFVAIAENGKLIGFNVLVGGGLAMTHGDTATYPRKADDFGFIPLEHTLKIAE
FT                   HVVSVQRDWGNRSNRKNAKTKYTLDRVGVDVFKAEVEKRAGVEFASSRPYKFTHRGDRI
FT                   GWVEGIDGKHHLTLFIQSGRILDYPDKPLKTGCRKIAEVHQGDMRMTANQNLIIAGVAA
FT                   NQKAVIEEIARNHGLIDDKDTEQRKNSMACVALPTCPLAMAEAERYLPSLVEKIEALLA
FT                   KHGVPNDSIIMRVVGCPNGCGRAMLAEAGLVGKGPGKYNVYLGGNLEGTRIPKLYLENV
FT                   GEDVYLAAFDELIGQWVNERNDGECFGDFVIRKGIVAEVKVSVTDFHA"
FT   gene            165235..165975
FT                   /gene="cysH"
FT                   /locus_tag="PSHAa0156"
FT   CDS_pept        165235..165975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="PSHAa0156"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   reductase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.8.4.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85260"
FT                   /db_xref="GOA:Q3IFM0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFM0"
FT                   /protein_id="CAI85260.1"
FT                   /translation="MSEFKNILQLDKQSQTSMLADANGILKNMSAEQRVQWALENLPET
FT                   HFLSSSFGIQAAVMLHLITLQQPDIPVVLTDTGYLFPQTYQFIEQMTARLSLNLKVYKS
FT                   ELSPAWQEAKFGKLWEQGEAGIKQYNQLNKVEPMTRALKEINAGTWFSGLRRDQASSRA
FT                   DKQVIEISRGTVKVYPIIEWTNRDVYQYLTKHNLPYHPLWEEGYVSMGDIHTTRKLEPG
FT                   MTEEETRFFGLNRECGLHIDGDGI"
FT   gene            166112..166615
FT                   /locus_tag="PSHAa0157"
FT   CDS_pept        166112..166615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0157"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85261"
FT                   /db_xref="GOA:Q3IFL9"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL9"
FT                   /protein_id="CAI85261.1"
FT                   /translation="MKYFTYLAVSVMIIAVISLFYLKKPNGETWLSTSVVINESQQIKD
FT                   KIISFTSNTFEQAVSSVSNTPSTTRSKIFKWQDRQGQWHFSDTPHPNGKSVEVKLDPKD
FT                   INVVVAQDTAILSGSSKSSAVNSTSATPTVYDPVSIKKVFDDAEKAKQKLEQRTKQLND
FT                   LNGF"
FT   gene            complement(166644..166895)
FT                   /locus_tag="PSHAa0158"
FT   CDS_pept        complement(166644..166895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0158"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85262"
FT                   /db_xref="GOA:Q3IFL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL8"
FT                   /protein_id="CAI85262.1"
FT                   /translation="MSQIIIIRLLKISIVLGLCLIVTGHALIVSSYFTRQHGINGIIIA
FT                   AACIAIGVLLSLPTKIYLTILLMEAEKRYLKAHSHKHK"
FT   gene            complement(167037..169781)
FT                   /gene="acnA"
FT                   /locus_tag="PSHAa0159"
FT   CDS_pept        complement(167037..169781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="PSHAa0159"
FT                   /product="aconitate hydratase (likely to be used in
FT                   stationary phase); likely to have a 4Fe-4S cluster"
FT                   /function="2.1.2 : TCA and related cycles"
FT                   /EC_number="4.2.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12732309; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85263"
FT                   /db_xref="GOA:Q3IFL7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL7"
FT                   /protein_id="CAI85263.1"
FT                   /translation="MNNSFKTQQQLTVNGEQFHIHSLKGLGDKAKRLPFSLKILLENLL
FT                   RNEDGENIKEQDIQALLDWDPQAKPSAEVAFTPARVVMQDFTGVPAIVDLAAMRDAMEK
FT                   LGGDPAKINPLSPAELVIDHSVQVDGYGNEGAFDLNAKLEYDRNKERYEFLRWGQTAFD
FT                   NLKVVPPATGIVHQVNLEYLARVVFNDERNGQKYAYPDTLVGTDSHTTMINGLGVLGWG
FT                   VGGIEAEAAMLGQPISLLIPQVVGVKLNGRLPEGTTATDLVLTVTEMLRNHGVVGKFVE
FT                   FYGDGLADLPLADRATIANMAPEYGATCGIFPIDDETINYLRLTNRDEKQLKLIEDYAK
FT                   HQGLWRNDGDEANYTDKLELILDDVVPSLAGPKRPQDRISLDKAGEAISQHLKEFQDER
FT                   LAKISSSDTEQARIESEGPVTNPDESSNEAPFIGAAKVNFKGQEFELKDGACVIAAITS
FT                   CTNTSNPSVILAAGLVAKKAKQLGINVKPWVKTSLAPGSKVVTDYLEKAGLMDDLESLG
FT                   FNLVGYGCTTCIGNSGPLAPEISDAIQKHKLVVSSILSGNRNFEGRIHQDVKMNFLASP
FT                   PLVVAYAIAGRTDIDVYNEPLAQDANGNDIYLKNIWPSVKEVSDLVKETVTREMFEKSY
FT                   ANVYEGDSRWQKIQIPDGKLYDWDDASTYIKKAPFFDGMSIEPPGIPTITGARCLAKLG
FT                   DSVTTDHISPAGAIKADSPAGLYLQDNKVGQAQFNSYGSRRGNHEVMMRGTFANIRLKN
FT                   LLAPGTEGGVTRTQPDDELASIYDAAMEYQKNDTPLVILAGKEYGTGSSRDWAAKGSLL
FT                   LGVKAVIAQSYERIHRSNLIGMGVLPLQFKDGESHESLGLTGQEQFDIEGLFDKTKEVS
FT                   VIATNSEGKKVSFSADVRIDTPKEWDYYKHGGILQYVLRNMLD"
FT   gene            complement(169968..170402)
FT                   /locus_tag="PSHAa0160"
FT   CDS_pept        complement(169968..170402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0160"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85264"
FT                   /db_xref="GOA:Q3IFL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL6"
FT                   /protein_id="CAI85264.1"
FT                   /translation="MLAHPPPKWLKPLAWVALIWNLCGVIAFALQMLMTPEVISKMPID
FT                   QQAAYSNIPVWSTIAFAIAVFGGTLGSALLLAKKSFALPVFTVSLMAILIQQYYNFIVI
FT                   NSVEIMGSSAVFMPLFVVVIAILLLCVSFKGKQQGWLYAN"
FT   gene            complement(170509..170892)
FT                   /locus_tag="PSHAa0161"
FT   CDS_pept        complement(170509..170892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0161"
FT                   /product="conserved protein of unknown function, similar to
FT                   putative regulator YbcJ from E. coli K12, could bind
FT                   nucleic acids"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85265"
FT                   /db_xref="GOA:Q3IFL5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL5"
FT                   /protein_id="CAI85265.1"
FT                   /translation="MNEEYIEIELEEEPIELCKLLKVLNLVEGGGQAKNLIAEGYVGVN
FT                   HEICTIKRKKLYSGDILEFDGELFQLALTEDATPVERPAEQPQSEPSQAAPQPASQPAK
FT                   NKRKRTKKPKVDEKTGRRPISFG"
FT   gene            complement(170972..171430)
FT                   /locus_tag="PSHAa0162"
FT   CDS_pept        complement(170972..171430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0162"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85266"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL4"
FT                   /protein_id="CAI85266.1"
FT                   /translation="MKLIENIPLFKQMEIINRLGFFKEFSLNERQILLESFGLLYLVRE
FT                   NSFLFKQHDNDKRLFIVLSGALIVFKHNHLLELGTIRPGEFIGEGAFINNRARSISARA
FT                   KTDAIVLAITSDALTRLPNVIREKIKDRIIEGMSLRIAKLSEHIENHG"
FT   gene            complement(171461..172846)
FT                   /gene="glnG"
FT                   /locus_tag="PSHAa0163"
FT   CDS_pept        complement(171461..172846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnG"
FT                   /locus_tag="PSHAa0163"
FT                   /product="response regulator in two-component regulatory
FT                   system with GlnL, nitrogen regulation (EBP family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /EC_number="3.1.1.61"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9720863, 11121068; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85267"
FT                   /db_xref="GOA:Q3IFL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL3"
FT                   /protein_id="CAI85267.1"
FT                   /translation="MKTVWLVDDDASIRFVLEKALTRAGFTVQSFAEAQSVLNALKFSQ
FT                   PSVLISDVRMPGMDGMALLELIAEQVPGLPVIIITAHSDLDSAVNAFQKGAFEYLAKPF
FT                   DLNEAIALVESAYRANSTKKVKRKLTPPKSAHIIGEAPAMQEVFRAIGKLAASSMSVLI
FT                   NGESGTGKELVASALHNHSPRKENQFIALNMAAIPKELVESELFGHEKGAFTGADSVRK
FT                   GRFEQANGGTLFLDEIGDMPLDVQTRLLRVLSDGEFYRVGGHKSIKVDVRIIAATHQNL
FT                   EELVKQGKFRDDLFHRLNVVRLRLPALRERTEDIERLALHFLHKSAKDLQVESKILSLK
FT                   AIEQLRLFSWPGNVRQLENTCRWLTVMAPGELVSEQDLPPEIINASLTQEEGDWLDAFQ
FT                   LWLNQELKQGKENIWPNIQAQLETRLIKTALANCAGHKQEAAIKIGWGRNTLTRKLKER
FT                   NIN"
FT   gene            complement(172862..173932)
FT                   /gene="glnL"
FT                   /locus_tag="PSHAa0164"
FT   CDS_pept        complement(172862..173932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="PSHAa0164"
FT                   /product="nitrogen availability sensory kinase (soluble) in
FT                   two-component regulatory system with GlnG, nitrogen
FT                   regulation (nitrogen regulator II, NRII)"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11121068, 12562801; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85268"
FT                   /db_xref="GOA:Q3IFL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL2"
FT                   /protein_id="CAI85268.1"
FT                   /translation="MLNNTHFSPELLNAIWQNQTTAVMLLNESFTLIYANTSTSELLGL
FT                   GTKRLLGQSFDDLFNYHSIDLKRIAQYSLIDGVDCHQHRADVVFVDSRHAKLAVSSKQI
FT                   KYQGALYILLECRQTDDEIKFDQASNQMHQYQAARNLIRGLAHEIKNPLGGIRGAAQLL
FT                   QYEVDQQERNECAELIIEQADRLRELVDRLLGPNQLPQKSYGNIHQTLESVIKLSTLDN
FT                   SDNIRLVKDYDPSIPDVYIDQSKVQQVVLNIVRNAQQALVNGGEIKIKTRINYQHRRPG
FT                   KAPKKALLIQVLDNGPGIDISVRDTLFYPMITNKDGGSGLGLSIAQTLIDQHNGYIECD
FT                   SWPGHTEFNIYLPFAD"
FT   gene            complement(174025..174570)
FT                   /locus_tag="PSHAa0165"
FT   CDS_pept        complement(174025..174570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0165"
FT                   /product="conserved protein of unknown function ; putative
FT                   secreted protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85269"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL1"
FT                   /protein_id="CAI85269.1"
FT                   /translation="MLKMQGCRVSSKILLLLITSLLSVCSYAGEKKIYAWKDKNGVLVF
FT                   SDTPHIGAKEIKLTSQDLTMPATNTDILNNQTKAQPVAFSIGIASPEHQQTIRENTGSV
FT                   YVSTRITPRFENDFTIQLLLDGKAYGAASDTSTFALRDVERGEHTLQVKLYNKQNQVIA
FT                   TSPLSVFFMHRKGLSLGN"
FT   gene            complement(174662..176068)
FT                   /gene="glnA"
FT                   /locus_tag="PSHAa0166"
FT   CDS_pept        complement(174662..176068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="PSHAa0166"
FT                   /product="glutamine synthetase"
FT                   /function="2.2.1.3 : Glutamate family"
FT                   /EC_number="6.3.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2882477, 6148334, 2858855; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85270"
FT                   /db_xref="GOA:Q3IFL0"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL0"
FT                   /protein_id="CAI85270.1"
FT                   /translation="MSQSVLDFIKENDVKFIDLRFTDTKGKEQHISIPHHQIDEDFFED
FT                   GKMFDGSSIAGWKGINESDMVLMPVAESAKLDPFTEEATLIIRCDVVEPSTLQGYERDP
FT                   RSVAKRAEEYMRSTGIADTVLFGPEPEFFVFDDVKYKTDMSGSMYKIDSKQAAWNSDKE
FT                   YADGNTGHRPGVKGGYFPVAPVDDFQDWRSATCLVLEEMGQVVEAHHHEVATAGQNEIA
FT                   TRFNTMVIKADEIQEMKYVIHNMAHLYGKTATFMPKPIVGDNGSGMHCHQSLAKDGVNL
FT                   FAGDKYGGLSEDALYYIGGIIKHAKAINAFANASTNSYKRLVPGYEAPVMLAYSARNRS
FT                   ASIRIPVVPSAKGRRIEVRFPDATANPYLAFAAMLMAGLDGIKNKIHPGDAMDKDLYDL
FT                   PAEEAAEIPTVASSLEEALASLDADREFLNQGDVFSNDLIDAYIKLKSQEVEKLNMTTH
FT                   PIEFEMYYSC"
FT   gene            176578..178401
FT                   /gene="typA"
FT                   /locus_tag="PSHAa0167"
FT   CDS_pept        176578..178401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="PSHAa0167"
FT                   /product="GTP-binding protein TypA/BipA (Tyrosine
FT                   phosphorylated protein A); involved in LPS core synthesis"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12654836, 12675808; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85271"
FT                   /db_xref="GOA:Q3IFK9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFK9"
FT                   /protein_id="CAI85271.1"
FT                   /translation="MSIEKIRNIAIIAHVDHGKTTLVDKLLEFSGTLETRGGNEERVMD
FT                   SNDIERERGITILAKNTAISWNGYHINIVDTPGHADFGGEVERVLSMADSVLLIVDAQE
FT                   GPMPQTRFVTQKAFAQGLKPIVVINKIDKPSARPDWVMDQIFDLFDNLGATDEQLDFKV
FT                   IYASAINGWATLDLDEPSDNMDAMFQMIVDEVSPPDADPEGDFQMQISQLDYNSYVGVI
FT                   GVGRIKRGSVAPNQQVTIISADGTKRNGKIGTVQSYLGLDRIETDRGYAGNIVTVTGIG
FT                   ELKISDTVCCPTNVEALPPLSVDEPTVTMTFSVNNSPFCGKEGKFVTSRNIRERLDKEL
FT                   VHNVALRVEDTASPDSFRVSGRGELHLGILIENMRREGYELAVSRPEVILRTVDGVLEE
FT                   PFETVTIDCQEEHQGSVMEQVGLRKGELTNMSPDGKGRMRLDFIIPSRGLIGFQTDFMT
FT                   LTSGSGLMYHTFDHYGPHKGGSIGVRKNGVIIANATGKALTNALFNLQERGRLFIGHGV
FT                   EVYEGMVIGIHNRDNDLTVNALKGKQLTNVRASGTDEAQTLSPPLNYSLEQALEFIDED
FT                   ELVEVTPLNIRIRKRHLTENERKRAGRAPKS"
FT   gene            complement(178735..179814)
FT                   /locus_tag="PSHAa0169"
FT   CDS_pept        complement(178735..179814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0169"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85272"
FT                   /db_xref="GOA:Q3IFK8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFK8"
FT                   /protein_id="CAI85272.1"
FT                   /translation="MKHITLIIFISCFLSACSTPNQVQKIADKNSVIAVNNQTGRYHNL
FT                   YQGKKVYPTTCEQNCYPPHPNLICETPSSNCQYQGKQIKPPLNTGYTVRWLGHASFVVS
FT                   TRNGQNVLFDPVSEQFDSPVDLGFKLAGGFYRKPGAWPNKQTLENINAVMYSHIHYDHF
FT                   NKADIKKLGNQPRYLAPLGMADNFPTGGFNITEMAWYAKTSIEDLTIHAVPAHHFSNRV
FT                   LIPYIYEDDNKDSWNGWLLEQNGSTLFFAGDTGYSKHFKDIQQKYGDIDLCLMPIASYY
FT                   HKTNAKGYRYVHTTPEDALNAATELNCKVMIPWGYGNSSWQMGDHSSHSALSRLLHMYK
FT                   QMNAPVPLYILNEGETIKL"
FT   gene            complement(179907..180563)
FT                   /locus_tag="PSHAa0170"
FT   CDS_pept        complement(179907..180563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0170"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85273"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ36"
FT                   /protein_id="CAI85273.1"
FT                   /translation="MKKQTLLSVTVLALVLTLSGCQSAYYSAMEKVGVHKRDILIDRVE
FT                   ETKDSQQESQEEFKSALERLTTLIDFNGGELQDTYNQLNDDYESSLNAANEVSTNINKV
FT                   EDVAEALFDEWSDELEQYKSASLKRESSKKLAATKRQFDQLLRSMRSAESKMEPVLTSL
FT                   HDNVLYLKHNLNAQAVSAIKGEFTNLKRDIQLLMNDMNKSIADSNKFIEQMNSAG"
FT   gene            180651..181553
FT                   /gene="rbn"
FT                   /locus_tag="PSHAa0171"
FT   CDS_pept        180651..181553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="PSHAa0171"
FT                   /product="tRNA processing exoribonuclease BN; required for
FT                   maturation of tRNA encoded by bacteriophages; dimer"
FT                   /function="3.2.2.2 : Ribonucleases"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10625642; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85274"
FT                   /db_xref="GOA:Q3IJ43"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ43"
FT                   /protein_id="CAI85274.1"
FT                   /translation="MNDKLSYYKQQVGSFLRQQPGWWMQYINRCIDDQITVNAGYLAYV
FT                   TLLSLVPLIAVGVAIFSAFPGFESTRLAIESFLFTNFVPTSSDVIKEHISSFAGNANQM
FT                   TAVGIGFLAAIALLLIRNVDATLNRIWRIKKKRPMMISFAVYWMVLSLGPVFLGGSIAV
FT                   TSYIVSLVSFADQGIPGFSGFLLKLLPYGISMVGFIMLYTLVPNTRVSFKAAIPGALFA
FT                   AMLFELTKKGFALYISHFPSYEVIYGAVATIPILFVWIYLSWIVVLLGAELTACISPEN
FT                   IEDTPEIELDEQENTKDTL"
FT   gene            181555..181992
FT                   /gene="dtd"
FT                   /locus_tag="PSHAa0172"
FT   CDS_pept        181555..181992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="PSHAa0172"
FT                   /product="D-Tyr-tRNA(Tyr) deacylase; removes other
FT                   D-aminoacids from mischarged tRNA"
FT                   /function="3.2.1.3.3 : Other"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14527667; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85275"
FT                   /db_xref="GOA:Q3IJ42"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ42"
FT                   /protein_id="CAI85275.1"
FT                   /translation="MQGLIQRVKHAKVEINNQVVGEIGQGILVLLGVEKQDDEQAADKL
FT                   LHKISNYRIFTDENDKMNLSLKDIAGELLVVSQFTLAANTKKGMRPSFSSAATPSQANE
FT                   LYEYFVAQAKALNLTVAAGEFGADMQVSLCNDGPVTFNLAV"
FT   gene            complement(181976..182704)
FT                   /locus_tag="PSHAa0173"
FT   CDS_pept        complement(181976..182704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0173"
FT                   /product="conserved protein of unknown function; some
FT                   similarity with spermidine synthase (could be an
FT                   aminopropyltransferase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85276"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ41"
FT                   /protein_id="CAI85276.1"
FT                   /translation="MLGNMSEYINPVNGLINSYFIENSHSIGQLLYWHKYGGDHIQVRQ
FT                   HQQLRWLLINDTLQSVVTQQQPSNLLLPHLQCLAQHWHTLSTPKKVLELGLGGGAIRNY
FT                   LLHQYPHAKITSAEINADIISCYKKFFTTQQVPNNNTQRLLCEDAQQVLARARNIDWII
FT                   LDLFSQIDAPRFLFAPAFYQKIHAALNNNGTLFINFLSQHESQLKQLQQVLLNVFGYKV
FT                   SPQKVAGYINHIVVITKQLN"
FT   gene            182867..183760
FT                   /locus_tag="PSHAa0174"
FT   CDS_pept        182867..183760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0174"
FT                   /product="putative acyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85277"
FT                   /db_xref="GOA:Q3IJ40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ40"
FT                   /protein_id="CAI85277.1"
FT                   /translation="MFQVSTPQSSEDWQAYYQLRWEILRAPWGEPRGSEQDDLEQDAEH
FT                   RFIKNKAGKVLGVARLHFNNQQQAQVRYMAVAEESRNQHIGSRLLHDLEKIAWSQDAAE
FT                   LVLFARERALEFYKRHGYETQEKAHLAYGDVQHYKMVKQKPSEPGWFRHPNWTQVLQNT
FT                   WRESIPISDAMGIKVESYTDWQFTTSADLDANLNLHNTMFAGSIYSLATLTGWGATYLA
FT                   LKEAGLEGNIVLADANIKYLKPLSSDPRGCVDIQSCKGKLSELETEGKASYLVPVIIYD
FT                   GDKVVAEFEGQFVVKK"
FT   gene            complement(183849..184883)
FT                   /gene="pldA"
FT                   /locus_tag="PSHAa0175"
FT   CDS_pept        complement(183849..184883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="PSHAa0175"
FT                   /product="putative outer membrane phospholipase A
FT                   precursor"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /EC_number="3.1.1.32"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85278"
FT                   /db_xref="GOA:Q3IJ39"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ39"
FT                   /protein_id="CAI85278.1"
FT                   /translation="MSWRYLIILSTLVSTTVFAEEKPKNNEQNSNIELVKQCILNEVIG
FT                   GDGKQTLDQLRKKCSALEEDKQLTAIDKRKAREAVSQKNRNVITPHKRNYILPISYVSH
FT                   PNNSSFETFDELTGEKNDEPLDNLEAKYQLSIKVPLFNDFSDKDQAIFFAFTLQSYWQL
FT                   YNKESSSPFRETNYEPEVFWVNYLDPEHVPWGDEMAVVLGISHQSNGNSQPNSRSWNRI
FT                   YANFIWEKNGFVFNFKPWYRISESEKETPLDPRGDDNPDIYKYMGYFEFSGAYRLNEHE
FT                   FSFMTRNNLNSDNRGALQLDWSFPLWGRVRGYAQYFNGYGESLIDYNADIERIGVGILL
FT                   TDLL"
FT   gene            complement(184941..185063)
FT                   /locus_tag="PSHAa0176"
FT   CDS_pept        complement(184941..185063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0176"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ38"
FT                   /protein_id="CAI85279.1"
FT                   /translation="MRESKLTIVNLHYKSGLGRFYFDLIILNIRKFSKSSPLHM"
FT   gene            complement(185078..186196)
FT                   /locus_tag="PSHAa0177"
FT   CDS_pept        complement(185078..186196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0177"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85280"
FT                   /db_xref="GOA:Q3IJ37"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ37"
FT                   /protein_id="CAI85280.1"
FT                   /translation="MIASPISQENIVVGEVANGLPLTIPVYRLKGDGTGPSVYIQANMH
FT                   GAEVQGNAVIFQLLEQLKHLNLKGDITLVPYANPIGCNQKSGEFTLGRFDPITGTNWNR
FT                   MYHYNTDLVTQFAQNHMQYDDAILKSAFKQALIDEVDSKLNGPAYLLNTGKRIALNLQK
FT                   LAHQADIVLDLHTGPISSKHLYCPTYATNSARYFNIEHVLLISSDFDGAMDEANFCPWW
FT                   HLSEALSKQGRELSIPVEAFTVELGSQEKIDLSEALNDANSILSYLNYKAVFVNAPHTP
FT                   ANITRYACHLNDYFAYYAPMGGMVEYIAPLGGHIKAGEPIAKILRMERYLSEQPLQTLS
FT                   LESDAIAILHFASASVNQGTELYKFFTNVFEL"
FT   gene            complement(186246..187451)
FT                   /gene="dcdA"
FT                   /locus_tag="PSHAa0178"
FT   CDS_pept        complement(186246..187451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcdA"
FT                   /locus_tag="PSHAa0178"
FT                   /product="diaminopimelate decarboxylase, PLP-binding"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11856852; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85281"
FT                   /db_xref="GOA:Q3IJ29"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ29"
FT                   /protein_id="CAI85281.1"
FT                   /translation="MSFLSTGVKTAINELSSQLDSPFFVYDLDTLNSHLAQLVAQTEVK
FT                   LWYAVKANPLSKIIQCLDNAGFNFDVASKGELEQVLAQGVSSDRVLNTGPAKSPKQIKH
FT                   FIERGVRTFVAESINQVRWLNEQAKLQNCQLQVLLRVQLRWPEGEKNPLGGDSLTPFGL
FT                   GCTEWQALNITDYDALSFDGLHIFQWGNMLSTQKLSELWSQMIAPLSQLARDLNINLKI
FT                   LDLGGGLGIPYTQNDITLNWDDLITALAKIKKQAGVEELWMELGRYAVGECGHYAAPVV
FT                   ERKQNYGQQQVILSGGINHLLRPAVTSQDFPAALLRDSHTPTQAMSLYGPLCTALDSLG
FT                   EHALPSDLNEHDWLVFSQCGAYGFSESMPYFLCHELAGEYVLEQNKLSCLRAAEDASYY
FT                   LR"
FT   gene            complement(187451..188191)
FT                   /gene="dapD"
FT                   /locus_tag="PSHAa0179"
FT   CDS_pept        complement(187451..188191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="PSHAa0179"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="2.3.1.117"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 6094577, 2537822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85282"
FT                   /db_xref="GOA:Q3IJ35"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ35"
FT                   /protein_id="CAI85282.1"
FT                   /translation="MSWLELLNNLESGAVRAASQNESGQWQANVAVKQGILEAFKNGTN
FT                   TEFVGGFVDKHNLAPQQFSATDGVRMVPGGSSVRRGAYVAKGTIIMPPAYVNIGAYIDE
FT                   GTMVDSHALVGSCAQVGKNVHLSAAVQLGGVLEPIGASPVVVEDDAFIGAGCVIVEGVV
FT                   IKKGAVLAPGVRLSATIPVYDCVNERQLDKGEPIPEYAIVIPGSRPASNEWARAQGLSM
FT                   SCALIVKYRDEQSDASLLLEEVLR"
FT   gene            complement(188207..189091)
FT                   /gene="dapA"
FT                   /locus_tag="PSHAa0180"
FT   CDS_pept        complement(188207..189091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="PSHAa0180"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.2.1.52"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8021219; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85283"
FT                   /db_xref="GOA:Q3IJ34"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ34"
FT                   /protein_id="CAI85283.1"
FT                   /translation="MIKNFNLDDYSVWTALVTPFNQNGTIDYGTLTTLVAEQAAANNAI
FT                   LLLGSTGEGLALTLKEQQAIVEHVCQLSPNVPLMVAVGGMNLKQQLAWVEYCNHLPIHS
FT                   FLLGSPLYAKPGVIGQTHWFESLLNISKHPCMLYNVPGRSAVDIPVATIQNLQQHKNLW
FT                   ALKEASGNIAQFEAYRQAAPNLAIFSGDDALMPYFAQAGAKGLVSVAANAWPLQTHEFV
FT                   QRSLSGQYPNLFTQWSSAISSLFTVANPIPVKVLMHLQGRLTSSYLRPPLTHLELTQTT
FT                   CIEQANNTILSWH"
FT   gene            189645..190343
FT                   /locus_tag="PSHAa0181"
FT   CDS_pept        189645..190343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0181"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85284"
FT                   /db_xref="GOA:Q3IJ33"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ33"
FT                   /protein_id="CAI85284.1"
FT                   /translation="MEKFNDIYQRAVERKGSTQMLQQLLAKPASKRQLVALSDDDWLEE
FT                   FTRKVFQSGFYWSVINSKWAGFREVFWQFSVEKLLMMPPDMLEQKASDERIVRNYKKVK
FT                   TIPENAFMIHEVTQQHGSFSQFIADWPSEDIIGLWAYLKKHGARLGGNTGPYTLRALGK
FT                   DTFLLSRDVESYLRAHKIIDGGLQTKKSLTAAQAFFNELQQQSGLSMQELSLIIAYSVG
FT                   DNRVGISQQQ"
FT   gene            190353..191762
FT                   /locus_tag="PSHAa0182"
FT   CDS_pept        190353..191762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0182"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85285"
FT                   /db_xref="GOA:Q3IJ32"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ32"
FT                   /protein_id="CAI85285.1"
FT                   /translation="MNLMPRYRQVADNFAIEDRPSKVAAPQLLLWNDSLAKAFNINVVP
FT                   ELRASTFSGNEQQAIAAVALGYSGHQFGHFSPRLGDGRAHLLGAVEDAQNQLWDIQLKG
FT                   SGATPYSRGGDGRCALGPAIREYIMSEAMQALGIKTTRCLAVVGSGETVYRNPPQPGAI
FT                   VTRLASSHIRVGSFQYLATQGDVAGLKNLADLAIERHYPKIQATGPERYLAFLAAVIKN
FT                   QVELVVSWMRVGFIHGVMNTDNTLVSGETIDYGPCAMMNSFDFDTVFSSIDKQGRYAFG
FT                   NQPNIANWNCARLAESLIPLVNDDDEQAVALMTPIIDGFAEQFNVEFSAMWATKLGLAG
FT                   TDTADKELIAELLQLLKEHQLDYTNTFDALTESLTGGMSIPEVLVQWAGKWQKRTDDRS
FT                   YTVMRAANPRVIPRNHVIEKILSEYNKTGSSELLHEFMQVMHTPYENTDKLAKFQDAPS
FT                   SDKEYYTFCGT"
FT   gene            192148..193212
FT                   /locus_tag="PSHAa0183"
FT   CDS_pept        192148..193212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0183"
FT                   /product="putative outer membrane protein; signal peptide"
FT                   /function="1.2.6 : Porins"
FT                   /function="1.1.3 : Surface structures (S-layers?)"
FT                   /function="1.9.1 : Biofim formation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12220987; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85286"
FT                   /db_xref="GOA:Q3IJ31"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ31"
FT                   /protein_id="CAI85286.1"
FT                   /translation="MKLKSLTIAIALAATSASAFAAEKTEGFYIGVFGDYYDASWKNLN
FT                   MHQNLEVNESASWGAEVGYRFSDYWSARLEYADMDFNAFLKNPIPNGNRNDVDGERFGV
FT                   DALYHFGGGPFYGLFGIKEVKVATDNTFLNAGVGYQHFITDGLFVNAETSVYQGLDRGY
FT                   TDVNAKLGINYLFGQSSVAEEPVQPAPEPVIVEVAPVDSDNDNIPDADDQCPNTPMTDA
FT                   VDGTGCTLYEDKEVTVSLLVTFPNNTSAVSTQYLNDIDKVAEFLKEYPDTTVLLEGHTS
FT                   SVGKASYNKWLSKKRADAVAKKLVADGVAEDRITTVGLGEERLKNEANTKAAHEENRRV
FT                   EAHIKTIKNVKVLR"
FT   gene            193464..196106
FT                   /gene="acnB"
FT                   /locus_tag="PSHAa0184"
FT   CDS_pept        193464..196106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="PSHAa0184"
FT                   /product="bifunctional protein [Includes: aconitate
FT                   hydratase 2; 2-methylisocitrate dehydratase] (iron-sulfur
FT                   protein)"
FT                   /function="2.1.2 : TCA and related cycles"
FT                   /EC_number="4.2.1.3"
FT                   /EC_number="4.2.1.99"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11992126, 12486059; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85287"
FT                   /db_xref="GOA:Q3IJ30"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ30"
FT                   /protein_id="CAI85287.1"
FT                   /translation="MKRYRILSRHQEGNIVLQEYRKHVEERAALGIVPAPLDAQQTADL
FT                   IELIKTPPAGEEEFILDLFANRVPAGVDDAAYIKAGFLAAVAKGETNSPLLSKEKAAEL
FT                   LGTMLGGYNIAPMIDLLDDDTLAPIVVKGLSNTLLMFDAFYDVEEKAKAGNTFAKQIIE
FT                   SWANAEWFTNKPAVAEKISVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKIERD
FT                   GITPDKPGEVGPITQLEELKTKGLPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPFVPN
FT                   KRVGGVCLGNKIAPIFFNTMEDSGALPIELNVDELNMGEQIDIYPYEGVVKQHGTDKVI
FT                   SKFELKSEVILDEVRAGGRIPLIIGRGLTDKARTSLGLGATDIFKVPTATEVSDKGFTL
FT                   AQKMVGKACNVAGIRPGQYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSADLTMQSFC
FT                   HTSAYPKPIDVNTHHTLPDFIMNRGGVSLRPGDGIIHSWLNRMLLPDTVGTGGDSHTRF
FT                   PLGISFPAGSGAVAFAAATGVMPLDMPESILVRFKGEMQPGITLRDLVHAIPYYGIKQG
FT                   LLTVEKKGKINEFSGRVLEIEGVEHLTVEQAFELSDASAERSAAGCTVKLSKESISEYL
FT                   ESNIVMLKWMISEGYGDVRTIERRINAMQDWLANPELMEADKDAEYAHVVEIDLAEIKE
FT                   PVLCAPNDPDDARLLSDVAGEKIDEVFIGSCMTNIGHFRAAGKLLDGFKGQLPTQLWVA
FT                   PPTKMDKDQLIEEGYYGIFGRVGARIETPGCSLCMGNQARVADKATVVSTSTRNFPNRL
FT                   GNGANVFLASSELAAVAAIIGRLPTAAEYQEYAAKINATASDTYRYLNFHRMPAYTKKA
FT                   DNVIIQQAV"
FT   gene            196306..196938
FT                   /locus_tag="PSHAa0185"
FT   CDS_pept        196306..196938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0185"
FT                   /product="putative biofilm formation, controlled by quorum
FT                   sensing, formation of cell aggregates"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="1.9.1 : Biofim formation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 14729694"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85288"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK57"
FT                   /protein_id="CAI85288.1"
FT                   /translation="MTALNPQNLLQLRFINQTNIDLVKPSFDNLPTNPYADGAFRKRRY
FT                   SVVKLQNGELKLQATKAFVQDDAINTFQGNVERSYENLEQSLLESAGMKSIVNEFRQIT
FT                   GIDEERDIEIHQFRMLAIDSDTPAAPEGVHQDGFDHVCVCGVSHENLEGGELLVYENKQ
FT                   ADPCFKMAIKDGMFAVINDRQVWHNATPMNKLDASKPGYLDCFVLTS"
FT   gene            196948..198183
FT                   /gene="csd"
FT                   /locus_tag="PSHAa0186"
FT   CDS_pept        196948..198183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csd"
FT                   /locus_tag="PSHAa0186"
FT                   /product="putative cysteine desulfurase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.5.14 : Other"
FT                   /EC_number="2.8.1.7"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10939241"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85289"
FT                   /db_xref="GOA:Q3IK63"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK63"
FT                   /protein_id="CAI85289.1"
FT                   /translation="MNITQLREQFPALMQSVNGKSPVFLDGPGGSQVPQSVLNAMTAYL
FT                   GYYNSNLGGAFFSSDKTVELMANARQAAADLLNAPSSQQIVFGPNMTSLTFSFSRAISR
FT                   DWQTGDEIIVTNADHFSNVSSWQQAAEDKGVKVNTALINETDCTLNMAQFESLLNSNTK
FT                   LVAVTYASNTTGSINNIKRIVELAHNVGALVYVDAVHYAPHELVDVQALDCDFLACSAY
FT                   KFFGPHLGMVYGKKEHLEGFTPYKVEPAKDVAPGRWETGTQSFEAMAGFIAAVDYIAAI
FT                   SELDDSHSRREKLSVAFAKTKQHEMALSEYFLTRLVNYPRIKLFGIDDLDRLNERTPTF
FT                   ALTFEGLEPRAVSECLGKQHICVWDGNFYAQGLCEQLGVLDKGGVVRIGCMHYNTTAEL
FT                   DQLFNLFDELLG"
FT   gene            complement(198203..198907)
FT                   /locus_tag="PSHAa0187"
FT   CDS_pept        complement(198203..198907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0187"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85290"
FT                   /db_xref="GOA:Q3IK62"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK62"
FT                   /protein_id="CAI85290.1"
FT                   /translation="MTDFIRVYDNALSNDFCDNFITTFSQSPHIKQGMTSGGIDLNKKD
FT                   SHDLHLNNHPEYVEQLKHIQQTTAQYVFKYIEEHIFIMIGAFGLKVYHPKSGEPVDLTH
FT                   ANFDEVGKPQLPLLVQQIFRLGNIQAQKYQVNKGGYPYWHSEVYPQLNHNEALHRVLLF
FT                   MFYLNDVEQGGETEFYYQKRKIAPKKGTMVIAPGYFTHTHRGNKPVSNDKYILTSWVLF
FT                   NRAEQIYGAPKS"
FT   gene            198941..199339
FT                   /locus_tag="PSHAa0188"
FT   CDS_pept        198941..199339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0188"
FT                   /product="conserved protein of unknown function (could be a
FT                   thioesterase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85291"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK61"
FT                   /protein_id="CAI85291.1"
FT                   /translation="MFIEKVMPRFSETDALGHINNTVLPVWFEASRAPIFRFFTPDLNP
FT                   HDWKLIIAKVEVSFVGELFYGHEVTIKTSVEHVGTSSFVLRQEAHQQGNCCAVGKTVLV
FT                   RYDFAAKAKQSLSVSEKSSLNEHLAPAS"
FT   gene            complement(199352..200890)
FT                   /gene="glpD"
FT                   /locus_tag="PSHAa0189"
FT   CDS_pept        complement(199352..200890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="PSHAa0189"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase FAD
FT                   binding; dioxygen as acceptor"
FT                   /function="2.1.3.2 : Sugar alcohols"
FT                   /EC_number="1.1.99.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11955283; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85292"
FT                   /db_xref="GOA:Q3IK60"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK60"
FT                   /protein_id="CAI85292.1"
FT                   /translation="MPSLKLIKRYSVKLLDNEYDLLVIGGGVNGTGIAADAAGRGLKVL
FT                   LCEQNDLASATSSSSSKLIHGGLRYLEHYQFRLVKEALKEREVLLKNAPHIMWPLSFRL
FT                   PHQAHLRPYWMIRIGLFIYDHLAKRITLPASKSIKFTRDSILNNTITRGFEYADGWVDD
FT                   SRLVILNALAAQQKGATILSRTRCIKAVRNNNNWSVTLEQQGSKKQCSIVAKGVVNAAG
FT                   PWVASLFDEVITGPSPHNIRLVKGSHIIVPRIHTEPQAYILQNKDQRIIFVTPFEDDYS
FT                   LIGTTDEEYSDNIADVKISDKEVDYLISITNNYFKKQLTHNDIVHTFSGVRPLLDDNSC
FT                   DAQAVTRDYKLILSSNNNQAPLLSVFGGKITTYRKLAENAVNELASFYPHMGQTWTKNT
FT                   PLPGGDFSSKVVLKQQLQVKYAWLPEFILNRFIRSYGTGTYTLLTDAQSVADLGQHFGH
FT                   GLYATEVNYLVNSEWASSAEDILWRRSKLGLRFNTEQITALSQYIQNYNGSIPL"
FT   gene            complement(200916..202421)
FT                   /gene="glpK"
FT                   /locus_tag="PSHAa0190"
FT   CDS_pept        complement(200916..202421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="PSHAa0190"
FT                   /product="glycerol kinase"
FT                   /function="2.1.3.2 : Sugar alcohols"
FT                   /EC_number="2.7.1.30"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85293"
FT                   /db_xref="GOA:Q3IK59"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK59"
FT                   /protein_id="CAI85293.1"
FT                   /translation="MSKYILSIDQGTTSSRAILFTKDAKVVDTVQQTFPQHFPNNGWVE
FT                   HDPNDILQTVLSTCKTVLANNQVTAEQVIAIGITNQRETTLVWNKKTGQPIYNAIVWQD
FT                   RRTSEYCEQIRSDKLSKKISDKTGLLLDPYFSATKIRWILDNVTDAQQQALAGELAFGT
FT                   VDSYLLWHLTAGKVHRTDATNASRTLLFNIHQQCWDEELLTQFNIPHSMLPEVMDSAAE
FT                   FGSTSSEIFGAPIKICAMAGDQQAALIGQACFKEGMAKSTYGTGCFLMLNTGDKALTSN
FT                   NRLLTTVAYRLNGRVTYAIEGSIFMAGATMQWIVEGLKLLEHAGDSEAMVKDVPLDHGV
FT                   FLVPSFTGLGAPYWDANARGAILGLTRDSGISTIVAAALQSVGYQTKDLQKAMEGDGLR
FT                   PSILRVDGGMAKNNWAMQFLANILGASVERPALTETTSLGVAYLAGLQTGIYKSTEQLA
FT                   TMWQCDRRFEPTMSIDERNDLYAKWQHCIAQVTLSNNATKDDC"
FT   gene            complement(202624..202866)
FT                   /locus_tag="PSHAa0191"
FT   CDS_pept        complement(202624..202866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0191"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85294"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK58"
FT                   /protein_id="CAI85294.1"
FT                   /translation="MLGEDHSLTQDFPEHLNTIKKLNSNDPEFADKAKKYNALDKEIRT
FT                   LELQDAPIDDEEMLQLKHDRVVLKDWLHQQLLKAS"
FT   gene            203138..203719
FT                   /gene="pabA"
FT                   /locus_tag="PSHAa0192"
FT   CDS_pept        203138..203719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="PSHAa0192"
FT                   /product="putative glutamine amidotransferase; putatively
FT                   involved in paraminobenzoate biosynthesis"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="4.1.3.27"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85295"
FT                   /db_xref="GOA:Q3IFU1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFU1"
FT                   /protein_id="CAI85295.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFQRLDQEVLVKRNDQITLSQIKQLNPQ
FT                   HIVISPGPKSPSEAGISLSIVEQLKGQYPILGICLGHQTIAQALGAKVVRAKKVMHGKT
FT                   SPIYHSDQGVFKGLAKPLTVCRYHSLIVEAQSLPKELQVTAWTQTQQGEFDEIMGLLHT
FT                   DLALEGVQFHPEAILTEQGLALLDNFLTRF"
FT   gene            203765..204925
FT                   /locus_tag="PSHAa0193"
FT   CDS_pept        203765..204925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0193"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85296"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFU0"
FT                   /protein_id="CAI85296.1"
FT                   /translation="MTEIVQQPRIVKMLNQRAHDLLLGHNFAHQQIGFIHTLEMDYGEP
FT                   LKQRTLLEVEVAAQQKRKLKSTAHHKYRAAASEQLHKAIEKMMSEQLSDIDSVIQNTIG
FT                   VEDSVCAMLDILATKSASVGRLEPLVNDLSWLGRELVTLVNLPYYRNQRSKNTAVKVDS
FT                   PALALRYIGLDNLQLVVPTFAVRHWMPYSTEPFSLLKRRLKESAMANAIAAQKIAEVNE
FT                   VNPSHAFTLGMLLNVGQIALVRLYLKVFEQIWQRKVQFARTTANKGLHTALLELKPDPL
FT                   FLTTLLSEQSLAISAKIIEKMAFKYLPFNSVMQQLVNGVEKGDTALPLTQVMLKARCYS
FT                   QYLTLKQHQLVEPDETLSWFSYFKFTKKELKALQASNFNNLAIQID"
FT   gene            205294..206499
FT                   /gene="astC"
FT                   /locus_tag="PSHAa0194"
FT   CDS_pept        205294..206499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astC"
FT                   /locus_tag="PSHAa0194"
FT                   /product="acetylornithine transaminase (NAcOATase and
FT                   DapATase), PLP-dependent"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="2.6.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85297"
FT                   /db_xref="GOA:Q3IFT9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT9"
FT                   /protein_id="CAI85297.1"
FT                   /translation="MTVNRELFDHVMVPNYAPSSVIPVRGEGSRVWDQQGREFIDFAGG
FT                   IAVNCLGHCHPALVGALKEQGEKLWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGA
FT                   EANEAALKLARRFALDQFGAEKSQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDI
FT                   VHCDYNDLAAFEALISDKTCAVMMEPLQGEGGIVSPTDEFAQGVRDLCTKHNALLIFDE
FT                   VQTGVGRTGNLYAYQGLNVVPDILTTAKALGGGFPIGAMITTTEIAQHLKVGTHGSTYG
FT                   GNPLACAVAEAAFDTVNTPEVLAGVTAKAALFNQLLTEINNKYHVFSEIRGQGLLIGAV
FT                   VSEQYKGRAKEFLVAGTEHGLMSLVAGADVVRFTPSLVIPEADIREGMARFEKAVASVV
FT                   SA"
FT   gene            206587..207603
FT                   /gene="astA"
FT                   /locus_tag="PSHAa0195"
FT   CDS_pept        206587..207603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astA"
FT                   /locus_tag="PSHAa0195"
FT                   /product="arginine succinyltransferase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="2.3.1.109"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14675764; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85298"
FT                   /db_xref="GOA:Q3IFT8"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT8"
FT                   /protein_id="CAI85298.1"
FT                   /translation="MMILRPIQQSDYPALVKIAHESGHGFTSLPNNEKLLQKKIDHSVS
FT                   SFAKAATEPGDEGYLFVLEDTETGEVVGTSGIEAAVGLDDAFYHYHLSKVIHSSRTLNV
FT                   YKAVDILTLCNDYTGATELCTLFLKDAYRKNSNGKLLSKSRFMFIKQHQERFAQTVIAE
FT                   MRGVSDDNGSSPFWQWLEEHFFSMDFPTADYLTGIGQKVFIAELMPKYPIYVNLLSKNA
FT                   QAVIGKVHDNTRPAIELLKSEGFTFNGYVDIFDAGPTVEAKVDNIATIRNAKHFKVEIG
FT                   EPSGDTMVLLANEKLTDFRATVVPMTFDERMSSIVITQQVADALYLQAGDSVSATTI"
FT   gene            207620..209089
FT                   /gene="astD"
FT                   /locus_tag="PSHAa0196"
FT   CDS_pept        207620..209089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="PSHAa0196"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="1.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12107143; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85299"
FT                   /db_xref="GOA:Q3IFT7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFT7"
FT                   /protein_id="CAI85299.1"
FT                   /translation="MTHPAQFINGQWSQGQGTEFSSVNPANNNVIFQANSATAEQVDAA
FT                   VSAAREAFYAWADKTFAERLEIVKAFAAQLKENSEELAITIAQETGKPLWETRTEAGAM
FT                   VGKIAISEKAFLERTGDVENAMPLGRAMIRHKPHGVVAVFGPYNFPGHLPNGHIVPALL
FT                   AGNTVIFKPSELTPKVAELTLKLWEKAGLPAGVINLVQGEVATGKALAAHKGIDGLFFT
FT                   GSSRTGHILHEQFAGQPGKILALEMGGNNPLIITDVEDTKAVVHDIIQSAFISSGQRCT
FT                   CARKLFLPTGSKGDVILERLITATKAIKVGNYDDADQPFMGSMISSAAAAGMVKAQNEL
FT                   VELGAQVLVELEHTVNTGFVTPGIIECTNISDFPDEEHFGPLLKVFRFDDFDQAIDKAN
FT                   DTSFGLSAGLLSDSAADYEHFLRRIRAGIVNWNRPITGASSAAPFGGIGASGNHRASAY
FT                   YAADYCAYPVASVELEKVAMPATLSPGLKID"
FT   gene            209218..209556
FT                   /locus_tag="PSHAa0197"
FT   CDS_pept        209218..209556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0197"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85300"
FT                   /db_xref="InterPro:IPR020979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT6"
FT                   /protein_id="CAI85300.1"
FT                   /translation="MVLNRQGYDDLIMYLTQNLALFEKPGEIKPGAPTVMELIEDVIAQ
FT                   NVMLICQQHTELTTEQRSQIVREVDGIVYDLQEVLSSITSRPVTVEQHMFIDEFGGLVK
FT                   NLFDNAVS"
FT   gene            209726..210139
FT                   /locus_tag="PSHAa0198"
FT   CDS_pept        209726..210139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0198"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85301"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT5"
FT                   /protein_id="CAI85301.1"
FT                   /translation="MQANVKWVEGNTFIGRSNSNHNVVFDGGSDSAAPSPMEMVLMSIG
FT                   CCSSVDVVSILKKAKQDFSNVEVQLTAERAETAPRVFTKVNLHFVATGNNVSEKHLARA
FT                   VSLSAEKYCSVALMLDKTVKITHSHEVVQDQVK"
FT   gene            210227..211039
FT                   /gene="speD"
FT                   /locus_tag="PSHAa0199"
FT   CDS_pept        210227..211039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="PSHAa0199"
FT                   /product="S-adenosylmethionine decarboxylase, proenzyme"
FT                   /function="2.2.2 : Polyamines biosynthesis"
FT                   /EC_number="4.1.1.50"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10844697, 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85302"
FT                   /db_xref="GOA:Q3IFT4"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFT4"
FT                   /protein_id="CAI85302.1"
FT                   /translation="MNKPFDKLKLHGFNNLTKSLSFSIYDICYAKTEQQRKEYIEYIDE
FT                   QYSADRLTDILGEVVDIIGANILNVARQDYEPQGASVTILVSEEPVEEQQNYDADEAPG
FT                   PLPDSVVAHLDKSHICVHTYPEAHPDDGICTFRADIEVSTCGIISPLKALNFLIHSLES
FT                   DVVTIDYRVRGFTRDINGVKHYIDHAISSIQNFMTEDTKEAYQMMDVNVYQENLFHTKM
FT                   MLKETDLNTYLFGLSTDDLSDEEEEEIRSKLTREMQEIFYGRNLPDLD"
FT   gene            complement(211123..212382)
FT                   /gene="sdaC"
FT                   /locus_tag="PSHAa0200"
FT   CDS_pept        complement(211123..212382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaC"
FT                   /locus_tag="PSHAa0200"
FT                   /product="putative serine transport protein (HAAAP family)"
FT                   /function="1.2.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8026499; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85303"
FT                   /db_xref="GOA:Q3IFT3"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT3"
FT                   /protein_id="CAI85303.1"
FT                   /translation="MPPSQDATHFNASTAKQSSWTLHDTQWTLSLFGTAVGAGILFLPI
FT                   NIGIGGFWPLIIMACLAFPMTFLAHRGLARFVLSSKNKDADFTDVVEEHFGVTAGRLIS
FT                   LLYFLSIFPILLIYGVGLTNTVDSFMVNQLGMESPSRVLLSGVLVAGMIGLMMGGEKLM
FT                   LRAFAILVYPLVGILFFLSLYLIPSWQMPNMALPEVGSFGKTLWLSIPIIVFSFSHAAA
FT                   ISSFVNVQRGHYGNKAVAKSEAILKRTSLLLITFVLLFVFSCVLSLTGEQMAAAKAANV
FT                   SVLSYLANITDNSFIATLGPLVAFIAIMSSFLGHFLGARESFTGLVTKQSNISAKVADK
FT                   VGAVLMFFAIWFCAVKNPSILDMMDQLSGPIIAMILFIMPMIAVYKVPALHKHRNRLST
FT                   LFILAVGSMAVMALLYSMLK"
FT   gene            complement(212505..212645)
FT                   /locus_tag="PSHAa0201"
FT   CDS_pept        complement(212505..212645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0201"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85304"
FT                   /db_xref="GOA:Q3IFT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT2"
FT                   /protein_id="CAI85304.1"
FT                   /translation="MQCVNFKLYGEKLLTPFLSAPFLLIIFNVELKPLPFSAHFYNAVA
FT                   N"
FT   gene            212751..213221
FT                   /locus_tag="PSHAa0202"
FT   CDS_pept        212751..213221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0202"
FT                   /product="putative ribosome protein acetyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85305"
FT                   /db_xref="GOA:Q3IFT1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT1"
FT                   /protein_id="CAI85305.1"
FT                   /translation="MLLQFESENKAWFESMLPPREDYFYRDLGIKMHIYDAIINMQLGT
FT                   HYSGVLIVNEQIVARANLKDITGQTNTAAVGYRVAKNSIGKGYASFCLNELISIAAQHY
FT                   AVNKLEALVLDNNPASKAVLLKCGFKAQSHKDNYMTINGHTLGVTHFLRAPI"
FT   gene            complement(213286..213525)
FT                   /locus_tag="PSHAa0203"
FT   CDS_pept        complement(213286..213525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0203"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85306"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT0"
FT                   /protein_id="CAI85306.1"
FT                   /translation="MLKNIVIVAAVIAHNKRESQRIAGIRRVLGCDNSISLSISYFASV
FT                   HQIIKSPNADKLKCRNIICETQNATQTRGSYSLT"
FT   gene            complement(213709..213837)
FT                   /locus_tag="PSHAa0204"
FT   CDS_pept        complement(213709..213837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0204"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR5"
FT                   /protein_id="CAI85307.1"
FT                   /translation="MSIVPYINVLDTLSIVDDLSKVALDYELGRKLQDIELLNKKR"
FT   gene            complement(213924..214076)
FT                   /locus_tag="PSHAa0205"
FT   CDS_pept        complement(213924..214076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0205"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85308"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR3"
FT                   /protein_id="CAI85308.1"
FT                   /translation="MHFITLSTTMNPTQNKHLIFGSLLHSDFVFMTLLHQYDLTKLHFN
FT                   IKVKL"
FT   gene            complement(214046..214192)
FT                   /locus_tag="PSHAa0206"
FT   CDS_pept        complement(214046..214192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0206"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR7"
FT                   /protein_id="CAI85309.1"
FT                   /translation="MYSSPIPILKGQLYKTNLIFASESSNVNIASQLGCVGKLCILLPS
FT                   LLL"
FT   gene            214195..215598
FT                   /locus_tag="PSHAa0207"
FT   CDS_pept        214195..215598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0207"
FT                   /product="conserved protein of unknown function"
FT                   /function="5 : Similar to unknown proteins"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85310"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR6"
FT                   /protein_id="CAI85310.1"
FT                   /translation="MEFKSNKIIIDPNDPFKNDKLGRKPHVENFTTLLKNISSPIVLSV
FT                   NAPWGQGKTTFLEMLEGNLQINNCSAIYFSAWETDFVNDPLQAFLGEVNKKIESLVEGD
FT                   KEKSKAWVKAKSAGAQILKKGLPVLVKLATAGIIDAGKITEAEAAKFTEGLSKDFLDDY
FT                   TKSKEAITSFKENVSKALKNEDGGASQLFIIIDELDRCRPTYAIELLERIKHLLDIEGL
FT                   VFVIAMDKLQLSHSVKGVYGAGFEAMGYLRRFIDIEYILPESDLDAFIEQLYKVFEFDI
FT                   FFQKRTQYQAFRYEKDYLKNTFKLLAKAKKLSLREVEQLFAKVNLVVKSTAENVYLYPD
FT                   LLAFLIVAKEYYYESYSGYINGGDTPEKLIQVLHSITPSLKSIDSRACAVIESSLIGAK
FT                   NDEYQGNIGGALKYHEDMSSDESASTDEQNYSHDVVQITKSFDGFRNSIDLESLKQRIE
FT                   MLESFKFNS"
FT   gene            complement(215671..216378)
FT                   /gene="cysQ"
FT                   /locus_tag="PSHAa0208"
FT   CDS_pept        complement(215671..216378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="PSHAa0208"
FT                   /product="likely to be PAP (3',5' adenosine diphosphate) 3'
FT                   phosphatase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.5.6 : Pantothenate and coenzyme A"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.4 : Metabolism of lipids"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85311"
FT                   /db_xref="GOA:Q3ILR4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR4"
FT                   /protein_id="CAI85311.1"
FT                   /translation="MGIYQKDFNVEYKADESPVTDADLAAHKIIVAGLQQLTPDIPILS
FT                   EENADISWEVRKAWKSYWLVDPIDGTKEFIKKNGEFTVNIALIENGIPVLAVVDAPALG
FT                   VSYLASEAIGAFKDKGDERIELKVTTKPNTGLIRVVGSRSHPSPDLAEFVKRFDEVEMV
FT                   SKGSSLKLCLVAEGSADIYPRLGPTCEWDTGAGHAIAAIAGAKVTKIDGSPLIYNTKDE
FT                   YLNPYFIVSAIEE"
FT   gene            complement(216452..217045)
FT                   /gene="cysC"
FT                   /locus_tag="PSHAa0209"
FT   CDS_pept        complement(216452..217045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="PSHAa0209"
FT                   /product="adenosine 5'-phosphosulfate kinase"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.1.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9515915, 10939241, 12072441; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85312"
FT                   /db_xref="GOA:Q3ILQ1"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ1"
FT                   /protein_id="CAI85312.1"
FT                   /translation="MDENIVWHNYATTKAQRSEQKKHQSAIIWFTGFSGSGKSTVANAL
FT                   EAALNQQGIHTYLLDGDNVRHGLCKDLGFSDADRVENIRRVGETAKLMVDAGLLVLTAF
FT                   ISPFRAERDMVRSLVDDKEFIEVFIDTPLDVCESRDPKGLYKKARAGEIKHFTGIDSSY
FT                   EIPINPEIILDTSKNTLDQSVVQLITYLKQQHII"
FT   gene            complement(217080..218804)
FT                   /gene="snaA"
FT                   /locus_tag="PSHAa0210"
FT   CDS_pept        complement(217080..218804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snaA"
FT                   /locus_tag="PSHAa0210"
FT                   /product="putative sodium/sulfate symporter"
FT                   /function="1.2.2 : Anions"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10939241; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85313"
FT                   /db_xref="GOA:Q3ILR2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR2"
FT                   /protein_id="CAI85313.1"
FT                   /translation="MVDQLILTGIMLTLVGCLFGTRLNPAWLFVGAIGSSYLAGLIDLE
FT                   SMLVNYTNPSLITLVLLILVSIAIEKTTLIQKLAQSLSSGSLVKSVTKLGLSTAFLSSF
FT                   TNNTAVVASLITAIKDNPNHSPSKLLLPLSYTAILGGTITLIGTSTNLIVNGFAVDAGM
FT                   APLGFFDFTLVGLGALSVGLITILVMLKYLPDNGKSDQEVVPFYLEGKVQAGSKLIGRT
FT                   VEENGLRELKDLFLGEIIRDNQRICAVTPQQIIKQNDILLFVGDIKSVPLLTRFDGLKV
FT                   VHDNHQKDIEHLVEVVVSQSSKFIGKTVKEARFREQFHAAVIAIRRGHDRLQGGLGQVR
FT                   LQAGDSLILAPGKNFYSLPNLKREFVYISGFDLQTHLAPKQSNIVLLSFAAVLGLSIIG
FT                   LVPLVKGLLVLLIGFMLCGTIKLSEVKRRFPIELLAVVGSAIGLAKLMIGTGLAGQISA
FT                   AMFVVLGDFGPYSAFIAIFLMTVLFTELITNNAAAALSFPVAYSLAVGFNVDPLPFIMA
FT                   VAFGASASFISPFGYQTNLMVYSAGNYRLKDYVVMGLPLSIIYSITVLTLIPLVFPF"
FT   gene            complement(218836..220260)
FT                   /gene="cysN"
FT                   /locus_tag="PSHAa0211"
FT   CDS_pept        complement(218836..220260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="PSHAa0211"
FT                   /product="ATP-sulfurylase, subunit 1 (ATP:sulfate
FT                   adenylyltransferase)"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1730615, 7487067, 10939241, 12007424; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85314"
FT                   /db_xref="GOA:Q3ILR1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR1"
FT                   /protein_id="CAI85314.1"
FT                   /translation="MANQNNDTFNEVKAIGIDAYLARQQDKSLLRMLTCGSVDDGKSTL
FT                   IGRLLHDSHQIYEDQLAALHKDNEKVGNAGDDLDLALLVDGLQAEREQGITIDVAYRYF
FT                   STAKRKFIIADTPGHEQYTRNMVTGASTSDVAIILVDARYGVQVQTKRHSFICDSLGIK
FT                   QFVVAINKMDIVDFDETVYEKIKADYLKFAEQLNVSNIKFVPMSALKGDNVVTRSVHTP
FT                   YYTDKPLLELLEDSPAAQIDTDFEARLPVQYVARPNLNFRGFQGTLASGKLQVGDAIKV
FT                   LPSGKTSSIKEIVTFDGNLDSAQAGQAITVTLNSEIDISRGDVIVPASSTAIVTNQLQA
FT                   KLVWMHETPLQLGKSYNFKLGSKNTSAQVTKIDHTIDVNTLEHGSSDTLQLNEIAIVTL
FT                   ELSETILADEYHSNHETGSFILIDRLSNLTIAAGMIEQVLQSQAQQSNFSAFEVEFNTL
FT                   VRKHFPHWQALDISKL"
FT   gene            complement(220260..221159)
FT                   /gene="cysD"
FT                   /locus_tag="PSHAa0212"
FT   CDS_pept        complement(220260..221159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="PSHAa0212"
FT                   /product="ATP-sulfurylase, subunit 2 (ATP:sulfate
FT                   adenylyltransferase)"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2828368, 7487067, 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85315"
FT                   /db_xref="GOA:Q3ILR0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILR0"
FT                   /protein_id="CAI85315.1"
FT                   /translation="MALTHLQQLEAESIKIMREVAAEFENPVMLYSIGKDSSVLLHLAR
FT                   KAFYPAKIPFPLLHVDTNWKFSEMIEFRDRIAKEYGFELLVHKNPEGMEIGISPFEHGS
FT                   GKHTDIMKTQGLKQALDKYGFDAAFGGARRDEEKSRAKERVYSFRDKHHRWDPKNQRPE
FT                   LWNTYNSQVNPGESIRVFPLSNWTELDIWQYIYQENIDMVPLYLAKERPVVDRDGTLIM
FT                   VDDERMPLLEGEVPMMKSVRFRTLGCYPLTGAVESTASSLTEIIEEMLLSTSSEREGRV
FT                   IDHDSAGSMEKKKREGYF"
FT   gene            complement(221215..222636)
FT                   /gene="cysG"
FT                   /locus_tag="PSHAa0213"
FT   CDS_pept        complement(221215..222636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="PSHAa0213"
FT                   /product="multifunctional siroheme synthase:
FT                   uroporphyrinogen methyltransferase; 1,
FT                   3-dimethyluroporphyriongen III dehydrogenase; siroheme
FT                   ferrochelatase"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2550423, 8243665, 7592323, 9150215, 10939241, 11114933;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85316"
FT                   /db_xref="GOA:Q3ILQ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ9"
FT                   /protein_id="CAI85316.1"
FT                   /translation="MQYLPIFTKLDNKPVLVVGGGDVALRKCSALLKARASITLVAPKF
FT                   CQQLIELASENKVTLIHEYFSEQHLKNMMLVIAATDLEHVNSQVFELANAHNIFVNVVD
FT                   DQPKCTFIFPSIVDRNPITIAISSAGTAPVLARRLREKLETLIPQHIGPLATLVGGFRS
FT                   KVKQRFKHFADRRQFWEGVFDSSVVSKVQTGDTQAAEQQLEHMLNAKAEPEGEVYVVGA
FT                   GPGDPELLTLKALQLMQQADVVVYDYLVSDEIMELVRRDADLICVGKRLGDHSVAQQDT
FT                   NQMLVDLAKQGKKVCRIKGGDPFIYGRGGEEVQVLAANKVNYQIVPGITAAAGCSAYAG
FT                   IPLTHRDHAQAIQFVTGHCKKDGQELDWQSLAKPNQTLAIYMGVIKSPHIQAELLKHGR
FT                   NANTPVAIIENGTRKNQRVITGKLGELADLITRNSVVSPALLIIGEVASLHQELHWFGA
FT                   KAQTSSFAQPLTDVA"
FT   gene            222904..223650
FT                   /locus_tag="PSHAa0214"
FT   CDS_pept        222904..223650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0214"
FT                   /product="putative sugar-phosphate aldolase"
FT                   /function="2.1.3.1 : Carbohydrates (other than glucose)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8939754; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85317"
FT                   /db_xref="GOA:Q3ILQ8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ8"
FT                   /protein_id="CAI85317.1"
FT                   /translation="MIKQQKEAALAVALMDLTSLNSNDDSAAINTLVNSINPKLGTPAA
FT                   VCVYSDFVAEAKIALATRELSHIKVATVTNFPTGDAPLNTVINETLIAIERGADEIDLV
FT                   IPYKALIAGDKSRVLEYVTESKKVCGSRALLKVIIESGELQTPDLIASATLLAIKGGAD
FT                   FVKTSTGKVAVNATLDATKTILNTIKESGKLVGFKAAGGVKTVADASDYLTLASTIMGN
FT                   DYLQANTFRFGASSLLTNVYAVLNEA"
FT   gene            223694..224140
FT                   /locus_tag="PSHAa0215"
FT   CDS_pept        223694..224140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0215"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ7"
FT                   /protein_id="CAI85318.1"
FT                   /translation="MFLRCYEQQYGIHMRHIWHNEPNKPDVSCYKGDQQLDIEVAHLYA
FT                   SETEAMAVLGRPLSIPMQRALADMAQAPSEQRLRLALERLLEQKATKSYHSARTWLLIR
FT                   NASTIWHKADFDAQLKMISVPQTHAFEQIWLLRDFYRGELVRLF"
FT   gene            224316..224392
FT                   /locus_tag="PSHAatRNA6"
FT   tRNA            224316..224392
FT                   /locus_tag="PSHAatRNA6"
FT                   /product="tRNA-Trp"
FT   gene            224525..224902
FT                   /gene="secE"
FT                   /locus_tag="PSHAa0216"
FT   CDS_pept        224525..224902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="PSHAa0216"
FT                   /product="preprotein translocase, membrane component,
FT                   transport across inner membrane (General Secretory
FT                   Pathway)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11867527, 11976315, 12167867, 12941690, 12950181; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85319"
FT                   /db_xref="GOA:Q3ILQ6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ6"
FT                   /protein_id="CAI85319.1"
FT                   /translation="MSTNVETPSSAMESVKWLVAIVLLAGAVVGNHMFADQSVLLRAIG
FT                   VVVAIAAGLAIASQTAKGRTFLTFAKEARIEVRKVIWPTRQETIHTTLIVMVATAIMAL
FT                   ILWGLDGILFRAVGFLTGLEI"
FT   gene            224907..225464
FT                   /gene="nusG"
FT                   /locus_tag="PSHAa0217"
FT   CDS_pept        224907..225464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="PSHAa0217"
FT                   /product="component in transcription antitermination;
FT                   couples translation and transcription"
FT                   /function="3.2.1.3.2 : Transcription / translation
FT                   coupling"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1831176, 8022288, 7590257, 10209750, 10820031, 11018144,
FT                   12600194; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85320"
FT                   /db_xref="GOA:Q3ILQ5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ5"
FT                   /protein_id="CAI85320.1"
FT                   /translation="MSDENNEIKLRWYVVQAFSGYEKRVAQTILEHIKIKGLEESFGEV
FT                   LVPTEEVIEMRAGQKRKSERKFFPGYVLIQMDMNDKSWHLVNSTERVMGFIGGTSDRPA
FT                   PISAKEAERILNRLQENAEAPKPATLFEPGEVVRVTDGPFADFSGVVEEVDYEKSRVKV
FT                   SVLIFGRSTPVELEFGQVEQDK"
FT   gene            225676..226104
FT                   /gene="rplK"
FT                   /locus_tag="PSHAa0218"
FT   CDS_pept        225676..226104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="PSHAa0218"
FT                   /product="50S ribosomal subunit protein L11"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11244072, 11673421; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85321"
FT                   /db_xref="GOA:Q3ILQ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ4"
FT                   /protein_id="CAI85321.1"
FT                   /translation="MAKKVEALIKLQVNAGMANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TESIEKGAPVPVVISVYGDRSFTFDMKTPPAAYLLLKAAGVKSGSGRPNTEKVGTVTRA
FT                   QLEEIVETKRADLTASDLEAAVRTIAGSARAMGLSVED"
FT   gene            226109..226813
FT                   /gene="rplA"
FT                   /locus_tag="PSHAa0219"
FT   CDS_pept        226109..226813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="PSHAa0219"
FT                   /product="50S ribosomal subunit protein L1"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 365581, 7556101, 3298242; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85322"
FT                   /db_xref="GOA:Q3ILQ3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ3"
FT                   /protein_id="CAI85322.1"
FT                   /translation="MAKLTKRMRTIREKVEVTKDYEINEAIALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPNGTGRDVRVAVFTQGANAEAAKEAGAELVGMEDLAELV
FT                   KKGEMNFDVVVASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFTAEQLQQNLESLIVALKKAKPSQAKGVYVKKVSISTTMGAGV
FT                   AVDQNTLSTTVA"
FT   gene            227136..227630
FT                   /gene="rplJ"
FT                   /locus_tag="PSHAa0220"
FT   CDS_pept        227136..227630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="PSHAa0220"
FT                   /product="50S ribosomal protein L10"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 377281, 782920, 2448482; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85323"
FT                   /db_xref="GOA:Q3ILQ2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ2"
FT                   /protein_id="CAI85323.1"
FT                   /translation="MALNLQGKQAIVAEVNEAANGALSAVVADSRGVTVGAITALRKEA
FT                   RANGVWMKVVRNTLAKRALEGTQFECLSDSFVGPSLIAFSSEHPGAAARIFSAFAKKNE
FT                   KFELKTAAFEGNVVDAAMLATLPTYDEAVARLMSAMKEASAGKLCKTIEAVRVQKEEQA
FT                   A"
FT   gene            227705..228067
FT                   /gene="rplL"
FT                   /locus_tag="PSHAa0221"
FT   CDS_pept        227705..228067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="PSHAa0221"
FT                   /product="50S ribosomal subunit protein L7/L12"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2660100, 168924, 8234320, 10747797; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85324"
FT                   /db_xref="GOA:Q3ILQ0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ0"
FT                   /protein_id="CAI85324.1"
FT                   /translation="MSVSKDQILDAIAEMSVMDVVALIEAMEEKFGVTAAAGMVAGPAA
FT                   EAVEEKTEFDVILTGAGANKVSAIKAVRSATGLGLKEAKALVEAAPTPVKEGISKEEAE
FT                   ALAKDLTEAGAEVEVK"
FT   gene            228338..232363
FT                   /gene="rpoB"
FT                   /locus_tag="PSHAa0222"
FT   CDS_pept        228338..232363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="PSHAa0222"
FT                   /product="DNA-directed RNA polymerase beta chain (RNAP beta
FT                   subunit) (Transcriptase beta chain) (RNA polymerase beta
FT                   subunit)"
FT                   /function="3.2.1.3.1 : RNA polymerase (core enzyme)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6266829; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85325"
FT                   /db_xref="GOA:Q3ILP9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP9"
FT                   /protein_id="CAI85325.1"
FT                   /translation="MAYSYSEKKRIRKDFGKRPQVLDIPFLLSTQLKSFKKFLVPDADG
FT                   DHGLEAAFRSVFPIKSYSGNSELQYVSYRIGEPVFDVKECQIRGVTYSAPLRVKLRLVV
FT                   MDKEAPGTVKDIKEQEVYMGEIPLMTDTGTFVINGTERVIVSQLHRSPGVFFDNDRGKT
FT                   HSSGKVLYNARVIPYRGSWLDFEFDAKDNLYVRIDRRRKLPASIILRALEYSSEDILGI
FT                   FFDNTTFEVTDGKVLMELVPSRLRGETAAFDIKSEDGEVFVESGRRVTARHIKNIEKKG
FT                   IKQLEVPHEYIIGRVLAKNYVDESTGEVVANANDELTLELMAELVKAGHTKIDTLYINE
FT                   VDSGAYMSNTLNIDSSSSRLEALVEIYRMMRPGEPPTKDAAEALFQNLFFSEERYDLST
FT                   VGRMKFNSRVGYDTDTGPGTLSKEDIVSVMKVLIAIRNGVGDVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVRERLSLGDLDAIMPQDLINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLINSLS
FT                   TYARTNDYGFLETPYRKVVDGVVTDEVDYLSAIEEGQFVIAQANSNLTETNEFVDELIP
FT                   CRHKGESTFMGRMDQQYMDVSPQQVISVAAALIPFLEHDDANRALMGSNMQRQAVPTLK
FT                   ADKPLVGTGIELTLAKDSGVTIVAKRGGEVMYCDASRIVVNVHEEERVPGEAGIDIYNL
FT                   TKYTRSNQNTCINQKPTCMVGEPVTRGDVLADGPSTDLGDLALGQNLRVAFMPWNGYNF
FT                   EDSILLSERVVEEDRLTTIHIQELQCIARDTKLGSEEITADIPNVGESALGKLDESGVV
FT                   YIGAEVKSGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVTGTVID
FT                   VQVFTRDGVEKDKRALEVEEMQLRDAKKDFNEEFRILEAGVLDRARKLLIAAGFDEDKL
FT                   ALLNAEKLLTQSLAEEDKQAELEQLAAQYDELKAEYDKKFENKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRCIQPGDKMAGRHGNKGVISTIVPVEDMPYDDKGRTVDIVLNPLGVPSRM
FT                   NIGQILETHMGLAARGIGERIEEMMKEQRELHELRAFIKQAYEIGESRQVVDIDSFTDD
FT                   EIRRLAENLKGGLPIATPAFDGAKENEIKDMLELAGYPRSGQVTLYDGRTGDQFERQVT
FT                   VGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAY
FT                   TLQEMLTVKSDDVNGRTKMYKNIVDGNHKMEPGMPESFNVLLKEIRSLGINIELEEN"
FT   gene            232468..236640
FT                   /gene="rpoC"
FT                   /locus_tag="PSHAa0223"
FT   CDS_pept        232468..236640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="PSHAa0223"
FT                   /product="RNA polymerase, beta prime subunit"
FT                   /function="3.2.1.3.1 : RNA polymerase (core enzyme)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6287430, 6278450; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85326"
FT                   /db_xref="GOA:Q3ILP8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP8"
FT                   /protein_id="CAI85326.1"
FT                   /translation="MKDLLKFLKQQNKTEEFDAIRIGLASPDMVRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTLTKVRRDRMGH
FT                   IDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVTEPGMTTLERGQLLGEE
FT                   EYLDALEEHGDEFEAKMGAEAVLDLLRELDLAQLIAEMREELPTINSETKRKKITKRLK
FT                   LMESFHQSGNNPEWMIMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLKLHQCGLPKKMALELFKPFIYGKLERRGMATTIKAAKK
FT                   MVEREMPEVWDVLDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIHLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTIEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDR
FT                   INAKGEGAIFKDPKEAEKAYRSGNADLHAIVKVRISQSVKNENGVVEDTITVIDTTVGR
FT                   AILSLILPKGMPYESINQPLGKKQISGLINECYRRLGLKDTVMFADQIMYTGFHYAMKS
FT                   GVSIGIDDLVIPPVKAQIIESAEAEVTEINQQFQSGLVTAGEKYNKVIDIWSRVNENLS
FT                   REMMSNLSKDTVINAQGEEVEQASFNSVFMMADSGARGSAAQIRQLAGMRGLMARPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVINED
FT                   DCGTEDGLTMKPLIEGGDVVEALRERVLGRVVAEDIVIPGTNTVLVERNIMLDEKLCDL
FT                   LEEHSVDEVRVRSVITCDNDFGVCANCYGRDLARGHIINAGESVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKTNGTLKLHNAKYVLNTDGKIAIISRSTEITIIDSYG
FT                   REKERYKVPYGAVLTVQDNAEVQGNDIVATWDPHSHPIVLEHKSKVSFSDIDDSNTETQ
FT                   TDELTGLTRIVVKDLSKANAKEPKLIIESEERGLQETRLPSFTTIEVVDGTTVNPGDVL
FT                   ARIPQEGSKTRDITGGLPRVADLFEARKPKEPAILAEVTGTISFGKETKGKKRLVITPD
FT                   EGDHYEEMIPKWRQLNVFEGERVSKGEVIADGPESPHDILRLRGVTHVANYIVNEVQEV
FT                   YRLQGVKINDKHIETIIRQMLRKCTIMHGGDTDFLAGEQIEVARVNIANRDLEAQGKIP
FT                   AKFEIQLMGITKASLATESFISAASFQETTRVLTDAAVNGKSDELRGLKENVIVGRLIP
FT                   AGTGFSYHQERMARRKQRNVVEEQTVSAEEATQALTDALNADLSGNQ"
FT   gene            236833..237207
FT                   /gene="rpsL"
FT                   /locus_tag="PSHAa0224"
FT   CDS_pept        236833..237207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="PSHAa0224"
FT                   /product="30S ribosomal protein S12"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 320034, 7556101, 8844851; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85327"
FT                   /db_xref="GOA:Q3ILP7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP7"
FT                   /protein_id="CAI85327.1"
FT                   /translation="MATINQLVRKPRRSKVTKSNSAALKACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDC
FT                   AGVSDRRQARSKYGTKRPKG"
FT   gene            237306..237776
FT                   /gene="rpsG"
FT                   /locus_tag="PSHAa0225"
FT   CDS_pept        237306..237776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="PSHAa0225"
FT                   /product="30S ribosomal subunit protein S7"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 385062, 7556101; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85328"
FT                   /db_xref="GOA:Q3ILP6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP6"
FT                   /protein_id="CAI85328.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNIVMLDGKKSTAEKIVYG
FT                   ALNVAAEKSGKSHLEIFETALDNIRPQVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWL
FT                   VDAARKRGEKSMGLRLAQEIVDAADNKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            237804..239918
FT                   /gene="fusA"
FT                   /locus_tag="PSHAa0226"
FT   CDS_pept        237804..239918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="PSHAa0226"
FT                   /product="protein chain elongation factor EF-G,
FT                   GTP-binding"
FT                   /function="3.3.4 : Elongation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3884371, 11294875, 12369843, 12960150; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85329"
FT                   /db_xref="GOA:Q3ILP5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP5"
FT                   /protein_id="CAI85329.1"
FT                   /translation="MARTTPLERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGETHD
FT                   GAATMDWMEQEQERGITITSAATTCFWKGMDAQFDAHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVLCASSGVQPQTETVWRQANKYEVPRMIFVNKMDRTGADFFAVVDQVKSRLG
FT                   ATPVPIQLPIGAEDGFKGVIDLIKMKAINWNEADQGMTFTYEAIPAELQELADEWRSHL
FT                   VESAAEATEELMDKYLEGEELSEAEIKEALRQRTLANDIVPMTCGSAFKNKGVQAVLDC
FT                   VVEYMPAPTQVKQIQGILEDGTEEERPADDKAPFAALAFKIATDPFVGTLTFFRVYSGT
FT                   VKQGDAVYNPVKSKRERLGRIVQMHSNSREEIKEVFAGDIAAAIGLKDVTTGETLCDPK
FT                   SIITLERMEFPEPVISVAVEPRTIADQDKMGIALGKLAAEDPSFRVQTDEESGQIIISG
FT                   MGELHLDILVERMKREFSVECNVGKPQVAYREAIRSTVKVEGKFIRQSGGRGQYGHVWL
FT                   KLEPMDITDDEAPIYEFVNETVGGSIPKEYVPAVDKGIQEQMSQGVLAGYPLLGVKATL
FT                   YDGSFHDVDSNEMAFKIAGSLAMKQGALQASPVLLEPVMKVEVLTPEANMGDVVGDLNR
FT                   RRGMIEGMEDALGGLKQINAQVPLSEMFGYATDLRSATQGRASYSMEFLKYAEASKHVA
FT                   ETIISARAVI"
FT   gene            239981..241165
FT                   /gene="tufA"
FT                   /locus_tag="PSHAa0227"
FT   CDS_pept        239981..241165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="PSHAa0227"
FT                   /product="protein chain elongation factor EF-Tu;
FT                   GTP-binding factor"
FT                   /function="3 : Information transfer pathways"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /function="3.3.4 : Elongation"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85330"
FT                   /db_xref="GOA:Q3ILP4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP4"
FT                   /protein_id="CAI85330.1"
FT                   /translation="MAKAKFERVKPHVNVGTIGHVDHGKTTLTAAITNVLAKVYGGVAK
FT                   DFASIDNAPEERERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPLIQGSALKALEGEKEWEDKIVELANALDSYIPEPQRDIDKPFIMPIEDVFSIQ
FT                   GRGTVVTGRVEAGIIRINDEIEIVGIRDTTKSICTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREDVERGQVLAKPGSIKPHTTFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   DVQLPEGVEMVMPGDNVKMTVTLIAPIAMDEGLRFAIREGGRTVGAGVVANIVA"
FT   gene            complement(241543..243084)
FT                   /gene="pck"
FT                   /locus_tag="PSHAa0228"
FT   CDS_pept        complement(241543..243084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pck"
FT                   /locus_tag="PSHAa0228"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85331"
FT                   /db_xref="GOA:Q3ILP3"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP3"
FT                   /protein_id="CAI85331.1"
FT                   /translation="MTSSATRFVDLTAAELVEHAIRRGEGTLAANGAFVANTGHRTGRS
FT                   PKDRFIVQESSTENEIQWGNVNRPFDADKFDALWARVEAYVQSNDHFISHLEVGADPEH
FT                   YLPVVVTTETAWHHIFAKNMFIQPKSYNSSDVPQWQVMNVPSFVCEPERDGTNSDGTVL
FT                   INFAQRKVLLAGMRYAGEMKKSMFSVQNFLLPAKGVLPMHCSANVGEAGDTALFFGLSG
FT                   TGKTTLSADPTRFLIGDDEHGWAPGSVFNIEGGCYAKCIDLSQKNEPVIWDAIRFGTIL
FT                   ENVVLDENRVPDFNDTSLTQNSRAAYPLEHVEKRKVENRAGEPKAVVFLTCDVSGVLPP
FT                   VSILTEEAAAFHFLSGYTAKVGSTEIGSTSDIESTFSTCFGAPFFPRPAGVYAELLMKR
FT                   VREFGAKVYLVNTGWTGGPYGTGKRFDIPTTRAVVDAIVSGKLVGVETQHIDVLNLDVP
FT                   VAVPGVDSNLLNPINTWEDKAKYAEYAAKLAADFTENFTKYDVSDEIKNAGPKAQ"
FT   gene            complement(243346..244191)
FT                   /gene="hslO"
FT                   /locus_tag="PSHAa0229"
FT   CDS_pept        complement(243346..244191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="PSHAa0229"
FT                   /product="heat shock protein 33, redox regulated chaperone"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="3.3.7 : Protein folding"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10025400; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85332"
FT                   /db_xref="GOA:Q3ILP2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP2"
FT                   /protein_id="CAI85332.1"
FT                   /translation="MQQDLLHRYLFDNLDVRGELVQIENAYNEMIANHNYPDAVKALLG
FT                   ELLVATCLLTATLKFEGEIAVQLQGDGPVKYAVINGDDKQNMRGIARLQSEVTGSTVKE
FT                   LIGQGYMVITITPTKGERYQGIVPLEHETLSECIEAYFEQSEQLKTRLWFATDTTEGNA
FT                   KACGLFLQVLPVDKQKSIEDFAHLEALSHTIKDEELLELDANTVLTRLYHEDNPRVFEP
FT                   QSIQFKCGCTREKTMTALVNIGQQALLDDVAEHGEIKISCHYCLKDYLFDEQDVKNIFN
FT                   "
FT   gene            complement(244204..244626)
FT                   /gene="hslR"
FT                   /locus_tag="PSHAa0230"
FT   CDS_pept        complement(244204..244626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="PSHAa0230"
FT                   /product="heat shock protein 15, DNA/RNA-binding"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10675343, 9867837; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85333"
FT                   /db_xref="GOA:Q3ILP1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILP1"
FT                   /protein_id="CAI85333.1"
FT                   /translation="MAKKSNANPNLEHKDELKIRLDKWLWAARFYKTRAAAREMVQGGK
FT                   VHYNGQRTKAGKIVEIGATIKLAQGVDEKIVTVLKILEKRQSAPIAQTLYQESDASIAK
FT                   REENSIARKNNSLFAPHPDKKPDKKQRRELLKLKLS"
FT   gene            244836..245777
FT                   /gene="gspC"
FT                   /locus_tag="PSHAa0231"
FT   CDS_pept        244836..245777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="PSHAa0231"
FT                   /product="putative general secretion pathway protein C"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85334"
FT                   /db_xref="GOA:Q3ILN1"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN1"
FT                   /protein_id="CAI85334.1"
FT                   /translation="MEQQVQQFKHFISRLPHAKLSAVVTLLVVVYIAFLSSKLVWLMWP
FT                   NPIVSPLTPIYYGQHSTAASNNYSQHIIEQFIFGKIIVKSKSDDHAAKVVNDAPETRLS
FT                   INLTGIVAVNNDDKAGLAIIESQGKQETYLVDEAVQGTRAKLAQILPDRVILTVNGRFE
FT                   TLMLDGLDFTKTVSMPVLAARDEAEMGPQLGPAPSEQQIDVTADPNIKQALIETREELL
FT                   EEPGKLFDYIRVSQAMSDGELIGYRLSPGKEPELFKQMGLQNNDLAVAINGYQLTDLKQ
FT                   AMAAINELRNSTDATITIERDNQQIDVQFSLQ"
FT   gene            245801..247867
FT                   /gene="exeD"
FT                   /locus_tag="PSHAa0232"
FT   CDS_pept        245801..247867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeD"
FT                   /locus_tag="PSHAa0232"
FT                   /product="General secretion pathway protein D"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7789814; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85335"
FT                   /db_xref="GOA:Q3ILP0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILP0"
FT                   /protein_id="CAI85335.1"
FT                   /translation="MVQALHLTKIKKGLAKYAALFLAASISFSVAAVEYAANFKGTDIN
FT                   EFINIVGKNLNKTIIIDPNVRGKVNVRSYELMGEALYYQFFLNVLEVYGYSAIEMDNNI
FT                   IKIEKSSDAKKSNVPLITDGSEASGDMMITRVVRVKNVSVQELGPLVRQFSDQKDGGHV
FT                   ANFNAANVMMLTGHAASVNRLVEIIRSVDQAGDKRVDIVKLKFATADDVVSVVDNIYKD
FT                   SGKGSIPEFLIPKVVADGRTNSVIVSGEGQARTRAIELIKRLDGELESQGNTKVFYLNY
FT                   AKAEDLVKVLQGVSKSLTDDTQGGSATKTRTRSNNETSIEAHPDSNSLIITAQPDTMRS
FT                   LESVIERLDIRRAQVLVEAIIIEVMEGDGINFGLQWISEQGGMLQFNNGTTVPVGALAV
FT                   AAEQARDTTVSKNIIGTESGTITQVDETTKGDYGPLASLLGGINGLAMGVIKNDWGAIV
FT                   QAVSTDSNSNILATPSITTMDNEEASILVGQEVPIITGSQTGSNNTNPFQTVERQEVGI
FT                   KLKVTPQINDGSAVQLTIEQEVSSVSGATAVDISVNKRSIKTTVMADDGGMVVLGGLID
FT                   EDVQESVSKVPLLGDIPILGHLFKSTNTTRRKRNLIVFIRPTIIRDGISMNKLSFNKYN
FT                   FIRGEQFKQREDGIELMPRTDTPILPEWNDELILPPTYEEHLRKQNAQERKDD"
FT   gene            247860..249425
FT                   /gene="exeE"
FT                   /locus_tag="PSHAa0233"
FT   CDS_pept        247860..249425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeE"
FT                   /locus_tag="PSHAa0233"
FT                   /product="General secretion pathway protein E (Type II
FT                   traffic warden ATPase)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1640836; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85336"
FT                   /db_xref="GOA:Q3ILN9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN9"
FT                   /protein_id="CAI85336.1"
FT                   /translation="MTKAIAEINQDVVHPNAHHPDELLTSDDLVELPAKRLPFSYARRA
FT                   GVLLSKNKEQRIVYYRGELDIDVLLEVRRIAGHGFTLEQLADDKFELLLEASYQRDSSE
FT                   TQQMMEDIGNEVDLFSLVDELPQTEDLLAGDDDAPIIKLINAMLSEAIKEGASDIHIET
FT                   FEQELVIRFRVDGVLKEVLKPNRKLASLLVSRIKVMAKLDIAEKRIPQDGRISLRIAGR
FT                   AVDVRVSTMPSSFGERVVLRLLDKNNAHLNLEDLGMTAQNRELFANLISKPHGIILVTG
FT                   PTGSGKSTTLYAGMSQINSRDRNILTVEDPIEYEIPGIGQTQVNTKVGMTFARGLRAIL
FT                   RQDPDVVMVGEIRDLETAQIGVQASLTGHLVMSTLHTNTASGAITRMEDMGVEPFLLSS
FT                   SLLGVLSQRLVRTLCKNCKKEHVADERECQLLGVPFESKPTIHRAVGCEACNFNGYKGR
FT                   TGIHELLVVDETIREMIHNGKGEQSVEKYIRKLSPSIRQDGCSRVLAGKTTLEEVLRVT
FT                   REEG"
FT   gene            249428..250663
FT                   /gene="gspF"
FT                   /locus_tag="PSHAa0234"
FT   CDS_pept        249428..250663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="PSHAa0234"
FT                   /product="putative general secretion pathway protein F"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85337"
FT                   /db_xref="GOA:Q3ILN8"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN8"
FT                   /protein_id="CAI85337.1"
FT                   /translation="MAAFEYRALDGRGKEKKGILEADTAKQIRQILRDQKLTPLEVVPA
FT                   AQSDKQVKGQKTSLLGGLFKPTISTSDLALITRQLATLIQSALPVEGAVMAVAEQCEKP
FT                   RLKRMLMSVRSKVVEGYTLADGMSEFPHVFDDLYRAMVAAGEKSGHLDQVLNRLADYTE
FT                   QRQYMRSQITQAMVYPIILVVFAIAIVSVLLGTVVPKILKTFEKTKQVLPWTTEWVMAG
FT                   SHFVQNYWFISLIVITALAIGIKHALKQPKIRFWWDDKILHMPGIGKVARGINTARFAR
FT                   TLSILSSSSVPLLEGMRIAGGVLINEKIKKAVADAADRVSEGASLRAALQQTKLFPPMM
FT                   LHMIASGEKSGELEQMLERAANNQDREFESMVNVSLKLLEPAMIALMAVIVLFIVMAIL
FT                   QPIMAMNKAVGL"
FT   gene            250765..251151
FT                   /gene="gspG"
FT                   /locus_tag="PSHAa0235"
FT   CDS_pept        250765..251151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="PSHAa0235"
FT                   /product="putative general secretion pathway protein G
FT                   [Precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7896718; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85338"
FT                   /db_xref="GOA:Q3ILN7"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN7"
FT                   /protein_id="CAI85338.1"
FT                   /translation="MVVLVIIGMIMSIVAPNIMGQQEEAAIDKAHLDIQQLEDAMSLYK
FT                   LKNKSYPSTEQGLEALVNKTSIEPIPKRFPDGGFISKLPEDPWGNTYQLISPGEIGKFD
FT                   IFSLGPDGQAGTDDDIGNWDEEKQ"
FT   gene            251201..251785
FT                   /gene="gspH"
FT                   /locus_tag="PSHAa0236"
FT   CDS_pept        251201..251785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="PSHAa0236"
FT                   /product="putative general secretion pathway protein H
FT                   precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7896718; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85339"
FT                   /db_xref="GOA:Q3ILN6"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN6"
FT                   /protein_id="CAI85339.1"
FT                   /translation="MQVSSERLRAKSRGFSLIEILVVLVIIAFATKMVVYSLEGGAEDE
FT                   LDTQALRLHTTINMASEFAILNQVELGFHIDNNVFEFLVFDGEKWVSFVREALFEPVEF
FT                   DPRFKLALNLDDLAWAQDNLLEQANWRELMSGDEDSLLELKKFKIPQVLILSSGEVSAF
FT                   QLTLELKEQSEPVYFIEGEFTAPVNLRREPE"
FT   gene            251785..252162
FT                   /gene="gspI"
FT                   /locus_tag="PSHAa0237"
FT   CDS_pept        251785..252162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="PSHAa0237"
FT                   /product="putative general secretion pathway protein I
FT                   [precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85340"
FT                   /db_xref="GOA:Q3ILN5"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN5"
FT                   /protein_id="CAI85340.1"
FT                   /translation="MRQYNKGFTLLEVLVALSICAMAGIAAMQATSEHIHHLSSIEEQT
FT                   YASWVAENIMVEQRTKGEQWEGKDGVRGSEVMAGVEWFWRQDIGKTADKDFVKLTINIF
FT                   SDEKYEHSVYELATYLNKGKK"
FT   gene            252163..252837
FT                   /gene="gspJ"
FT                   /locus_tag="PSHAa0238"
FT   CDS_pept        252163..252837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="PSHAa0238"
FT                   /product="putative general secretion pathway protein J
FT                   [Precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85341"
FT                   /db_xref="GOA:Q3ILN4"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN4"
FT                   /protein_id="CAI85341.1"
FT                   /translation="MKQRGFTLLEVMVALGILGFVIMATHQILDTTTRAKEASDDKIAE
FT                   LNGLQTTFRLMDQDFSQMTKRAVRNEAGDVQEQYLLAGRYVLDSQYDGIGFVRDGWINP
FT                   INLLPRSELQAVGYRVINDNLERVYRVYVDQLDNMEPRVQVVLKNIEELKFEFLDDKNE
FT                   WQAKWQIKALPKAVAVTLQQIEAEPIRRVFLVPGQGKEILPSSPSTDDALADEGNPQEG
FT                   GQ"
FT   gene            252837..253823
FT                   /gene="gspK"
FT                   /locus_tag="PSHAa0239"
FT   CDS_pept        252837..253823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="PSHAa0239"
FT                   /product="putative general secretion pathway protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85342"
FT                   /db_xref="GOA:Q3ILN3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN3"
FT                   /protein_id="CAI85342.1"
FT                   /translation="MGLRSSRGAALVIVLFIVALAAILAVEMSANLMVQVQKSTNLQGH
FT                   QQAKWYAYGAEELAIKALIKSKRDDPDKTTLDQIWAQQGDIPYPVDNGTLSGKITDLQA
FT                   CLNLNAIAVEPDLNSASKTNPAHKALFALLENIEDLPAQESEETMADSVFDWLDENSIT
FT                   YRSGAEEGEYLSRQFPYMTANSLFASTSELRLVKGFNPLVMEKVLPYVCVIPGSTLLSI
FT                   NVNTLAAEQALILSTLIDELSVSGAEAVIAARPDAGFESKAAFFEQVQQQGGQNVKAVE
FT                   KLFSINSEYFKLQTQANFVDLRFSMTTLLHAKDGDVTILARKFGGVQ"
FT   gene            253820..255028
FT                   /locus_tag="PSHAa0240"
FT   CDS_pept        253820..255028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0240"
FT                   /product="putative general secretion pathway protein L"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85343"
FT                   /db_xref="GOA:Q3ILN2"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN2"
FT                   /protein_id="CAI85343.1"
FT                   /translation="MTEILLIRTGQTEQELLNWLIYSPQEQQIIASGELVNASYLNELS
FT                   EKSLGREVVVLLPCDQVQLKTVMLPTKWNRKLEQALPYMLEEDIACDIDELFIAVGEPV
FT                   MIGEQHAVRVAMTDREWFEAWLALFAEHNLSVYKILPDALLLPPADEDTVTAIALNNQW
FT                   LFKQGPWRISAVETSWLNGYLTAMGNPDVKHFSPATQFPETVNLQAQTSDYDLPLALFA
FT                   KQLEHTKFNLRQGMYQLKKKSTLWWGYWKSAAIITSVALVASITIKAIELHQLNTQLEL
FT                   AKAQVIERYQKAFPGTKVRPHLIKNQIKGALAKIQDTSDAGFLELTTELVGVFSQVSNF
FT                   TPETLRYDKKRNELRMRARAKDFQTFGKVKAILEQQGLTVDQGSLSNDGDFVVGEIKLR
FT                   GAV"
FT   gene            255025..255498
FT                   /locus_tag="PSHAa0241"
FT   CDS_pept        255025..255498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0241"
FT                   /product="putative general secretion pathway protein M"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85344"
FT                   /db_xref="GOA:Q3ILM0"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM0"
FT                   /protein_id="CAI85344.1"
FT                   /translation="MKQQLIKHWRSLKEQEQQLIIVASGIFIVFILVMGIFRPLNNAIA
FT                   SAEQSQLKQQELLVWVDESIVKLKAAGNTQVVNSQNISQIVNATRGRYKINISKMQPSN
FT                   NSLRLTLDSVEFNQLILWLDELVNQHGLRVENLDLSRDDKSGYVRVSRLLLEK"
FT   gene            255502..256260
FT                   /locus_tag="PSHAa0242"
FT   CDS_pept        255502..256260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0242"
FT                   /product="putative general secretion pathway protein N"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85345"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN0"
FT                   /protein_id="CAI85345.1"
FT                   /translation="MKKIITLSIVFLLSFIVFCIIKLPVAVAIDLAKPYFPKQLEVGQS
FT                   VGTIWQGQMMQVRYQGEQLNNVRWDVAGWALFTGKLNANVKFGDPRERSDISGYADVSF
FT                   GLFNKQVKVTNGLVRSTVERAMQRIQLPLPVTAKGRVILELAEYTSGAPYCESLQGEIA
FT                   SPNIDVQGLNGWFNIGPLGGNLSCKSGDIAILIDPDNTLGLEADATLKANFDFKVSGYV
FT                   KPDATLPKDVHDAVKFLGRPDNQGRYPLNF"
FT   gene            256282..256869
FT                   /locus_tag="PSHAa0243"
FT   CDS_pept        256282..256869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0243"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85346"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM9"
FT                   /protein_id="CAI85346.1"
FT                   /translation="MQLPQFTEQHAKQLSTFLDTQSQAMTLTQSQGYLFGVICSPEPLD
FT                   VHEWMAAILPNTANNVDEEMLFLFMALYHQISEQVFEVGYKLPAQYNYEFCSNWSAGFV
FT                   TATTSYTQKLLSSTALEAEYKQALESAQATLSFFALDGQTISQIALQNSIDEQLLCQQQ
FT                   YELMGDFALGFAELVEIVALNSGLYTDEGWEE"
FT   gene            complement(256918..257124)
FT                   /locus_tag="PSHAa0244"
FT   CDS_pept        complement(256918..257124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0244"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM8"
FT                   /protein_id="CAI85347.1"
FT                   /translation="MDFSGLNKKASDSFHQQRNMLKKLTQGKTLKCEKCNGVLTLDLAT
FT                   SEPGKGLIKCKQGCTDIILELGA"
FT   gene            complement(257124..257483)
FT                   /locus_tag="PSHAa0245"
FT   CDS_pept        complement(257124..257483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0245"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85348"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM7"
FT                   /protein_id="CAI85348.1"
FT                   /translation="MKKFIILVIVVLAFFTVDHPLVKEPRERLFNDGIDFLSDASKVNR
FT                   SPTASMTKNKISAQLTLSESEREYTEKTFTTDDSIRLFHLRYCRERDLNLYFYDERLNT
FT                   VCKIVSGSLEHMRGK"
FT   gene            257764..259194
FT                   /locus_tag="PSHAa0246"
FT   CDS_pept        257764..259194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0246"
FT                   /product="conserved protein of unknown function ; putative
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85349"
FT                   /db_xref="GOA:Q3ILM6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM6"
FT                   /protein_id="CAI85349.1"
FT                   /translation="MDKQIKVKNIPVEVKIQKPDLSGQQDRFNPRNRIYVRAVNGLHQL
FT                   LRQRIGFLGLLAFMLLPWINFNGEQAVLFDLIGQKYNIFGLTLWPQDFTILAFIFMLAA
FT                   FALFLVTTFYGRVWCGYTCPQTVWTFTFIWFEEKFEGTANQRKKLDQRAMDFDKFWRKT
FT                   AKHTSWILFSLYTAITFVGYFTPIRELLPDFVTFNAGSYALMSIIFFAACTYGNAGWMR
FT                   EIMCLHICPYSRFQSAMFDKDTYTVSYDEKRGESRGPRSRKVAHQDLEIGDCIDCNLCV
FT                   QVCPTGIDIRNGLQAECINCGACIDACDGVMDKMNYPRGLISYTTERNLETPENKTNPL
FT                   RAKIIGYIVILVILTSALVANIALRKTMEFDIIRDRNQLYRVDFEGLVENTYTLKVINK
FT                   AQYEQTFTIKVQGLDNFKYIGKQTFRVNAGQSHNVPLSLVMDPYDLKAPMTEFNFVLSP
FT                   VGEPDNQISQSSNFFKAR"
FT   gene            259246..260220
FT                   /gene="rdoA"
FT                   /locus_tag="PSHAa0247"
FT   CDS_pept        259246..260220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdoA"
FT                   /locus_tag="PSHAa0247"
FT                   /product="conserved hypothetical protein, putative
FT                   homoserine kinase type II"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12511488; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85350"
FT                   /db_xref="GOA:Q3ILM5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM5"
FT                   /protein_id="CAI85350.1"
FT                   /translation="MSKFSFIDLTPDLILDAIESVGIYVESGLLALNSYENRVYQFVAE
FT                   GGKRYVVKFYRPERWSEKQIQEEHDFAFELAEAEVPVVAPMEYNGQSLFEHQGYLFTLF
FT                   PSVGGRLFEVDNLDQLDVLGRLIGRMHQVAKTKPFTQRPTLTCEEYLHTAKVHLQKSNL
FT                   VPMGLETAFYTILDLVIKQAQAQYTNVKTIRLHGDCHAGNILWAGDALMFVDLDDSRQG
FT                   PPIQDLWMMLSGDRQTQLLQLDTLVTAYEEFCDFDHSQLKLIEPLRAMRIIHYMGWVAK
FT                   RWSDPAFVRNFSWFADDKYWEQQILALKEQLAALQEAPLKLLP"
FT   gene            260255..260878
FT                   /gene="dsbA"
FT                   /locus_tag="PSHAa0248"
FT   CDS_pept        260255..260878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="PSHAa0248"
FT                   /product="periplasmic protein, disulfide bond formation,"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85351"
FT                   /db_xref="GOA:Q3ILM4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM4"
FT                   /protein_id="CAI85351.1"
FT                   /translation="MLKKLKLSLLLLCLPFAALAANFEVGNQYTVIDIEKSTTPQVTEY
FT                   FSFYCPHCFKFEPVAHAIEENLPAGAVFIKNHVNFLGGVSPQTQSNLSLAYLVAKKHGQ
FT                   ADTITDKIFKSIHVQRAPLTEIKDLKKLLDINGISSDTFDQDIASMPIIAAEQAMQDKQ
FT                   NKYSKLGALTGVPTFIVNDKYKINLNTIKSQEELDELVSFLLAL"
FT   gene            260899..261537
FT                   /gene="porA"
FT                   /locus_tag="PSHAa0249"
FT   CDS_pept        260899..261537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porA"
FT                   /locus_tag="PSHAa0249"
FT                   /product="periplasmic protein, disulfide bond formation"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85352"
FT                   /db_xref="GOA:Q3ILM3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM3"
FT                   /protein_id="CAI85352.1"
FT                   /translation="MIKLVKAGLLAVLLPFAATSFAATFEEGVHYEVVSERATKKPEVK
FT                   EFFSFYCPACNNMEPLVAEIKPMLDKGVKFKKSHVDFVGVRDTEHQQMISQALATAEVL
FT                   PQKDKIIAAIFSHIHTKRANFNELADVKDVFVAQGVDGDKFDKLFKSFSVRTLSSKMKR
FT                   DQDYFKEKGALRGVPTFIVNGKYKLLLGRESGISEPADITKLINYLASK"
FT   gene            complement(261601..262704)
FT                   /gene="trmA"
FT                   /locus_tag="PSHAa0250"
FT   CDS_pept        complement(261601..262704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="PSHAa0250"
FT                   /product="tRNA (Uracil-5-)-methyltransferase
FT                   (tRNA(M-5-U54)-methyltransferase) (RUMT)"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.1.1.35"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1999392, 1447162; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85353"
FT                   /db_xref="GOA:Q3ILM2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILM2"
FT                   /protein_id="CAI85353.1"
FT                   /translation="MAVIKIDTSQYDAQLSEKEQRIAAQFQRFGVDKLEVFSSEPINYR
FT                   QRAEFRVWHDGDDLFHIMFDQQTKDKIRVDSFDPAAPLVGEVMQVMIDNLKSCEILRRK
FT                   LFQIDYLSTLSGEILVSLLYHKPLDEHWLSEINTLKEKLSSKYKIDFIGRARKQKEMLG
FT                   DDYVTERLNVNGQELIYQQVENSFTQPNAKVNIKMLEWAQDLCKPLKNDLLELYCGNGN
FT                   FSIALAGSFNKVLATEISKSSVHSAQYNIAQNKVDNLDIIRMSSEEFTQAMNGERSFSR
FT                   LEGIDLNSYNCQTILVDPPRAGMDTLTCDLVANYESIIYISCNPETLERDLDHLTRTHE
FT                   VKRFAIFDQFPYTHHIESGVFLQKKNT"
FT   gene            262872..263999
FT                   /locus_tag="PSHAa0251"
FT   CDS_pept        262872..263999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0251"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85354"
FT                   /db_xref="InterPro:IPR041651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM1"
FT                   /protein_id="CAI85354.1"
FT                   /translation="MKIGNFGFVPNHNINKYGNKGALQQPTIQSPQDNYQQRGKELAAK
FT                   VLGDKMAQALGLPISEPKKDKPLFDFDEIVKNVLDFVTSAVRKAKANGADDEKLKGMLG
FT                   DARKGVQIGIDDAVDELKGNGVFNDDIAQGINKSKEGIFNGLDKFEDDLFNPKPASVSV
FT                   SQAQYASLSNKAEYKFTTAEGDEVSISFADAYESQSASRYQQNGNSESFVSESSQSREL
FT                   SFSMSVNGDLNENEQKAINELMADLQSVSSTFFSGDLDKAFEEAQALSLGNEQLVAFSM
FT                   DLRQTKTVATVKGYEEYKPVPEKAVADKLAPFNDDLKAVFNKATELGIQNQLSGIVQWL
FT                   NQDQAEIDKLVDYTKAMFENLNQLNAATDELANQQ"
FT   gene            264077..264874
FT                   /gene="murI"
FT                   /locus_tag="PSHAa0252"
FT   CDS_pept        264077..264874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="PSHAa0252"
FT                   /product="glutamate racemase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="5.1.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8098327; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85355"
FT                   /db_xref="GOA:Q3IDS7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS7"
FT                   /protein_id="CAI85355.1"
FT                   /translation="MSAHIMVFDSGIGGTTVLEHIQQSIPDAQYSYFMDNALLPYGAQS
FT                   QQTIINRLCALIHFINQQALNVDLIVIACNTASTSALGAVRQITTIPIVGVVPAIKPAA
FT                   QLTQSKHIGLLATPATISSPYTRTLIQEHTNNIAVSLYSSVELVTLAERLFFEQSLDTT
FT                   KLHQELDRLNIDQSIDVLVLGCTHFPILAEPISQYFNRKVQLLDSGAAIAKRVHYLISQ
FT                   LNLTNNNIADTKKPLQYYATASVSSKLAVKLVTLIDPAQNEER"
FT   gene            complement(264837..265316)
FT                   /locus_tag="PSHAa0253"
FT   CDS_pept        complement(264837..265316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0253"
FT                   /product="conserved protein of unknown function ; putative
FT                   RNA-binding domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85356"
FT                   /db_xref="GOA:Q3IDS6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS6"
FT                   /protein_id="CAI85356.1"
FT                   /translation="MKLPDQKSFILSVILAVVGFVIVKFALESLELDPALLFAVGLLIG
FT                   GIVIAAMSSDGVVEAEVKTKTLYVGNLPYRANEGVVRALFEEQGKVFNVRLLKDKNTGK
FT                   RRGFGFVEMAQADADNAIAQLNDSEFQQRTLKVREAKQKQEDDSNALRSEPDQSV"
FT   gene            265958..267485
FT                   /locus_tag="PSHAa_rRNA16s8"
FT   rRNA            265958..267485
FT                   /locus_tag="PSHAa_rRNA16s8"
FT                   /product="16s"
FT   gene            267563..267639
FT                   /locus_tag="PSHAatRNA7"
FT   tRNA            267563..267639
FT                   /locus_tag="PSHAatRNA7"
FT                   /product="tRNA-Ile"
FT   gene            267751..267826
FT                   /locus_tag="PSHAatRNA8"
FT   tRNA            267751..267826
FT                   /locus_tag="PSHAatRNA8"
FT                   /product="tRNA-Ala"
FT   gene            268133..271021
FT                   /locus_tag="PSHAa_rRNA23s8"
FT   rRNA            268133..271021
FT                   /locus_tag="PSHAa_rRNA23s8"
FT                   /product="23s"
FT   gene            271165..271281
FT                   /locus_tag="PSHAa_rRNA5s9"
FT   rRNA            271165..271281
FT                   /locus_tag="PSHAa_rRNA5s9"
FT                   /product="5s"
FT   gene            complement(272118..272603)
FT                   /gene="rnk"
FT                   /locus_tag="PSHAa0258"
FT   CDS_pept        complement(272118..272603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="PSHAa0258"
FT                   /product="putative regulator of nucleoside diphosphate
FT                   kinase"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7565093; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85357"
FT                   /db_xref="GOA:Q3IDT1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT1"
FT                   /protein_id="CAI85357.1"
FT                   /translation="MQLSLCRIILRVSFIYINIIKDIELNKRPEIIISSLDADRLYDLI
FT                   ESLPANSFAGEKELEAELGRATIVDPKDVPATIVTMNSTVNFVVESSKEEFNLTLVYPK
FT                   DLDASGQKISILAPIGGALLGLSQGDEIEWPKPGGGLIKVKIKEVTYQPERVGELHR"
FT   gene            complement(272763..274406)
FT                   /gene="groL"
FT                   /locus_tag="PSHAa0259"
FT   CDS_pept        complement(272763..274406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="PSHAa0259"
FT                   /product="60 kDa chaperonin (Protein Cpn60) (groEL
FT                   protein)"
FT                   /function="1.7 : Cell division"
FT                   /function="3.3.7 : Protein folding"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; PubMedId : 15225312, 15294778;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85358"
FT                   /db_xref="GOA:Q9XAU7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XAU7"
FT                   /protein_id="CAI85358.1"
FT                   /translation="MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFG
FT                   SPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDKEIGDIIA
FT                   QAMEKVGRNSGVITVEEGQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFIL
FT                   LVDKKISNIRELLPTLEAVAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPG
FT                   FGDRRKAMLQDIAVLTGGTVISEEIGLELEKATVEDLGTAKRVIITKDDTTIIDGAGEE
FT                   AGINGRVSQIKAQIEEATSDYDKEKLQERMAKLAGGVAVIKVGAATEMEMKEKKDRVED
FT                   ALNATRAAVEEGVVPGGGVALVRAASKLVDLVGDNEDQNHGIKVALRAMEAPLRQIVTN
FT                   AGDEASVVINAVKAGSGNFGYNAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMIT
FT                   TEAMVAEIPKDDSAPDMGGMGGMGGMGGMM"
FT   gene            complement(274455..274742)
FT                   /gene="groS"
FT                   /locus_tag="PSHAa0260"
FT   CDS_pept        complement(274455..274742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="PSHAa0260"
FT                   /product="10 kDa chaperonin (Protein Cpn10) (groES
FT                   protein)"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85359"
FT                   /db_xref="GOA:Q9AKT2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKT2"
FT                   /protein_id="CAI85359.1"
FT                   /translation="MNIRPLHDRVIVKRLEEETKSAGGIVLTGSAAEKSTRGEVVAVGN
FT                   GRILESGDVRALEVKAGDTVLFGSYVEKVEKIEGQEYLIMREDNILGIVG"
FT   gene            complement(274850..275326)
FT                   /locus_tag="PSHAa0261"
FT   CDS_pept        complement(274850..275326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0261"
FT                   /product="putative FxsA protein (Suppressor of F exclusion
FT                   of phage T7)"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10497016, 10497017; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85360"
FT                   /db_xref="GOA:Q3IDT5"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT5"
FT                   /protein_id="CAI85360.1"
FT                   /translation="MFRFLFVLFIIIPIIEIALLIQVSEVIGGFSTIALVIITAILGAK
FT                   MVKQQGMSALQKAQTQMAEGQMPAKELFTGICVIIAGVLLLTPGIMTDVFGLLLLTPVI
FT                   RNKLAAGLASQATVRMSAGMQQGGSPFTQHSQTEADPHQVNKPTIIDGEFERKD"
FT   gene            275506..275826
FT                   /gene="cutA"
FT                   /locus_tag="PSHAa0262"
FT   CDS_pept        275506..275826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="PSHAa0262"
FT                   /product="periplasmic divalent cation tolerance protein
FT                   (C-type cytochrome biogenesis protein)"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7623666"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85361"
FT                   /db_xref="GOA:Q3IDT4"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT4"
FT                   /protein_id="CAI85361.1"
FT                   /translation="MAAQFKLIFTTCKDENEARELAKALVERKLAACVNILPKVASIYI
FT                   WEGEVVEATEAKLLIKTKLDKMNDVFLTIKALHSYEVPEIQVVDVATGNLAYFNWMDEV
FT                   LN"
FT   gene            275826..277637
FT                   /gene="dipZ"
FT                   /locus_tag="PSHAa0263"
FT   CDS_pept        275826..277637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dipZ"
FT                   /locus_tag="PSHAa0263"
FT                   /product="thiol:disulfide interchange protein[Precursor]
FT                   (Protein-disulfide reductase) (Disulfide reductase) (C-type
FT                   cytochrome biogenesis protein cycZ) (Inner membrane copper
FT                   tolerance protein)"
FT                   /function="1.4.2 : Electron transport"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7623667, 7628442; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85362"
FT                   /db_xref="GOA:Q3IDT3"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT3"
FT                   /protein_id="CAI85362.1"
FT                   /translation="MRFFFLLLVALLAAPAKANNILGDLLAPPQQTFLQVDQAFVFDFD
FT                   QQDNTLFIGWDIAPEYYLYKNKIEIIAKGANIEVGDLGNGEVIEDEFFGKTEVFFNALS
FT                   IVSKLSNVTEGAVVKVRYQGCAEAGLCYPPEVISIPLNKIAGEQLQNADDATHSATSAN
FT                   AFTALSQANAPTSNAPKKDLTFTEQLASQGLITNLLIFFVVGVGLAFTPCVFPMFPILS
FT                   SLIAGQKNLSTKKAFALSFVYIQGMAVTYAALGLVVAALGGQVQGYLQHPYVLISFSLL
FT                   FVLLAMSMFGWYEIKLPSGMMNKLTQVSNNQKGGNYVGVFLMGVLSGLIASPCTTAPLS
FT                   AALLFVAQSGDYLVGGLTLYVLSLGMGLPLLLLGTSGGKLLPKAGGWMEQVKTLFGFIM
FT                   LVVPLILLERLLDADVILLMAGVLALATALYLHHWQSSQTQGKLKTALWFAATLLVVSG
FT                   FNLTKNYFWPVHMQTMQVSAQSNEFKQVANLTELKAAVAHANEQGRLVMVDLYADWCIA
FT                   CKEFEHYTFPDAKVQNEFSHFELIQVDLTDSDNKTIELMEEYTVFGLPSILFFNTQGEE
FT                   LSAQRVTGFLNAEDFAQHLSTVRASVK"
FT   gene            277864..278316
FT                   /gene="aroQ"
FT                   /locus_tag="PSHAa0264"
FT   CDS_pept        277864..278316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="PSHAa0264"
FT                   /product="3-dehydroquinate dehydratase (EC 4.2.1.10)
FT                   (3-dehydroquinase) (Type II DHQase)"
FT                   /function="2.2.1.1 : Aromatic amino acid family"
FT                   /EC_number="4.2.1.10"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85363"
FT                   /db_xref="GOA:Q3IDT2"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT2"
FT                   /protein_id="CAI85363.1"
FT                   /translation="MAAKFKLLVINGPNLNMLGKREPDKYGSRTLSEIMSELTCAADSL
FT                   NVELTHFQSNSEQALIERIHDTWQAIDYIIINPAAFTHTSVALRDALLSVDIPFFEVHL
FT                   SNVHAREAFRHHSYFSDVAQGVICGLGAMGYHAALEAAVNQLQNSN"
FT   gene            278350..278814
FT                   /gene="accB"
FT                   /locus_tag="PSHAa0265"
FT   CDS_pept        278350..278814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="PSHAa0265"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase (BCCP)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12794081, 1370469; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85364"
FT                   /db_xref="GOA:Q3IDT0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT0"
FT                   /protein_id="CAI85364.1"
FT                   /translation="MDIRKIKKLIELVEESGIAELEITEGEESVRINRNNMSAGPGYAQ
FT                   FAPQQYAPAPVAAPVAAAPAAAVEAAAPAASTGHQVKSPMVGSFYAAASPEAPAYVEVG
FT                   SQVKVGDTLCIIEAMKMMNQIESDKAGTVKAILAENGEPIEFDQPLFIIE"
FT   gene            278841..280181
FT                   /gene="accC"
FT                   /locus_tag="PSHAa0266"
FT   CDS_pept        278841..280181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="PSHAa0266"
FT                   /product="biotin carboxylase (A subunit of acetyl-CoA
FT                   carboxylase)(ACC)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="6.3.4.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1682920, 1370469; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85365"
FT                   /db_xref="GOA:Q3IDS9"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS9"
FT                   /protein_id="CAI85365.1"
FT                   /translation="MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLA
FT                   DETICIGKPAATESYLDIPRIIAAAEITDAVAIHPGYGFLAENADFADQVEQSGFVFIG
FT                   PTGDTIRLMGDKVSAIAAMRKAGVPCVPGSDGPVSDDKERNMQIAKRIGYPVIIKAAGG
FT                   GGGRGMRVVRSEAELIDSIALTQQEAKQFFGNGMVYMEKYLENPRHIEVQILADGQGNA
FT                   VHLGERDCSMQRRHQKVVEEAPAPGITAETRKFIGERCTRACIEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHTITEMVTGIDLVKEQLKIAAGQPLSFTQDDVVIRGHAIECRIN
FT                   AEDPETFIPSPGKITRFHPAGGLGIRWDSHIYADYTVPPHYDSMIGKLITYGENRDVAI
FT                   ARARNALNELVIDGIKTNTPLHKRILADENFQNGGTNIHYLEKKLGL"
FT   gene            280312..280788
FT                   /locus_tag="PSHAa0267"
FT   CDS_pept        280312..280788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0267"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85366"
FT                   /db_xref="GOA:Q3IDU1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDU1"
FT                   /protein_id="CAI85366.1"
FT                   /translation="MSRSFKSHLSDDIATVTMGNRIAAIIEQGAVIYLHGDLGAGKTTF
FT                   TRGIVQGFGHTGKVKSPTYTLVEPYELERANVYHFDLYRLGDPEELEYMGIRDYFSAQA
FT                   ICVVEWPEKGGEFIPVPDLNITLSYVGDERNIVINSASERGSVIIEKLNNLTSE"
FT   gene            280889..282184
FT                   /gene="amiB"
FT                   /locus_tag="PSHAa0268"
FT   CDS_pept        280889..282184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="PSHAa0268"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II, murein
FT                   hydrolase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="3.5.1.28"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8824618; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85367"
FT                   /db_xref="GOA:Q3IDT8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT8"
FT                   /protein_id="CAI85367.1"
FT                   /translation="MSSSLWAQNTINSVRVWPSPDSTRVVFDLTEKPDFSYFMLKNPSR
FT                   LVVDLEQTRELKVLPGIPPEHQIVSKLRYSKPKNKHSVRFVFELSAPVKPVVFALAPTG
FT                   PYKNRLVVDLYDKSESSTAVSPAQTAAKNRQLSQERDIVIAIDAGHGGEDPGSIGPSGT
FT                   YEKTITLQIAKRLERMIDSERGMISRMVRSGDYFVKLNTRTNRAREKKADFFVSIHADA
FT                   FTSPGPNGASVWVLSLRRANSEIGKWIEDKEKHSELLGGAADVIKDAANEKYLAQALLD
FT                   MSMDHSMKTGLSVADEVVKELRKVAKLHKKDPQHASLAVLKSPDIPSILIETGFISNPR
FT                   EEKLLKSANHQERLAKAIFTSIKNYYLKNPPDDSLFAKLKSQYPTKHKVRPGESLSMLA
FT                   SRYGITINKLKQANKLSSNTLFIGQELDIPQS"
FT   gene            282222..284078
FT                   /gene="mutL"
FT                   /locus_tag="PSHAa0269"
FT   CDS_pept        282222..284078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="PSHAa0269"
FT                   /product="Enzyme in GATC methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12887908; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85368"
FT                   /db_xref="GOA:Q3IDU0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDU0"
FT                   /protein_id="CAI85368.1"
FT                   /translation="MSIEILPARLANQIAAGEVVERPASVVKELVENSLDAGATRIQID
FT                   IERGGHKLIRIRDNGAGIAQDELTLALSRHATSKLKSLDDLENICSLGFRGEALASISS
FT                   VSRLTLSSKTKHQEAAWQAFAQGRDMAVQVKPVAHPDGTTIEVKDLFFNTPARRKFLRT
FT                   EKTEFSHIDELIKRIALSRFDVSITLTHNEKVVRQYRAKTDPSQAIARVAQVAGKAFAE
FT                   QGLHIQSGEGGLQLHGWVLPVGSANTVQYTYVNNRMMRDKLILHAIRQAFEEVSGAQEL
FT                   PGFVIYIDIDPRQVDVNVHPAKHEVRFHQGRLVHDFILQAIKQVVVPLQGEFTNEPLNN
FT                   LADTAFSQTDTARSPTGNFESGEVFDYPKSQLQPSHSVSSGGASLGSRSAGGSGGAYRA
FT                   TPSTNHHDINAFYQGVSEQHAAHFDQGAHVSVGVNQSHAVEQAVALKTVAIISINEGVC
FT                   VFSSEQQLYCSHFKYALVDDWHEQIKEQGSLEGKALLLPVRVNLSKQDCELIAAQQSWF
FT                   TLLGFELIIEKQFVMVKKLPACLYLLDVTSAVESLLEACKAPLENIESWLAWQMQHTPA
FT                   RFYSSNIFLAQQARMQNNPQTIERLRVKAVKIDIEHYLMQLD"
FT   gene            284086..285006
FT                   /gene="miaA"
FT                   /locus_tag="PSHAa0270"
FT   CDS_pept        284086..285006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="PSHAa0270"
FT                   /product="delta(2)-isopentenylpyrophosphate tRNA-adenosine
FT                   transferase"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.5.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9148919, 10692168, 11160115; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85369"
FT                   /db_xref="GOA:Q3IDT9"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT9"
FT                   /protein_id="CAI85369.1"
FT                   /translation="MLSNLPVIFLMGPTAAGKTALAISLCEHLNTEIISVDSALVYKGM
FT                   DIGTAKPDASELARAPHHLIDLLDPSETYSVADFRRDAIIKIDEFHQQGKVPVLVGGTM
FT                   LYFKALIDGLSPLPEANVEIRAELEAQAAQYGWPHLYQELVKIDPQAAQKMSENDSQRI
FT                   NRALEVYKLTGKTMTELQKQKQPVLPYTFHQFAIAPTQRSELHQRIEKRFKIMLEQGFE
FT                   NEVSTLYLRKDLHPNMPSIRCVGYRQMWDYLAGEIDHDEMVFRGIAATRQLAKRQLTWL
FT                   RSWPDVTWLTTGDEENLHRVVSSLS"
FT   gene            285088..285351
FT                   /gene="hfq"
FT                   /locus_tag="PSHAa0271"
FT   CDS_pept        285088..285351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="PSHAa0271"
FT                   /product="Host factor-I; polyA binding protein"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12634847, 12834354, 12853626, 14561880, 7748952; Product
FT                   type mc : molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85370"
FT                   /db_xref="GOA:Q3IDT7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT7"
FT                   /protein_id="CAI85370.1"
FT                   /translation="MAKGQSLQDPFLNALRRERIPVSIFLVNGIKLQGKIQSFDQFVIL
FT                   LENTVNQMVYKHAISTVVPARAVNFQGVQENDDTEEPEAGNI"
FT   gene            285368..286657
FT                   /gene="hflX"
FT                   /locus_tag="PSHAa0272"
FT   CDS_pept        285368..286657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="PSHAa0272"
FT                   /product="HflX, putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="4.4 : Phage-related functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8248183, 7748952; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85371"
FT                   /db_xref="GOA:Q3IEY9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY9"
FT                   /protein_id="CAI85371.1"
FT                   /translation="MFDRYKSGEQAVLVHIDFPKEGDREDLHELELLVSSAGVSSLAVV
FT                   QGSRQAPHPKLFVGTGKAEEIAETVKIHNADVVIFNHQLRPSQERNLERILQCRVLDRT
FT                   TLILDIFAQRARTHEGKLQVELAQLRHMSTRLIRGWTHLERQKGGVGLRGPGETQLETD
FT                   RRLLRARLQNIRARLDKVAVQREQGRRARSRNEIPTVSLVGYTNAGKSTLFNRITNSDV
FT                   YAADQLFATLDPTLRKLELGDVGPVILADTVGFIRHLPHDLVAAFKATLTETREADLQL
FT                   HVIDVADARLKENIEQVQSVLKEIEADEVPQLLVYNKIDALDDITARIDRDDEGQPIRV
FT                   WLSAQTGEGCELLSEAISELLAKQMLSETLLLAPQYGRLRSSLFSLSAVSDERFDEQGN
FT                   WLLDVRLPVVEWNRLIKEFGPEIAGFIVCD"
FT   gene            286759..287928
FT                   /gene="hflK"
FT                   /locus_tag="PSHAa0273"
FT   CDS_pept        286759..287928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="PSHAa0273"
FT                   /product="HflK complex with HflC"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8947034, 9159109, 9636708, 9792691; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85372"
FT                   /db_xref="GOA:Q3IEZ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ5"
FT                   /protein_id="CAI85372.1"
FT                   /translation="MAWNEPGNNGNDKDPWNNKGGRDQGPPDLDEVLRKFSNKFSGLFG
FT                   GKKPGNGSGGGLGGAGISFILIIAVIVWALSGIYTVKEAERGVVLQFGKYDRIADPGLR
FT                   WKMTFIETIIPVDIEAVRSLSTSGFMLTEDENVVSVEFQVQYRVIDPYLYKFSVTNADS
FT                   SLEEALESALRYVVGHAKMDQVLTNGREVVRQNTWDELNKVIEPYNLGLIVTDVNFKDS
FT                   RPPAEVKDAFDDAIAAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLE
FT                   AQGEVARFEKLLPEYQAAKTVTRERLYIDAMQEVLGNSSKVLVDVKGGNNMMYLPLDKI
FT                   MEKQGTATRVALPSSSDIQDLRNKVNTSRNSSVNSGSDRFNNDRFNDGR"
FT   gene            287934..288812
FT                   /gene="hflC"
FT                   /locus_tag="PSHAa0274"
FT   CDS_pept        287934..288812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="PSHAa0274"
FT                   /product="HflC; HflKC is a membrane-associated complex"
FT                   /function="4.4 : Phage-related functions"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8947034, 9159109, 9636708, 9792691; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85373"
FT                   /db_xref="GOA:Q3IEZ4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ4"
FT                   /protein_id="CAI85373.1"
FT                   /translation="MKNFSLVILLAAIVMSFSSVFVVPEGQKAIVLLFSKVQKDSDDQA
FT                   IVYSPGLQFKVPFFSQVRRIDARIQTLDGTPDRFVTSEKKDLIVDSFVKWRVNDFSAFY
FT                   LRARGDKQYAETLLEQKVNNGLRTNFGTRTIREIVSGERSELMEEALVQASESARELGI
FT                   EVLDVRVKQINLPQEVSSSIYQRMRAERTAVAKEHRSEGQEKAETIRAGVDRRVTVMLA
FT                   DAERNSRTVRGQGDADAAAIYANAYNKDPEFFSFVRSLEAYKQTFKNKQDVMVLSPDSD
FT                   FFKYMKGATAQ"
FT   gene            289024..290337
FT                   /gene="purA"
FT                   /locus_tag="PSHAa0275"
FT   CDS_pept        289024..290337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="PSHAa0275"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.4.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2123815, 14701822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85374"
FT                   /db_xref="GOA:Q3IEZ3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEZ3"
FT                   /protein_id="CAI85374.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTDKASLVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGVLRDNVKCVIGNGVVLSPEALMREIGMLEARGVPVRERLLISAAC
FT                   PLILPFHVALDVARETARGDKPIGTTGRGIGPAYEDKVARRGLRVGDLFNPELFAAKLE
FT                   EVLEYHNFTLVNYYKVDAVDFQKTFDDAMAVADILKAMIVDVTELLDQTRLAGDNILFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGAGFGPLHLDYVLGIIKAYTTRVGSGPFPT
FT                   ELYDGLDKQDPVGKHLGDKGHEFGATTGRLRRTGWLDAVAMRRAVQINSISGFCLTKLD
FT                   VLDGLETLKICTGYKLEDGTVTNVTPLAAEGYEKVTPIYEEMPGWSENTVGVTSLDGLP
FT                   KAAIDYVKRIEELTGVPVDIISTGPDRVETMILRNPFA"
FT   gene            290672..291310
FT                   /locus_tag="PSHAa0276"
FT   CDS_pept        290672..291310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0276"
FT                   /product="Sodium-type polar flagellar protein motX"
FT                   /function="1.5.3 : Motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85375"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ2"
FT                   /protein_id="CAI85375.1"
FT                   /translation="MQLLFSHSVLLLPLMTLSLLMSSNSLAEETAAAVPLYTETELISL
FT                   INKNTHLARVKADDCQLVQDIEARANKMALPSYQFLYGDMLAYNVCVDRDVELGVYYMQ
FT                   KAAEQGLAAALEQLGRYYDIGRLVQQDKAMAITYLREASSQGNLKAQFRLVKLFNQGYG
FT                   SPRDFEDMYRWLFYAKVADANTHKKIERLLAQLAEKMPASVVARARLPM"
FT   gene            complement(291391..293238)
FT                   /locus_tag="PSHAa0277"
FT   CDS_pept        complement(291391..293238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0277"
FT                   /product="putative sodium/hydrogen antiporter"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 26666, 8142450; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85376"
FT                   /db_xref="GOA:Q3IEZ1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ1"
FT                   /protein_id="CAI85376.1"
FT                   /translation="MSAIYIAGIALCSVLAQWIAWAFRVPAILFLLLTGLLLGPFTGVL
FT                   DPDALLGDLLFPVVSLSVAIILFEGSLTLHFRELKGISKVVRNLCSIGMLTTCIIISFS
FT                   AYWLLELNWRVAAVLGAVLVVTGPTVIAPLLNSMRPTQDIDRILRWEGIVIDPIGALFA
FT                   VLVFEAVMLVGEGQIFSHTIIALVKTLGVGLTIGVVAGWLTTQLMRREWLPFELHKFGI
FT                   LALVLISFSVSNHLSHESGLLAVTVFGIWLANQDDLEIDSVLEFKEDLSMILISTLFIL
FT                   LAARLELSDLMMLDSDVFIFLAIVLFIARPVCIAISTFGTDLPMKSRLVLAWIAPRGIV
FT                   AAAVGSVFALSMMEAGVADAEKMVPLIFTVIIITVVLQSLTAIPLAKLLGVRQPSPSTI
FT                   LIIGANHVSRAIARGLKDQNIPVHLSDPAWENCKMARMDGLPCYYGNPQSEHAERYLPL
FT                   TTIRSVLALSPNRHHNALGVQYFSHLLNDKNVFSLRSSSSHAKANKDSATFLSRQILFG
FT                   ENGSYARLSSVIAKGGKVSATRISDEFSWEQYQEMNPEAIPLFILKGDKDGDDDAPVKL
FT                   RPFTSDMEKPPQEGERIVALQPAKISLLKDSQAKAKEES"
FT   gene            293261..293410
FT                   /locus_tag="PSHAa0278"
FT   CDS_pept        293261..293410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0278"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85377"
FT                   /db_xref="GOA:Q3IEZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ0"
FT                   /protein_id="CAI85377.1"
FT                   /translation="MIDKSITYVNYNTGVYTDKLNFANRILAVYQILRVLKSVILSVIL
FT                   INTL"
FT   gene            294102..295208
FT                   /gene="proB"
FT                   /locus_tag="PSHAa0279"
FT   CDS_pept        294102..295208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="PSHAa0279"
FT                   /product="putative glutamate 5-kinase (Gamma-glutamyl
FT                   kinase)"
FT                   /function="2.2.1.7 : Other"
FT                   /EC_number="2.7.2.11"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 6089111; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85378"
FT                   /db_xref="GOA:Q3IEY8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEY8"
FT                   /protein_id="CAI85378.1"
FT                   /translation="MNKLNWRRIVLKVGSALIAPDQDGCRSRYILTIAQFIVRCRARGI
FT                   EVILVSSGSVAAGAHLFPSDTARSVVMKKAMAAAGQTEMIAMWDRFFDFPSAQLLLTHG
FT                   DLRDHERYQSIRETVFTLLEHGVLPIINENDAVTTDDLKVGDNDNLSAMVAAAADADAL
FT                   LIFSDVDGLYDKNPNLHDDAILLPEIKSIDDSIYAMAGCATSAVGTGGMKTKIEAAEKA
FT                   TSHGISTYIINGFKEETFTRLLAGENPGTIFLPYEKPMQDSVHWMTHTANEQGEVVVDG
FT                   SFDKSLEGETGCIRGDEIMAVHGEFAIGDTILVRSEDGTRLAKATANYSSCLLSFIADN
FT                   EQSEFSEKMQDSIGPVISEKHIALLEKS"
FT   gene            295205..296452
FT                   /gene="proA"
FT                   /locus_tag="PSHAa0280"
FT   CDS_pept        295205..296452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="PSHAa0280"
FT                   /product="Gamma-glutamyl phosphate reductase (GPR)
FT                   (Glutamate-5-semialdehyde dehydrogenase)
FT                   (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA
FT                   dehydrogenase)"
FT                   /function="2.2.1.7 : Other"
FT                   /EC_number="1.2.1.41"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6089111, 3026898; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85379"
FT                   /db_xref="GOA:Q3IEY7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEY7"
FT                   /protein_id="CAI85379.1"
FT                   /translation="MSLITDISRQAAKAAHQLALLDTETKNKVLLDMAAALRAEKAFII
FT                   KENESDLAAARDNNLAAAMVDRLTLNDERVEAMAEGIEVIVSLDDPVGQLRDITERPNG
FT                   IKIRKMRVPLGVVCMIYEARPNVTADAGALCFKSGNSVILRGGKEALKSSQAIASVMHS
FT                   VLAKHNLPEALISVIPDPDRGLLMELMQQRDSIDLIIPRGGEGLINFVTENSTIPVIQH
FT                   FKGVCHLYVDKDADLEVAINLLLNGKTQRTGVCNALEGLVVHQDIANEFLNLCAVVLRQ
FT                   EGVKINADSQAATYFDNATVLGDDEFGEEYLDLEIAIRVVPSFAAAVEHIAQFGSHHTE
FT                   VICTKNAATAELFQRSVDASVVTVNASSRFSDGSQLGLGAEIGIATSKLHAYGPMGLES
FT                   LTTEKYLVNGDGQIRE"
FT   gene            complement(296689..296764)
FT                   /locus_tag="PSHAatRNA104"
FT   tRNA            complement(296689..296764)
FT                   /locus_tag="PSHAatRNA104"
FT                   /product="tRNA-Ala"
FT   gene            296932..297318
FT                   /locus_tag="PSHAa0281"
FT   CDS_pept        296932..297318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0281"
FT                   /product="putative orphan protein ; putative signal
FT                   peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY6"
FT                   /protein_id="CAI85380.1"
FT                   /translation="MKKYALVLMVLLVGCANSSDEQPYEINNKQFHEKQDEQGNKLFAY
FT                   VVSVKAKSRQNINLDKKFTRSDFERFAAQEHFEESSILKLQLEDQAVELLNKELETRNY
FT                   CPAKHEINEVLWRDLSVQLRGRCL"
FT   gene            297320..297820
FT                   /locus_tag="PSHAa0282"
FT   CDS_pept        297320..297820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0282"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85381"
FT                   /db_xref="GOA:Q3IEY5"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY5"
FT                   /protein_id="CAI85381.1"
FT                   /translation="MLADKTKLAALLAQLNINYEVIEHPPLHGSLDADAFMVERPGTRL
FT                   KNLFLRDNEGKRHFLVITAHDKQLDLKVLSKQQGLSRLGFASSERLARYLKVAPGCVSM
FT                   LSLMNDKQNEVSVWLDQDIWQGELFHCHPFENTQTWLLNKADLEQFFNFTEHQPRVVFL
FT                   PSR"
FT   gene            complement(297787..298935)
FT                   /locus_tag="PSHAa0283"
FT   CDS_pept        complement(297787..298935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0283"
FT                   /product="putative transport protein (MFS family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85382"
FT                   /db_xref="GOA:Q3IEY4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY4"
FT                   /protein_id="CAI85382.1"
FT                   /translation="MRLPHLLLCSVFIFFVLYAPQPLLGLFAVEFGVAPAAAGSLMTAA
FT                   MLPLAIAPLVYGLFLTKRNPLFILRIAMLLLGGCCLLFVYAPTFELLLLVRFLQGLILP
FT                   AALTAMTSYIGMSFSADTLQKNMTIYIGSTIVGGYFGRVLAAIFSDIWHWQSFYYFIAT
FT                   MLILLAWSIPHTRFKSNNVKSILSPLDYIKQLREGPLLKVYGAVFCMFFCFAALLNYLP
FT                   FILQNTFLITNTRDIGLVYSGYLIGALASITTPWLLKKVPSAWHLLTAIFLFYSISIVM
FT                   LMSHQLIVFLAAFTLFCGSMFVIHSTAAPLVNKISKAPPSVTNGGYVSFYYSGGALGSL
FT                   LPGVIYQHHGQTAFMAALLAVCLCGLMLVIWAYLEGKNTTRG"
FT   gene            299201..299740
FT                   /locus_tag="PSHAa0284"
FT   CDS_pept        299201..299740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0284"
FT                   /product="conserved protein of unknown function ; putative
FT                   nucleoprotein/polynucleotide-associated enzyme"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85383"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY3"
FT                   /protein_id="CAI85383.1"
FT                   /translation="MGSLQEQLLQAGLTTSHKAKVAKSEKRKQQKKQKKGATSNPSDLQ
FT                   KHIQQTKLEQQQKAEELNQARQGSLKQREQSARVKQILEHHNQEAIRGERTFNFTYENK
FT                   VKSIEVNERTQKALSGGRLAICVLEGRFYVLEDEPARKVAEVDEHYIVFHVEPESKVKD
FT                   EDDPYADFEIPDDLTW"
FT   gene            299916..300239
FT                   /locus_tag="PSHAa0285"
FT   CDS_pept        299916..300239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0285"
FT                   /product="putative cytochrome c4 family"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85384"
FT                   /db_xref="GOA:Q3IEY2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY2"
FT                   /protein_id="CAI85384.1"
FT                   /translation="MSKIKTLLLGAGISLAASLSFNAAAADGAALYTAKNCQTCHGAEG
FT                   KAPIMGMYPKLNGQNKDYLVAQMKDIKSGARSNGMSMAMKAMVATVTDEEFAAIADYLA
FT                   NVK"
FT   gene            300382..301149
FT                   /locus_tag="PSHAa0286"
FT   CDS_pept        300382..301149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0286"
FT                   /product="conserved protein of unknown function ; putative
FT                   aldolase class II family"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="4.1.2.-"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85385"
FT                   /db_xref="GOA:Q3IEY1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY1"
FT                   /protein_id="CAI85385.1"
FT                   /translation="MFDLPQLDLKNKVSAQEWQLRVDLAACYRLVDHFRWGDLIYTHLS
FT                   ARIPGSDHYLVNAFGLTFDEISASNLVKVDLSGNIIDDTPFNINPAGFTIHSAIHEVRD
FT                   DAHCVIHLHTKETIAVATQKNGLLPLSQYSMFSLPSLSYHGYEGLAVNDDERKRLQDDL
FT                   GNTNHMLLVNHGGLTVGPTVGDAFMRFYDLQRACEIQLAIQASSQQAISVPQPIIDNIY
FT                   NQANVVHSGSTGGQLAWPAMLRKAYRLDPSFAK"
FT   gene            301177..302352
FT                   /locus_tag="PSHAa0287"
FT   CDS_pept        301177..302352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0287"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme family"
FT                   /EC_number="5.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85386"
FT                   /db_xref="GOA:Q3IEY0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY0"
FT                   /protein_id="CAI85386.1"
FT                   /translation="MKVNRVEVFDIHCPDRPAWTPVFVRIHTDEGISGVGEAGLAYDLG
FT                   HSAAAAMIKEMADAFLIGHDPFQTEKLWSRMLRESFWGLGGGPVVYAAMSAIDTALWDI
FT                   KGKALGVPVYQLLGGKVNDKLRTYASQLQFDWDSEFKALVQPQEYAEAALKAVAEGYDA
FT                   VKVDPIQYDKDGNTYYDRTNIISRAEMKLYRARMQAIREAVGDEVDIIFECHSLPGVTS
FT                   AIQLGEIAKEFDCMFFEEPVNYLNHSLHAKVADKVAVPIAGGERLYNRWGVRPYLEDQS
FT                   INVLQPDIGLCGGFTETKKVCDYADIFDVRIQAHVCGGPVATAASLHLETAIPNFLIHE
FT                   HHTYAIKKWNRELCLQDPQPKNGFFQVSEEPGIGIELNDEIVMRSQRVEIK"
FT   gene            complement(302423..302806)
FT                   /locus_tag="PSHAa0288"
FT   CDS_pept        complement(302423..302806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0288"
FT                   /product="putative orphan protein ; putative signal
FT                   peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX9"
FT                   /protein_id="CAI85387.1"
FT                   /translation="MKVRRLTVIAFITTALSGCLAQSAEPTPKLQHALLVTPNSIAVAN
FT                   AIASLLHSSQVQLADDVFTTNSTVTLDKLNHKDSMGNPIMGKQLNMPDQFELMIKGKQC
FT                   FVRHLDSKATQQLKGVQCKINQL"
FT   gene            complement(302810..304375)
FT                   /locus_tag="PSHAa0289"
FT   CDS_pept        complement(302810..304375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0289"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85388"
FT                   /db_xref="GOA:Q3IEX8"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX8"
FT                   /protein_id="CAI85388.1"
FT                   /translation="MHSKIRDKKTTTLASLALLSVLSGCGGGSDSEGLTPNSNTNSWSA
FT                   GVFASASQFKGQCQASNEKNWLRSWSNETYLWYDEIIDTDPALTSGVVAYFNTLKTNEL
FT                   TDSGAKKDNYHFNLPTDEWQRQSQSGVTYGYGFNIKILASSAPRQAVISYTEPNTPASN
FT                   QNLARGFELVAVDGIDFVNTTSSSEVALISASLFPEQTGKTTEFVFKDINTNQNRTVTL
FT                   TSQNITSQPVVNVRTDLADGDVGYFQFNSHNAIAEDQLYNAFNQFAASNIKDLVIDVRY
FT                   NGGGFLQMASQVAYMIAGRANTQGKVFERTVFNDKNPNTNPVTGQTLSPMPFTNQFVGF
FT                   ADNPATVPGSALPTLNLNRVFVLTTSSTCSASEAIINGLRGADIEVIQIGSGTCGKPYG
FT                   FYPTDNCATTYFTIQFSGINNKGFGEYADGFAPKNTIDNAFQPVLLNGCALADDFSQPL
FT                   GNANEALLKTALNYRNTGSCPAPSSINSKQGFAPAITTDSPEVKDTRIQTLLEQNTILS
FT                   DNMR"
FT   gene            complement(304425..305264)
FT                   /locus_tag="PSHAa0290"
FT   CDS_pept        complement(304425..305264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0290"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85389"
FT                   /db_xref="GOA:Q3IEX7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX7"
FT                   /protein_id="CAI85389.1"
FT                   /translation="MSRAIIDPHVHFFNLLEGQYTWLQGANPPPWPNLDKIKQPISAAQ
FT                   LMQDCDFKLAGLVHIEAGFDNSAPINELNWLTKHLAGITYKAVSFAQIDQSNQLFSHAL
FT                   SNLSHPSLAGIRDITQGDDAKRLLSSNCYNNFETLQQLKLHFEAQFELENHIIVKQIAQ
FT                   YAKQFPQLQIILNHAGLPHNMPAWQQGIKLLAKYHNIAIKFSGFELLKLNSGQQAQCFN
FT                   IILQHFGEQRIMFASNFPVCQINTQYNDLWQAHFNLCSNQALWQQLSYKNAKHCYQL"
FT   gene            complement(305261..305989)
FT                   /locus_tag="PSHAa0291"
FT   CDS_pept        complement(305261..305989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0291"
FT                   /product="putative glucose/ribitol dehydrogenase family"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85390"
FT                   /db_xref="GOA:Q3IEW4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW4"
FT                   /protein_id="CAI85390.1"
FT                   /translation="MSKVAIVTGGTKGIGLAVVQRLLASGYEVHNLDITPSNFGEFHHC
FT                   DVSDVTVVRHCINAIVEQTQRIDVLVSNAGKHLSANIESTDEQTLDALFALNVKGAYAA
FT                   VQSVLPIMKTQNNGAIVLIASDQAIIGKKNSFAYNLTKHALASMAKTTALDYASFNIRA
FT                   NAVCPGTIETPLFHNAIDAYCKNSGANKAQTVAEEAALQPLNRLGQADEVAALVNFLVS
FT                   DDASFITGSLQSIDGGYTAQ"
FT   gene            complement(306021..306515)
FT                   /gene="slyDB"
FT                   /locus_tag="PSHAa0292"
FT   CDS_pept        complement(306021..306515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyDB"
FT                   /locus_tag="PSHAa0292"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FkbP family"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9350861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85391"
FT                   /db_xref="GOA:Q3IEX6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX6"
FT                   /protein_id="CAI85391.1"
FT                   /translation="MQISKNSAVEFHYTLSEAGEQIETSTNEAPLTYIHGSEGMLPGLE
FT                   NALEGKAAGEKFSVTLAPSESYGERVDNLVQRIPLKHLQTQSKVKVWKPGMTAMVSSDQ
FT                   GRHQVTIIKVGRFNADCDLNHPFAGKTLTFDVEVVSVREATSEEVSHGHVHAAGGCGHS
FT                   H"
FT   gene            complement(306586..308055)
FT                   /gene="mltD"
FT                   /locus_tag="PSHAa0293"
FT   CDS_pept        complement(306586..308055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="PSHAa0293"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase D [Precursor]"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10843862, 1663890; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85392"
FT                   /db_xref="GOA:Q3IEX5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX5"
FT                   /protein_id="CAI85392.1"
FT                   /translation="MRSLVLACLGVFLFGCETTKPEPIEAPQIFTHFKPSYSAPSELKT
FT                   PQSTKTNLRITPPKNTKNKIITPPAKTTDLWQHIANNLHFPIEQNKALKKRINWYLQQP
FT                   DYLQVMSKRAAPYLYHIVKKVEQQQLPIELALLPFVESGFRPTAHSSQQAVGVWQLVGA
FT                   TAHHFGVKSDQWYDGRQDVLAATDAALAYLSYLYKRFDGNWLHALAAYNSGEGRVKRAI
FT                   KQNKKHGKSTDYWSLKLPQETADYVPKLLALSYLVKHPQQGFKRPKLAYKALTTHMNVG
FT                   QQFDFSIIAKLSGVGSKQLHALNQGYLKNQSSPNGPHTLLLPIEQQALLNSSFFKTNFA
FT                   GEYIVKQNDTLYSIARRFGMPLSTLKQLNNKQNNLIGIGEKLLVGQPKTLPESLTIDYK
FT                   ISPYLEHQEVVIATLEIDYEVQPGDTLWSISQLYNVPHSDLAKWNKLSASSMLKPGIQL
FT                   VLFIPQAEKPQVTTIKKDLLLDLQKTLNQPR"
FT   gene            complement(308112..309128)
FT                   /locus_tag="PSHAa0294"
FT   CDS_pept        complement(308112..309128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0294"
FT                   /product="putative orphan protein ; putative
FT                   beta-lactamase-like domain ; putative signal peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85393"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX4"
FT                   /protein_id="CAI85393.1"
FT                   /translation="MKSALRLFKLSKYLLLLNSFYFAANANADVTWEKISPNIQFLKQQ
FT                   HKLRFYDSNQVLIEGSKCALLVDTSGNFAAVEQLASDLKKHLTTPLCYLVATHFHDDHL
FT                   LGMAVMQHFYPDAQLITHQQVKTDFALYQQAFNDKLEGFEKSIELSYQRLATLPENEQA
FT                   QWRTKLERAKQRLFRWQKYQLNAPEISINTNKTLDLGNFEITLNAHQAHTNGDLTITTN
FT                   SGSTLIGGDIVDWLPYPGHGELSSWRALLQQYINDSVLKTIIPGHGELTNKSQLQQSHA
FT                   FLTAITEHVANNSGQTIEQLMLSFPDVAIKPYMQESLNAKSSNLFLQAGLIRAINAK"
FT   gene            complement(309188..309493)
FT                   /locus_tag="PSHAa0295"
FT   CDS_pept        complement(309188..309493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0295"
FT                   /product="conserved protein of unknown function; putative
FT                   FtsZ-associated protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85394"
FT                   /db_xref="GOA:Q3IEX3"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX3"
FT                   /protein_id="CAI85394.1"
FT                   /translation="MSELQNQRVTVELLGKEQQFACPPGQEEALKAAAKNLNDLVEQMK
FT                   QRSTVKNEQNALLMAALNLSHELLEAKTIKAVDLQHQDQLIDKLSQHLSNDSKHNK"
FT   gene            complement(309493..309723)
FT                   /locus_tag="PSHAa0296"
FT   CDS_pept        complement(309493..309723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0296"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85395"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX2"
FT                   /protein_id="CAI85395.1"
FT                   /translation="MNNNTLQQLEQLIDQLIQRNNQLQADVSNLKEQNSKLADDNELLQ
FT                   LEALENEEKQKDASTTLSGLLDKLQSAQQAS"
FT   gene            309839..309958
FT                   /locus_tag="PSHAa0297"
FT   CDS_pept        309839..309958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0297"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85396"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX1"
FT                   /protein_id="CAI85396.1"
FT                   /translation="MYWLFHSEMVHFNGRLSGDRLSKYSAYGSLFLLNSVWRK"
FT   gene            309962..310801
FT                   /locus_tag="PSHAa0298"
FT   CDS_pept        309962..310801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0298"
FT                   /product="conserved protein of unknown function ; putative"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85397"
FT                   /db_xref="GOA:Q3IEX0"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX0"
FT                   /protein_id="CAI85397.1"
FT                   /translation="MLSYRHSFHAGNPADVLKHLVLAQVLGYQTLKDKPLDYIDTHSGA
FT                   GFFELAAADAQKTQEYQDGIEKLWQHTSKHSALNDYIALIKSFNQTANLEFYPGSPKIA
FT                   EHFLRRQDKGWFFELHPRDLLLLEENMQGKRSIRVRGENGFAGLVGLLPPASRRACVLI
FT                   DPPYEVKDDYDTVITTLMQAYQRFATGTYMIWYPVVDRSRIDNMEQDLIDSGMRNIQLF
FT                   ELATKADTDVHGMTASGMIVINPPWKLKQVMDEVLPELVSILSESSGFYRSEQLVAE"
FT   gene            complement(310858..311667)
FT                   /locus_tag="PSHAa0299"
FT   CDS_pept        complement(310858..311667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0299"
FT                   /product="conserved protein of unknown function ; putative
FT                   lipoprotein precursor"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85398"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW9"
FT                   /protein_id="CAI85398.1"
FT                   /translation="MFKRKPSSILKSVAGISFLASGALVLSGCDDAKNTAQATQAESTA
FT                   TLTTEVSYLDRSMLAPNSQLTVTLADVSKMDIKATVISQQVIDLNGGPPYTVELAYDTN
FT                   KINKALSYSVSARIENNGELLYTSTSNNNPFAADAQTSPYKIVVTKVDQKPDVDLANTY
FT                   WKAITLAGDNVTVTTKEPFIQFSNDGKVHGFLGCNNFNGGYEVNEQTVTFDHIAATQKM
FT                   CHENMDQEAAMSSMLSKAAQWQVNGESLSLKDEKGEQLATFKAVYFN"
FT   gene            complement(311815..312381)
FT                   /locus_tag="PSHAa0300"
FT   CDS_pept        complement(311815..312381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0300"
FT                   /product="conserved protein of unknown function ; putative
FT                   PhnA protein(yjdM)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2155230; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85399"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW8"
FT                   /protein_id="CAI85399.1"
FT                   /translation="MSIEQALVERSNNQCELCAATDTLSVYEVPPVKEAHSDKCIYTCQ
FT                   VCKDQIEDTAELTPTHWHCLNDSMWSQTPAVQVVAYRMLSRLAADNGWAQDALDMIYLE
FT                   EDTLAWAQQVLAEDDDLKHLDSNGVVLKAGDTVTLIKDLDVKGSSLTAKRGTAVRNIGL
FT                   TSNPEHIEGRVDGQRIVILTKFVKK"
FT   gene            312623..313231
FT                   /locus_tag="PSHAa0301"
FT   CDS_pept        312623..313231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0301"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85400"
FT                   /db_xref="GOA:Q3IEW7"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW7"
FT                   /protein_id="CAI85400.1"
FT                   /translation="MRLLLPIVSILIALVLLVPGVTQPVLSLEGKIDKSKLAQTGIEMI
FT                   ADEGDRNTRNMLMMASSMFGLDKLEGEISAYQKTRSIWGTVNELAHNKNYLVAVLVAFF
FT                   SIVIPTIKLLMQLVFCLLPASKFKQNLGVTICALSKWSMVDVFVIALIVTYLAGNAEGE
FT                   TGGLIKMHAELGNGFWYFTGYCLFAIAASSFIKTDAKNI"
FT   gene            313369..313740
FT                   /locus_tag="PSHAa0302"
FT   CDS_pept        313369..313740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0302"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW6"
FT                   /protein_id="CAI85401.1"
FT                   /translation="MQRIYSSLLIIAMLLTLVGQAVASVAMLCEMPHMSQTQHAATNVA
FT                   TEKVHQQMSVSMMNMDCCDDAATEQECNCPINACSAYSMLSVDGLFSTPLIISEKIQLY
FT                   PSQNQHHLVSSLYRPPMSA"
FT   gene            313832..315157
FT                   /locus_tag="PSHAa0303"
FT   CDS_pept        313832..315157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0303"
FT                   /product="putative outer membrane cation efflux protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85402"
FT                   /db_xref="GOA:Q3IEW5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW5"
FT                   /protein_id="CAI85402.1"
FT                   /translation="MNHFAVFKVSFLALMLGTAISAHSNELSLDEALSYALNHEPWLKA
FT                   SQYQQASEQAQSIAAGSLPDPVLTLGLMGVPTDGFALDQEGMTQLSIGVSQMFSRGDSL
FT                   ALKQQALAQSAQQHPWLRADRLAQVKTIVIESWLNAYRAQRSIALIEQDKALFSQLIDI
FT                   TESSYASSLGKTRQQDIIRAQLELTRLEDKLVMLAQQLESAKKRLSQWLPMSMLTQPVS
FT                   TKNTAIEPLISFTTLEFEALMSLLMAHPAIVAIDQTVTAKQTEIALAKQSYKPQFGVNM
FT                   GYSHRGDTPMGDSRADLLSVGVSIDLPLFTSNRQDQQVNAAIATAEAVKTQKLIALQKL
FT                   KGMYFKEFSQLMQLQKRDTLYQTKLLPQMAEQAQATLNAYTRDDGDFSEVMRARISELN
FT                   AKIDGLNIQIDQQIIIARLNYYASSQDAAVMLEQLGEQNREY"
FT   gene            315147..316895
FT                   /locus_tag="PSHAa0304"
FT   CDS_pept        315147..316895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0304"
FT                   /product="putative cation efflux system protein"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12813074; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85403"
FT                   /db_xref="GOA:Q3ILD2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD2"
FT                   /protein_id="CAI85403.1"
FT                   /translation="MNTNLKLLIAAVVGGGVTALVLSLMPASNTDIKASTEKQPLYWVA
FT                   PMDSNYRRDEPGLSPMGMDLVPFYDEAPGSSSNLDGPGAVTISPAVVNNLGVRIAKVQH
FT                   KALQNEVKTVGYVQYNQDQLIHIHPRVEGWLETLYIKAAGDSVEHGEPLYTLYSPQLVN
FT                   AQEEFLLALNRNNQVLIRAAKARLKSLNISDDFVERLQKSKQVMQNITFYAIQSGVVEE
FT                   LNVREGFYVNPGTTMMSIGKLDEVWVEAQVFERQAELIKIGQPVSMTLDYLSGQSWQGK
FT                   VDYIYPTLDAKNRTLRVRLRFNNEGHKLKPNMFAQVNIHTQANKAQLVVPKEAVIRTGN
FT                   QNRVVVALGEGRFKSVAVEMGRSDSKNTAILSGIMADDDVVVSAQFLLDSESSKSSDFK
FT                   RMQAPQAVSSVWSEGIVNSIMAEHRMVNISHEPIAELDWPSMTMDFTVADDVDFTAFEN
FT                   GQTLHFELTKQADGSYVLTAIHIMKSTVTNSEKNTATVLGTINSIDKAQRIANISRGAI
FT                   EKWGREPARLDFTFADDIDLTALAAQQQINFTFSLQQGEFVISHINGEHSTSASGNHTM
FT                   QLHNAH"
FT   gene            316904..320020
FT                   /gene="cusA"
FT                   /locus_tag="PSHAa0305"
FT   CDS_pept        316904..320020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="PSHAa0305"
FT                   /product="cation efflux system protein cusA"
FT                   /function="4.2 : Detoxification"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12813074, 11222619; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85404"
FT                   /db_xref="GOA:Q3ILD1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD1"
FT                   /protein_id="CAI85404.1"
FT                   /translation="MIAAIIRWSVLNRFFVLLLTVILIGGGLFAVKNTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQVVQDQVTFPLTTAMLSVPGAQTVRGFSFFGDSYVYVIFDEKTDLY
FT                   WARSRVQEYLSQVASRLPATASAELGPDATGVGWIYLYALVDKTNQHDISQLRSLQDWF
FT                   LKFELQTVPGVSEVASVGGMVKQYQVTVDPDKLRAYGIPLSLIQTAIAQGNQEMGASVV
FT                   EMAEAEYMVTSTGYIKSVADLEAIPLGVNTNATPLQLRDVADIRLGPQMRRGIAELNGE
FT                   GEVAGGVVVMRFGENAQKTIELVKAKLESLKKGLPAGVEIVPVYDRSNLIKDAVDNLSS
FT                   KLLEELVVVALVCIVFLFHVRSSLVAIITLPLGILTAFLIMYWQGINANIMSLGGIAIA
FT                   IGAMTDGAIVMIENMHKHMEKTPLTDENRWQVVIDSASEVGPALFFSLMIITVSFMPVF
FT                   ILEAQEGRMFAPLAYTKTYAMAASAGLAITLVPVLMGYFIRGKVISEQKNPVNRMLVNA
FT                   YKPLLNAVLKFPKATLALATLIAVIGFYPVNKMGSEFIPPLDEGDLMYMPTTYPGISIG
FT                   KARELLQQTDKLIATVPEVLTVFGKVGRAETATDPAPLTMIETFIQLKPKDQWREGMTL
FT                   DKLKKELDSLVKFPGVTNAWVMPIKTRIDMLATGIKTPVGIKVAGPKLSEIQKIGQQIE
FT                   SILKDVPGTASVYSERVAGGRYIKVDINREKAARYSLNIADIQQVVATAIGGTNVTQTV
FT                   EGQERYPVNLRYPQGYRDSPEELMLLPIVTPAGQRIALADVAKVFIEDGPAGIKSENAR
FT                   LNGWSFIDIENIDIGTYVENAQQILHEQLILPAGYSITWAGQYEYMQRAKDKLAYVLPL
FT                   TLAIIVVLLYLNFRSFAEVLIIIVTLPLAMIGGIWLMYLEGFNFSVAVGVGFIALAGVA
FT                   VEIGVIMLVYLNQAYQEKITQAQQTGVPLNYEQLKQAITEGAGLRVRPVMMTVATIVIG
FT                   LLPVLYGTGTGSEIMSRIAAPMVGGMFSAVVLTLLVIPATYLLWRKRDL"
FT   gene            320162..320617
FT                   /locus_tag="PSHAa0306"
FT   CDS_pept        320162..320617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0306"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85405"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD0"
FT                   /protein_id="CAI85405.1"
FT                   /translation="MQVKTIQQMYDWTILFHTQMAANFFSVRELLGEHNTQLVDYCTKY
FT                   EKKLAEDLIGFKAITTINTLDTYCYEYFAENPELLNFTDLDRSTQLDEQAIQGYLSDQH
FT                   QKVINAYEYLEGKTQTADGKEKLGQILQLEYQGLKQMVQSINRHIDM"
FT   gene            320768..320887
FT                   /locus_tag="PSHAa0307"
FT   CDS_pept        320768..320887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0307"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC9"
FT                   /protein_id="CAI85406.1"
FT                   /translation="MIQYVSKSLNQSSGYVNLYTVKTNKNNGATLWCVAPLFC"
FT   gene            complement(320884..321390)
FT                   /locus_tag="PSHAa0308"
FT   CDS_pept        complement(320884..321390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0308"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85407"
FT                   /db_xref="GOA:Q3ILC8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC8"
FT                   /protein_id="CAI85407.1"
FT                   /translation="MKQLVITILGQDRPGLVESISSVILENHGNWLSSNLSHLLGHFAG
FT                   IIQIEVSEEHFQALQNALNALPKLDVRIETGNTEIEPATREQLNFVITGNDRPGIVQEL
FT                   ASVIRHKGANITHLNSRQQSAPNWGVPIFSAVATVTLPNGLNKEEVINALESITSDLIV
FT                   DVEKV"
FT   gene            321748..323982
FT                   /gene="pstC"
FT                   /locus_tag="PSHAa0309"
FT   CDS_pept        321748..323982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="PSHAa0309"
FT                   /product="putative phosphate ABC transporter, permease
FT                   protein"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 2993631, 3881386; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85408"
FT                   /db_xref="GOA:Q3ILC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC7"
FT                   /protein_id="CAI85408.1"
FT                   /translation="MTSNPNKPTFNTDRSRLFKDRLAQFGITVGGVMVLIALLLIFFYL
FT                   LYIVQPIFESAKVEKRDSFNLTNAEQIVGVGVEEQTEVAYLLSQQGSVDFYSVEKANFG
FT                   KKLKTLEVTLPSDVSSFATSAPFQGQYAYGLENGSVKIVIPKFMVTFPNNERKLTPRLD
FT                   YPLGELALEVDEQGAAIKRFAFSHFEDKTAVVALTADKRVLFSSFVAEENMFSGEVEWL
FT                   VERTELDVAGRVDELLMSPDTTRVFVRSANQIYVYDTRDPSEVEQIQLLSANEENANIV
FT                   AAQLLAGANSLMLANDNGKVSQWFEINTDSGREYQKIRSFETTKQSKLNVFTEFYRRTF
FT                   FTTSSNGELGVYYTTSQAKLWQGKVSEGAIKSFAIAPRANAALIVADNKLTVLEIHNEH
FT                   PEVTWSALWQEVWYEGYPEPGYIWQSTSASDDFESKFSLVPISFGTLKAAFYAMLFAVP
FT                   IAISAAIYTAYFMSSELRKVVKPTVEIMEALPTVILGFLAGLWLAPLIEQHLPAIVGLL
FT                   VLLPLGILATALGWTKLPASIRHKIPEGSHAIILIPVVLFIGWFSFAMSETVELWMFDG
FT                   NVRQYLTNELGMTFDQRNALVVGIAMGFAVIPTIFSIAEDAVFSVPKHLSNGSLALGAT
FT                   QWQTLIRVVLLTASPGIFSAVMMGLGRAVGETMIVLMATGNTPIMDWSVFQGMRTLAAN
FT                   IAVEMPESEVGSSHYRILFLAAFVLFIFTFVFNTIAEFVRQQLREKYSSM"
FT   gene            323997..325646
FT                   /gene="pstA"
FT                   /locus_tag="PSHAa0310"
FT   CDS_pept        323997..325646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="PSHAa0310"
FT                   /product="putative phosphate transport system permease
FT                   protein"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85409"
FT                   /db_xref="GOA:Q3ILC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC6"
FT                   /protein_id="CAI85409.1"
FT                   /translation="MVKQWFRSGSPWIWMTGGAVSISLISVIGLLAMIAWKGLSFFWPS
FT                   EVVQFELEGSIAKQTIIGEIYDRELVPKARLAATGVDVSAYDREEFERLLIKTGNREYV
FT                   DLDFRWILNTDIKNQSTPTTLAVFERSKNGNFYGYVEGVIEDGQPVTGDKVAYLHKLVE
FT                   RAVDLNDEALDLQNGDIGHINYELERLRLKEKSYLLDNELTDERVAELAEARAELRAEY
FT                   AVLEKQLFALRKQAQRDQVMVKDMRGEIVTIPLYQVLDVWFPNDMSFLTKLGHYFIQLG
FT                   KFVSDDPREANTEGGVFPAIFGTVFMVMLMAVIVTPFGVVAAIYLHEYAAKNAVTKMIR
FT                   IAVINLAGVPSIVYGVFGLGFFVYMLGGSLDQLFYPESSPTPVFGTPGVMWSALTLAIL
FT                   TLPVVIVSTEEGLSRIPSTVRHGSLALGATQAETLWRIVIPMASPAIMTGLILAVARAA
FT                   GEVAPLMLVGVVKMAPTLPLDGNFPYFHLDRKFMHLGFHIYDVGFQSPNVEAARPLVYA
FT                   TAFLLVSVIITLNITAIGIRNHLREKFRSLEL"
FT   gene            325669..326496
FT                   /gene="pstB"
FT                   /locus_tag="PSHAa0311"
FT   CDS_pept        325669..326496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="PSHAa0311"
FT                   /product="Phosphate import ATP-binding protein
FT                   pstB(Phosphate-transporting ATPase)(ABC phosphate
FT                   transporter)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /EC_number="3.6.3.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2993631, 3881386, 8682808; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85410"
FT                   /db_xref="GOA:Q3ILC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILC5"
FT                   /protein_id="CAI85410.1"
FT                   /translation="MISVAPKVNQANTSLKLDLDNLTTEQTALEIKDLDLYYGDKQALS
FT                   KVNMNIPKGQVTAFIGPSGCGKSTLLRCINRMNDLVDICRIEGEILLHGQNIYDKSVDV
FT                   AALRRNVGMVFQRPNPFPKSIYENVVYGLRLQGIKDKRKLDEVVEQSLRGAALWDEVKD
FT                   RLHDSAFGLSGGQQQRLVIARSIAISPEVLLLDEPTSALDPISTLVIEELINDLKSKFT
FT                   VVIVTHNMQQAARVSDQTAFMYMGELIEYSDTNTLFTTPNKKKTEDYITGRYG"
FT   gene            326539..327240
FT                   /gene="phoU"
FT                   /locus_tag="PSHAa0312"
FT   CDS_pept        326539..327240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="PSHAa0312"
FT                   /product="transcriptional repressor for high-affinity
FT                   phosphate uptake"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2993631, 3881386; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85411"
FT                   /db_xref="GOA:Q3ILC4"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC4"
FT                   /protein_id="CAI85411.1"
FT                   /translation="MEHNINKHISGRFNQELENVRNLVLSMGGLVEQQLNSALDAVSQN
FT                   DAMLAQKVRENDYKVNAMEVSIDEECTRIIARRQPAASDLRLVVAIAKTIADLERIGDE
FT                   AKRIAKVALDSFTKDQQALLVNIENMGRQVSKMLHDVLDAFARMDVQRAFEVHKEDAKV
FT                   DREYEAIIRQIMTYMMEDPRSIPKIMDLVWSVRSLERIGDRCQNIAEYIIYFVNGKDIR
FT                   HTSQEDIEKSL"
FT   gene            327389..328066
FT                   /locus_tag="PSHAa0313"
FT   CDS_pept        327389..328066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0313"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85412"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC3"
FT                   /protein_id="CAI85412.1"
FT                   /translation="MQTNAFLGVFAKSPIKPMEEHIRKVHQASKALIPFFNHVFKEEWQ
FT                   QAEELRLTIRNLEREADEMKRNIRLQLPRGLFMPVERTDLLELVTQQDKIANKAKDIAG
FT                   RVIGREMIIPKVIQIDFLAYLTRCVDATKQASNAINELEELLETGFKGREVALVEKMLV
FT                   ELDAIEQDTDEMQIKIRRQLRAVEGELNPVDVMFLYKIIEWVGELADIAERVGSRLELM
FT                   LAR"
FT   gene            328169..329374
FT                   /locus_tag="PSHAa0314"
FT   CDS_pept        328169..329374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0314"
FT                   /product="putative inorganic phosphate transporter"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85413"
FT                   /db_xref="GOA:Q3ILC2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC2"
FT                   /protein_id="CAI85413.1"
FT                   /translation="MAYGIGANDVANAMGTSVGSKALTIKQAIFIAMIFEFAGAYLAGG
FT                   EVTSTIRNGIIDSTPFMDIPELMILGMISALFAAGAWLLMASFLGWPVSTTHSIIGAII
FT                   GFALVAVGSEAIHWNKVAGIVGSWIVTPAISGFIAYLIFMSAQKLIFDTATPLKNAKRF
FT                   VPIYMGLAGFIMSLVTIKKGLKHIGINLGTVEGISLSIAIAVVVGFIGKIAISRLKIDP
FT                   QADKKMQFNNVEKVFAVLMVLTACCMAFAHGSNDVANAIGPLAAVVSIVENNGEIAKQA
FT                   AIAWWILPLGGFGIVAGLAILGKKVIKTIGEGITHLTPSRGFAAELAAASTVVIASGTG
FT                   LPISTTQTLVGAVLGVGMARGIAALNMGVIRNIVVSWVITLPVGAGLAIVIFYVLRTAF
FT                   GV"
FT   gene            329457..330395
FT                   /locus_tag="PSHAa0315"
FT   CDS_pept        329457..330395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0315"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85414"
FT                   /db_xref="GOA:Q3ILC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC1"
FT                   /protein_id="CAI85414.1"
FT                   /translation="MTNLPSIKQLQYLLAVHQYQHFGRAASACFIGQSTLSTAIQNLEE
FT                   TLGCQLIERENRSLMFTTIGEEVVERSRKIIHDTISLKELTKSFLTPLSGKLTVGVIPT
FT                   IASFIAAPLYHFCKQEFCDLELVLVEDTSDKLLDKLEHGQIDLALLALPYQTDKFHTQV
FT                   LARDHFSLVHHKDYTPAKNVQDFNLLPDASVFLLEREHCMTGHALSACHLNRVSCINPF
FT                   EAASLHTLLSMVEYQLGVTFLPQMAINAGILDNKNMLATPSANEAYREIGILWRKTTGR
FT                   IRDFKLFSQQLEVFLKHQCSLDFAKEAATSS"
FT   gene            complement(330392..330604)
FT                   /locus_tag="PSHAa0316"
FT   CDS_pept        complement(330392..330604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0316"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85415"
FT                   /db_xref="GOA:Q3ILB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB1"
FT                   /protein_id="CAI85415.1"
FT                   /translation="MTQLVVLLLLMHFAIAFQCYRYAHIKGYPVRVFTVLGLVPYFNLV
FT                   VWVYLLFLPKLEPYESHNHENKQLS"
FT   gene            complement(330808..333339)
FT                   /locus_tag="PSHAa0317"
FT   CDS_pept        complement(330808..333339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0317"
FT                   /product="putative orphan protein ; putative sensory-box
FT                   domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85416"
FT                   /db_xref="GOA:Q3ILC0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC0"
FT                   /protein_id="CAI85416.1"
FT                   /translation="MVNQLKLLILNASSAERGTIRATLEKLNVFEFIEVSDSQQALKIL
FT                   KKQAVNIIITGLDVGKIDGWRFSRMIRSGLLNTPKNTPILLIPPIYCERIAETTARSYG
FT                   IDAVLPFERQDMLPQVLASVLANHLEKSSRLNLLLLEPTNTKANEISKPLLLNFSITHV
FT                   TSSQAALNAYNQQQFAIVLLDATAARAEESSVLVSEILQHNPMQAIVTIIDSDDADYAE
FT                   QLLLSGVTDFIRAPYDPPFLNKVCDHAARREDFMVSYAEFANKVEQLSISEVRYRDLFS
FT                   AHQRILLHLNTVVLELDQQGLIRFINPAWEALSGFGVKSTLQQQLTNFCIAECQVKLQA
FT                   TIDDILCGGEYKQQVEIRLQHKNGSQIWVECRLQLIQNSHNNATITATIDNIHERKQAE
FT                   LQLRHLALHDTLTGLHNRYYFDQQLNRICQPQHTHSDIEHALIYIDLDHFKIINDSKGH
FT                   QQGDIVLKEVAQLFITNISTEHLVFRVGGDEFAVILKHTNLLDAHLIAEGICNAIEQNQ
FT                   FKSEEQIYSISCSIGLTQITEKNCDPSECLKQADIALYIAKNLGRNLVHCYAKQDAHNN
FT                   TLQTGLEWGHGIRQALQQDSIELHYQPIWDFRRNEVAYFEVLLRLKINDELVFPNQFIP
FT                   SLEMLNDTFLMDQCVIRNTIANVALYPELNQVAINLSAQSFLDERLVPLIESNLAKYQV
FT                   LPTQIIFEITESASINNLAATRKMIEKLNILGCHFSIDDFGTGFSTFNYLKQLPAQHVK
FT                   IDGSFVCDMLNDPIDLALVKAINDISHSLDKRSVAEYVETEEVFFALKEIGVDYGQGYF
FT                   IARPMPIKGVKSELEKILKNKTFYQQLPSKK"
FT   gene            333540..334571
FT                   /gene="queA"
FT                   /locus_tag="PSHAa0318"
FT   CDS_pept        333540..334571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="PSHAa0318"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase (Queuosine biosynthesis
FT                   protein )"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1706703; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85417"
FT                   /db_xref="GOA:Q3ILB9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILB9"
FT                   /protein_id="CAI85417.1"
FT                   /translation="MRVADFSFDLPDELIARFPKQDRTSSRLLSLDGPSGVVEHKVFSD
FT                   LLELVNENDLLVFNNTRVIPARMFGQKASGGKVEVLVERVLDEHRVLAHVRASKSLKPG
FT                   NEVILEGKAKATMVARHDTLFELEFEHSQNVLDILNDIGHMPLPPYIDRPDNEADRERY
FT                   QTVYGEKPGAVAAPTAGLHFDDKLMTALKNKGVQMAFVTLHVGAGTFQPVRVATVDEHI
FT                   MHSEYIEVPDDVVAAVANTKANGGRVIAIGTTSVRSLESAAKVHGGKLDTYFGDTDIFI
FT                   YPGYQFNVVDAMITNFHLPESTLIMLVSAFAGQNNIMGAYNTAIEQQYRFFSYGDAMFL
FT                   TRK"
FT   gene            334722..335849
FT                   /gene="tgt"
FT                   /locus_tag="PSHAa0319"
FT   CDS_pept        334722..335849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="PSHAa0319"
FT                   /product="Queuine tRNA-ribosyltransferase(tRNA-guanine
FT                   transglycosylase)(Guanine insertion enzyme)"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8323579, 1706703; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85418"
FT                   /db_xref="GOA:Q3ILB8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILB8"
FT                   /protein_id="CAI85418.1"
FT                   /translation="MKFELDTTDGKARRGRLIFDRGVIETPAFMPVGTYGTVKGMTPDE
FT                   VKATGAQVCLGNTFHLMLRPGTEIIKQHGGLHKFMNWDFPILTDSGGFQVFSLGAMRKI
FT                   TEEGVLFSSPVNGEKIMMTPESSMQVQRDLGSDIVMIFDECTPYPATEKEAKDSMELSL
FT                   RWAKRSKEGHGDNPSALFGIIQGGMYPELRAQSQAGLEEIGFDGYALGGLSVGEPKNEM
FT                   INILDHCAYKMPADKPRYLMGVGKPEDLVESVRRGIDMFDCVMPTRNARNGHLFITTGV
FT                   VKIRNAVHKTDTGPLDPECDCHTCGNYSRAYLHHLDKCNEILGARLNTIHNLRYYQRVM
FT                   EGLRNAISAGKLDEFVQDFYARRGQDVPELADITN"
FT   gene            335876..336211
FT                   /gene="yajC"
FT                   /locus_tag="PSHAa0320"
FT   CDS_pept        335876..336211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="PSHAa0320"
FT                   /product="putative preprotein translocase IISP family,
FT                   membrane subunit"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12068816; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85419"
FT                   /db_xref="GOA:Q3ILB7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB7"
FT                   /protein_id="CAI85419.1"
FT                   /translation="MSLFISNAHASTGSASAGGGMEMLIMLAIFGLVFYFLIYRPQAKR
FT                   VKEHKSLMSAMAKGDEVLTQGGLVGKIVKIADDKDFVVISLNEQAEVTVQKSAVTAVLP
FT                   KGTMKSL"
FT   gene            336231..338090
FT                   /gene="secD"
FT                   /locus_tag="PSHAa0321"
FT   CDS_pept        336231..338090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="PSHAa0321"
FT                   /product="preprotein translocase, auxillary membrane
FT                   component (General Secretory Pathway)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85420"
FT                   /db_xref="GOA:Q3ILB6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB6"
FT                   /protein_id="CAI85420.1"
FT                   /translation="MLNKFPLWKYLLVLAVVAVGLLYASPNLYGRDPAIQVSGAKGADV
FT                   DLSVIDKVNATLKKHNVSVKSTKLEDGQILVRFRNVEEQLKAQDLLRNSLSDDYISAIN
FT                   MAPAQPAWLKAVGGNPMKLGLDLSGGVHFTMEIDMATAVDNQLEQMEEDFRSDLREEKL
FT                   RYRSVRRVAGSDRMRVEMRSEEDKDAAERFLKTQYPLNVYIDDSSNDNAFYATMSEQKL
FT                   KEIRDYAIKQNETIIRNRINQIGVAEPNVQRQGAERIIVQLPGIQDTARAKEILGATAT
FT                   LEFREVEENADISAAAQGRIPPGTEMIMSRDGYPVVLKKRIILEGSHITGAQSGSDEYQ
FT                   RPQVSITLDSKGGAKMNAFTKRAIGKRMATVFIEYKPSGKKDADGKALPPIKVEEVINV
FT                   ATIQARLDRSFRITGIDNPAEAHNLSLLLRAGALVAPIQIVEERTVGPSLGQENIEAGM
FT                   TAVALGFAFVLAFMLIYYKGFGMVANLALAANLVLIIGVMSLIPGATLTLPGIAGIVLT
FT                   VGMAVDANVLIFERIREELADGRSPQQAVHFGYDSAFSTIFDANITTLIAAVILFAVGT
FT                   GPIAGFAVTLAIGILTSMFTAIVGTRAIINLFIGGKRVDKLSI"
FT   gene            338100..339047
FT                   /gene="secF"
FT                   /locus_tag="PSHAa0322"
FT   CDS_pept        338100..339047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="PSHAa0322"
FT                   /product="preprotein translocase, auxillary membrane
FT                   component (General Secretory Pathway)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85421"
FT                   /db_xref="GOA:Q3ILB5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB5"
FT                   /protein_id="CAI85421.1"
FT                   /translation="MQILKLGSKTLRFMSLRKVAMGFSTLLILAAFISVFTKGLNFGLD
FT                   FTGGTAVEVGFSQPADLKKVRNVLAENGFADASVQLFGSSQEILVRLAPRGDDVKAEVI
FT                   GNQVIAALKLADESVVMRRIEFVGPSVGEDLKEQGGLAMLTALICILIYVAFRFEWRFA
FT                   VGAVSGLIHDVIITVGLFSVLGLEFDLTILAAILAVIGYSLNDTIVVSDRIRENFRKVR
FT                   IDDTIEIIDISLTQTLNRTLVTSITTILVLIALFIWGGQTIHGFATALLFGVFIGTYSS
FT                   IYVASSVAIALGVSKEDLIPEVIEKEGADLDAMP"
FT   gene            complement(339326..340129)
FT                   /gene="suhB"
FT                   /locus_tag="PSHAa0323"
FT   CDS_pept        complement(339326..340129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="PSHAa0323"
FT                   /product="inositol-1-monophosphatase"
FT                   /function="3.2 : RNA metabolism"
FT                   /function="3.3.6 : Protein modifications"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8002619, 10747806; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85422"
FT                   /db_xref="GOA:Q3ILB4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB4"
FT                   /protein_id="CAI85422.1"
FT                   /translation="MHPMLNIAVRAARNAGKIILRASEDLSKVEVQQKGTNDLVTNIDK
FT                   EAEAIIRDTILRSYPDHCIVGEELGEHKGKDADYQWIVDPLDGTTNFIKGIPHFAVSIA
FT                   LKVKGRLDQAVIYDPIRGELFTASRGQGAQLNSKRLRVSKTVDLGGSILATGFPFKQKQ
FT                   HLDAYTEAFKALFIHTADIRRAGSAALDMAYVAAGRVDGFFEIGLKPWDTAAGELLVKE
FT                   AGGMVVDFAGGVNYNNSGNIICGAPKLTQAIIREIRPVLTESLLR"
FT   gene            complement(340400..341065)
FT                   /locus_tag="PSHAa0324"
FT   CDS_pept        complement(340400..341065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0324"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85423"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB3"
FT                   /protein_id="CAI85423.1"
FT                   /translation="MSVKITDRPQEQVREEVIDQLIYNYSHGVISVEAFERRLDEAMAT
FT                   NNNEVLVSLVEDLTLNTDQQYNAQKHSQFSPNYSAQQFSQSDFTLRSILGSNERSGQWI
FT                   VPKNIYLTNFMGSVVLDFTDAIFTHQEITIHVNCIFGSDEIYVPEHVNVVSKMFSIISS
FT                   VENKTVALNKHQGPTIHIEGKAIMGSVEIKIKRTIKEKFISFANQLKTQLGGKSGTPM"
FT   gene            341380..341943
FT                   /gene="osmY"
FT                   /locus_tag="PSHAa0325"
FT   CDS_pept        341380..341943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="PSHAa0325"
FT                   /product="putative hyperosmotically inducible periplasmic
FT                   protein"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85424"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB2"
FT                   /protein_id="CAI85424.1"
FT                   /translation="MKTFNKSIIAALVLGTTAMGAQASSWENESKDAWIDGKAETVLLM
FT                   NTNLNNFDINTDVKNGKVILTGKVNSELDKELAEELVLSLDGVTDVDNQLTVVKNMNSK
FT                   SHDNMKDDDGSGLTDAKITTVITTRYLFNSEVGGTNIDVDTDNGVVTLTGTVNSDAEKQ
FT                   LAVKIAKNAEDVRDVVDKLTIVAK"
FT   gene            342019..342177
FT                   /locus_tag="PSHAa0326"
FT   CDS_pept        342019..342177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0326"
FT                   /product="conserved protein of unknown function ; putative
FT                   low temperature and salt responsive protein"
FT                   /function="1.3.4 : Other"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 9342870; Product type m :
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85425"
FT                   /db_xref="GOA:Q3IFS2"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS2"
FT                   /protein_id="CAI85425.1"
FT                   /translation="MDIIRIIFSILLPPLGVFLQVGLGLHFWINILLTLFGYFPGVIHA
FT                   IYIIAKK"
FT   gene            342483..342559
FT                   /locus_tag="PSHAatRNA9"
FT   tRNA            342483..342559
FT                   /locus_tag="PSHAatRNA9"
FT                   /product="tRNA-Met"
FT   gene            342908..343633
FT                   /locus_tag="PSHAa0327"
FT   CDS_pept        342908..343633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0327"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85426"
FT                   /db_xref="GOA:Q3IFS1"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS1"
FT                   /protein_id="CAI85426.1"
FT                   /translation="MTPEELEQQAITFAKSNRTRIARKLTDKNEFPSDIRPVSVFMSGS
FT                   PGAGKTETSKAFLEEIGADNVLRLDPDELRELIPGYSGDNSYLFHRAVSFIVERTLDHA
FT                   FKNKQSFLLDGTLASYDVAKKNIERSIRKGRQVLILFVYQKPELAWEFVEAREKLEGRR
FT                   ILPNIFIDQFFASQEVIRELKLNFGSQIQVDLLVKNNKGKTRFYHGNVQAIEHHLDEKF
FT                   TREDLESLIESPSSSKNEL"
FT   gene            343642..343809
FT                   /locus_tag="PSHAa0328"
FT   CDS_pept        343642..343809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0328"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS0"
FT                   /protein_id="CAI85427.1"
FT                   /translation="MFSNLIKPKPTQNSKLSDFVLDSSSSEKKRVYSQVIERAISSQVQ
FT                   VVNKASAIQR"
FT   gene            complement(343957..344286)
FT                   /locus_tag="PSHAa0329"
FT   CDS_pept        complement(343957..344286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0329"
FT                   /product="putative 5-carboxymethyl-2-hydroxymuconate delta
FT                   isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 2194841; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85428"
FT                   /db_xref="GOA:Q3IFR9"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR9"
FT                   /protein_id="CAI85428.1"
FT                   /translation="MPHIIIEHSEDLPVLPQVLVEKIHNAAFQSNLFDLETIKTRAISY
FT                   QQYLLGAGGSGFIHIAVHILAGRSIEQKQMLSEQLLECLKTYCRASDSLSVNIYDIEHE
FT                   IYRKN"
FT   gene            344318..344506
FT                   /locus_tag="PSHAa0330"
FT   CDS_pept        344318..344506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0330"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85429"
FT                   /db_xref="GOA:Q3IFR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR8"
FT                   /protein_id="CAI85429.1"
FT                   /translation="MNLIIPNTRLPANPYNAELASFCFAQLAIKKCYGAAKVNVYSVMF
FT                   IFYNMCFVAVNTFSIEK"
FT   gene            344541..345017
FT                   /locus_tag="PSHAa0331"
FT   CDS_pept        344541..345017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0331"
FT                   /product="conserved protein of unknown function ; putative
FT                   CreA protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85430"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR7"
FT                   /protein_id="CAI85430.1"
FT                   /translation="MKYLKVSFLLAGILTLTACSDDVASVSLGLFTTKDVIVNSQQDPL
FT                   VTGVTCHISHIEANLDFSDPSDMSISCRQTGVITAEQLQQIDRSKSGEVVFKSSKSILF
FT                   KSLKVRRIYDAKAHTLLYLSYSTKESTGSHHHALSTVPLYNTQAWQWALGQERE"
FT   gene            345021..345794
FT                   /locus_tag="PSHAa0332"
FT   CDS_pept        345021..345794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0332"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85431"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR6"
FT                   /protein_id="CAI85431.1"
FT                   /translation="MLALFKPKPLLAEQEQQWLIDTFIWAVENFDVEFFTQHTQITLPT
FT                   VEFFPDSVSSIEEMATKVFNRVSSYAGMTAWPIQLVAPQQLTPQVFPQFKFSQQLRGEG
FT                   AKLIVPPSQAINISFNPNQVNQPQDLVASFAGTLATILIHHVGVLPPGGKDYLAQAADA
FT                   LACFLGFGVMMSNTVYQFKGGCGSCYNPYANREASLSETHTVFMHALVSYFKNDKRSKQ
FT                   HLKPHLRGQFKKAQKEIKALVNNSANPLLLAYMPN"
FT   gene            345808..346434
FT                   /locus_tag="PSHAa0333"
FT   CDS_pept        345808..346434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0333"
FT                   /product="putative transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85432"
FT                   /db_xref="GOA:Q3IF04"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF04"
FT                   /protein_id="CAI85432.1"
FT                   /translation="MNYLDEFLLIAVAHFFAVASPGPDFAVVLKQSVQQGRRNALWTSA
FT                   GVGAAILLHVAYCVLGVALILTQSPKVFMGLKYLAGAYLAYLGVQALRAAKPGANLNDN
FT                   IANKTVPAEPVWFAFRRGFLTNALNPKATLFFMSLFTLVISPATPTIVQVSYGVYMALA
FT                   TWAWFSMLSIVLCKTKVRGFFQRSGYWFERCIGVILIALAIRVVI"
FT   gene            346469..346963
FT                   /locus_tag="PSHAa0334"
FT   CDS_pept        346469..346963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0334"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85433"
FT                   /db_xref="GOA:Q3IF03"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF03"
FT                   /protein_id="CAI85433.1"
FT                   /translation="MSLYNFSFGSNMSSHRLLARLPNAKRIGTAVLQGYELTFDMYFKD
FT                   GSGKCSISPSDAEDALVYGVVYQISDAEKVILDGIEGAGYDCVNITVKLLSGEDVNAHC
FT                   YIANTHDSEALPYDWYIKHVHRGALEAGVPKAYSDAILNRAQKSDSNLERAEIEFAVHQ
FT                   K"
FT   gene            346985..348526
FT                   /gene="ampH"
FT                   /locus_tag="PSHAa0335"
FT   CDS_pept        346985..348526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="PSHAa0335"
FT                   /product="putative beta-lactamase, penicillin-binding
FT                   protein"
FT                   /function="4.2 : Detoxification"
FT                   /function="1.1 : Cell wall"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9324260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85434"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF02"
FT                   /protein_id="CAI85434.1"
FT                   /translation="MKLIKFATIALLAGATFSTWAQVDTNKIEQVIKTSMARFDVPGMA
FT                   VAIVENDKVIFAKGFGVTHINTGNKVNKDTLFGIASNTKAFTSAALAKLVDEGKLSWDD
FT                   KVIDHLPEFQLYDAYVTREMRIRDLLSHRSGLGLGQGDLMIWPSTDKSVDDILAGLKYL
FT                   KPASSFRSQYAYNNLMFVTAGEVVARVSGMSWNDYIEKNMLQPLNMTHSRAGFSRIPSS
FT                   NKNWATGHIPMDNQLHPFFVNYLEDFRGAGAIASSASDMSQWLRTQLAGGTMPNGEQLF
FT                   SEKQQAQMWHPHITAMASKSAFEAYHQQFRGYGLGWSIEDYHGFKKLGHNGGILGMVSQ
FT                   VTLLPEKKLGIVILSNQQALGALAAVTHEVLEDALELEDKDWVEDLAKKHFESKEKAYG
FT                   NAKPAAPADYQPQLPNINYTGTLHDNWYGDVIIEQLDGKLHIDFTHTKGLKGSLEHYTG
FT                   NTFIVKWDEKLLEADAFINFNMNTENRVSSAKMRAVSTQVTDFSFDFRNLKLTAK"
FT   gene            348643..349563
FT                   /locus_tag="PSHAa0336"
FT   CDS_pept        348643..349563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0336"
FT                   /product="putative histone deacetylase family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85435"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF01"
FT                   /protein_id="CAI85435.1"
FT                   /translation="MRTAIISHPHCRKHKMIDDHPECPERLDAINDRLLASGLDIAIEQ
FT                   KQAPKAQREHYLLAHDESLVSFVESKIPTQGLVDLDGDTWLCPDSLKAIERAVGAGILA
FT                   VDEILEGNLDAAFCSVRPPGHHANRTTSSGFCVFNNLAIAVKYAQSKGVKRIAIVDFDV
FT                   HHGNGTQDIFIDDKNVLFCSLFQHPFYPNTVVENNTTLVNSPLPIASDGNDLKAVFEQQ
FT                   WLPKLNAFKPDMLFISAGFDAHLEDDMASLKFVEEDYRWLTEQLARFSEQHNCRGIVSY
FT                   LEGGYALSALGRSAIAHVKALVDYE"
FT   gene            complement(349546..349836)
FT                   /locus_tag="PSHAa0337"
FT   CDS_pept        complement(349546..349836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0337"
FT                   /product="putative orphan protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85436"
FT                   /db_xref="InterPro:IPR025284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF00"
FT                   /protein_id="CAI85436.1"
FT                   /translation="MSYPKIIIYNNEIELAEQPDEVDDFVYAMDELQKSRIIILDSKYS
FT                   YTTLSGEPKTAISAIELADLVKDYLLKEGQCCLSKIKQLTPEQAFALLIID"
FT   gene            349919..352447
FT                   /locus_tag="PSHAa0338"
FT   CDS_pept        349919..352447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0338"
FT                   /product="conserved protein of unknown function; putative
FT                   signaling protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85437"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ9"
FT                   /protein_id="CAI85437.1"
FT                   /translation="MPHSSRFQKVGDIFTNKVITCSKHTPLIDAVKLMRAHNISAIFIA
FT                   QQQRILGVWTETDCLKLDFTNPAVTSTSIKDVMTSPVLSVPSQQLLSDTALTFHQHGVR
FT                   HLLVTDNNNVPCGVISITDIVRNQGLDHYLQFRTINDQYTKNITIVPSSLALNEAVKLM
FT                   RERSEKVILVFNQQQKEHGIITQRDLLQLITRQSEQSVCWDLASRPLYKITPQDSLFDA
FT                   YKLMLDSQVRHLVVSDKDEIKGVLSLEHLIHEIESAYCSELEKVLVQRDLALQHSQRNL
FT                   YLANKIIDSSLDGIMITHSNSTIMQVNPAFTQLTGYKEHEVIGKCPSILSSGRHDKSFY
FT                   IKMWDAINKTGVWQGEICNRKKNGDIYIEWLTIIEIKEPNNSDAIYAAIFSDITERKNA
FT                   EDKIVQLAYFDELTGLPNRRLFNDRLKMALAAAHRDQHLLAVMFIDLDRFKEVNDSLGH
FT                   SAGDCLLTLVAARIEATLNEGDTLARLGGDEFVVLCEINKIDAVASLADKILNNLNSPF
FT                   QLDHVEVGVTASIGAAVYPDDGLDSETLLKHADIAMYRSKDVGRNSFQLFKPSMNARSL
FT                   ERLAMMSRFQHALDNNEFELYFQPKQCLKSEQIMGVEALLRWHDPDLGMISPAQFIPLA
FT                   EELGLIVRLDLWVINQAGKVLTLWQKEGLVAGRLAINISACHLSQGKLANNIGTMLKHY
FT                   NLPGSLLEIELTESSFISSFTQAKTQLQQLKKLGVHIALDDFGTGYSALSYLTKLPFDT
FT                   LKIDASFIAKIPDEYGNSQIVAALIALASNLNLMVVAEGVEQPAQKNYLISLGCNVIQG
FT                   YYYCRPLTQRQWFDFYRLNDLSASTQPTGT"
FT   gene            complement(352444..353253)
FT                   /locus_tag="PSHAa0339"
FT   CDS_pept        complement(352444..353253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0339"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85438"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ8"
FT                   /protein_id="CAI85438.1"
FT                   /translation="MQGTLRKLKSSLTEPVQYHLPVGEHLVDLNAFIGKELTLTFSGTI
FT                   LCSSCGKKTKKSYSQGHCFVCMRKLASCDMCIMKPETCHYDQGTCREPEWGEENCMIPH
FT                   YVYLANTSGLKVGITRHTQIPTRWVDQGATQALPIFKVQTRLQSGLVEVALAEFIADKT
FT                   NWRNMLKGQNEALDLKAAAAELIPQISAKLNELSELFGATAIEQLDEDVVDLNFPVSEY
FT                   PTKISSFNFDKDPVVSGVLQGIKGQYLIFEKGVINIRKFTSYEVTVG"
FT   gene            complement(353276..353479)
FT                   /locus_tag="PSHAa0340"
FT   CDS_pept        complement(353276..353479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0340"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85439"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ7"
FT                   /protein_id="CAI85439.1"
FT                   /translation="MFRRLARWWRMSTITIEGVETQEVHDLLKGMNADHAQGYLYAKPL
FT                   AYDDYLQYLNSQYNLKMLDSPF"
FT   gene            complement(353505..354671)
FT                   /locus_tag="PSHAa0341"
FT   CDS_pept        complement(353505..354671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0341"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85440"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ6"
FT                   /protein_id="CAI85440.1"
FT                   /translation="MVQYAGNCRFLWNKALAINLFKLQNKQKICYYQELDFFSKLWKKS
FT                   EEYGFLTLSPAQTIQQTLKQLERAFKDAFDKNQPLKRMPTFKKKGEVNSFNFPQGFKID
FT                   KNGKRIFLPKIGWVNVRKSQAILGKAKNVTVSQKGKHWFVSIQVEQEVAPPKHSSNAMI
FT                   GGDLGVKRLITLSDGSFVEPIDTSKQTIRIKRLQKQLARKVKFSSNWKKLKAKITTFHT
FT                   KVANIRHDKLHKISTQLSKSHAIIVLEDLKIRNMTKNSKGSSEQHGKMVKQKSGLNRVI
FT                   LNQGWGMFKEMLKYKQDWLGGQVIFVDPKHTSQTCPACGHQSKDNRLTQSKFECAKCGY
FT                   QDNADHVGALNILARGHRVLACGEIDISQLVEAGTCLMSDHKAPMVLN"
FT   gene            complement(355015..356304)
FT                   /gene="purD"
FT                   /locus_tag="PSHAa0343"
FT   CDS_pept        complement(355015..356304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="PSHAa0343"
FT                   /product="phosphoribosylglycinamide synthetase (GAR
FT                   synthetase)"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.4.13"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85441"
FT                   /db_xref="GOA:Q3IIC5"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC5"
FT                   /protein_id="CAI85441.1"
FT                   /translation="MNVLVIGSGGREHALAFKAAQNTKVNTVFVAPGNAGTALEPKLEN
FT                   VAINVDDLDGLLQFAQQNNVELTIVGPEIPLVLGVVDKFREHGLAIFGPTAGAAQLEGS
FT                   KSFTKDFLARHNIPSGDYQTFEQVAPALAYLKEKGAPIVIKADGLAAGKGVIVAMTEAE
FT                   AEDAIRDMLAGNAFGDAGSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGD
FT                   AGPNTGGMGAYSPAPVVTDEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDTDGT
FT                   PKVIEYNCRFGDPETQPMMLRLQSDLVELIEAANRVELDKTTIEFDPRAAVGVVLAAKG
FT                   YPGDYPKGDVISGLQVDYPAGEKVFHAGTKQNGNDVVTAGGRVLCATALGNTVTEAQQR
FT                   AYELIKQLSWDGMEYRTDIAYRAIAREQNS"
FT   gene            complement(356321..357145)
FT                   /locus_tag="PSHAa0344"
FT   CDS_pept        complement(356321..357145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0344"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85442"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC4"
FT                   /protein_id="CAI85442.1"
FT                   /translation="MKFALKSILVATIALSSAASLAHNHSENSLVANALNDEQRAAKNS
FT                   ERDKFRHPAQTLAFFGLKPNMSVVEISPGGGWYSEILAPVLKDNGKFYAAHFPKDATGF
FT                   YQRSRSEFEQKVTQDPRFSKVIVTEFAPVTHTELAPANSADMVLTFRNVHNWYMGKNKD
FT                   GALSAFKSFYTALKPGGTLGVVEHRLPEARADDDQKSSGYMKQSYVIEIAKQAGFELVA
FT                   SSEINANPKDTADHPKGVWTLPPSLRLGEQDADKYKAIGESDRMTLKFKKPL"
FT   gene            complement(357249..358835)
FT                   /gene="purH"
FT                   /locus_tag="PSHAa0345"
FT   CDS_pept        complement(357249..358835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="PSHAa0345"
FT                   /product="bifunctional purine biosynthesis protein
FT                   purH[Includes:IMP cyclohydrolase (Inosinicase) (IMP
FT                   synthetase) (ATIC);Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase (AICAR transformylase) ]"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85443"
FT                   /db_xref="GOA:Q3IIC3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIC3"
FT                   /protein_id="CAI85443.1"
FT                   /translation="MDTHRPIRRALLSVSDKTGIVEFARALEAQGVDILSTGGTCKLLA
FT                   DNGIKVTEVSDHTGHPEIMDGRVKTLHPKIHGGILARRGQDESVMAENNISAIDIVVVN
FT                   LYPFANTVAQENCSLEDAIENIDIGGPTMVRAAAKNHKDVTIVVNASDYDRVISEMQSN
FT                   KGSTTYKTRFDLAIAAYEHTAQYDGMIANYFGKMVPDYTEEAAEDTKFPRTINMQFTKK
FT                   QDMRYGENSHQDAAFYVENDIVEASVATATQLQGKALSFNNIADTDAALECVKEFDVPA
FT                   CVIVKHANPCGVSIGSNILEAYERAFKTDPTSAFGGIIAFNQELDAATAEAIVERQFVE
FT                   VIIAPSVSDAAAKIVSAKQNVRLLVCGQWTDKAAGQDIKRVNGGILVQDRDLGMVTQGD
FT                   LKVVSKRQPTEQELKDLLFCWKVAKFVKSNAIVYARDGMTIGVGAGQMSRVYSAKIAGI
FT                   KAADENLEVKGSVMASDAFFPFRDGIDAAAAAGITAVIQPGGSMRDAEVIAAADEAGMA
FT                   MVLTGMRHFRH"
FT   gene            complement(359309..359599)
FT                   /gene="fis"
FT                   /locus_tag="PSHAa0346"
FT   CDS_pept        complement(359309..359599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="PSHAa0346"
FT                   /product="DNA-binding protein for site-specific
FT                   recombination and inversion, transcription of rRNA and tRNA
FT                   operons, and DNA replication"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2835774, 2837762, 1459953; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85444"
FT                   /db_xref="GOA:Q3IIC2"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC2"
FT                   /protein_id="CAI85444.1"
FT                   /translation="MFEQNVTSPFITNPHVQAHEKPQPLRDAVKKAVHHYLKQLNGQDV
FT                   QDVYDLVLSELEAPLLEEVMTYTRGNQTRAAILLGINRGTLRKKLKKYGMN"
FT   gene            complement(359619..360599)
FT                   /gene="dusB"
FT                   /locus_tag="PSHAa0347"
FT   CDS_pept        complement(359619..360599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="PSHAa0347"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85445"
FT                   /db_xref="GOA:Q3IIC1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC1"
FT                   /protein_id="CAI85445.1"
FT                   /translation="MNIVRIGKYQLENNVIVAPMAGVTDRPFRQLCRRLGAGLAVSEML
FT                   SSNPDVWKTEKSMNRMDHSGESGIRAVQIAGADPELMAQAAQFNVANGAQIIDINMGCP
FT                   AKKVNKKLAGSALLQFPELVEEIIDAVVNAVDIPVTLKIRTGWDLDNRNGVEIARIAER
FT                   YGIASLAVHGRTRACMYKGEAEYATIRDIKRSVSIPVVANGDITSPEKAKQVLDYTGAD
FT                   AIMIGRAAQGRPWIFREIDHYLRTGEHLQPPAIAEVRSILMEHLTNLHTFYGEPMGARI
FT                   ARKHVSWYLQTHDRDGQFRRVFNTIDNPLTQVDVLEQYFKTLAAN"
FT   gene            complement(360871..361752)
FT                   /gene="prmA"
FT                   /locus_tag="PSHAa0348"
FT   CDS_pept        complement(360871..361752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="PSHAa0348"
FT                   /product="methylation of 50S ribosomal subunit protein L11
FT                   (ribosomal protein L11 methyltransferase)"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8226664; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85446"
FT                   /db_xref="GOA:Q3IIC0"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIC0"
FT                   /protein_id="CAI85446.1"
FT                   /translation="MAWIQIRINANADNADLISDLLVEAGSASVTFIDAKDTPIYEPKI
FT                   GTVQFWADTTVIGLFDANHDMDSVVALLNADKSVAQNLTYKIEQLEDKDWEREWMDNFH
FT                   PIQFGKRLWICPSWRDIPDPDAVNVLLDPGLAFGTGTHATTALCLKWLESQDLTGKTVV
FT                   DFGCGSGILGIAAIKLGAERMIGIDIDPQALEASLDNANRNGVADKLEVYLPENQPEFS
FT                   ADIVVANILAQPLRELHSVILGLLKPGGKIAMSGILTEQAQSVADVYAPFIELDDIAIE
FT                   GDWTRVSGTKKA"
FT   gene            complement(361834..363681)
FT                   /gene="rpoD"
FT                   /locus_tag="PSHAa0349"
FT   CDS_pept        complement(361834..363681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="PSHAa0349"
FT                   /product="RNA polymerase sigma factor rpoD (Sigma-70)"
FT                   /function="3.2.1.2.1 : Sigma factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6269063, 8858155; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85447"
FT                   /db_xref="GOA:Q3IIB9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB9"
FT                   /protein_id="CAI85447.1"
FT                   /translation="MDPTPQSQLKLLILKGKEQGYLTFAEVNDHLPQDIIDSDQVEDII
FT                   SMINDMGIKVSENAPDADELMMQETTTDEDAAEAAAAALATVEKEIGRTTDPVRMYMRE
FT                   MGTVELLTREGEIVIAKRIEEGINQVQISVAEYPEAITYLLEQWDKFEAEEMRLSDIIV
FT                   GFIDPNEDTAPISATNIGSELSAKQLNDDDKDDDDSDEDDEDEEEVDTGPDPEEARVHF
FT                   ENLRDLYNKARETFEAKGRSHPDSLAAIFEIGELFKTFKLIPKQFDRMVNNMREMMDRV
FT                   RVQERLIMKQAVQIAKLPKKTFVKHFANNETDATWVDLEIAANEKYSAKLEEVKPEIIR
FT                   SLNKLRVIESSTGLNIERIKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRG
FT                   LQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMI
FT                   ETINKLNRISRQMLQEMGREPNPEELAERMMMPEDKVRKVLKIAKEPISMETPIGDDED
FT                   SHLGDFIEDTTIDSPIDSATMESLRGATNDVLAGLTAREAKVLRMRFGIDMNTDHTLEE
FT                   VGKQFDVTRERIRQIEAKALRKLRHPSRSDLLKSFLDAK"
FT   gene            complement(363807..365558)
FT                   /gene="dnaG"
FT                   /locus_tag="PSHAa0350"
FT   CDS_pept        complement(363807..365558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="PSHAa0350"
FT                   /product="DNA primase"
FT                   /function="3.1.1 : DNA replication"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 6186393; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85448"
FT                   /db_xref="GOA:Q3IIB8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB8"
FT                   /protein_id="CAI85448.1"
FT                   /translation="MAGKIPRNFIDDLLARTDIVDLIDSKVGLKKAGKDYQACCPFHNE
FT                   KSPSFTVSQDKQFYHCFGCGVNGNAISFVMEYEKLEFVDAIEELASLLNLEVPREQGSG
FT                   SAPERTAAQKRSDYDLMLHTARFYQHQLKHHSNSAAVIEYVKGRGLSGEIVKKFMIGYA
FT                   PSEWDGLCLQLGRNKEQKEQLVELKLASEKTPGRQFDFFRDRLMFPIRDKRGRVVAFGG
FT                   RVMQADQGPKYLNSPETRIFHKGFELYGLYEAKQAHKKLDHVLIVEGYMDVVALAEQGI
FT                   EYAVAALGTATTSEHMHTLFRTTDKVICCYDGDRAGRDAAWRALENALPYLNDGKALNF
FT                   VFLPDGEDPDSLVQAEGKDKFEQRLNAADDFTKVLFNKLSLEIDLTLDSGKAKLLSAAL
FT                   PLIEKIPSEFYQENILEQLGRLIGRTREQLNNRLKTPKQQHSIERKFKITPMRQAIGIL
FT                   IQHPQMAKSVPYLPDLAQMNIAGIGLLLRLQHQALQKEDVTTAQLLEFFRGTDDYDPLT
FT                   KLATWQHQINEERLETVFQNTFKFIEDQCLNYRLETLLIKDKTQGLNSDERLECHLLMT
FT                   ALKATNS"
FT   gene            complement(365785..366189)
FT                   /locus_tag="PSHAa0351"
FT   CDS_pept        complement(365785..366189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0351"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85449"
FT                   /db_xref="GOA:Q3IIB7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB7"
FT                   /protein_id="CAI85449.1"
FT                   /translation="MRAKDKLRLNPIRMVLAEVMKREKDEQITLDDAGITSVIVKLVKQ
FT                   RRDSYTQYKDAGRDDLADIEANEIVALETFLPQKLSEEEIIALIDAAIADTNAAGMQDM
FT                   GKVMGIIKSKAEGRADMGKISGLIKQRLTA"
FT   gene            complement(366251..366466)
FT                   /gene="rpsU"
FT                   /locus_tag="PSHAa0352"
FT   CDS_pept        complement(366251..366466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="PSHAa0352"
FT                   /product="30S ribosomal subunit protein S21"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6186393; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85450"
FT                   /db_xref="GOA:Q3IIB6"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIB6"
FT                   /protein_id="CAI85450.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTAER
FT                   KRKKAAAVKRHMKKLSRDNARRVKLY"
FT   gene            complement(366612..367217)
FT                   /locus_tag="PSHAa0353"
FT   CDS_pept        complement(366612..367217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0353"
FT                   /product="putative enzyme with N-6 Adenine-specific DNA
FT                   methylase domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85451"
FT                   /db_xref="GOA:Q3IIB5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB5"
FT                   /protein_id="CAI85451.1"
FT                   /translation="MRKKTTQNKVTSKSSDGFIRVISGQFRGRKLPVKDVQGLRPTTDR
FT                   IKETVFNWLMQDTREANVLDCFAGSGGLGFEALSRFAKSATFVELDAAAAKQIELNIST
FT                   LKLQNAHVKHTNTLAFLEQINSNEPFNLVFVDPPFRKNLAQSSADLLENNQWLSSDALI
FT                   YIEVESELSTFTAPINWLLIKEKKAGQVFCRLYQRQVN"
FT   gene            367425..369380
FT                   /gene="ftsY"
FT                   /locus_tag="PSHAa0354"
FT   CDS_pept        367425..369380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PSHAa0354"
FT                   /product="Cell division transporter substrate-binding
FT                   protein FtsY"
FT                   /function="1.7.2 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556, 2161989, 8194520, 15148364"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85452"
FT                   /db_xref="GOA:Q3IIB4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB4"
FT                   /protein_id="CAI85452.1"
FT                   /translation="MAKKSKLLSWLGFGKSDKKQQAEQSAQEADNQQQARLAAEKAEAE
FT                   HLEQQRLAAEKAEQEAAEKIAAEQAQREQAEKLAIEKANAELLAKQQADAHALQLEQQQ
FT                   RLAEQEAQMRLEQEKAAAEQAEAERLEQARIVAEQAEAENLEQRKLAAEQAQREQAEKL
FT                   AIEKANAELLAKQQADAHALQLEQQQRLAEQEAQIRLDQEKAAAEKAEAERLEQTRIAA
FT                   EQAEAERLEQTRIAAEQAEAERLEQARIAAEQAEAERAEAERAEAERAEAERLEQVRIA
FT                   AEQAEAEQLEQQRIADEQAEAERLEQQRIAAEQAEAEHLEQQRIADELASEAAQKVEKP
FT                   KKEGFFSRLKKGLLKTRVNIGSGFASIFSGKKIDDDLFEELETQLLTADLGVDTTMKLI
FT                   DRLTDAANRKQLKDGDALYELMKQEMAVMLKTAEQPLVIPADKKPFVILMVGVNGVGKT
FT                   TTIGKLAKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVIFD
FT                   AFQAAKARNVDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQ
FT                   NAISQVNLFNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGESIDDLRAFK
FT                   SDDFIDALFSQDEDDA"
FT   gene            369614..370291
FT                   /gene="ftsE"
FT                   /locus_tag="PSHAa0355"
FT   CDS_pept        369614..370291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PSHAa0355"
FT                   /product="cell division protein (ABC transporteur
FT                   superfamily, ATP_binding)"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556, 10048040; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85453"
FT                   /db_xref="GOA:Q3IIB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB3"
FT                   /protein_id="CAI85453.1"
FT                   /translation="MINFQQVSKTYPGGHRALEKVNFHIKPGELAFLTGHSGAGKSTLL
FT                   KLISLMERPSAGSVFINGIDLNKVNSRQIPYVRRDIGIIFQNHRLLERYTIFDNVALPL
FT                   IIEGTHHKQIAKRVHGALDKVGLIDKIKCHPSMLSGGEQQRVGIARAIVNSPPILLADE
FT                   PTGNLDPELSMEILRLFEEFNNHGTTVLIATHDLGLVARMKYRSLTLKDGRMIQDPLAE
FT                   GAL"
FT   gene            370288..371274
FT                   /gene="ftsX"
FT                   /locus_tag="PSHAa0356"
FT   CDS_pept        370288..371274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PSHAa0356"
FT                   /product="cell division protein"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85454"
FT                   /db_xref="GOA:Q3IIB2"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB2"
FT                   /protein_id="CAI85454.1"
FT                   /translation="MSLLFKSRQNSNDKQKKSVFAGGYFFIINIFRQGVHSLGEMWRTP
FT                   LASLMTIAVLGLSLTLPASLYLVVKNVQQVSSGFEEASEISLFVKESMNEQETQTLVKR
FT                   LALYPEVESVTFISKQQALQEFKQVSGFGQALSYLNSNPLPDVVLVIPTSRHRQPNAAK
FT                   VLLTKLESEREVDFGKLDIAWLERLNALLSLLKESVITIALLLLTSVTLIIGNTIRLSI
FT                   MDKKEEIQVMKLVGATNTFIHAPFLWTGIWYGVIGGLFAFICVALMMWWLSTAVSSVAS
FT                   VYQTSFSLIGLTLKEFGSLVLLATSLGFIGSYLSVNRYIKEIEPDKV"
FT   gene            371499..372362
FT                   /gene="rpoH"
FT                   /locus_tag="PSHAa0357"
FT   CDS_pept        371499..372362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="PSHAa0357"
FT                   /product="RNA polymerase sigma-32 factor (Heat shock
FT                   regulatory protein F33.4)"
FT                   /function="3.2.1.2.1 : Sigma factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2841288, 6387714; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85455"
FT                   /db_xref="GOA:Q3IIB1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB1"
FT                   /protein_id="CAI85455.1"
FT                   /translation="MSKDLYAMALTVGQQSASMDGYLQAVSTIPMLKVEQEQELATRLQ
FT                   EEGDLSAAKQLIMSHLRFVAHIAKGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRL
FT                   VSFAVHWIKAEIHEFVLKNWRIVKVATTKAQRKLFFNLRKNKKRLGWFNQAEVSTVASE
FT                   LGVSEKEVREMESRMSGQDMGFDLTGDDDDSAPSSTYSPVQYLTDGTADLADDIEQQQW
FT                   QEQSHTRLFSALKTLDERSQDIVSARWLTDDKATLQELAEKYSVSAERVRQLEKTAMKK
FT                   LQAAMV"
FT   gene            complement(372508..373344)
FT                   /locus_tag="PSHAa0358"
FT   CDS_pept        complement(372508..373344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0358"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85456"
FT                   /db_xref="GOA:Q3IIB0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB0"
FT                   /protein_id="CAI85456.1"
FT                   /translation="MIKDILLHPVLISVVVLTIAFSLKVLVDKLARYRAEKKEKDTRYI
FT                   AHNIKHFINFTMVLLLLFIWSTEIQNFALSIAAFAVAIVLATREFIQCVIGFFYLVTTR
FT                   PFRIGDWVQVGEYYGEVAETNWIKTTLHEIDMRTYQFSRKTIFIPNNKLITSPIKNLNF
FT                   VKRFATHHFNIVRKDSFNPYPIYETLRNKAKHYCEEFEEVASRYNSIIERKLDAKISGP
FT                   EPEIHFGTTELGEFRASFTLFCPTDKALEIEHKLTECFMELWYSEATKSDVQSKIT"
FT   gene            complement(373436..374068)
FT                   /locus_tag="PSHAa0359"
FT   CDS_pept        complement(373436..374068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0359"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85457"
FT                   /db_xref="GOA:Q3IIA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA9"
FT                   /protein_id="CAI85457.1"
FT                   /translation="MFLLRSLIYLLCLAGVASLIQLEGFELQQNALYSEETLTEHMQDI
FT                   LTFLSAILFFYASRISPKLKVASVLLAALTAMMFVREFDTYLDMYVFDGAWQTIVYSIL
FT                   ACTFVYLIRKRGTIFSSIQAYTQTPSYGICLSGLVTLLAFSRIMGRGEFWHSIMGESYV
FT                   RIVKNIVEEGIETLGYTLILISAIELILLCRKQLNKQHHHVGNGVTD"
FT   gene            complement(374336..375697)
FT                   /gene="gor"
FT                   /locus_tag="PSHAa0360"
FT   CDS_pept        complement(374336..375697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="PSHAa0360"
FT                   /product="Glutathione reductase"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="1.8.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3521741; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85458"
FT                   /db_xref="GOA:Q3IIA8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA8"
FT                   /protein_id="CAI85458.1"
FT                   /translation="MAQHFDYIAIGGGSGGIASANRAAMRGAKVALIEAKHMGGTCVNV
FT                   GCVPKKVMWHGAQVAEAINLYAPDYGFNVEVKGFDWGKLVESREAYIGRIHKGYDNGLA
FT                   NNGVTVIKGFAKFVDNKTVEVDGEHYTADHILIAVGGRPSIPNIEGAEHGIDSNGFFEL
FT                   KEQPKRVAVIGAGYIAVELAGVLHSLGTDTHLFVRKHAPLRNFDPYIIDTLVEVMAKEG
FT                   PTLHTESVPHKLVKEDDGSVTLHLDNGKSHNVDQVIWAIGREPTTNAINIAAAGVEVNS
FT                   KGFVKVDEYQNTTAKNVYAVGDIIENGIELTPVAVKAGRTLSERLFNKELPDDLKMDYS
FT                   LVPTVVFSHPPIGTIGLTEQEAISQYGAENVKVYQSAFAAMYTAVTQHRQPCKMKLVCA
FT                   GPDEKVVGLHGIGFAVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR"
FT   gene            375903..377954
FT                   /gene="prlC"
FT                   /locus_tag="PSHAa0361"
FT   CDS_pept        375903..377954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PSHAa0361"
FT                   /product="oligopeptidase A"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.24.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1325967, 8366062, 1537805; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85459"
FT                   /db_xref="GOA:Q3IIA7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR034005"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA7"
FT                   /protein_id="CAI85459.1"
FT                   /translation="MTNANTNPLIGLEGLPPFSKIKPEHVVPALKHGIEQCRQAIEDVL
FT                   AKKSYTWNDLVLPLEEADDKLSRMFSPVSHLNSVMNNDELREQYEQCLPLISEYSTFVG
FT                   QHQGLFAAYNALYNSDEFKTLTTAQQKSITNALRDFKLSGIALEPAQQKRYGEISARLS
FT                   ELASKFGNNVMDATLAWHKHITDESELAGLPESALALAADTAKSKELDGWVFTLDFPSY
FT                   LPIMTYADNRELREETYTAFSTRASDQGPNAGEFDNSAIMSEELALRHELAQLLGFNSY
FT                   AEKSLATKMAETPAQVFSFLEDLAAKSKPQAEQELAELQAYAEQKHGITELAAWDFGYY
FT                   GEKLKQDKYAISDEVLRPYFPANKVLSGLFETVNRLFGISVKEVSDFDSYHKDVRFFEI
FT                   YDSSNTLRGRFYLDLYARDHKRGGAWMDDCMGRKVRASGELQTPVAYLVCNFNKAIGDK
FT                   PALFTHNEVTTLFHEFGHGIHHMLTQVDAAPVAGINGVAWDAVELPSQFLENWCYEEQA
FT                   LSFISGHYETGEPLPKELLDKLLAAKNYNSGMQMLRQLEFSLFDFKIHNDYVAGEPCNI
FT                   QAVLNDVRSRTSVIKAPEFNRFQHGFSHIFAGGYSAGYYSYKWAEVLSADAYSKFEEEG
FT                   IFNPETGRAFMQHILEKGGSEEPMELFKNFRGREPNVDALLRHSGIAA"
FT   gene            378159..378917
FT                   /locus_tag="PSHAa0362"
FT   CDS_pept        378159..378917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0362"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85460"
FT                   /db_xref="GOA:Q3IIA6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIA6"
FT                   /protein_id="CAI85460.1"
FT                   /translation="MVIKCAFKECRPYLNELETRFGLAHWADQSSGFSLHYDDTGLSLY
FT                   KTDEPKLGAISVDFVTGAAAHRRKFGGGKGQAIAKAVGLNKGATPIVLDATAGLGRDGF
FT                   VLASLGCKVILHERHPVVAALLYDGLQRAYNDIEIGPWMQQNMSLIFGSSHTLLAQCES
FT                   MPDVVYLDPMFPHREKSALVKKEMRVFQDLVGADTDADDLLEFAYPLASKRVVVKRPDY
FT                   APFLNDKTPSMQIKTKKNRFDVYVKAAMKK"
FT   gene            complement(379115..379855)
FT                   /locus_tag="PSHAa0363"
FT   CDS_pept        complement(379115..379855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0363"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85461"
FT                   /db_xref="GOA:Q3IIA5"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA5"
FT                   /protein_id="CAI85461.1"
FT                   /translation="MKVIIGLILMLGFASLNAKAKQIAIVIDDIGYHQRDLELLTLPGQ
FT                   VSYSILPHTPYAQAFATLASKTNKELLLHIPMQALNGKELGPGALTLNMNKEQIQQILG
FT                   TALASLPQVKGVNNHMGSALTQQSQAMRWIMEVLKKRHLYFLDSRTTELSQAQNAANFL
FT                   GVENIGRHIFLDNITTPEQLQLRLDELKQHATEHKFAIAIAHPYPETIAFLRHVLPQLS
FT                   KQGFELVPVSKLVERKYIQLAEKY"
FT   gene            complement(379928..381193)
FT                   /locus_tag="PSHAa0364"
FT   CDS_pept        complement(379928..381193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0364"
FT                   /product="putative carboxyl-terminal protease"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.102"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85462"
FT                   /db_xref="GOA:Q3IIA4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA4"
FT                   /protein_id="CAI85462.1"
FT                   /translation="MDKKSTVAKWFKNTGFTLNLSLYLLALFVFISFSANVFSSSIKEL
FT                   KSQQITEILFNIHTYYVEDLALQNTTHTSYNNQQFAHLYAQLDPYSKYLDEHELNALFD
FT                   NTNGRYTGLGIEVKQINNNVTIVNVVNNSPAKSAGVMAGDIIINVNNQTTQHSSVEHVA
FT                   QLITASKLSNISLTIKRDNQPQPLNFNVSRRKIKLESVTSQRLDLGCGYLAINSFSNHT
FT                   LHEVALQIAAMQNHFGDPLKGLVIDLRDNPGGTLRSAVAVSDLFLQNGTIVTTKGRYNE
FT                   ANKAFYAKHGDILKGAPIVVLINENSASAAEILAAALKDNNRAKVVGSQSFGKGSVQSL
FT                   IPLGDGSTALKLTTAKYFTPLGKSIEGVGITPDVAINQTTLSQSDKAVIIKNQQAKSKQ
FT                   TQLASKVTDLQLAKAKQLLNLQ"
FT   gene            complement(381262..382404)
FT                   /locus_tag="PSHAa0365"
FT   CDS_pept        complement(381262..382404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0365"
FT                   /product="conserved protein of unknown function ; putative
FT                   protease"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12113939"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85463"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE5"
FT                   /protein_id="CAI85463.1"
FT                   /translation="MQKCINSVTKLILILTFLATATAVANEDRTKKDLSEVQTALKQSQ
FT                   SEYNAQRKKVATLQKNLQQHELDIAKNAKALNMAEQSIKKTEQQQQLQQQKADQLEQQH
FT                   AQFQHALAAQLKSAYMAGGDDDYAKMLLNQEDTAKFERTLSYYNYLNKARIEQLEELKA
FT                   LQLQIAQNQAELAKTKQKLVNLHDEQKRRQTALVNAQSERQANLKNLQAQLNSTKSSIN
FT                   YLKENQQTLITTIEELEKEKNKKVELLGLNNSKGKLNWPSRGKLEHTFGQRKHGGIDWK
FT                   GVLIGAKEGSNINSVHNGQVVFADWLKGYGWVIVVDHGEGFMSLYGHAQTLLKDVGDMV
FT                   REGETVALVGQSGGQASSGLYFEMRHKGRAVNPEKWCKRI"
FT   gene            complement(382408..383952)
FT                   /gene="gpmM"
FT                   /locus_tag="PSHAa0366"
FT   CDS_pept        complement(382408..383952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmM"
FT                   /locus_tag="PSHAa0366"
FT                   /product="phosphoglycerate mutase III,
FT                   cofactor-independent"
FT                   /function="2.1.1.1 : Glycolysis/gluconeogenesis"
FT                   /EC_number="5.4.2.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85464"
FT                   /db_xref="GOA:Q3IIE4"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE4"
FT                   /protein_id="CAI85464.1"
FT                   /translation="MSEHKKPLVLMILDGWGYREDEQSNAILAANTPVLDELWATRPRT
FT                   LISASGFDVGLPDGQMGNSEVGHVNLGAGRVVYQDFTRITKAINDGEFDSTPALVDNID
FT                   KAVSADKAVHIMGLLSPGGVHSHEDHIVASIELAAKRGAKEVYFHGFLDGRDTPPRSAK
FT                   ASIERIEAVFAKLQCGRLASLIGRYYAMDRDNRWNRVEKAYNLLTLAQGDFSYPTGVSA
FT                   LEAAYERDENDEFVAASTITPAGAEPVQINDGDTVIFANFRADRAREITRAFVEPNFDG
FT                   FAKQKSPALSAFVMMTEYAADIDAPVAFGPTPLVNVLGEWFEKHGKTQLRISETEKYAH
FT                   VTFFFSGGREDEFNGETRELIPSPQVATYDLQPEMNSEMLTDKLVAAIKSGKYDAIICN
FT                   YPNGDMVGHSGVFAAAVKACEAVDHCIGRVVAALNKYGGEALITADHGNAEQMANLKTG
FT                   QAHTAHTSEPVPFIYVGRDATASEGKALSDVAPTMLHLMGMEQPTEMTGKPIMTLK"
FT   gene            384581..385012
FT                   /locus_tag="PSHAa0367"
FT   CDS_pept        384581..385012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0367"
FT                   /product="conserved protein of unknown function ; putative
FT                   rhodanese sulfur transferase domain"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="2.8.1.1"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85465"
FT                   /db_xref="GOA:Q3IIE3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE3"
FT                   /protein_id="CAI85465.1"
FT                   /translation="MDQYIEFITNHPILSAAWVGIVFLIVSGWIKSKLSAVRQINPQQL
FT                   TLLINREDGQVIDMRAQKEFNTGHIAGAQHLSPENAKKSDFSNLEKYKSKPIILVCTTG
FT                   MTASGTATAMHKAGFEQVSVLSGGMGAWQSASLPTTTGR"
FT   gene            385042..385311
FT                   /locus_tag="PSHAa0368"
FT   CDS_pept        385042..385311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0368"
FT                   /product="glutaredoxin 3 GrxC"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="3.3.8 : Protein repair"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11741965; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85466"
FT                   /db_xref="GOA:Q3IIE2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE2"
FT                   /protein_id="CAI85466.1"
FT                   /translation="MSNVVLYTKAYCPFCQRARALLDSKGVQYTNFDIGVQPELRDEMI
FT                   AKAGGASTVPQIFINDEHIGGCDDMMAIEAQGQLDKKLNATLNA"
FT   gene            385351..385839
FT                   /gene="secB"
FT                   /locus_tag="PSHAa0369"
FT   CDS_pept        385351..385839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="PSHAa0369"
FT                   /product="molecular chaperone in protein export, enhances
FT                   activity of SecA (General Secretory Pathway)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12427258, 14517549, 15010547; Product type mc : molecular
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85467"
FT                   /db_xref="GOA:Q3IIE1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE1"
FT                   /protein_id="CAI85467.1"
FT                   /translation="MNEETQNAAAQQETGAQFTIQRIYTKDVSFETPNSPAIFQKEWTP
FT                   EVKLDLDTRSNKLDEGVFEVVLALTVTASIGEETAFLCEIQQAGIFTIADVEETQLAHM
FT                   LGAFCPNVLFPYAREAVSNLVNRGTFPQLNLAPVNFDALFAQYMQQRTAQAEQASVDA"
FT   gene            385843..386850
FT                   /gene="gpsA"
FT                   /locus_tag="PSHAa0370"
FT   CDS_pept        385843..386850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="PSHAa0370"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="1.1.1.94"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9426138; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85468"
FT                   /db_xref="GOA:Q3IIE0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE0"
FT                   /protein_id="CAI85468.1"
FT                   /translation="MSTATSAVTVLGAGSYGTALAICLARNGHQVTLWGRNSDDVATLA
FT                   AERKNQRYLPDIPFPDTLTLEADLQRAAASNEIVLVVVPSHAFGDTLKQIKPALQQGAK
FT                   VAWATKGLEPNTGRLLQEVAVQELGDAIPLAVLSGPTFAKEMAMGSPTAISVSSTSTEF
FT                   AQQLADLLHCGRSFRVYNNDDFIGIQLGGAVKNVIAIGAGISDGVGFGANARTALITRG
FT                   LAELTRLGCALGAKPETFMGMAGLGDLILTCTDNQSRNRRFGLALGKGESVEAAIESIG
FT                   QVVEGFRNTKEVYLLAQRSGVEMPITEQIYKVLYENKDMKEAAMALLGREQRSE"
FT   gene            complement(387032..387496)
FT                   /locus_tag="PSHAa0371"
FT   CDS_pept        complement(387032..387496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0371"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85469"
FT                   /db_xref="GOA:Q3IID9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID9"
FT                   /protein_id="CAI85469.1"
FT                   /translation="MLDIVLYQPEIPPNTGNIIRLCANTGYSLHLIEPLGFAWDDKRIK
FT                   RAGLDYHEFSHVQRHASFEAYLEACKPKKIYACTTKGSQFHHQAQYEAGDCLVFGPETR
FT                   GLPDELIQSLPNEQRVRIPMQANSRSMNLSNAVSVFVYESWRQLGFPGAK"
FT   gene            387676..388524
FT                   /locus_tag="PSHAa0372"
FT   CDS_pept        387676..388524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0372"
FT                   /product="putative transport protein"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85470"
FT                   /db_xref="GOA:Q3IID8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID8"
FT                   /protein_id="CAI85470.1"
FT                   /translation="MIAAKTWAWLASGSASMLGSLTDSLMDITATAMSFLVLGYALRPA
FT                   DDDHRFGHGKAEALAGLGQAAFIAGSGCLLAFHSIERLFNPLELTHSLLGVWVSIFAIA
FT                   CTLVIVFVQNKVVKHTESIAIKADSVHYKGDLILNAAVLLAILLSYYGVLYADPIFAVG
FT                   VAGYLLYNSWDIARDSADHLMDKELPDEEKQRILDVSKSHIDVRGVHGVRTRQGGKVKF
FT                   IQLHLELDDHLSLIRAHNVADEVEAMITKEFESEVDILIHLDPLSSVELSDTEGAAVTE
FT                   A"
FT   gene            complement(389162..390094)
FT                   /locus_tag="PSHAa0373"
FT   CDS_pept        complement(389162..390094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0373"
FT                   /product="putative lysophospholipase L(2)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /EC_number="3.1.1.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 3908445; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85471"
FT                   /db_xref="GOA:Q3IID7"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID7"
FT                   /protein_id="CAI85471.1"
FT                   /translation="MFYSSENELVNNQPSINDFYNNTLVKAYLNTPAGQLFYAYAKPEH
FT                   AHTAIVISSGRIEGLDKYKELLWELYTNNFAVFIVDHQGQGRSYRQLANKHKGYVKCFT
FT                   DYRHDLHLFNQQIVDNHWQGKKILLGHSMGGAIAFDYLAHFENNFSGLFLSAPMFDIHT
FT                   KNTPKPLAKLIANAAVFFGFSQSYALGQNDYNPEEFALNSLTSSQVRYKNFRQTYQDPL
FT                   LQLGGVTYGWLQAAFTFIASVDKLSINIPLFIASAERDEVVDNAAQYKLANRHNQAIIK
FT                   SFAGAKHELLFERDEIRQPLLTSLYQFCE"
FT   gene            complement(390098..391489)
FT                   /locus_tag="PSHAa0374"
FT   CDS_pept        complement(390098..391489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0374"
FT                   /product="putative sensor histidine kinase protein"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="3.3.6 : Protein modifications"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 3058985; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85472"
FT                   /db_xref="GOA:Q3IID6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID6"
FT                   /protein_id="CAI85472.1"
FT                   /translation="MASFSWLKHPRHYLFFKIFTWFWLTIIGTGAALIFLSSVTTINSV
FT                   SYNPLHGPMEKNLAYTAKNIERSTIKHKRSLNDTLKHPRRTNGKLLYLNAEQLEDSLTN
FT                   KSIPADVDLSLLNFTKSMPPQVIYTEKYQAIGPIKIRVPEGDFYLYEIDIYNHTPLYLR
FT                   LKLMPGWIKISIAIIASLILSFLFSRNLIAPINSLKKAAIKLSAGDLTARAAISVNRKD
FT                   ELGILGRDFNRMADQLAQLISAQKRLLADISHELRSPLTRLKMATGLAQMQANEASQSY
FT                   LLRIEKEANQLDKMIADVLQVSRLEANSQALSLHKQSLQDIVDHVLNDATFEAKQHNKQ
FT                   LQVSGSAAVTLNCDEALIASALENLLRNAIKYAQHTISLTLKHGDAIYIEICDDGPGVP
FT                   NNQLSKLCEPFFRQSDARDRVSGGTGLGLAIAKNAIIAHGGSLVLSNKPQGGLCAMVTL
FT                   PIIKE"
FT   gene            complement(391491..392180)
FT                   /gene="cpxR"
FT                   /locus_tag="PSHAa0375"
FT   CDS_pept        complement(391491..392180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="PSHAa0375"
FT                   /product="Transcriptional regulatory protein CpxR"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8294007; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85473"
FT                   /db_xref="GOA:Q3IID5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID5"
FT                   /protein_id="CAI85473.1"
FT                   /translation="MKLLMIDDDTGLCELLSEYLTAQGFNVQSVHDGEQGLKLAQANDY
FT                   ALILLDVMLPTLDGFEVLKQLRQTKLTPVIMLTAKGEDFDRIFGLELGADDYIPKPFNH
FT                   RELLARVKAITRRIEHITTMNTTSSNKLVVNGVTINLAAREALIKQTTLTLTGTEYEIL
FT                   ALLAKRAGEVVSKEQISEDVLGRRLASFDRSIDMHVSNIRKKIAEHLPNELIKTIRGTG
FT                   YVFIQGE"
FT   gene            392345..392830
FT                   /locus_tag="PSHAa0376"
FT   CDS_pept        392345..392830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0376"
FT                   /product="conserved protein of unknown function ; putative
FT                   CpxP (P pilus assembly/Cpx signaling pathway, periplasmic
FT                   inhibitor/zinc-resistance associated) domain"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85474"
FT                   /db_xref="GOA:Q3IID4"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID4"
FT                   /protein_id="CAI85474.1"
FT                   /translation="MTKVNTLSKLVLICGLATATFGATSVMAKGDMHKQGRHSQAHFLL
FT                   SERGADKLDLTQEQQTKLEAIFAAQKTQMQALKGTDKESRKAQRTAHKAKMESLLSAAT
FT                   FDENAAKELLAQRHEKGEEMGLIKLKTQHQVWQVLNAEQQEKFAKMQKRMGKKKHSK"
FT   gene            complement(392989..393219)
FT                   /locus_tag="PSHAa0377"
FT   CDS_pept        complement(392989..393219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0377"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85475"
FT                   /db_xref="GOA:Q3IID3"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IID3"
FT                   /protein_id="CAI85475.1"
FT                   /translation="MPTIVNCPTCKSKVEWSEQSPHRPFCSKRCQLIDLGEWSFENNRI
FT                   SAPITSAEDFSQDMIEDIEAMMAKNEDDFFK"
FT   gene            complement(393375..395048)
FT                   /gene="pilB"
FT                   /locus_tag="PSHAa0378"
FT   CDS_pept        complement(393375..395048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="PSHAa0378"
FT                   /product="type IV pilus biogenesis protein PilB"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85476"
FT                   /db_xref="GOA:Q3IID2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID2"
FT                   /protein_id="CAI85476.1"
FT                   /translation="MNINSPLLRKFITLGRVDADIVKTKQQEFASTAELIAKCGKIDSK
FT                   DLAAQCIDLFRVPFFDLKDFNTALISPELIKEKLIRKHHILPLVQKGRKVYIAASDPTD
FT                   YGAFENFEFSTGLSCEVVVVDYIQLDKKIEQLLDATGSLNLSDDEFKEFAELDADIQKD
FT                   TTKDDDKDDAPIIVYINKILMDAIKKGASDLHFEPYEHKYRIRFRIDGILHEVASPPNS
FT                   LATKLSARIKVMSRLDIAEKRKPQDGRIKLKITERKSVDFRVSTMPTLWGEKIVMRILD
FT                   SSSAMLGIDVLGYEPEQKKLYMDALEQPQGMILVTGPTGSGKTVSLYTGLNILNQPERN
FT                   ISTAEDPVEINLEGVNQVQINIKADMTFANALRAFLRQDPDVVMVGEIRDLETAEISIK
FT                   AAQTGHLVLSTLHTNSAPETITRLLNMGVPAYNVASSISLIIAQRLARRLCPKCKTPEN
FT                   LPSEELLRQGFSQQQISEMTLYAPKGCENCTDGYKGRVGIYEVMKITPEIAQIIMRGGN
FT                   SLEIAEVSLKAGFNNLRLSGIRKAADGMTSLAEINRVTSF"
FT   gene            complement(395169..395801)
FT                   /gene="coaE"
FT                   /locus_tag="PSHAa0379"
FT   CDS_pept        complement(395169..395801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="PSHAa0379"
FT                   /product="dephospho-CoA kinase"
FT                   /function="2.5.6 : Pantothenate and coenzyme A"
FT                   /EC_number="2.7.1.24"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11292795; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85477"
FT                   /db_xref="GOA:Q3IID1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IID1"
FT                   /protein_id="CAI85477.1"
FT                   /translation="MSEQAVKVTNINNWVLGLTGGIGCGKTAVSNMLEALGICVVDADI
FT                   IARQVVEPGSEGLKAIVTHFGADILLADGNLNRSALRELVFSNNEHKNWLNTLLHPLIR
FT                   QQIIIDLNNATSPYVVLVAPLLFENGLDKYCNRTLLIDVPKNVQIERTVKRDNISLEQV
FT                   NSIIAAQMSREQKQQQADDILNNDRSLTLVKHDLIALHKGYLKLALK"
FT   gene            complement(395803..396678)
FT                   /gene="pilD"
FT                   /locus_tag="PSHAa0380"
FT   CDS_pept        complement(395803..396678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="PSHAa0380"
FT                   /product="Type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /function="3.3.6 : Protein modifications"
FT                   /EC_number="3.4.23.43"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619, 9224881; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85478"
FT                   /db_xref="GOA:Q3IID0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID0"
FT                   /protein_id="CAI85478.1"
FT                   /translation="MQSQLWFYLTTIGLVSLCVGSFLNVVIYRLPLMMQHEWQGECRLL
FT                   LESELKGNKADESESLNSTFNLVKPNSTCPKCKTAIKAWQNIPVVSWLFLKGKCASCSN
FT                   PISARYPIVEAITALLSLVVAYKLGATEQALLYIAITWALVALTFIDIDHMLLPDQITL
FT                   PLVWLALIAAVLGYTVTPTDAIIGAACGYLSLWSVFWLFKLLTGKEGMGYGDFKLLAVF
FT                   GALLGWQSLLTIILLSSVVGAIIGIALLTIQGKDKATPIPFGPYLAIAGWITMLWGEQL
FT                   QTSYFNLIGY"
FT   gene            complement(396727..397953)
FT                   /gene="pilC"
FT                   /locus_tag="PSHAa0381"
FT   CDS_pept        complement(396727..397953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="PSHAa0381"
FT                   /product="type IV pilus biogenesis protein PilC"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85479"
FT                   /db_xref="GOA:Q3IIC9"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC9"
FT                   /protein_id="CAI85479.1"
FT                   /translation="MAKQQEKKGQDTFEWVGVSTRGKRLEGELTGSSVALVKAQLRKQG
FT                   ITPSKVKRKAKPLFGARLQKITPKDIAIVTRQIATMLMAGVPLIQSIEMIGTGATNKSL
FT                   GKLMETIADEVKAGQPLSQALRRHPRYFDDLYCDLVASGEQSGALDKIFDRVAIYKEKS
FT                   EALKSKIKKAMFYPIAVLVIALIVTSILLIFVVPQFQDIFAGFGAELPAFTLFVISISE
FT                   FMQAYWWIILIIMFAFGWAFKEAHLKSLKLRDATDRAILKLPVIGMILNKAAVARYART
FT                   LSTTFAAGVPLVDALDSAAGASGNAVYRYAILEIKAEVSSGNQMNWAMRNSKIFPDMVI
FT                   QMVAIGEESGSLDGMLGKVATIYEQEVDDAVDGLSSLLEPMIMAVLGVLVGGLIIAMYL
FT                   PIFQLGSVI"
FT   gene            398078..398689
FT                   /locus_tag="PSHAa0382"
FT   CDS_pept        398078..398689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0382"
FT                   /product="putative orphan protein ; putative membrane
FT                   protein, putative fimbrial assembly protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85480"
FT                   /db_xref="GOA:Q3IIC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC8"
FT                   /protein_id="CAI85480.1"
FT                   /translation="MLKQKFKQKLQWSIIHLLTGALVLTIAAMLIYLNWFYDGRYLLTD
FT                   LVGLAVIIFTLDLILGPVLSFWLLSPNKTKKENVINILLIVLLQVVSFSYGVVQIDSQR
FT                   LAYIIKWQSSYFAVSKSESRRDEITEHFYNFNEPKVGTVNRSQYDKLIKESISPVEMYE
FT                   FFEEVSFATECGLQCAVITKKGIVNVTKNSNSLVFNKSLR"
FT   gene            complement(398670..399065)
FT                   /locus_tag="PSHAa0383"
FT   CDS_pept        complement(398670..399065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0383"
FT                   /product="putative Pilus biogenesis protein tapA precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85481"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC7"
FT                   /protein_id="CAI85481.1"
FT                   /translation="MITIAIMGILISLALPAYNNHYKRAKFTEVVLATNALQRNIEICF
FT                   YIKESLNNCNTFSKLGSNKSDFLAPEFISDIEITNTALSIQIKSTASNKASISSAGDTY
FT                   IMLATINVNQLQWELLATSTCINEGTC"
FT   gene            complement(399118..399549)
FT                   /gene="ppdD"
FT                   /locus_tag="PSHAa0384"
FT   CDS_pept        complement(399118..399549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="PSHAa0384"
FT                   /product="putative prepilin peptidase dependent protein D"
FT                   /function="1.9 : Collective behaviour"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7959070, 10633126, 10811613; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85482"
FT                   /db_xref="GOA:Q3IIC6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC6"
FT                   /protein_id="CAI85482.1"
FT                   /translation="MKTMTQQNQKGFTLIELMIVIAIIGILAAIALPQYQTYTKKARFS
FT                   EVVLAASSAKGLIDVCFQTRGAGSLANCDTDKKIGLTAGVADGAHVASVVIKPTDAEIT
FT                   ATGESTVDGATYILTPTVSTNAGTLTWAQTGDCVEKGVC"
FT   gene            399865..400002
FT                   /locus_tag="PSHAa0385"
FT   CDS_pept        399865..400002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0385"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85483"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III4"
FT                   /protein_id="CAI85483.1"
FT                   /translation="MHSLILNQLISAFILMVHSFIVQQREFTIVFYFLVHGLYLKKYFI
FT                   "
FT   gene            complement(400100..400945)
FT                   /gene="nadC"
FT                   /locus_tag="PSHAa0386"
FT   CDS_pept        complement(400100..400945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="PSHAa0386"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8561507; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85484"
FT                   /db_xref="GOA:Q3III3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III3"
FT                   /protein_id="CAI85484.1"
FT                   /translation="MPIPHTLVSQLVTLALGEDLNYQSAENGDITAQLIPVNEQANAKV
FT                   ITREDCIFCGKDLIIEVFKQVDPSVVVNVLVNDGDAVKANSTLFTATGSARAILTAERT
FT                   ALNFVQTLSGTATTTAHYVKELAGTKTQLLDTRKTIPGLRILQKYAVKCGGGANHRIGL
FT                   YDAFLIKENHIAACGGINKAVAQAKQNQPNKPIEVEVESLVDLKQALDAGADIIMLDNF
FT                   NVEQIKQAVVVTNKRAKLEVSGNMTLQTLKTYSQAGVDFISSGALTKNLQSIDLSMRFD
FT                   "
FT   gene            complement(401320..401436)
FT                   /locus_tag="PSHAa0387"
FT   CDS_pept        complement(401320..401436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0387"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III2"
FT                   /protein_id="CAI85485.1"
FT                   /translation="MIDEAIKAYQPANLQAGVYLALFFNFNQRGIKPRLRVT"
FT   gene            401490..402044
FT                   /gene="ampD"
FT                   /locus_tag="PSHAa0388"
FT   CDS_pept        401490..402044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="PSHAa0388"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85486"
FT                   /db_xref="GOA:Q3III1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III1"
FT                   /protein_id="CAI85486.1"
FT                   /translation="MNIDLNGVVNCALQRGCSHFDERPSDTDVSLLVIHNISLPAGQFG
FT                   TPYVDDLFMGTLNCEAHSSFSDLHGVRVSAHCFIKRSGELVQYVPFTKRAWHAGASEFN
FT                   GQTNCNNFSIGIELEGTDTTAYTLAQYTSLKILSEAIMQRYPNITTERIVGHCDIAPGR
FT                   KTDPGSSFNWHLFLTMLKQSG"
FT   gene            402058..402909
FT                   /locus_tag="PSHAa0389"
FT   CDS_pept        402058..402909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0389"
FT                   /product="putative ampicillin resistance protein"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85487"
FT                   /db_xref="GOA:Q3III0"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III0"
FT                   /protein_id="CAI85487.1"
FT                   /translation="MILVSIIIALILERLGARSAHWQISYYADGYVNRSANLLTNKGVF
FT                   GSGVGFLVWLLLPVLAIGCLYLLSDFVLWQLIFNVTILLVCFGCAKQRALYKSYLNALT
FT                   RDDKTAATLYALQMGQNRTEEEQDGETVGQTLAWVNFRFYCAVIFWFVILGVAGAVLYA
FT                   LVRTFADLVTQDDDEIIAKHSKMLHRLLFWLDWLPARITSFGYLVIGNFNKGTSCWLRY
FT                   ALDFSSPNRKVVTYTALAAEQVEKRYYDCAYEATCMIKLVKRNVLFYLVLIALLTLFGG
FT                   LD"
FT   gene            403616..404365
FT                   /gene="pdhR"
FT                   /locus_tag="PSHAa0390"
FT   CDS_pept        403616..404365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="PSHAa0390"
FT                   /product="transcriptional repressor for pyruvate
FT                   dehydrogenase complex (GntR family)"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85488"
FT                   /db_xref="GOA:Q3IIH9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH9"
FT                   /protein_id="CAI85488.1"
FT                   /translation="MSLKIKAAKLSDVILQQLENMILEGSLAPGEKLPPERELAKQFEV
FT                   SRPSLREAIQKLEAKGLVTRRQGGGTYVKNQLEEGLTDPLFDLISKHPESQFDLLEFRH
FT                   ALEGIAAYYAALRGTNNDFIKVKQSFDQIALVQDDLQQKAKAINAFHFCIAEASHNIVL
FT                   LHLVRGMQALLEQNVLQNLTVLLTKSDISNQLGHHRGLLMDAVIEGKPEEARLASNAHL
FT                   AYIEEALLEAGKEHSRIERSLRRTKQN"
FT   gene            404449..407115
FT                   /gene="aceE"
FT                   /locus_tag="PSHAa0391"
FT   CDS_pept        404449..407115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="PSHAa0391"
FT                   /product="pyruvate dehydrogenase, decarboxylase subunit,
FT                   thiamin-binding"
FT                   /function="2.1.1.5 : Pyruvate dehydrogenase and
FT                   input/output into the TCA cycle"
FT                   /EC_number="1.2.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6343085; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85489"
FT                   /db_xref="GOA:Q3IIH8"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH8"
FT                   /protein_id="CAI85489.1"
FT                   /translation="MSEVNKIDVDALETQEWLQALESVVREEGVERAQFLLEQVLEQAR
FT                   LDGVDMPTGITTNYVNTIPVEQEPAYPGDVNIERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASYQSSAAFYEVCFNHFFKAPNDVDGGDLVYYQGHISPGIYARAFVEGRLSASQLD
FT                   NFRQEVGGEGLPSYPHPKLMPEFWQFPTVSMGLGPISSIYQARFLKYLDGRGLKDTKNQ
FT                   RVYAFLGDGEMDEPESRGAISFAAREKLDNLCYLVNCNLQRLDGPVMGNGKIIQELEGL
FT                   FKGAGWNVIKLVWGSGWDILLAKDKTGKLLQLMNETVDGDYQTYKAKNGAYVREHFFGR
FT                   YPETAALVADMTDDEIFALKRGGHEPSKLFAAFKKAEETKGRPTVILAKTVKGYGMGEA
FT                   AEGKNIAHQVKKMDMSHVAHLRSRLGLDDLISEEQLTELPYLTLEEGTPEHTYLHARRE
FT                   ELKGYTPKRIARFSEKLTVPEVEAFNPLLEEQKRDISTTMGFVRALNILLKDKGIGKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPHGQNYTPQDRDIVSYYKEATSGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHILASTVPNCISYDPTYAYEVAVIIQDGIRRMYGDDQENIYYYLTLM
FT                   NENYHQPAMPEGAEEGIRKGIYKLESYAGKKANVQLLSSGTIMTEVRKAAKVLSEDYGV
FT                   ASDVFSVTSFNELTRDGQDVERFNMLNPEGEQKTAYITSVLNDSVTVAATDYMKNYAEQ
FT                   ARSFIPSNNYKVLGTDGYGRSDSRENLRRHFEVNADYVVVATLSELAKRGEVEKSVVIE
FT                   ALKKFNIDTNKLNPLYA"
FT   gene            407126..409090
FT                   /gene="aceF"
FT                   /locus_tag="PSHAa0392"
FT   CDS_pept        407126..409090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="PSHAa0392"
FT                   /product="pyruvate dehydrogenase,
FT                   dihydrolipoyltransacetylase subunit"
FT                   /function="2.1.1.5 : Pyruvate dehydrogenase and
FT                   input/output into the TCA cycle"
FT                   /EC_number="2.3.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6345153; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85490"
FT                   /db_xref="GOA:Q3IIH7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH7"
FT                   /protein_id="CAI85490.1"
FT                   /translation="MSIEIKVPDIGGDEVEVTEILVAVGDVVEVDQALLTVEGDKASME
FT                   VPADTAGTVKEIKVSVGDNVATGSLVFIFEGESEGESADKSASADKSDSAAEQKTPATD
FT                   AKPAPAASGSTAQDVTLPDIGDDEVEVTEILVAVGDSVSEDQSILSVEGDKASMEVPAP
FT                   FAGTVKEIKVATGDTVKTGSLVFVFEVAGSESAAPAAESTPAETKAAPAAEQSSVSSTK
FT                   EVNVPDIGGDEVEVTEVLVAVGDSVTEDQSLLNVEGDKAAMELPAPFAGTVKEIKVATG
FT                   DKVSTGSLIFVFEVAGGAPAAAAKPEAEKSAPAAKSEKPAPKAETATQSAPAASNESFA
FT                   DNSAYAHASPVVRRLAREFGINLANVKGSGRKNRVVKDDVQNYVKNLVKQVESGQLSAD
FT                   KGNAGGSELGLIPWPKVDFAKFGEIEEKKLSRIQKLSGKNLHRNWVQIPHVTQFDEADI
FT                   TSLEEFRKEQNALNEKKKLGVKITPLVFVMKAAAKALAEFPTINSSLSNDGESLILKKY
FT                   INIGVAVDTPNGLVVPVFKDVDKKGIIELSRELMEVSAKARDGKLTSADMQGGCFTISS
FT                   LGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPKLMVPLSMSYDHRVIDGALA
FT                   ARFTVTLASYMSDIRQLVM"
FT   gene            409248..410675
FT                   /gene="lpd"
FT                   /locus_tag="PSHAa0393"
FT   CDS_pept        409248..410675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="PSHAa0393"
FT                   /product="dihydrolipoamide dehydrogenase,
FT                   FAD/NAD(P)-binding, component of the 2-oxoglutarate
FT                   dehydrogenase and the pyruvate dehydrogenase complexes"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.8.1.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6352260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85491"
FT                   /db_xref="GOA:Q3IIH6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH6"
FT                   /protein_id="CAI85491.1"
FT                   /translation="MSNELKTQVVVLGGGPGGYSAAFRAADLGLEVTLVESRDTLGGVC
FT                   LNVGCIPSKALLHVAKVIDDAAAMADHGVTFGAPQIDLDKIRSWKDSVIGQLTGGLTSM
FT                   SKMRKVKVVYGYGKFTGSNTIAVEGTDGTTTITFDNAIIAAGSKPVSLPFIPEDDRVID
FT                   STGALELKDIPEKLLVLGGGIIGLEMGTVYRALGSAIDVVEFADQLVPAADKDIVKIYQ
FT                   KYVSDKFNVMLSTKVTGIDAKDDGLYVTFEGKNAPAEPVRYDKVLVAVGRTPNGKLLDA
FT                   DKAGVNVDDRGFINVDKQLKTNVEHIFAVGDIVGQPMLAHKAVHEAHVAAEVISGQKHY
FT                   FDPKCIPSIAYTDPEMAWVGVTEKEAKEQGLSIETAVFPWAASGRAIASARTEGSTKLI
FT                   FDKESGRVIGGAMVGINAGEMLGEIGLAVEMGADGEDLALTIHAHPTLNESIGLAAEIY
FT                   EGSITDLPNKKAVKKKK"
FT   gene            411183..411779
FT                   /locus_tag="PSHAa0394"
FT   CDS_pept        411183..411779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0394"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85492"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH5"
FT                   /protein_id="CAI85492.1"
FT                   /translation="MTRCQQCLLAELYCICEGVVQADCDAAVCLLMYHNESFKPSNTGR
FT                   LIAEIVPENYAFRWDRTDPDAKLLALINDPQYQPMVVFPAEDVEPGRAVTEVNITAGKK
FT                   PLFIFLDGTWREAKKMIRKSPYLDNLPVLSITADKLSDYRLRVAPHAHQLGTAEVAIMV
FT                   LALAGEKDAATKLEQHFIKFRDAYLLGKRNKGRPE"
FT   gene            412176..413717
FT                   /locus_tag="PSHAa0395"
FT   CDS_pept        412176..413717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0395"
FT                   /product="putative aerotaxis sensory transducer"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12511500; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85493"
FT                   /db_xref="GOA:Q3IIH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH4"
FT                   /protein_id="CAI85493.1"
FT                   /translation="MSQQKQAIVDQEVTFGIDEELLSTTDLQGVITYANDNFCKVAGYT
FT                   LDELVGNNHSMVRHPDMPKAAFADLWSNLKNDIAWRGAIKNRCKNGQYYWVDAFVTPIY
FT                   ENGKKIGYQSVRRRLLPEYLNSAENLYKRINSGKSINTFTHKLSALKLPLYLCFSALFA
FT                   WLASYSLWFILLFIPLPFVIYYDQLVLSQRYLKKRKTESDSISRHVFSGSNIFSFADFQ
FT                   IKLLEGKVTTIVGRIIDGTLSLEKGANSLKAVAQKSKLGVEKEAAELHQVSSAVEQMVN
FT                   SIDEVAKSTVITTQKVNQAHSNCEAATQAMSQTMDKVSLLANEVDNSANSATELAKEAG
FT                   KIGDIMQEIQGIADQTNLLALNAAIEAARAGEHGRGFSVVADEVRALSSRTHSATEQIQ
FT                   TSIAEMQSTLLSWSKTMEVGKNAAEDCVKETRQTQEIVSQVHLSISDISDLTGQISTAA
FT                   EEQSMVSQEISRNIYNISETSSENLTQAQLVEVESDSIDKRSKMLASLGLSFKVD"
FT   gene            complement(414242..414317)
FT                   /locus_tag="PSHAatRNA103"
FT   tRNA            complement(414242..414317)
FT                   /locus_tag="PSHAatRNA103"
FT                   /product="tRNA-His"
FT   gene            414580..415398
FT                   /gene="mscS"
FT                   /locus_tag="PSHAa0396"
FT   CDS_pept        414580..415398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /locus_tag="PSHAa0396"
FT                   /product="putative mechanosensitive channel protein (MscS
FT                   family)"
FT                   /function="1.3.2 : Mechanosensors"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 14671322, 15063854, 12767977; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85494"
FT                   /db_xref="GOA:Q3IIH3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH3"
FT                   /protein_id="CAI85494.1"
FT                   /translation="MESVLNWLNENSGLILHYGIQAVIALVIFLLGGRIAKFCANLTEK
FT                   AFDKKKVDKAVGSFVSSIVFAIVFMATVLMALSQIGIETTSFIAILGAAGLAVGLALQG
FT                   SLSNFASGVLIILLRPFKSGDYVEAGNKAGTIKKIEIFSTELRTPDNKVIIMPNSKIMS
FT                   DAIVNYSRESTRRIDLVIRVDYDADLRKAKEVLKSILDSESRILKDPAYNVSVSELAES
FT                   SVNFIVRPWVESADYWPTYWSLLEEIKIIFDEQGINIPAPQMDVHLRKQD"
FT   gene            415431..416213
FT                   /locus_tag="PSHAa0397"
FT   CDS_pept        415431..416213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0397"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85495"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH2"
FT                   /protein_id="CAI85495.1"
FT                   /translation="MKLKLLSILVAATAATNAFADDAEQKTWEVTSELGAIITSGNTET
FT                   TTLKGGIKVLHHLERWNNEYKLDGIYKEDEVENDDGTKDKQRTNEKYAISAQGNYKLNE
FT                   KHSHLFIYGSHVSDYFGAYRSESVVSAGYGLRLLNEKTMWLNAEIGPGYKYFKYPDVST
FT                   EVDENGNSLAGEYEGEIIALGKLDYNWKISDNARFTQLVTVEYGDTNTKTRSETALLAK
FT                   INGSLQMKVAYNIINNSDVADDKESTDTETSLTLVYSF"
FT   gene            416337..417320
FT                   /locus_tag="PSHAa0398"
FT   CDS_pept        416337..417320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0398"
FT                   /product="putative polysaccharide export family"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85496"
FT                   /db_xref="GOA:Q3IIH1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH1"
FT                   /protein_id="CAI85496.1"
FT                   /translation="MNVFKYFIAVFILACGFGALAFTPTNAQIEQFKKLPKSQQEALAK
FT                   QYGVDLSSIGNISQSNETAATEQSTVINQRAEERKEPLTDEERFQPEIEPVKPFGYELF
FT                   AGEPTTFMPNESAAVPDTYLIGRGDQLLINFYGKESDSFEVIVDREGRINIPDLSPVQV
FT                   AGLTFAEVKELIKVKVEQEIIGVKAFVSLGQLRSMRIMVLGEAYKPGSYSVSSLTTVSH
FT                   ALFVSGGVSDIASLRNIQVKRAGKVITNFDMYDLLINGDSSNDIILKPGDVVFIPTVGE
FT                   QVAVEGLVKRPAIFELLGMGGILTKNIPERMIFAGNPAKKLKEIVE"
FT   gene            417320..418165
FT                   /gene="bhbD"
FT                   /locus_tag="PSHAa0399"
FT   CDS_pept        417320..418165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bhbD"
FT                   /locus_tag="PSHAa0399"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase
FT                   (Beta-hydroxybutyryl-CoA dehydrogenase) (BHBD)"
FT                   /EC_number="1.1.1.157"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8001771; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85497"
FT                   /db_xref="GOA:Q3IIH0"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH0"
FT                   /protein_id="CAI85497.1"
FT                   /translation="MEVSIIGSGTMATGITQVLCLSNEVSKVNLIARTEEKALASKSTC
FT                   AKNISRLARKGKISDEQASFALEKLYCNAELVAVVNSDLIIEAIVEDFTAKMVLFSKLA
FT                   EFINDSVIVASNTSSLSITAFASVLPNPQNVVGLHFFNPAPIMELVEIIVGHETAPAKI
FT                   QLLQGLTKNLGKVPVVVQEAPGFVVNRMLIPMINEAVSILAEGVATADDIDKAMKFGAH
FT                   HPMGPLALADLIGNDVNLSIMETLYSETGDPKYRAHPLLRKMVRANHLGRKTKKGFFEY
FT                   "
FT   gene            418169..419347
FT                   /locus_tag="PSHAa0400"
FT   CDS_pept        418169..419347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0400"
FT                   /product="putative aminotransferase, DegT/DnrJ/EryC1/StrS
FT                   family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85498"
FT                   /db_xref="GOA:Q3IIG9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG9"
FT                   /protein_id="CAI85498.1"
FT                   /translation="MLNTTFSPWPSFTQDEADAVSRVVLSNKVNYWTGTEGREFEKEFA
FT                   SWADSEYAIALGNGTLALDIALKALNVGSGDEVITTPRTFLASASSIVTAGAAPVFADV
FT                   DLNSQAITAASIKAVLTPKTKAVIVVHLAGMPAEMDSIMALSKEHGFYVIEDCAQAHGA
FT                   KYKGRSVGSIGHVGAWSFCQDKIMTTGGEGGIVTTNSKELWSIMWSYKDHGKSFDAIYN
FT                   REHPPGFRWLHESFGTNWRMTEMQAVLGRIQLTRMSDWTAKRQAYGAELDKAASEFDSI
FT                   RLVTVPSYIEHAEYKHYMFVKPEKLAEGWDRDRMVNEIVERGVPCFQGSCSEVYLEKAF
FT                   NNTPWRPDKRLPNAVELGETSLMFLVHPTLTEAEITKTTQVMKEVFSLASKS"
FT   gene            419833..421788
FT                   /locus_tag="PSHAa0401"
FT   CDS_pept        419833..421788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0401"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85499"
FT                   /db_xref="GOA:Q3IIG8"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG8"
FT                   /protein_id="CAI85499.1"
FT                   /translation="MDSFIRSIINAPRAKKRVITLFIDSLFIAAAFWLALIVRLDSLEP
FT                   LSVSGNWLLLALLIPISLYAFITLGLYRAVLRYMNSQAVWAIILGTLITTVSLVLLAFF
FT                   VGIEIPRTMPFIFAWLCLLTVGGSRIIVRALIGRMTTSNKDAVIIYGAGSSGRQLATAL
FT                   NAGPEYFVSAFIDDDVTKHGSIIQGIPVRAFNDIHALIKKRKATKVLLAMPSETRARRK
FT                   EVLAQLEPLTIKVLSIPGMADIVEGKAKLSEFRDVEIEDLLGRDPVTPKDDLMTVNITD
FT                   KVVMVTGAGGSIGSELCRQIIKLKPTKLVLFERSEIALYSIEKELGEYIISNTLNIELI
FT                   PIMGSVQRVNRLETVMRTFGVRTIYHAAAYKHVPLVEHNVVEGVRNNVFGTYYAAKAAV
FT                   EAKVDTFVLISTDKAVRPTNIMGATKRMAELVLQGLAQEQGAKHKTRFCMVRFGNVLGS
FT                   SGSVVPLFRRQIKEGGPITLTHPDITRYFMTIPEAAQLVIQAGAMGKGGDVFVLDMGDS
FT                   VKISDLATKMVRLSGLEIKTDDTPHGDIEIKCTGLRPGEKLYEELLIGDNVEQTSHERI
FT                   MTAKEVMLPLSELNVFIEALDIACHDFNHETIRQLLLDAPTGFNPTDGICDLVWNARLE
FT                   NKGNTESESNVVNLSK"
FT   gene            421985..422149
FT                   /locus_tag="PSHAa0402"
FT   CDS_pept        421985..422149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0402"
FT                   /product="putative orphan protein ; putative ISSod2,
FT                   transposase OrfA (partial)"
FT                   /function="4.5 : Transposons and ISs"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85500"
FT                   /db_xref="GOA:Q3IIG7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG7"
FT                   /protein_id="CAI85500.1"
FT                   /translation="MKKAHFTDSQILAILKQAKSGVPIPELCREHGMGNSTFYKWRAKC
FT                   VFNDAHGRA"
FT   gene            422046..422237
FT                   /locus_tag="PSHAa0403"
FT   CDS_pept        422046..422237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0403"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG6"
FT                   /protein_id="CAI85501.1"
FT                   /translation="MYQSLSYVVNMVWVTQPFINGALNASLMTRMEELEDENRRLKKMY
FT                   AEERLKSEVIQEAMAKKW"
FT   gene            422231..422512
FT                   /locus_tag="PSHAa0404"
FT   CDS_pept        422231..422512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0404"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85502"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF4"
FT                   /protein_id="CAI85502.1"
FT                   /translation="MVKASERKVLAHKVVSTNKMSIALACRTFMISETCYRYTPILRNE
FT                   NLKIAKLLLDLTELKRSWGFGLCFLYLRNEKSTSGITSEFTAFTVILS"
FT   gene            422515..423060
FT                   /locus_tag="PSHAa0405"
FT   CDS_pept        422515..423060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0405"
FT                   /product="putative orphan protein ; putative transposase
FT                   (partial)"
FT                   /function="6 : No similarity"
FT                   /EC_number="2.7.7.49"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85503"
FT                   /db_xref="GOA:Q3IIG5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG5"
FT                   /protein_id="CAI85503.1"
FT                   /translation="MRIKPRKRLNRDKPEPLAVPETINECWSMDFMHDQLADGRACRLF
FT                   NVIDDFNREGLTIDADLSLPAERVIRSLNQIIEWRGKPKAIRCDNGPEYISKQLAQWAL
FT                   NNDIELRFIQPGNPQQNAYIERFNRTVRYDWLSHYIYSDISELQDRATDWLWTYNNERP
FT                   NMGLGGITPIQKLEKLNN"
FT   gene            423413..424981
FT                   /locus_tag="PSHAa0406"
FT   CDS_pept        423413..424981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0406"
FT                   /product="putative orphan protein ; putative
FT                   acyltransferase"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85504"
FT                   /db_xref="GOA:Q3IIG4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG4"
FT                   /protein_id="CAI85504.1"
FT                   /translation="MIVNTPNESNQVVNQAIFGSTFISNIGFWLQNSYFSKAEFNPLLH
FT                   LWSLGVEIQFYLIVPILAWFFSKTRFSLVFIVIVSMALCFIVLTISPKTSFFMMPLRLW
FT                   EFLLGYGVALYLTQSGAVKFPKQSWLGFVGLILILLIPFFNVNGESLSIILGHPGAGAL
FT                   LVSIATSIVLVFGLPKIVEKNIISKGLAILGKYSYSIYLIHFPVIVLYLSEPFMGTILD
FT                   IPNVITFIIIFALIFTLSFTLHKLVETRNFNISITKLSVIFIALIIGLAIIGPWIKTNF
FT                   ISNQEKSIFNAFNDRSTYRCGKLIRITNPTTLTCNLSEDINDTVNKVMLVGNSHADSIK
FT                   TTFIKVAAKHNQAVYFIVQNNPLMAGGLSPDIVVREAISKEVKHIVVHFSPSGISVSKL
FT                   KELVFLAEKNSIKITFIDPVPVWESHIPKMMYRQLKGFNDNELQTKDDYLSFNNELFTE
FT                   VDNISNDNFKRISIADYFCTPNCSYKLEDGTPFYFDSGHLTLTGSNVIEKALNEAISAG
FT                   KYSEN"
FT   gene            complement(425137..425622)
FT                   /locus_tag="PSHAa0407"
FT   CDS_pept        complement(425137..425622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0407"
FT                   /product="putative orphan protein ; putative insertion
FT                   sequence ATP-binding protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85505"
FT                   /db_xref="GOA:Q3IIG3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG3"
FT                   /protein_id="CAI85505.1"
FT                   /translation="MSDAICRTFTKHGGNILLFGASGLGKTHIASSIGYGLIEQGHKVK
FT                   FVAASAIVQQLQQAKRHLRLQDELVKLDKYSLLIVDDVGYVRKTEQETSVLFELIAHRY
FT                   ERHSMIITSNKSFEQWDELFEDSTMTVAAIDRLVHHATIIHCEGDSYRRKTALNKSK"
FT   gene            425674..425973
FT                   /locus_tag="PSHAa0408"
FT   CDS_pept        425674..425973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0408"
FT                   /product="putative orphan protein ; putative transposase"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85506"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG2"
FT                   /protein_id="CAI85506.1"
FT                   /translation="MRIMRSPEQWRTIIHEQQSSGLTIIDYCRQHQLSMTSFYAVRKKL
FT                   GLSSNNFVRAKITQQVEIVDEQSSITLTVGKANVSLPATTSATYLSQLLREFVQ"
FT   gene            425970..426317
FT                   /locus_tag="PSHAa0409"
FT   CDS_pept        425970..426317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0409"
FT                   /product="putative orphan protein ; putative transposase
FT                   (IS66 family element,Orf2-like)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85507"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG1"
FT                   /protein_id="CAI85507.1"
FT                   /translation="MKMFVEPSEVFLHRDFVDFRKSINGLVSIVEDELVRDAYTGTLFV
FT                   FCNKAKDKLKILYWDKTGFALWYKRLEKQKFKWPSKLSSQEFELTYQQLSWLLSGYDVL
FT                   GHEPLHYQSPI"
FT   gene            426414..427976
FT                   /locus_tag="PSHAa0410"
FT   CDS_pept        426414..427976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0410"
FT                   /product="putative transposase (IS66)"
FT                   /function="4.5 : Transposons and ISs"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85508"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG0"
FT                   /protein_id="CAI85508.1"
FT                   /translation="MKIDTHSLPDDPEQLKQMLLELQAKTTQELAEKDKIISEQAIQIN
FT                   QFIERYEIAKRKQFGKSSEQLPGARETFNEAEEIIDEADKTLLAAADSHNKITIKNKPT
FT                   RKPLPKELPRKVVTIDVSIDEKMCDCCQGKLHKIGETRSEKLEFVPAYIKVIETVRPKY
FT                   ACKKCEQTGTENSIKVAPVPATPIPKGIATSSLQSQIISAKYQYGLPLYRQEKMFNEYG
FT                   IELSRKTMSDWIIRCSELLMPLVNELKAALLSQAVIHADETPLKVIKADNSSSYMWVYC
FT                   CGSDSVTANSLPNIILYDYHNSRAAACVVDYLGDYDGYLQVDGYAAYGKTDAILAGCMA
FT                   HARRKFIDAKTVQTKNKTGKADVALSLIRKLYGIEASLKDKTAAERYQARQESSKPIID
FT                   KLHHWIIENKDKVPPKSKLGEAITYWCNQEHKLITYLKDGRINIDNNRAERAVKPFVIG
FT                   RKNWLFSNTARGATASAVLYSIIETAKANGLLVDNYLQTCQDELAKKPESVEHLLPWNV
FT                   NQG"
FT   gene            complement(427973..428302)
FT                   /locus_tag="PSHAa0411"
FT   CDS_pept        complement(427973..428302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0411"
FT                   /product="putative orphan protein ; putative insertion
FT                   sequence"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF9"
FT                   /protein_id="CAI85509.1"
FT                   /translation="MDNFTASLPLMLKQLKLSTMLQQWNTLGKKAIEEQWSPQQYLSDL
FT                   CHIELATRDDKRLQRLLKDAKLPVGKHLSSFDFTLVDGVSKPLVADLINQPDWLKHGKR
FT                   LSKCV"
FT   gene            complement(428295..429311)
FT                   /locus_tag="PSHAa0412"
FT   CDS_pept        complement(428295..429311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0412"
FT                   /product="putative orphan protein ; putative transposase
FT                   (partial)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85510"
FT                   /db_xref="GOA:Q3IIF8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF8"
FT                   /protein_id="CAI85510.1"
FT                   /translation="MPASGWAYAQVIYGGESFAAFSDGVQNAFKAAGGVPKEVRTDSLS
FT                   AAYRNHTNDNDFTERFNELVIHYGFKATRNNRGIAHENGAIESPHGHLKSQLEQALKIR
FT                   GSYDFQTRVVYESFVADIVARRNRRVSDKYAVEQRQLHALPKTMSVSYTEHYLTVSRTS
FT                   TVSLKRVTYSVPSRLIGSRLLVRLYDNRLELRYGSDLVQTLARVYASKGCRARNISYLH
FT                   VIDALVKKPLAFRYSQLRDDLLPSDNYKAIWEYVNAHLLADEASYYMVKLLHLAKQSGC
FT                   ERQLGRFVAASITQRQLPAIRECEAQFLVIASNIPTITIKQHSLSAYSSMIPGGLHG"
FT   gene            complement(429278..429769)
FT                   /locus_tag="PSHAa0413"
FT   CDS_pept        complement(429278..429769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0413"
FT                   /product="putative orphan protein ; putative
FT                   transposase(partial)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85511"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF7"
FT                   /protein_id="CAI85511.1"
FT                   /translation="MVLSDRHHGITQKRNSQVIAAAKADISERSARRIDKLDEQPLSNK
FT                   RQWRTRIDPLESIWDSIVVPLLQGDATLTPVGIFDHLCEFHTDKFNPSSRRTLERRIHK
FT                   WRALYGSSKEVVFLQTHEYGLLGMCDFTHVKSPVTIASEPLKHMLFIIVCPPVAGLTPK
FT                   "
FT   gene            complement(429814..430287)
FT                   /locus_tag="PSHAa0414"
FT   CDS_pept        complement(429814..430287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0414"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85512"
FT                   /db_xref="GOA:Q3IIF6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF6"
FT                   /protein_id="CAI85512.1"
FT                   /translation="MASSSPNILITGATGCGKTYLACALGQNHCQQGSSVYYFRFKELL
FT                   EKMFLAQADGGYRKLINKLSSANLLILDDWGLEPLTAQQRSDLLELIDARYDTKSTLIA
FT                   SQLPIENWYEMIGESTHADAILDRLVHGAIKLELKGESMRKKLNFLTDADHSS"
FT   gene            complement(430260..430577)
FT                   /locus_tag="PSHAa0415"
FT   CDS_pept        complement(430260..430577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0415"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85513"
FT                   /db_xref="GOA:Q3IIF5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF5"
FT                   /protein_id="CAI85513.1"
FT                   /translation="MQNINQQVNNQLSNLKLSGIRDALLQQYEQPNLYVEQSFEERLSL
FT                   LLEHEITQRDQRKVDRLTRQAKFRVGGTLAQLNYGAARQLDKAQIRSLAQGEWLRLHQT
FT                   S"
FT   gene            complement(430606..431715)
FT                   /locus_tag="PSHAa0416"
FT   CDS_pept        complement(430606..431715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0416"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase (IS408)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85514"
FT                   /db_xref="GOA:Q3IIF3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF3"
FT                   /protein_id="CAI85514.1"
FT                   /translation="MDYCGPTMSIVDTSTGECRTAQVFVAVMGASNYTYAEATYSQKLE
FT                   DWVMSHARCFEFLGGVSELIIPDNLKSAVTKPCRYEPDLNPTYQQLATHYDTVIVPARP
FT                   YKPKDKAKAEVGVQIIERWIMARLRNETFFSLRQLNLKIQALLVNLNQRKMKKHPGSRL
FT                   SQFDAIDRPALKPLPTQPYSYTLVKQVSVHIDYHVEIEKHYYSVPHTLIKQKLEAHASG
FT                   KLVTLYHQGIRVAVHPRSYREGAHTTLDLHMPIAHQKQQQWTPQRFERWASKFGTSTEQ
FT                   FVMQLMQAKKHPEQSYRACMGLLRLGKKFSDQRLEAACHRALTTGVTRVKQVKTILEKG
FT                   LDKQPLPQAQGDLLQDIDHKNIRGNHYYH"
FT   gene            complement(431735..432151)
FT                   /locus_tag="PSHAa0417"
FT   CDS_pept        complement(431735..432151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0417"
FT                   /product="conserved protein of unknown function; putative
FT                   transposase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85515"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF2"
FT                   /protein_id="CAI85515.1"
FT                   /translation="MPTAPISMRKLKEILRLKYSCKLSHRQIATSLSVSPSIVSKYACK
FT                   SAELDITYWPLDEKWDDHALQQAFFKTKPRLKGFTIPDWSLVQQELRPKTMTLLLLWEE
FT                   YKERHAEGFYSYTHFCRQYKAWLKCQKPSMRQKS"
FT   gene            432912..433061
FT                   /locus_tag="PSHAa0418"
FT   CDS_pept        432912..433061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0418"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF1"
FT                   /protein_id="CAI85516.1"
FT                   /translation="MFIPKEDGSERGLSIICLEDKIVQQAMVQVLNQIYETDFLGISYG
FT                   FRPE"
FT   gene            433092..433991
FT                   /locus_tag="PSHAa0419"
FT   CDS_pept        433092..433991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0419"
FT                   /product="putative enzyme with RNA-directed DNA polymerase
FT                   domain"
FT                   /function="3.2 : RNA metabolism"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85517"
FT                   /db_xref="GOA:Q3IIF0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF0"
FT                   /protein_id="CAI85517.1"
FT                   /translation="MAIMKRKVNWVLDLDISKFFDTVEHDWLIKFIEHRIGDKRIIRLI
FT                   RQWIKVGTVDSHGHRQQSTIGTPQGAVISPLLANIYLHYSFDLWLNKQRKYARGNVTII
FT                   RYADDAVLGFQKHQDAIDCQRALTQRLLCFGLKVHPNKTKLIRFGRFAPTQYRENPSRG
FT                   KPGTFDFLGFTHYIGKKLSGEVIVKRKTKRNRQITQLKRIKQALRKRLHDKPWETGRWL
FT                   RRVIQGHINYYGVPYNAHKIGQFVEEVKKLWLKSLRRRSQRHRMTWERFKYYVRYWLPK
FT                   PRIVHPYPEQRFYAKYPR"
FT   gene            434045..434185
FT                   /locus_tag="PSHAa0420"
FT   CDS_pept        434045..434185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0420"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85518"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE9"
FT                   /protein_id="CAI85518.1"
FT                   /translation="MTIPTATKTPVGAGGEIQPTDAIDTLIESETVEAISYEWLFTRLW
FT                   R"
FT   gene            complement(434383..435537)
FT                   /locus_tag="PSHAa0421"
FT   CDS_pept        complement(434383..435537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0421"
FT                   /product="conserved protein of unknown function ; putative
FT                   phage integrase"
FT                   /function="4.4 : Phage-related functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85519"
FT                   /db_xref="GOA:Q3IIE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE8"
FT                   /protein_id="CAI85519.1"
FT                   /translation="MAHIRIRPNGRIQFDLHIYGQRFREGTKLMATPVNIKKANATLKK
FT                   INAEIDLDTFQYRDYFPESKKVAKFEALQRAKDPDRLYPFFNDYANEWFDRQKAKWKSS
FT                   YQSVVRNTLDRYLIPEFGNILVNEIKLANVDYFRESLMVCDTKGARKLSNKRINGILWP
FT                   FVAILSLAAEEHEFTYPLRRYKTLKEERANSLPLTADEVQRFLECTPTQWRDYFTVRFW
FT                   TGMRSCEIHGLRWEDIDFNHRLIRIRHNWVNGELGDVKTPKSRRDLKMCNTLFSLFKRL
FT                   QKQTTSEFVFTHKGKPLDTHFVSTQLWYPTLNKAGLARRRPYETRHTAAVLHIAAHENP
FT                   LYISHMLGHSDTRLLFDVYAPYVANASRQDGFAFNEMMIERGIA"
FT   gene            complement(435971..437257)
FT                   /locus_tag="PSHAa0422"
FT   CDS_pept        complement(435971..437257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0422"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE7"
FT                   /protein_id="CAI85520.1"
FT                   /translation="MKIIIPKEKKQLLKNTTIHIDTSYSDSLATVLTNKKERSLTLVTG
FT                   QKPLFAHCVFILDKGSTNLKDKQFSIDGSYAKQLPHYFTSEQDIELNFQASSADSSFIE
FT                   LIQTDLKDNEATLRRCECSDASKEHLTYLKDNKQLPTTTVSKAVIERVIFESTGHMPYQ
FT                   FIELDSDKQHIRVQRDGKVEKKYLPKDIKLPVSIVMTQEITYKLFDFCKTINGDKIEMV
FT                   QQGELLTFKTDESSVTSTLTGLNEFYTKTPEKTETLRFVELDFYEFKAELRHCFKEYGV
FT                   IKKANDALLYLSDKKAAIAVFTEPYKFVHPFTVSKIDNKKDNVNSIFRFSPKDLLNIKI
FT                   KDLIGAKSTRLEVIEYSNGEIKLGVYYSLEDKLPYLSIPIEKDKSQLPKVLAMLESLDK
FT                   NQHKTQHKKQEIQGDLFGSDMGEGEEDEY"
FT   gene            complement(437254..440052)
FT                   /locus_tag="PSHAa0423"
FT   CDS_pept        complement(437254..440052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0423"
FT                   /product="putative orphan protein ; putative phage
FT                   integrase family"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85521"
FT                   /db_xref="GOA:Q3IIE6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE6"
FT                   /protein_id="CAI85521.1"
FT                   /translation="MSKQFIEKQANKINDYLVHTWPHSTAQEAILWILNNLPVVSTQTP
FT                   SLDHSELSIINKKIDTIPTGNQRVYRKALDGVLFYLGNECQWQLPEKIEEKIIDADHEY
FT                   FDDLTKGTAHAQQIFTRYQQRKVLFFTTRPPLTPCFTALMIGFEIAPLSLVHICAILNN
FT                   TDSITDEVSNPRLAITHFECGTDKPQVTHYHLPIICYRLLRDYYAQYPEKITVTRLYNH
FT                   LAQWLEERGLSGVKQGEWPRRFQISWYTRFKLPPIFIKDLAYPERHVGIPCDINPSTIK
FT                   AEDIYAIDWDTKWFDSLKKSRTKIHWPHEILLKHSENPNAVEPPSWDAANILPRLLFNY
FT                   TKQLIVFGGVKKANLALDSIKNYTSLKSKLELFPLSYADAINEEAVNKWAETVYDSIDS
FT                   DIVKVTFYNFLRFLKHQEQTDTLDLSLFSSPLIPPSVSPARLGVDECDLLIKTLIESES
FT                   NHPFRSLFCIVAALLGFYAMLRRGEVLRLRRKDIRFKPSTGLITIIVTNTPEGNTKSNT
FT                   TRKVYTTLPKQYHPLFKSLFKIKKRNIDREQPLLGFKGEMYHSRQLYYLLPVSRALRFL
FT                   FGAHLNFHHLRHSGVHLFMLQTLHCLNNTPNEQRGEIPLEQEVLSSTSVATRFNYWFEG
FT                   REVDEVNDAAFLDEMGKQIGHIYYGTTRWSYLHDIDWLLPIISRAHSPYTGREYTHSEL
FT                   RYLFGLKPDSNDLSRILLKLSPKYANKNLGQKRSQPIMLRDCKLREAVFGKAIQSKHTP
FT                   LTVDHNLDWQKSIHNSEHSLLGFIFKAMLKSKTLDLYALSFIWGNGNKHHIQPISKKQH
FT                   TALNNLPPIVLSDDKQSLQITLACNSKNARAFSSVFRQADWGWLNIKFILSVNRKINSE
FT                   RQVMLLKTLFVQKNEVIQIAKHLRGKTQLTIYLIPKKTLPSNVLKFVQSFIQLFQYYEA
FT                   KQ"
FT   gene            complement(440045..441622)
FT                   /locus_tag="PSHAa0424"
FT   CDS_pept        complement(440045..441622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0424"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85522"
FT                   /db_xref="GOA:Q3IEH6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH6"
FT                   /protein_id="CAI85522.1"
FT                   /translation="MSISKHIARSNRLKNAGGCYPDALPYATTLAILLAKLAKVDVKTR
FT                   PAITVVALFMWLTEDWRIIDKPDDIPDFIRISGASPCRQYAFRNYYDSTVSWTEYARAC
FT                   KDKNKTTYLWQPIPTYLNQFFQTFISEKTYDTPFLTQKAKTILFELMSKAWKTPHKLQG
FT                   QPRVRKDSLQNYFIKCAQADNTLGAIVRVQLIADQQAHHRSARYYQQQSSDRIRRKIFD
FT                   AHNRYLSRLIAAARNAKINSYFVVYLKSYSVSLIKDNHEKAKYLSIPGIIKQFELDTSQ
FT                   NGESKVCTPAIMLGSRRSLDDKNVSLFFQSLQKEVEDAKESIYVKCSSQKSSSANHAAL
FT                   RDYYNKATYRIALLFIVLTGARPTHSISILSDYYSGSDITFIKDKGVLRQLILCDYLQQ
FT                   EIKHYLSLQTVIRSQLNIHTELDELWYTCNEKNIPIALTCRELRLFMHKLWPGVVPYHL
FT                   RHFYCHCANSHMFSDKLFDNDIDRLMGHENLGERLGSDILSPRRFALMKDYLNMLSQRI
FT                   GLEALIHV"
FT   gene            complement(441636..442109)
FT                   /locus_tag="PSHAa0425"
FT   CDS_pept        complement(441636..442109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0425"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH5"
FT                   /protein_id="CAI85523.1"
FT                   /translation="MRYKQKSIPFDNAKLQVHPLLVTLTKNDVTQLKVNQCIGELPIEV
FT                   IQTLLDLNPLPVALSTDDDCYLTLAPSGILERFKAHPLSKKLSLKLYVYPTDAIEHVLS
FT                   VTLLYNYAVTLYLKNGFSTNIQRRLSCFKEHGIHAPKKTILANLANTSPSIFR"
FT   gene            443258..444010
FT                   /locus_tag="PSHAa0426"
FT   CDS_pept        443258..444010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0426"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85524"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH4"
FT                   /protein_id="CAI85524.1"
FT                   /translation="MSTLKSSNRIAFSTLNYPLDKKENRSINVANSMLYQIKKLGITIK
FT                   DEKFLLSFTKSLNEVERDPSAPHLCFDHDPRRTAQFLQRLKINLSESGQNFSLSKLGYL
FT                   LALTLGFDKYDGLLKQLDAYQCFIKKPWYIYGKKITKPLIRHNGKDTYIFLPLMSISPS
FT                   SRYMTQDMSVSIILASDLKTIGCPIIFSYRKESHGCEFRSFGTTQEDAMAWLIVHAIHQ
FT                   LQDVRLWNVELNYHRATARYEAEKEKFE"
FT   gene            complement(444374..445306)
FT                   /locus_tag="PSHAa0427"
FT   CDS_pept        complement(444374..445306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0427"
FT                   /product="putative transcriptional activator for lysine
FT                   biosynthesis (LysR family)"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 6350602; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85525"
FT                   /db_xref="GOA:Q3IEH3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH3"
FT                   /protein_id="CAI85525.1"
FT                   /translation="MQQNQQKITLNSLEAFDAVIKTGSATGAAKLLGLTQPGISRLIAQ
FT                   LESKVGFSLFYREKARLFPTDEAVALHKQVETSLASVYRVEQLAKNIHQSHVGHLNIVA
FT                   PSSFVAGPLAEAVASFLKDHPNVKINLDSHSPARACELVANKAFDCGFIQLPENHDNLL
FT                   CEPIISSNLVCAVSSSHPFASARELQPEDLRDESLVLLGQGRHSRRRIEHAFLQSNVRL
FT                   KVRVETHTVPTACTLAKHGVGISIVNKLIAQQFQNDDLKLIPFKPEIEIVYGFITSTSA
FT                   PMNRLTQTFYNHCKVHFSQFMDSCGLSEK"
FT   gene            445425..448136
FT                   /locus_tag="PSHAa0428"
FT   CDS_pept        445425..448136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0428"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85526"
FT                   /db_xref="GOA:Q3IEH2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH2"
FT                   /protein_id="CAI85526.1"
FT                   /translation="MERLMFKQSVISLAIATACLTASHTVSAEDVTAEKSVERIAVTGS
FT                   RIKRQSATASPIQNIDLETLNANGSLSLGDALQELPSVGSSLNGNGSAGSSHGSSSLNL
FT                   RNLGANRSLVLVNGHRWVNGAGSRGFRDFVDMNTIPQAIIKRVEVLQDGATAIYGADAI
FT                   AGVVNLYTYDDYEGLEVKTTYGETTKSDRETFNIDILSGVNINDGNLMFAASHVDQKPI
FT                   YTQDRNITAVPLNGLTSATPEGHFFEDNLATVNGLTPSSGGITRDPGKDGNNIDNWRKV
FT                   NSDDTYNRYYNNYVTGPSERSSLYTQLVMPIGSVNFKAEALYNSRESDQQFSPALSPIR
FT                   GSRGFVIADDARVNPFGVEFSGSDFKHNAFFMNNGYRVNEQKVETTRFAIGLDGELSND
FT                   WSWDSFASWASNKGEFTSNNQMNLDKLALGLRACDTTGIDADVTDLVSGCVPVNIFAPL
FT                   TDDMVNYINFTGHDKNEASQLDFTANITGSLYELPAGYIGAAFGIEYRKEKGEDTPDSI
FT                   INSDPRINTYRTTTSSPREGTIGEYDLKEAYAEFSIPLLDDKPLAEYLELSLAVRYSDY
FT                   STFGSTTNSKVGLLYTPFEQLTLRANWAEGFRAPSILELFEGERLTYKAVNDPCSTDNN
FT                   LAGCSGVPTDYSQPFSNVQVTTGGNRQLVPETSKNKTVGLIYESNLIENLSFTLDWYEI
FT                   EINNTISEFGAQNNLDLCAYQNKNCDTITRDSSGEIIDILDGPVNLNATRVSGIDFVSY
FT                   YTLQTDFGDWSFNANVSKLNTLTEYSTLSDGSIEQEDLVGTAASRESYPEWRGTFSSTW
FT                   KYNGWTANYNLRHIDSTTEQFLGEPRGIGSVTYHNISGGYQFANNLSVKLGVNNLGDKQ
FT                   PPASLTNLNINFDQNTYNPVGRYMYLQLTYSL"
FT   gene            448196..449044
FT                   /locus_tag="PSHAa0429"
FT   CDS_pept        448196..449044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0429"
FT                   /product="conserved protein of unknown function ; putative
FT                   N-formylglutamate amidohydrolase family"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85527"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH1"
FT                   /protein_id="CAI85527.1"
FT                   /translation="MKSAFSLLTPIESEEIPLVFDSPHSGIHCPDDFNAQVPLEFIKSG
FT                   WDAFIDDIWQPITEKGGYLLHANFSRMYIDPNRAPDDIDPALLDESWDRCKPTKYSDRG
FT                   MGLIRRYALPGKAMYDRKLTREEVTHRIDHYYSPYHTQLQTLLDDLYTRHQGVWHVDCH
FT                   SMKSVGNGMNIDAGIARPDIILGDKDGQSADPEFVNVIAQAFTHKGYKVVKNTPYKGGY
FT                   LVSNYGNVAANRHSVQIEVNRALYMNEKKFEKNENYEQFKRDTSFVAQQLAAYVSAQVG
FT                   K"
FT   gene            449047..450438
FT                   /locus_tag="PSHAa0430"
FT   CDS_pept        449047..450438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0430"
FT                   /product="conserved protein of unknown function ; putative
FT                   C4-dicarboxylate anaerobic carrier family"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85528"
FT                   /db_xref="GOA:Q3IEH0"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH0"
FT                   /protein_id="CAI85528.1"
FT                   /translation="MSENNYSNEKKGLNPIIILLGILFLATLLTYIVDSGVYERDDNMV
FT                   VANSYNIIDKDKSLSNLFNYQDADLVKAEPVSIIGTFMAIPSGLEQGSGLIFMVLIIGG
FT                   MFGILTKAGTIDAGLERLLSLVQGNIYVLVILLMIVFSAGSTFLGLASEYLLIIPLMVG
FT                   MANRLGLPNIIGFAIVCVAVKAGYLSSVTNPLPLTIAQPLLGLQIFSGASVRFFFYLAF
FT                   LAVGIGFVLFMIKRQGFKNEQVHFHSEKLSTRHVIILLTLTSGIALLVYASTQWYWKHH
FT                   ALSAYYIALSMVLAAISGLSANQAAQAFVDGMKKVLLASILIGVATAVAVVLKQGMVLD
FT                   SIVHFLMSFIGEGNAYFAATGMFVSQLMLDFLIPSTSGQAAVSMPILGPIGNLAGVSEQ
FT                   TTIVAFLFGNGITNILTPTSGTLLAYLATARVGWGEWAKFIFPLWLIYIVLAIVLLQVS
FT                   VFINF"
FT   gene            complement(450511..450633)
FT                   /locus_tag="PSHAa0431"
FT   CDS_pept        complement(450511..450633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0431"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85529"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEG9"
FT                   /protein_id="CAI85529.1"
FT                   /translation="MCSIYMLVKVSYESFVEEDLDKIVDLIFRLLQHGFKQLTD"
FT   gene            450650..450826
FT                   /locus_tag="PSHAa0432"
FT   CDS_pept        450650..450826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0432"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85530"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEG8"
FT                   /protein_id="CAI85530.1"
FT                   /translation="MTANTQHCYFVIAEDDLGNESPASNERFAIVEAFDVMNPTVPMPF
FT                   SAEPTATIVLTVS"
FT   gene            complement(450673..450897)
FT                   /locus_tag="PSHAa0433"
FT   CDS_pept        complement(450673..450897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0433"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85531"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEG7"
FT                   /protein_id="CAI85531.1"
FT                   /translation="MSVSVLFFKYYKGMLRMTIMNSKAQLTVNTIVAVGSAENGIGTVG
FT                   FMTSNASTIANLSFDAGDSLPKSSSAITK"
FT   gene            451103..451309
FT                   /locus_tag="PSHAa0434"
FT   CDS_pept        451103..451309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0434"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85532"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS8"
FT                   /protein_id="CAI85532.1"
FT                   /translation="MTLKSIKSKNDFENAIKRFDELFNSAEPNTPEGDEFVLLSELIED
FT                   YELINVVLERKNQEEISVDLAEL"
FT   gene            complement(451705..452718)
FT                   /locus_tag="PSHAa0435"
FT   CDS_pept        complement(451705..452718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0435"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85533"
FT                   /db_xref="GOA:Q3IFS9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS9"
FT                   /protein_id="CAI85533.1"
FT                   /translation="MVRPYVTLNDKFIPVQGLVACLLELAQQRQLNQHKLLRGTGIFDE
FT                   DLLRPDFYLSLSQLLRLLKQFNNLMPGRDAAFQLGHRLFPASSAEASAILHSRNLTQAL
FT                   RLLSCFRLQLAPLLFAHHYKYNDYSYLQLNDAVGLDEQQYQFVVELYCCLLVSASRYML
FT                   GERIPFHFEFPFQRPRHIYEYEEHLGLKLTFGRPSLIVKFAQKWLTSPLLRSSQLHRKL
FT                   AMQQVNRDMLKQTFIEMISNYLHHHRQANLQQVSEHLNMSTATLKRRLKEHNLRFSQLQ
FT                   DRINMQLAFHFLTVQGLSNEVVAEKLAFHDAPNFRRACKRWTGLTPTELKALALSK"
FT   gene            complement(452694..453614)
FT                   /locus_tag="PSHAa0436"
FT   CDS_pept        complement(452694..453614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0436"
FT                   /product="conserved protein of unknown function ; putative
FT                   GGDEF domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85534"
FT                   /db_xref="GOA:Q3IFS7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS7"
FT                   /protein_id="CAI85534.1"
FT                   /translation="MNFTLLKLHPRMIVLTLSIIVLALLLCNMMGTTKLWQEIDWWDVL
FT                   GEGGIVLLTILWQFFLLLSRPPGRVTTLLTVGLCCFMFSGLLDFLDEFFRYPQEAWLPL
FT                   IENIPAPFGMILISRGLYLWYQEMLVLNAQLRRREANVREHQNVDSVTWLYRADYMHEQ
FT                   LRLQLEQGGRYCVAVVDIDQFDTFNRRFGHPEGDRLLREIAELILMNARLTDLVCRYAG
FT                   DRFILLMPQLALPQASLQVQQIASAVKHLAFKSGDMAVFHTLTTAVIEATKGESCQALL
FT                   RRLNTQFAQQKSDKAGVAWCDHMSR"
FT   gene            453923..456631
FT                   /locus_tag="PSHAa0437"
FT   CDS_pept        453923..456631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0437"
FT                   /product="putative tonB-dependent receptor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85535"
FT                   /db_xref="GOA:Q3IFS6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS6"
FT                   /protein_id="CAI85535.1"
FT                   /translation="MKFKLSIISSACLAAMLSASAYAEPGNFVGTLSDGNKQVYFEGAQ
FT                   VKIKELNLTTQTRRDGTFRFNNIEPGHYTIEISYLGAAPIVKTIYIEENKTLKDQFTLT
FT                   ESGNTIEDIVVYGQRAGQAGALNMQRSADSIKSIVSSDAIGQFPDQNVAEALQRLPGLS
FT                   IERDQGEGRFVGIRGLDPNLNNVTVNGINIPSPEAGVRSVALDVFPSELVEGLEVSKSV
FT                   TSDMDADAIGGSVEIRSLSAFDRAGESASVTLQASHNQLRSDTSPKVSASYSNRYKFGN
FT                   VDDVFGVAAAVSWSDRDFGSDNIESNGDDEVEQRHYKINRERLGAALNLDYRPDFNNQY
FT                   YLRTLYSQFSDTEFRQANAFTFAGDDSEVERSSKDRFEEQQILSLTGGAEHQINQWLLT
FT                   YQAGYSKASEDEPEALNYVFKTDGFTLNSDLLGKIPHVEQQVGVSELANYKLDEIEFAN
FT                   NQSNDKEYSFRFDLAKDLTFLNYPSQIKFGSKYRSREKQQATQVTFFDGDFDNIDSDMF
FT                   VGGSPDWGLGEFGEGLNKHALRSFFNSNRANLEVAQLDSDIESRGESFINKEDILAAYI
FT                   MGTIDIEQLRIVAGFRYEKTQFSTSGHKVELIEDEYSDINQLDVNPWQVDRDYDYLLPS
FT                   LNVRYNVTENLISRFAYTQTLSRPKFEESAAFQIIESNTVKDSDGVLTTEREASVGNPE
FT                   LKPFESDNIDFTIEYYPGGIGVLSAGYFYKNISNFVIYADVANQPQWQGFDEVIQPING
FT                   DKATLQGIELAWVKTFENGLLLAANATFSDSEAVTLLDGKRFETSLPNQADRVGNLTVG
FT                   YEDEKWNLRLTMTHKSENLEEIDGELLRMEDSHQQLDFSSKYYINQKMNLYFNAINITD
FT                   QPFYNYFSERNRNAQYEEYGRTFELGFTWKM"
FT   gene            456754..458682
FT                   /locus_tag="PSHAa0438"
FT   CDS_pept        456754..458682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0438"
FT                   /product="putative phytase domain protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85536"
FT                   /db_xref="GOA:Q3IFS5"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS5"
FT                   /protein_id="CAI85536.1"
FT                   /translation="MKYSLVTTLLCSLLPIMGCHAQKTTTTTVNINPLFSEPAFSGKQG
FT                   VMLSGEEPKWLLTSESKGLLLLDQQAQPLSRFNGNFETLTMRENVLLNEEQSTLIATID
FT                   NEHNTIKLLSLKQDNTFTLQSSLPFEHSQLESLCLFRQPLGDISLFAVDAVGEVHQFII
FT                   YNAKQQHIDIQPIRSFVGVPEVQGCAVDDSREQLYLVEGNIGVWQYDANPESDPMRTLI
FT                   VAANPFGQLQGDISDISVTAEGSVWITTPENQQLHVIQPITGLYQSITLDGLTEPETVN
FT                   VTLHNKRFQAVVFDAVQDSYWQVDDLKNIVPQKLLKTTTLATISADVQTDPVLRFGDAA
FT                   DDPAIWVDQQTPANSLILGTDKRVGLMVYGLDGALLQSLEIGRVNNVDVRQHSSINSPL
FT                   NTIITASNRTKSSISVFELDEQRSVHHVGEIATDLGDIYGLCMYQSDSGSYVFVNDKDG
FT                   RYQQYRISATKPNIVAKKVREFALPSQPEGCSADDRTGKLYMGEEDAGIWQIDAEPNPS
FT                   AQASRIADVGDILKDDVEGMEVYHGQNASYLVVSSQGNNSFVVYGLWDDYPILTNFRID
FT                   MDLTNGIDGVSETDGLTVSAAALPGYPQGVLIVQDGRNQLPQQPQNFKVVDWRKVQALI
FT                   EQSDHVN"
FT   gene            458833..459633
FT                   /locus_tag="PSHAa0439"
FT   CDS_pept        458833..459633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0439"
FT                   /product="conserved protein of unknown function ; putative
FT                   hydrolase activity(metallophosphoesterase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85537"
FT                   /db_xref="GOA:Q3IFS4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS4"
FT                   /protein_id="CAI85537.1"
FT                   /translation="MAGSSIRFAVLGDAEPKPVAEFPNLARAIDDVNRLASEKKIDFIL
FT                   GVGDIPHKGTMLQYNNVTPELQRLTLPFYPIMGNEEHGAEDAVTRFLHFANLWNKGKVT
FT                   IKSDKYTLEFDDFAIVLASPDHGRDFNSTGVNWILKQLKQLSPKPVLLVVHGAQQGVYP
FT                   ENPDKGISHEKFANVIAQPNLKAVISGDLHMDMDRVDHSKKIGKVHYLHIPALERTKIP
FT                   DETRHNPMYRVFNISPEGDVDVATYSVGNQHAIAEHSYQFSLNQ"
FT   gene            complement(460427..460741)
FT                   /locus_tag="PSHAa0441"
FT   CDS_pept        complement(460427..460741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0441"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS3"
FT                   /protein_id="CAI85538.1"
FT                   /translation="MPQIPLNSVLLGLFIRAPVLALFISHISNRGQNWPFFIIKLHKIR
FT                   SLIINHLALNNHQTRLKLGKQLKYKIKNKLSVATIKPRDIINFISAYQVSILALCVDAF
FT                   "
FT   gene            complement(460808..462103)
FT                   /locus_tag="PSHAa0442"
FT   CDS_pept        complement(460808..462103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0442"
FT                   /product="putative transport protein (MFS family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85539"
FT                   /db_xref="GOA:Q3IEI7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI7"
FT                   /protein_id="CAI85539.1"
FT                   /translation="MAGVNIAIPNLAEDLNASAKMIAWMPTLYLLSSVMFMLPCGKIAD
FT                   NYGRKRVYASGLALNALASLMCALATSIEWVLFWRFIQGAAGAMIFGIGVAIITSVTPD
FT                   NKRGMALGTSAACVYIGLSAAPAMGGWLTEMWGWRAVFYSQIPLVLMLLITIKLFLQGE
FT                   WKNDKKSPFDWWGTVIFSLFALCLVLGLSDLPRMSGWLLTLLSITFLMLFIVHQSRSRR
FT                   PLIRVQMFLESRVFSLSLSTSFLMYASNFSLAFLLSLYLQYIKGLSPAHAGQIVLLQAV
FT                   SMAIMAPLAGKLADKIQPRLLATFGCIIVMIGFFLLSLLTVNSSTTYISGSLLLLGIGF
FT                   GLFSTPNNNAIMGAVDKSELGVASSSMNLSRTIGNLFGMSLINLIVQYYLGDSTFSAQN
FT                   SPALMSTISLAFKMSLGFVILASCISALRGRA"
FT   gene            complement(462542..463966)
FT                   /locus_tag="PSHAa0443"
FT   CDS_pept        complement(462542..463966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0443"
FT                   /product="putative RNAse with metallo-beta-lactamase-like
FT                   domain"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85540"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI6"
FT                   /protein_id="CAI85540.1"
FT                   /translation="MKILHHGAVNGVTGSCHELVINNSTSILIDCGLFQGEDSKTDLAI
FT                   GFDITNVTALIVTHCHIDHVGRIPYLLAAGFKGPIYTTKASASLLPLVIEDALKVGVTR
FT                   DPKIIAACLSLLAKRIVAVDFKTWFNLPINPSVNNAENTQTAKARFQRAGHILGSAYVE
FT                   IDIFENKSTKTTPNNTQGKSTHRVVFSGDLGAPYTPLLPTPKPPYKADTLVIESTYGDK
FT                   NHQGRKERTQTLKKVIEGAVADNGVVLVPAFSIGRTQELLYELEQLIHSAPKNSPWHSI
FT                   HVILDSPMAANFTEQYRNFKHLWDAEAKRKVAKGRHPLDFKNLTTIDTHKEHVAIISYL
FT                   ATRQTPAIILAASGMCTGGRIVNYLARFLSDKTTDILFVGYQGRGTLGHDIQTYGPRNG
FT                   YVFVNDTRIIINAKVHTISGYSAHADQNGLIKFVTGMRKKPNHIKIVHGDDDAKNALAN
FT                   KYREILGEKTFVEIAK"
FT   gene            464254..465420
FT                   /gene="ugd"
FT                   /locus_tag="PSHAa0444"
FT   CDS_pept        464254..465420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="PSHAa0444"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9383197; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85541"
FT                   /db_xref="GOA:Q3IEI5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI5"
FT                   /protein_id="CAI85541.1"
FT                   /translation="MKVTVVGTGYVGLSNAMLLAQHNEVIALDIDEQKIALLNNKQSPI
FT                   VDFHISEYLQRDDISFTATTNKSMAYCNADFIIIATPTDYDTHTHNFNTSSVEAVINDA
FT                   LAYNPHAVIIVKSTVPVRFTQRMKAQLGVDNIIFSPEFLREGKALYDNLHPSRIVVGEQ
FT                   SERAAVFANLLKQGAIKQDIAVLFTESTEAEAIKLFSNTYLAMRVAYFNELDTYAEAHG
FT                   LNSKQIIQGVGLDPRIGNHYNNPSFGYGGYCLPKDTKQLLANYKDIPNNMICAIVDANT
FT                   TRKNFIADSIIKRNPKVVGIYRLVMKTGSDNFRASAIQGIMKRIAASNVQMVVYEPELK
FT                   EDVFYNSRVIRNLNEFKQISDVVVSNRMVEELSDITDKVYTRDLFGSD"
FT   gene            complement(465647..466573)
FT                   /gene="ppa"
FT                   /locus_tag="PSHAa0445"
FT   CDS_pept        complement(465647..466573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="PSHAa0445"
FT                   /product="inorganic pyrophosphatase, manganese-dependent"
FT                   /EC_number="3.6.1.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85542"
FT                   /db_xref="GOA:Q3IEI4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI4"
FT                   /protein_id="CAI85542.1"
FT                   /translation="MSMYVVGHKIPDSDSICGAIALAYLKNQINEPAIPTRLGEISPET
FT                   QFILDKFGFEAPELKLSYAGEDVYIVDHTEKTQAPDDIDQARIVGVVDHHKLGDLTSSA
FT                   PLECWIRPVGCSNTIIKMMYDFYNVEIPKNIAGIMMCAILSDTVIFKSPTCTTADIKCV
FT                   EALAEIAGIDDPKELGMEMFRVKSAVADTPIRDLVMRDFKDFNMNGNLVGIGQLEVIDL
FT                   AVFDDIKADLATDIAKLKTEGNRHSVFLLLTDIMKEGSEMLIASDDANLVEQAYGEKPA
FT                   DGKVWLDGVLSRKKQVVPPLQDAFQKV"
FT   gene            466693..467199
FT                   /locus_tag="PSHAa0446"
FT   CDS_pept        466693..467199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0446"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85543"
FT                   /db_xref="GOA:Q3IEI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI3"
FT                   /protein_id="CAI85543.1"
FT                   /translation="MQLSRKGWNNVIIFSMLIMIFFLNGWHKDIGGSNNEPVLQPVLPI
FT                   QSFVLTLSFVDQKIERIGTSWRTTALQTDVPLTWQGTEQQLGELVNVWQSAQLMSVHES
FT                   VVFNPNAPLSVATFELAGEPLPWVYLLYKGDGQYYLLEKNSQRVFALDLAVVKQLFPSS
FT                   TPSEQ"
FT   gene            467259..468035
FT                   /gene="mutM"
FT                   /locus_tag="PSHAa0447"
FT   CDS_pept        467259..468035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PSHAa0447"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.2.2.23"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3053667; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85544"
FT                   /db_xref="GOA:Q3IEI2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI2"
FT                   /protein_id="CAI85544.1"
FT                   /translation="MGITPHVLNQVVTKVNIHNGSMRWPVPDDVYQLTGLTVTGVERRA
FT                   KYLLLHCALGSTILHLGMSGNLRVVSANEPLKKHDHIEFIFANGKALRLNDPRRFGCCL
FT                   WQAPGSVHKLLAKLGPEPLTDEFFAKQVYQQSRNKKVPVKQFIMNNAIVVGVGNIYANE
FT                   SLFKAGIDPRREAGKVSLKSFEALIPIIKDTLAAAITQGGTTLKDFAQSDGKPGYFAQQ
FT                   LLVYGRKGQPCLVCKSELQEVRLGQRSTVFCGKCQK"
FT   gene            468181..468531
FT                   /locus_tag="PSHAa0448"
FT   CDS_pept        468181..468531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0448"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85545"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI1"
FT                   /protein_id="CAI85545.1"
FT                   /translation="MMNFENLDVWKRSTRLSADIYKNPTLKKDFGFRDQLTRSGLSVPS
FT                   NIAEGMTRDSDKEKVRFLDIARSSLAEARTQIYIAIDINYIESDVGRAWLNETFELSKM
FT                   LTSLISKIKTRI"
FT   gene            complement(468736..469236)
FT                   /locus_tag="PSHAa0449"
FT   CDS_pept        complement(468736..469236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0449"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85546"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI0"
FT                   /protein_id="CAI85546.1"
FT                   /translation="MTFLKTTFQYIALVSLILTSFVSSANPPKEIFWEDLIPQGHMQIN
FT                   TQAQANHEGSEQNWVQPDLNAPVVKALDGKSVSLPGFVVPLEGDSEVITEFLLVPYFGA
FT                   CIHVPPPPPNQIVHVTIKGGVPIDSLYDAIVVTGVISTQTWSGEIAQVGYTMKAVGVAP
FT                   FEL"
FT   gene            complement(469248..470480)
FT                   /locus_tag="PSHAa0450"
FT   CDS_pept        complement(469248..470480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0450"
FT                   /product="conserved protein of unknown function ; putative
FT                   transmembrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85547"
FT                   /db_xref="GOA:Q3IEH9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH9"
FT                   /protein_id="CAI85547.1"
FT                   /translation="MILIKLAYKSLLNRRSSVLLTLLTIAISVMLLLSIERVRIDAKSS
FT                   FSNTISGTDLIVGARTGDIQLLLSSVFRIGHTNNGVSWQSYEYITGQRGVKWSIPISLG
FT                   DSHKGQAVLGTTLDYFNYYRFGKKQPLSFKQGHAFNTINQVVLGSGVASKLNYKLGDSI
FT                   VISHGMGSTSFHHHDDNPFKVVGILNATGTPVDKTLHIPLAAIDLIHGGHSEEHDEHSN
FT                   LVGHPKQITAFLMGFNSPLYTLQIRRNINQYKKEALLGIMPTVTLKELWEMLAIVEKIL
FT                   LLFSVVVVIISLLGMLTTLLANLNQRRRELAILRSVGARPWQLFTLISIESLLTTLLGC
FT                   IVGCVLFYALMFFGAGYLQSHAGISINIAMLSYYELTLIGVIMIAGFIIGLIPATRAYF
FT                   YSLSDGMSIKI"
FT   gene            complement(470477..471163)
FT                   /locus_tag="PSHAa0451"
FT   CDS_pept        complement(470477..471163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0451"
FT                   /product="putative ABC transporter"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /EC_number="3.6.3.30"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85548"
FT                   /db_xref="GOA:Q3IEH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH8"
FT                   /protein_id="CAI85548.1"
FT                   /translation="MITISKLLFKWHKNAVSPTLNINQLNIKQGEHVFLHGPSGCGKST
FT                   LLALLAGINTATSGEVSILNKNLNSLSNTQRDVFRADHIGYIFQNFNLLPYLTPLENVS
FT                   LGCQFSKQRQQRALQQSNCLTAESARLLNALGLAQHLHHQDVGKLSIGQQQRVAAARAF
FT                   IGSPELIIADEPTSALDTNNRQSFIKLLFEQAKHANSTLVFVSHDESLQPLFNRSIDLV
FT                   NLQAAS"
FT   gene            471494..471814
FT                   /locus_tag="PSHAa0452"
FT   CDS_pept        471494..471814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0452"
FT                   /product="conserved protein of unknown function; putative
FT                   transcriptional regulator (hipB)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85549"
FT                   /db_xref="GOA:Q3IEH7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH7"
FT                   /protein_id="CAI85549.1"
FT                   /translation="MSNCVFRATVINYLLLSEGDVQLAFAAHLQALRKKAKLSREALAK
FT                   KSTVPASTIKKFEVTGLISFRQLLLLWQSLDDLTRLYDLTKDLPQSKDAPTSIEQVLKN
FT                   GL"
FT   gene            471804..473099
FT                   /locus_tag="PSHAa0453"
FT   CDS_pept        471804..473099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0453"
FT                   /product="conserved protein of unknown function ;putative
FT                   hipA protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 1715862, 8021189; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85550"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR5"
FT                   /protein_id="CAI85550.1"
FT                   /translation="MVFKPINKLEVKRTLSDSTELLVGVLAQNRQGVYFQFDQNYLDQY
FT                   SNLSPFSLSFNRDVQLAPKSPHNGLHGVFSDCLPDGWGSLLQDRVFRQNNIMPNFVTAM
FT                   DRLSFVGHSAMGALSFTPEANYNIPSEEEPGLAELGQQAQAIFDGQTETVLSALVAAGS
FT                   SGGARPKAQVYFPEHNIEECRTQPKIGDDAWLIKFTSKNLSLGHEEGLCEAVYLELADK
FT                   AKLSPPERLLVNAPEGTGAKQWLALKRFDRFKLPSNKMGRKQMHSACGLLDADFRAPTL
FT                   DYEDLIKASRVLCKSPAAGQLQFRRAIFNLFSCNQDDHSKNWAFLQEDSGEWNLAPFYD
FT                   VTFSPHPFNEHATSFAGYGKNPPIKAIQKLASAAGYANWKQVQIIISEIADIVFSFKDT
FT                   AKTFEVNKQTIQLIEQQLDNTYRINKQLCGSL"
FT   gene            473249..474352
FT                   /gene="purC"
FT                   /locus_tag="PSHAa0454"
FT   CDS_pept        473249..474352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="PSHAa0454"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1534690; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85551"
FT                   /db_xref="GOA:Q3IFR4"
FT                   /db_xref="InterPro:IPR014106"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR4"
FT                   /protein_id="CAI85551.1"
FT                   /translation="MTSYKVLDVNDDLPIRTKGDVHSGKVRSVYWLTDADSKRLISEKG
FT                   YKVPADTELAIMVISDRISAFDCIWQGENGLNGVPGKGIALNSVAAHWFKLFDEAGLAG
FT                   NHIVDIPHPYVWIVRKASTVKVEAIARQYITGSMWRDYAKGVRDFCGINLPEGLTANQK
FT                   LDKVLITPSTKGIITGVADIPPVDDVNITRSNITNNLSVFNFRAADDVAQYEKLLVEGF
FT                   ELISGELAKLGQIFVDTKFEFGYVEDINGAEQLIYIDEVGTPDSSRIWDEASYKDGKIV
FT                   ENSKEGFRQLLINNVPESDVLLNKDRMDEREQLAKDYILPESVMLEVSNTYVGIASKIV
FT                   GKEIVIPADPRQEVIAILDADYGLIIK"
FT   gene            474474..475151
FT                   /locus_tag="PSHAa0455"
FT   CDS_pept        474474..475151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0455"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85552"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034242"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR3"
FT                   /protein_id="CAI85552.1"
FT                   /translation="MFERALQVFAKKRYLFALSVLFSHAAISANIDLVIKDQHGMVLPN
FT                   AVVEIGQANTAFKPTNPSVKKLPVAVMDQVNKQFLPELLIVQQGQLINFPNSDNIRHNV
FT                   YSFSSAKSFQLKLYSGQPKEPIIFDTQGVVVLGCNIHDSMVGYIYVAKSEQVYKTDKNG
FT                   VVSLPVTTQPLQISVWHALQTAPLENKKMMNIEPQAILPITINTSSPAPRNTFGSQFKG
FT                   GND"
FT   gene            475144..477459
FT                   /locus_tag="PSHAa0456"
FT   CDS_pept        475144..477459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0456"
FT                   /product="putative HAMP domain/GGDEF domain/EAL domain
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85553"
FT                   /db_xref="GOA:Q3IFR2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR2"
FT                   /protein_id="CAI85553.1"
FT                   /translation="MTNNLRNRITILCVGLVLLTTVVSLLSFWWSTSKFQEEKVNQDIS
FT                   VAQNVYKQYLNSKENLLLTAAKVLTSDFGFKQAVATRDAATISSVLYNHSQRINADLML
FT                   LLDLSGQLISTNDDEDNFTDNLQPLMSELLTTAERSSFVVLNGQLYQVILLPVKTPRTI
FT                   AYSLVGFKITSDVASELKSLTGMEVSFIASADSLVKTSLVAPPANLQPVNYFNSKTTSR
FT                   FFGDYLVYKNREIELPALQAHPVIILLSADLTQSYRDFEQLFITLIILAILTLIVGVVT
FT                   SSLLANNLTTPLSQLAVVAKQFAKGNYNFEFKGSKQSCEITTLMDAFHHMGSDINKREQ
FT                   QISYQARHDTLTGFYNRSAMLEMLAKQLNKSTEHTLVAIDIKGLRHINDKLGPRIGDDC
FT                   LKAVAKRISEFSDELGGFHARIGGDEFLTVFPAGAVSEFKRGIIALMAQLQASYTIQNL
FT                   KINLRFSVGVVQYPLHGEQAEDLIRRVLIAVDSATSHHQNIHYYQQGEDEAHLERLVML
FT                   DELKQAISDDDGQLFMTYQPKLNMKIQKVDKVESLIRWQRKDGSWVSPEVFIDLAEQSG
FT                   LIVELTAWVVNTVIAQVAAWQQKGIHLQAAINVSAQDIAFAGFHSSLVRTLKKHKVNPA
FT                   LITIELTERDMIENEEKGIIALENLKAIGVKISLDDYGVGQTSLGRLKMLPIDELKLDK
FT                   CFILKLDESQKDQFIVQSSITLGHQLGFSVVAEGVETVGTLTLLKQMQCDHAQGYYLSR
FT                   PLKAELLEQWLEEYDGVH"
FT   gene            477446..478279
FT                   /locus_tag="PSHAa0457"
FT   CDS_pept        477446..478279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0457"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85554"
FT                   /db_xref="InterPro:IPR021393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR1"
FT                   /protein_id="CAI85554.1"
FT                   /translation="MAYIKCFMAGVLLTASFIAAASSGKLLATPGVSQVEGAGGGGLVP
FT                   WAQLAGYASEDEVSVNGFCSRADVTDYTLDVCGAQLNLFNRVELSYAQQEFDVPALSTQ
FT                   IEQSITGAKVRLYGDIVYSSWPQVSLGMQHKSLDDGTVAKLVGAQSTSGTDFYLAASKL
FT                   HLGAIAGYNWFWNVTTRYSKANQLGLLGYGGNNASNKLLFEASTAIFLSREVALGVEYR
FT                   QKTNNLGLGEQDWKDVFVAWMPNKHMSVTAAYLDLGSIAGASDQTGWYLSVTGYW"
FT   gene            478279..478698
FT                   /locus_tag="PSHAa0458"
FT   CDS_pept        478279..478698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0458"
FT                   /product="putative protozoan/cyanobacterial globin family
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85555"
FT                   /db_xref="GOA:Q3IFR0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR0"
FT                   /protein_id="CAI85555.1"
FT                   /translation="MRVFILFLLATSVLAGCSSKPKQSLYQQINGNAGIEKLVDSFIYQ
FT                   IGNDRQVFHYFEHSNITHFRQGFISHLCALTNGPCEYKGDSMVAIHTGMNINEKDFNHV
FT                   VDLLINAMDEQSIPHPVQNKIISKMAPLRSEIIKI"
FT   gene            478765..479595
FT                   /gene="sseA"
FT                   /locus_tag="PSHAa0459"
FT   CDS_pept        478765..479595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="PSHAa0459"
FT                   /product="putative 3-mercaptopyruvate sulfurtransferase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.8.1.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85556"
FT                   /db_xref="GOA:Q3IFQ9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ9"
FT                   /protein_id="CAI85556.1"
FT                   /translation="MKNIITNEQLYTQLNDPTLILFDAGMLRPGITGNYVAKAVLPNAQ
FT                   RFDIKNELADRSNPLPNTLCSETQFTQAMQKAGVNHDSLVVIYEDAGLFSAARAWWMFK
FT                   AMGFNNVKVLSGGLAKWLELGLPVESNYTQASLKGDFIAQYRPDYFIDKKQVLSATKDA
FT                   NTVILDARAYERFTGKSSEPRAGMRSGHIINSYSLPLTSLLENGEAKSLDFIQAKFSEL
FT                   VGNATHLQFSCGSGVTACALALFADECGYSNLSVYDGSWSEWGADNSLPIAVGG"
FT   gene            complement(479597..479947)
FT                   /locus_tag="PSHAa0460"
FT   CDS_pept        complement(479597..479947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0460"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85557"
FT                   /db_xref="InterPro:IPR040807"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ8"
FT                   /protein_id="CAI85557.1"
FT                   /translation="MTQINCTQCNAALTCNVTDISACWCNELPAILPLDLNATSCLCRN
FT                   CTLAKINTYLQSLYSQPIKIQLAFAKQFKNNGELIEGLDYTMQNSYMVFSKWYFLKRGT
FT                   CCKNGCKNCPYS"
FT   gene            479790..480011
FT                   /locus_tag="PSHAa0461"
FT   CDS_pept        479790..480011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0461"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ7"
FT                   /protein_id="CAI85558.1"
FT                   /translation="MFILASVQLRHKQLVALRSNGKIAGNSLHQHADMSVTLQVRAALH
FT                   WVQLIWVIILLLNHGERRITILWIYKKH"
FT   gene            479990..480313
FT                   /locus_tag="PSHAa0462"
FT   CDS_pept        479990..480313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0462"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85559"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ6"
FT                   /protein_id="CAI85559.1"
FT                   /translation="MDIQKALAQFITFGSEKDEAIDVIVSAAAAKQPLFTLSTSIMLNV
FT                   FERCLHNEIVLDDLELWANVIEARDDIDCAECEGVIYALSNSEQMGELNYEKLAKLATL
FT                   LQE"
FT   gene            complement(480524..481492)
FT                   /gene="fbp"
FT                   /locus_tag="PSHAa0463"
FT   CDS_pept        complement(480524..481492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="PSHAa0463"
FT                   /product="Fructose-1,6-bisphosphatase"
FT                   /function="2.1.1.1 : Glycolysis/gluconeogenesis"
FT                   /EC_number="3.1.3.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2843822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85560"
FT                   /db_xref="GOA:Q3IFQ5"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFQ5"
FT                   /protein_id="CAI85560.1"
FT                   /translation="MRRLPPVLLEDGCPRELISLIRTILAACKEISFRVGQGELSGVLG
FT                   STLDENIQGETQKKLDVLTNQLLKDILLESGYVKAIASEEEDYTVAGNPDAEYIVAFDP
FT                   LDGSSNTDINSLVGTIFSVMKAPEGADPADQSIFMQPGINQVAAGYVLYGPSTILALTT
FT                   GKGTRFFTLDKTHGTFLLTQDFAKIPADTNEYAINASNQRHWQPAMQNYINDLVAGDTG
FT                   PRARNFNMRWIAAMVGDVHRVLSRGGLFTYPTDTKNPSQPNKLRLLYEANPMAMLVEQA
FT                   GGIASTGTERIMDIQPNAIHQRVAVILGSKNEVETCLGYHK"
FT   gene            481647..484076
FT                   /locus_tag="PSHAa0464"
FT   CDS_pept        481647..484076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0464"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85561"
FT                   /db_xref="GOA:Q3IFQ4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ4"
FT                   /protein_id="CAI85561.1"
FT                   /translation="MQKIKLLGYILFTVLLTMITQAHAAIKSIDEFTGKMNHFPGYFSF
FT                   FYDTENGKVYLKVDKLEQQFLLQQSLPNGLGSNDIGLDRGQLGNTHLVQFERFGDKVML
FT                   RAVNTYYRANTSNKAEQQSINEAFASSILAGFKVVAQNKRALLIDYTPYLLSDVHGVNR
FT                   TLAATKQGNFNLDESRSAVYMSRSKAFINNTELEAVLTFAGTQPGKFVREISPDAYSLT
FT                   VHMHHSLIKLPDDNYTPRNFHPQSGFWSIEHKNYAAALGESMYVRYIPRHRLTKKDPSL
FT                   PISEPIEPIVYYLDPGVPEPVKSALLEGAQWWDEAFSAAGYKNAFIIKVLPTNADPMDI
FT                   RYNVVQWVHRATRGWSYGSSVIDPRTGEIIKGHVTLGSLRVRQDILIAEALAAPYLNGN
FT                   EIAKALQAMALDRIRQLSAHEIGHTLGISHNFAASVGDRASVMDYPHPLLSFDEQGKLD
FT                   VSRGYATGMGVWDTQVIKYGYSDFTNQNETAALAAILKENNTKGLEFISDSDARAAGGA
FT                   HPTAHLWDNGAAPSEELLRVLEVRKQALAQFGIHNIKTGEALSQLEEKLVPLYLFHRYQ
FT                   VEAVAKLIAGVNYKYEVRGDKPVKGAQVVAKPAQQQAVKAILTTLEGRNLVLPESILAL
FT                   IPPKAYGESRTRESIVGRTGLTLDAMALPEVAVQHSLSLLLNAQRLNRLAQQQARSDDF
FT                   YSLDELLLQLYKQVFVALPSNNMVAKITQRVQFLSAKTMADLVASDNVSPEVQAQLRYY
FT                   LTKLKDDFEQNSLLSNTSIGESAFKQYLAEQVNLFLTTGSWPDNFKALPIPPGSPI"
FT   gene            484287..485060
FT                   /locus_tag="PSHAa0465"
FT   CDS_pept        484287..485060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0465"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85562"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP2"
FT                   /protein_id="CAI85562.1"
FT                   /translation="MAFLSRSILALSVALLSNNVFAQKQCDVELRHGLIITDDIIRIVD
FT                   KGQTRVQINNNNQLFIRGYWIDLSDDESKVLEQFSSGIRQTVPELVNLATDGVNLGLSA
FT                   IEHVVEGMTDKESEVLKTQLQYVERALMDKFKRGDDFFFIAPQSLSKIDDFFTKDISKK
FT                   IHSAVHGSLGAILMSLGDAFKSREGNIEDRMNDMSQRMDIISSEIDKSLQEKARQLELK
FT                   AAEYCECLNALDVTESRLQAIVPGMVNFDLVQIKS"
FT   gene            complement(485171..486241)
FT                   /gene="rffE"
FT                   /locus_tag="PSHAa0466"
FT   CDS_pept        complement(485171..486241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffE"
FT                   /locus_tag="PSHAa0466"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7559340; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85563"
FT                   /db_xref="GOA:Q3IFQ3"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ3"
FT                   /protein_id="CAI85563.1"
FT                   /translation="MAPLVHALTNDSRFEAKVCVTAQHREMLDQVLELFKITPDYDLNL
FT                   MKAGQTLPEVTSRILLELTPVLKEFKPDVVLVHGDTATTFAASLAAYYEQIAVGHVEAG
FT                   LRTGNIYSPWPEEGNRKLTGSLTKYHLAPTENSKANLLKENHAAENISVTGNTVIDALL
FT                   MVKQQIENDAELSNTLASQFPMLDENKKLILVTGHRRESFGGGFERICEALAQTAKTHP
FT                   NTQILYPVHLNPNVQEPVKRILKDVDNVHLIEPQQYLPFVYLMNRAHIILTDSGGIQEE
FT                   APSLGKPVLVMRDTTERPEAVEAGTVKLVGTDVAKITAALNELLTDDAAYKTMSRAHNP
FT                   YGDGNACQRICDILAR"
FT   gene            complement(486414..487112)
FT                   /gene="rsuA"
FT                   /locus_tag="PSHAa0467"
FT   CDS_pept        complement(486414..487112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="PSHAa0467"
FT                   /product="16S rRNA pseudouridylate 516 synthase"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7612632; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85564"
FT                   /db_xref="GOA:Q3IFQ2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ2"
FT                   /protein_id="CAI85564.1"
FT                   /translation="MKFPCRLDKFISHLAELPRSKARASIKRQAALVNGEVVTAFDFQI
FT                   KQQDEVVFQGEQLVFLGKRYFMLNKPVGYVSANSDELHKTVFDLIDEPNMSDFHVAGRL
FT                   DIDTTGLVILTNDGDWSHKITSPKNNKFKTYLVETQEPITDESLDALREGVQLHNEKAL
FT                   TRPAKAERLANYGLRLSICEGKYHQVKRMLAAVDNKVVELHREQIGNIKLDENLAAGEY
FT                   RLLTAEEIKL"
FT   gene            487172..488281
FT                   /locus_tag="PSHAa0468"
FT   CDS_pept        487172..488281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0468"
FT                   /product="conserved protein of unknown function ; putative
FT                   ATPase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85565"
FT                   /db_xref="GOA:Q3IFQ1"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ1"
FT                   /protein_id="CAI85565.1"
FT                   /translation="MTVQDTQIISLYQAKVASGELSFDAAQNNAVQALNSLSEQLQMHY
FT                   SWWQKSPLIKGVYLYGPVGRGKSMLMDLFYNNVAISKKQRLHFHHFIAQVHQQLGQLQG
FT                   QKDPLIIIAKNWAKNIRVLCFDEFFVSDIGDAMIMARLFDALFKQGVVLVATSNAKPEQ
FT                   LYYNGLQRARFLPTIDLINNYCEIVNVAGEEDHRFRYGKNSSHYFINLPSDDFKAKFLT
FT                   QYPQASHSGNITVHGRALPYLLKTANALMIDFMALCSGPRSANDYMFLAQQFSVLYVAN
FT                   VPKMGVGATGKVIVHGIEDSYQREKQTLDEHFFDDEARRFIALVDEFYDCHKLLVINAQ
FT                   ADIDTLYQGKKLSFEYARTQSRIVEMQNW"
FT   gene            complement(488463..489476)
FT                   /gene="galE"
FT                   /locus_tag="PSHAa0469"
FT   CDS_pept        complement(488463..489476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="PSHAa0469"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="2.1.3.5 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="5.1.3.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1956282, 3022232; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85566"
FT                   /db_xref="GOA:Q3IFQ0"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ0"
FT                   /protein_id="CAI85566.1"
FT                   /translation="MTILVTGGAGYIGSHTVLELLQQNSNVVVIDNLSNSSSESLTRVK
FT                   KITGKEVTFYQGDILDKAFLDSVFAKHTIESVIHFAGLKAVGESVVKPIEYYQNNVQGT
FT                   LTLVDAMRDAGVFKLVFSSSATVYGDPASLPIKEDFPVGGTTNPYGTSKLMVEMMLQDI
FT                   AKSDERFAFAILRYFNPVGAHESGLIGEDPNGIPNNLLPYISQVAVGKLKQLAVFGDDY
FT                   DTVDGTGVRDYIHVVDLALGHLKALNKIATNTGALVYNLGTGNGYSVLQMVNAFIKASG
FT                   QAVPYQVSPRRPGDIAACYAAPEKALNELDWQAMRGIDTMMQDTWRWQSNNPNGYK"
FT   gene            489751..490242
FT                   /locus_tag="PSHAa0470"
FT   CDS_pept        489751..490242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0470"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85567"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP9"
FT                   /protein_id="CAI85567.1"
FT                   /translation="MNPVNKIAMLMCFALPALAHAGESAIKWHDFKDYRDVRESNQGKA
FT                   SYHKHIASSIEEHVAKLAEQLPKDYKLSLEITDVDLAGDVRYGGINEIRVVKPIYFPQL
FT                   KLNYSLTNDKGEVISAASDVKLKDMGFMDKIKMGRDEPFNYEKRLLTEWFGEEILSKVD
FT                   "
FT   gene            complement(490322..490612)
FT                   /locus_tag="PSHAa0471"
FT   CDS_pept        complement(490322..490612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0471"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP8"
FT                   /protein_id="CAI85568.1"
FT                   /translation="MDSIIEQLNANLKIVYRQALDADKKLDELQQQGHGKFKALFTADS
FT                   GFTFEAKRFKPYVLDVAADVESLSSDGFNEEKLKTTVIKLQQLLTLLATFK"
FT   gene            490781..490990
FT                   /locus_tag="PSHAa0472"
FT   CDS_pept        490781..490990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0472"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85569"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP7"
FT                   /protein_id="CAI85569.1"
FT                   /translation="MNISGGNLPVMPSSSQGGEVLSAALSKKQQLADGAAALALIEGAA
FT                   QSSSAQTPTQSATATLGNNVNIYV"
FT   gene            complement(490999..491925)
FT                   /gene="kamA"
FT                   /locus_tag="PSHAa0473"
FT   CDS_pept        complement(490999..491925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kamA"
FT                   /locus_tag="PSHAa0473"
FT                   /product="putative lysine 2,3 aminomutase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11222759, 11578923, 10839984, 14532061;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85570"
FT                   /db_xref="GOA:Q3IFP6"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP6"
FT                   /protein_id="CAI85570.1"
FT                   /translation="MVGLSSQVHDNDIKARSLFPVRVPIPFIKKMRKGDANDPLLLQVM
FT                   PRHQEFLTKSGFNKDPLLEQSNQQPGLLHKYKSRVLVMFKTGCAVNCRYCFRRHFPYQE
FT                   NQLNKRSLLDALSYIKSDNNINEVILSGGDPLMAKDDAISWFLDELEQLPQIKRMRIHT
FT                   RLPVVIPARITDELCERLARSPLKIVFVNHINHANEIDDDFKAAMQKLKQVGVVLFNQA
FT                   VILKDVNDTTAAQVNLSEALFDADVLPYYLHLLDKVEGASHFDISEEQAIKIMAELLEA
FT                   LPGFLVPKLVREIGGEKSKTPIDLKLI"
FT   gene            492054..492620
FT                   /gene="efp"
FT                   /locus_tag="PSHAa0474"
FT   CDS_pept        492054..492620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="PSHAa0474"
FT                   /product="elongation factor P (EF-P)"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85571"
FT                   /db_xref="GOA:Q3IFP5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFP5"
FT                   /protein_id="CAI85571.1"
FT                   /translation="MANYSTNEFKGGLKIMMDGEPSSIIENEMVKPGKGQAFNRVRIRK
FT                   LISGKVLEKTFKSGESVEGADVMDTDLAYLYTDGEFWHFMNNETFEQIAADEKALGDAG
FT                   KWLVENDVCTITLWNGNPIVVTPPNFVELEITETDPGLKGDTAGTGGKPATLSTGAVVR
FT                   VPLFVQIGEVIKVDTRNGEYVSRVK"
FT   gene            492680..493654
FT                   /locus_tag="PSHAa0475"
FT   CDS_pept        492680..493654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0475"
FT                   /product="putative fold recognizing lysyl-tRNA"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 5653192"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85572"
FT                   /db_xref="GOA:Q3IFP4"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFP4"
FT                   /protein_id="CAI85572.1"
FT                   /translation="MSVNLWAPSASIATLKQRAVILRSIREFFYARNVMEVETPSLSGA
FT                   SVTDIHLVSFNTRFVGPGHASGLELYLQTSPEFAMKRLLAAGSGPIFQLCKAFRNEEAG
FT                   SHHNPEFTMLEWYRPGFDEFALMAEIDELMQLILDVAPSERLTYQHAFEQVLGLDPLTA
FT                   SLEQLQQLACEQGFADIAKNETHRDTLLQLLFCMKVEPTIGQHKPCFVYHFPASQAALA
FT                   QICDHDSRVAGRFELYYKNMELANGFNELTNATEQAKRFNDDNEYRKQNGLKQVPMDKH
FT                   LIAALEHGLAPCAGVALGIDRLVMLATQKSNIKEVIAFDVTRA"
FT   gene            complement(493796..495895)
FT                   /locus_tag="PSHAa0476"
FT   CDS_pept        complement(493796..495895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0476"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85573"
FT                   /db_xref="GOA:Q3IFP3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP3"
FT                   /protein_id="CAI85573.1"
FT                   /translation="MNLRLSLITAALLPLFGASVTANADDTDLERIVVTGDFQRESIQT
FT                   LSASASLFSEDEVNLRGATYLDEMLGSTANINFASGASRGRYIQIRGVGLRSQFVDPIN
FT                   PSVGLVIDGINYSGLGGSALLFDIDQVEIYRGPQGTRFGADGMAGMIQMQSAQATSDPS
FT                   LKLQVGAGTYNSREAGLAASTGLTDDTSARVSYFRRKSDGYVDNLYLNKPTQGQDEQVA
FT                   RFKLNSQITANLRTELNLHYIDINNGYDTFALDNGRNSVADEPGEDNQLSYAIGLNNTY
FT                   TGFDLFDVNLSLSAIDSELFYSFDEDWVCNDPSKPQLCAAGLHPDGYSSTDVYSRDRDD
FT                   QGVDLQFKSKTGNWVAGLYYQNRDVDLERQYTWLASPFNSTYETNNVAVYGQLATPIGP
FT                   KTTLITGLRVEQYQGDYTDNNGFIEDTDDIMVGGKIALEYQVIDRTMIYTSITRGYKAG
FT                   GINSEALAKAKDEGLNLDAEFFKQHTSFDPEYLWSGEFGVKGSSLDDKFILRLAAFYMH
FT                   RDNIQLKSWQVQDQKFTGYVDNASSGSNYGLELEGSYQLTDDLLITGSAGYLNTKINKF
FT                   VTKAGLNQDGRDQAQSPKYQYALSARYNLTNELYAMVGVEGKDDYYFSDSHNAQAPNSN
FT                   LVNVSLGYEADSWAVRAWARNVFDETVPTRGFEFGNNPLDGYADHTYTQLGEPRVAGVT
FT                   FTLNL"
FT   gene            495998..496399
FT                   /locus_tag="PSHAa0477"
FT   CDS_pept        495998..496399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0477"
FT                   /product="conserved protein of unknown function ; putative
FT                   thioesterase superfamily"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85574"
FT                   /db_xref="GOA:Q3IFP1"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP1"
FT                   /protein_id="CAI85574.1"
FT                   /translation="MTFTVDFKVRDYECDLQGIVNNSVYFNYLEHARHEFLHAHGVDFA
FT                   QLAKDKINLVVMRSEMDYKQSLLPGDEFYVAVEPQRISRLKFAFKQTLIRKHDEKIMLN
FT                   ALVIGTALNEKGRPFLPAQIDNLFKTDSE"
FT   gene            496544..496921
FT                   /locus_tag="PSHAa0478"
FT   CDS_pept        496544..496921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0478"
FT                   /product="putative heat shock protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8349564; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85575"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP0"
FT                   /protein_id="CAI85575.1"
FT                   /translation="MLIIGLCVGCASTQTVTSEQLKHTQWQLSRIDGLAIPPSFNASVG
FT                   FIEALQVNGFAGCNKFFGEGELDDSSLTVNKIGMTRKSCGQQLDKFEQQLLHALQQGAQ
FT                   LKMQDQQLVMQGEKTFVFIAK"
FT   gene            497369..499321
FT                   /gene="thiC"
FT                   /locus_tag="PSHAa0480"
FT   CDS_pept        497369..499321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="PSHAa0480"
FT                   /product="thiamine biosynthesis protein thiC"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85576"
FT                   /db_xref="GOA:Q3IFN9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN9"
FT                   /protein_id="CAI85576.1"
FT                   /translation="MSNTAKKSSRRETRAAASEYIYNLTGQPFPNSHKVYVEGTQNNIR
FT                   VGMREITLSDTYIGGSDENPVYEPNEPLRVYDTSGPYTDPNFKLDVRQGLAKFREQWIE
FT                   SRGDTELLESVTSRFTQQRMADEGLDHLRFEHLPKIRRGKAGKNVTQMHYARQGIITPE
FT                   MEYVAIRENMGRKKIHAELLAAQHKGESFGASIPDFITPEFVRDEIARGRAILPNNINH
FT                   PETEPMIVGRNFLVKVNANIGNSSVSSSIEEEVEKMVWSTRWGADTVMDLSTGRYIHET
FT                   REWVVRNSPVPIGTVPIYQALEKVNGVAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVLL
FT                   RYVPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYTHFEDICEILKQYDICFSLGDGLR
FT                   PGSIADANDEAQFSELRTLGELTKLAWKHDVQVFIEGPGHVPMHMIKANMDEQLKHCDE
FT                   APFYTLGPLTTDIAPGYDHITSGIGAAQIAWYGCAMLCYVTPKEHLGLPNKEDVKEGLI
FT                   TYKIAAHAADLAKGHPGAQERDNALSKARFEFRWHDQFNIGLDPERAREYHDETLPQES
FT                   GKVAHFCSMCGPKFCSMKISQEVREYAKDLEARGIDPANAADTITIKMIDVEAQMKAKS
FT                   DEFKKTGSEIYHKAI"
FT   gene            499379..500380
FT                   /gene="thiO"
FT                   /locus_tag="PSHAa0481"
FT   CDS_pept        499379..500380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="PSHAa0481"
FT                   /product="putative thiamine biosynthesis oxidoreductase"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85577"
FT                   /db_xref="GOA:Q3IFN8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN8"
FT                   /protein_id="CAI85577.1"
FT                   /translation="MFYNIAVVGFGLTGRLAALELSKQHRVTVFEADDEHSQNSAGKVA
FT                   AAMLAPLAESVLCEADLALMGLDSIKRWPGIIDKLDSEVFFQQQGTLVVAHQQDKGDLL
FT                   SFAQRLKPLANYTGESVNSQQIEMLEPELANRFSQGLFLPCDGQIDNQAFYQASFTQLN
FT                   KRKVKFVFNQRVTINDNKINNREFDYIIDCRGLGAKDDKPLRGVRGEVARLYAPEVSLT
FT                   RPVRLMHPRYPIYIAPKPNNEYVIGATEIESQDTGPATVRSALELLSAAYTVHSGFAEA
FT                   RLLNIQTGLRPAFSDNRPQVTHVGRVISINGLYRHGYMLAPSLVANALLCIE"
FT   gene            500388..500582
FT                   /gene="thiS"
FT                   /locus_tag="PSHAa0482"
FT   CDS_pept        500388..500582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="PSHAa0482"
FT                   /product="putative ThiS protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10382260"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85578"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN7"
FT                   /protein_id="CAI85578.1"
FT                   /translation="MNITINGELIAISSNKLINCLQDFGGVAPFAVAINGEFIPQSQHS
FT                   DYQLTEGDSIELLSPIQGG"
FT   gene            500588..501379
FT                   /gene="thiG"
FT                   /locus_tag="PSHAa0483"
FT   CDS_pept        500588..501379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PSHAa0483"
FT                   /product="thiazole biosynthesis protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85579"
FT                   /db_xref="GOA:Q3IFN6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN6"
FT                   /protein_id="CAI85579.1"
FT                   /translation="MPNNDYLTIYGEQIKSRLLIGSALYPSPAVMNESIVASGAEIVTV
FT                   SLRRQQSAAAGDDFWQLIKNTGLKILPNTAGCHSVKEAITLAKMCREVFATDWIKLELI
FT                   GDDYNLQPDPFALLEATKILIDDGFKVLPYCTDDLVLCQRLNALGCEVLMPWGAPIGTG
FT                   KGLLNSYNLKTIRERLPEATLIVDAGLGLPSHACQALELGYDAVLLNSAIAGAGCPITM
FT                   SRAFKAAVEAGRFAYNAKAMPEKDVAAPSTPTMGMPFWHQE"
FT   gene            501391..502917
FT                   /gene="thiDE"
FT                   /locus_tag="PSHAa0484"
FT   CDS_pept        501391..502917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiDE"
FT                   /locus_tag="PSHAa0484"
FT                   /product="putative phosphomethylpyrimidine
FT                   kinase/thiamin-phosphate pyrophosphorylase"
FT                   /function="2.5.10 : Thiamine"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.5.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85580"
FT                   /db_xref="GOA:Q3IFN5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN5"
FT                   /protein_id="CAI85580.1"
FT                   /translation="MNNVVWTIAGSDSGGGAGIQADIKAMQSFGVHGCTAITALTAQNS
FT                   LGVEAINAVSTDIIESQLLALEKDMKAKVIKIGMLANVQQIQLISEHISHYKAKWPVPP
FT                   VIVYDPVAIASSGDLLTEEDTVSAIKECLLPLVDVITPNTHETQLLTGVYLIGPAAIKE
FT                   AANKLLSWGAKAVVIKGGHWDYPSGYCIDYCINNFTQKGEEYWLGNEKIQTPHNHGTGC
FT                   SMASVIAACLAKDYPLKDAFILAKAYINQGLKVAVRYGEGIGPVAQTSFPTNLADYPQV
FT                   IEAGSWLGDELDFDVPLDFNMAADFAPCESKSLGLYAVVDSVDWLEKCLQQGVKTVQLR
FT                   VKNKDDAQLDELVAKAVALGEQYNAQVFINDYWQLAIKHGAYGVHLGQQDLENTNLAAI
FT                   KNAGLRLGLSTHGFYEMLRAHNYRPSYLAFGAIYPTTTKDMTGQIQGLEKLFKFVPLMQ
FT                   SYPTVAIGGIDLKRASQVAKTGVGSVAVVRAISEADDYVQAISALQAAIN"
FT   gene            502940..503686
FT                   /gene="thiF"
FT                   /locus_tag="PSHAa0485"
FT   CDS_pept        502940..503686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="PSHAa0485"
FT                   /product="putative adenylyltransferase; thiamine
FT                   biosynthesis protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9632726, 8432721; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85581"
FT                   /db_xref="GOA:Q3IFN4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN4"
FT                   /protein_id="CAI85581.1"
FT                   /translation="MNELSDKEMLRYSRHILLKEVGLAGQLKLKSASVAVVGAGGLGSP
FT                   ALLYLAAAGIGKLILIDDDAVELSNLQRQVLYKVNHLGQKKVVAAGKVLASLNNQITII
FT                   THAEKLTQDNSAALLNNADIVLDCSDNFTTRYSVNRFCVQHKTPLISGAALATKGQLIS
FT                   LDLRNANSPCYGCIFPQSDIAPLINCDNAGVISPLLGIIGSMQAQLTLNMLLSHSSDCV
FT                   FMSINALTLQQQQFKVVKDIDCKECR"
FT   gene            complement(503857..504684)
FT                   /gene="psd"
FT                   /locus_tag="PSHAa0486"
FT   CDS_pept        complement(503857..504684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="PSHAa0486"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="4.1.1.65"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3042771, 8244943, 12900013; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85582"
FT                   /db_xref="GOA:Q3IFN3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN3"
FT                   /protein_id="CAI85582.1"
FT                   /translation="MPKHFISRVVGKLAAAKAGVLTTTLIKLFIKQYKVDMSEAKHPDP
FT                   AHYESFNEFFTRPLKDGARPIVADSDIIIHPVDGAISQLGDIVDGQLIQAKGHDYSLQA
FT                   LLGGNKDDTTPFLGGKFATIYLAPKDYHRIHMPIDGTLSKMIYVPGDLFSVNPLTAQNV
FT                   PNLFARNERVVAIFETEIGPLAMVLVGATIVASIETIWAGTVTPPAGSDVFSWNYPTKG
FT                   ENAISLKKGEEMGRFKLGSTVVLAWGDDKADILDDQLPETVTRLGTPFAKIDD"
FT   gene            complement(504739..505797)
FT                   /locus_tag="PSHAa0487"
FT   CDS_pept        complement(504739..505797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0487"
FT                   /product="putative GTPase engC precursor"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85583"
FT                   /db_xref="GOA:Q3IFN2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN2"
FT                   /protein_id="CAI85583.1"
FT                   /translation="MAKQKKLSKGQSRQIKANHQKRISSADARPAKKGAQEWQTDNLGQ
FT                   VESAIVISRFGQHADVEVESGEVLRCNIRRTVSNLVCGDEVLFRRAKVSEGDLAGVIEA
FT                   TQERRSQLTRPDFYDGVKVIAANIDQILMVSAVLPEFTPSIIDRYLIACEDMGIEPILV
FT                   LNKIDLIDAQGLSEIQKVLDVYRKLDYKVLLVSNISTDGIDELKDVLVGKNNIFVGQSG
FT                   VGKSTLVNTVLPDAEILTKEVSENSGLGQHTTTVSRLHHLPSGGNLIDSPGIREFGLWH
FT                   LEVDRVTWCFKEFREFIGGCRFRDCKHLNDPGCIIKEAVADGKISQLRFDSYHRILETM
FT                   ADGRAGSRAPRV"
FT   gene            505919..506464
FT                   /gene="orn"
FT                   /locus_tag="PSHAa0488"
FT   CDS_pept        505919..506464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="PSHAa0488"
FT                   /product="oligoribonuclease"
FT                   /function="3.2.2.2 : Ribonucleases"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9573169; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85584"
FT                   /db_xref="GOA:Q3IG97"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IG97"
FT                   /protein_id="CAI85584.1"
FT                   /translation="MNINKSNLIWLDLEMTGLEPETDKILEIATVVTDADLNILAEGPT
FT                   IAIHQSNELLDNMDEWCTTQHGKSGLTARCKASTYDEAYAVEQTIAFLKQWVPAGASPM
FT                   CGNSIGQDRRFMNKYMRELEDFFHYRNLDVSTIKELARRWKPEVLAQVNKKGSHLALDD
FT                   IKDSIMELKVYREKFFNL"
FT   gene            506472..506591
FT                   /locus_tag="PSHAa0489"
FT   CDS_pept        506472..506591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0489"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85585"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG96"
FT                   /protein_id="CAI85585.1"
FT                   /translation="MQTHCIIVESCPAQDDNPRGVSVFELFKYKAILAQLLEC"
FT   gene            506639..506714
FT                   /locus_tag="PSHAatRNA10"
FT   tRNA            506639..506714
FT                   /locus_tag="PSHAatRNA10"
FT                   /product="tRNA-Gly"
FT   gene            506920..506995
FT                   /locus_tag="PSHAatRNA11"
FT   tRNA            506920..506995
FT                   /locus_tag="PSHAatRNA11"
FT                   /product="tRNA-Gly"
FT   gene            507112..507187
FT                   /locus_tag="PSHAatRNA12"
FT   tRNA            507112..507187
FT                   /locus_tag="PSHAatRNA12"
FT                   /product="tRNA-Gly"
FT   gene            complement(507477..507905)
FT                   /locus_tag="PSHAa0491"
FT   CDS_pept        complement(507477..507905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0491"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85586"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG95"
FT                   /protein_id="CAI85586.1"
FT                   /translation="MSWQQKAITLKPRIRGFHLIDDEILTQIPELTNYKVGLLHLFIQH
FT                   TSASLTINENADPTVRMDMESHFNEFVPQCQPYYRHDYEGDDDMPAHIKTSILGCELSI
FT                   PITNGYLALGTWQGVYLGEHRDNGGTRRIVATIQGELF"
FT   gene            complement(507902..508369)
FT                   /locus_tag="PSHAa0492"
FT   CDS_pept        complement(507902..508369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0492"
FT                   /product="conserved protein of unknown function ; putative
FT                   CheC-like protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85587"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG94"
FT                   /protein_id="CAI85587.1"
FT                   /translation="MNVEFINPFLSSLINVLSTMAQTQLKPGKPRIKTDEKACGDVSGL
FT                   IGMVGPQTRGSFSITFDEQLALTIMERMLGERPDSINEEVTDMVGEITNMVTGGAKNLL
FT                   GQKGFDFDMATPIVVSGKDHTITHKSQGKKILMPFTCDAGNANIEVSFDKL"
FT   gene            complement(508433..508870)
FT                   /gene="zur"
FT                   /locus_tag="PSHAa0493"
FT   CDS_pept        complement(508433..508870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="PSHAa0493"
FT                   /product="Zinc uptake regulation protein"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9680209; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85588"
FT                   /db_xref="GOA:Q3IG93"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG93"
FT                   /protein_id="CAI85588.1"
FT                   /translation="MNIESLVSKAKQVCDNRGARFTPIREKVFRLLASAQGGVGAYDLL
FT                   EQLKVTETGAKPATIYRALDFLAELGFIHKIESTNAFMLCHHFDHIHPVQLLICDTCGF
FT                   VKELHSTVISHELNSLAAEGGFVVSAQTIEAHGRCESCRAA"
FT   gene            509920..511447
FT                   /locus_tag="PSHAa_rRNA16s9"
FT   rRNA            509920..511447
FT                   /locus_tag="PSHAa_rRNA16s9"
FT                   /product="16s"
FT   gene            511749..514637
FT                   /locus_tag="PSHAa_rRNA23s9"
FT   rRNA            511749..514637
FT                   /locus_tag="PSHAa_rRNA23s9"
FT                   /product="23s"
FT   gene            514781..514897
FT                   /locus_tag="PSHAa_rRNA5s10"
FT   rRNA            514781..514897
FT                   /locus_tag="PSHAa_rRNA5s10"
FT                   /product="5s"
FT   gene            515246..516178
FT                   /gene="dusA"
FT                   /locus_tag="PSHAa0499"
FT   CDS_pept        515246..516178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="PSHAa0499"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11983710; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85589"
FT                   /db_xref="GOA:Q3IG92"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG92"
FT                   /protein_id="CAI85589.1"
FT                   /translation="MLDWTDRHCRTFHRKMTKHTVLYTEMITTGAILFGRGDYLHFNQH
FT                   EGPVALQLGGSDPQALAQCAKLAGERGYDEINLNVGCPSDRVQNGRFGACLMGEPQLVA
FT                   DCVAAMKAEVNIPVTVKTRIGIDEQDSYEFLCALIEASHNVGCDDFIIHARKAWLKGLS
FT                   PKENREVPPLDYPRVYQLKKDYPQLDLSLNGGVKTIEQSLEHLQHIDGVMIGREAYSNP
FT                   FILNEVDEKIYGDIANTQSRHDVVRSMYSYIEDEMRLGANFWHVARHMLGIFQGQPGAR
FT                   GFRRHLSENGHGKQADLSVMDKALSFVPE"
FT   gene            516432..517112
FT                   /gene="pspA"
FT                   /locus_tag="PSHAa0500"
FT   CDS_pept        516432..517112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="PSHAa0500"
FT                   /product="putative negative regulatory gene for the psp
FT                   operon, phage shock protein A"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 1712397; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85590"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG91"
FT                   /protein_id="CAI85590.1"
FT                   /translation="MGIFNRVTDIVQANIVSILDKAEDPEKSLNLMLSEMQDALTECRI
FT                   TTAALLCEEKTLKRQIENKNNNLVYWQDKAELAIERGRDDLAKSALLEKQTISNTVVAK
FT                   QLQLETLQQSIAKMTADCQRLQQRIAEAKAKQTQLVQRHNIVAARGQINSQLQSEKVAH
FT                   ALSRFEKVEQRVEGIEAQVEAYELTDSENTIAAQIDALVKNEQVDAELARLKADLKTNL
FT                   KQSA"
FT   gene            517123..517329
FT                   /gene="pspC"
FT                   /locus_tag="PSHAa0501"
FT   CDS_pept        517123..517329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspC"
FT                   /locus_tag="PSHAa0501"
FT                   /product="putative phage shock protein C"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 1712397"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85591"
FT                   /db_xref="GOA:Q3IG90"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG90"
FT                   /protein_id="CAI85591.1"
FT                   /translation="MNSFNSKRGWYKDPLDKKIFGVCSGLAQRLDLPVWSTRLVTILLF
FT                   LSFPFAIALGYFIAHCCLEEKAI"
FT   gene            517366..517692
FT                   /locus_tag="PSHAa0502"
FT   CDS_pept        517366..517692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0502"
FT                   /product="conserved protein of unknown function ; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85592"
FT                   /db_xref="GOA:Q3IG89"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG89"
FT                   /protein_id="CAI85592.1"
FT                   /translation="MKALAVCIIVYLLFFTDVVSAVHFDTWQLPLWIADTSWTGLELIG
FT                   ALAAIIIFVAVAVLITIGLVGAAAVALVGTVLAFLFGSLMIAWPLLFIAVLCWLVADNK
FT                   KVAS"
FT   gene            517771..518280
FT                   /locus_tag="PSHAa0503"
FT   CDS_pept        517771..518280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0503"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85593"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG88"
FT                   /protein_id="CAI85593.1"
FT                   /translation="MIKQCISIVLVSVLSLFSSSSMAHSGHEHDADVAIIKVSNAQVRE
FT                   FLPATTSSVGYLSIINHSDTVATLTKATIDGLGRVEIHEHSHVDGMMKMQKVESLTINA
FT                   HQQIDFKPGGYHLMIFEPQEPLKVGQQRKLTLYFSDGNRVFTNAQVVSLASQAEQSQAS
FT                   KQHTHH"
FT   gene            518289..519275
FT                   /locus_tag="PSHAa0504"
FT   CDS_pept        518289..519275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0504"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85594"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG87"
FT                   /protein_id="CAI85594.1"
FT                   /translation="MSQHKGKIVAALAILLIIFYAIAVYWSTEPARFNVVEKAKQQAQQ
FT                   RNEQFVIGYTTTSTLITVASTLLEKPGGYLSNDVLPPSIIMDDMPAWEYGALEMVRDLA
FT                   LSMRKDFSRSQSQSTEHEALKKAQPQFNISSEAWAWPSAEGEYQKGIDYLLVYRTQIAN
FT                   DHERDSQFYARADNLRSWLKEAEKRLGSLSQRLSASVGQDKVNTDLAGNTSNTQATFSP
FT                   LQQQAKTPWLDIDDVFYESRGATWALLHFLQAVEYDFADVLEKKNARVSVQQIIRELEA
FT                   TQETVWSPMILNGNGFGYVANHSLVMANYISRANAALIELSELLTQG"
FT   gene            519279..520049
FT                   /locus_tag="PSHAa0505"
FT   CDS_pept        519279..520049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0505"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85595"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG86"
FT                   /protein_id="CAI85595.1"
FT                   /translation="MKKYCLAAALSMACLAPAAQADTLLGLYVGVDGWKADNEGSFSYK
FT                   GNAPQDFNFDDETFVSYYAALEHPVPLVPNIKLRYTELELTGSTRLDKTFSFNGSDYVV
FT                   GTTVNSVSDLTHIDYTFYYEIFDNDLISIDLGVNAKQFDGEILVKGTTQQGGADYTETV
FT                   EFSGFVPLVYGRAEAGLPFTGLSVFFEGSFVAIDDSKVQDYQMGIAWEFIDNLAIDVAV
FT                   KAGYRSMTLELDDIDDINTNIDASGPFAGIQVHF"
FT   gene            complement(520086..520973)
FT                   /locus_tag="PSHAa0506"
FT   CDS_pept        complement(520086..520973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0506"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85596"
FT                   /db_xref="InterPro:IPR021254"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG85"
FT                   /protein_id="CAI85596.1"
FT                   /translation="MAVKTAQARINLANTIESLLGYPIIKVGNNEASHNNEQSYGPQGK
FT                   VKPLYRINSDNTVLARAQKRQDLLLIKQQQNIETILAMAMDFCPDVASSKQPDADWVEH
FT                   FVALCGDTSNQSMQSLWAKILTGETLNPGTFSIKSLQTLKHMTQREADSLQKCVSLSGY
FT                   NEKDDSHFILLGFYKKPSLFDLLRKGNKVSLNLGKTGISFPDILTLMDLNLLYRKEIES
FT                   AVLKTGQELTLSFLSQKVTLKAKNSDLVLSYYKFTQTGDELSKLINYPVNKVYKQLLNS
FT                   ALESEFELAWHTTK"
FT   gene            complement(520942..521502)
FT                   /locus_tag="PSHAa0507"
FT   CDS_pept        complement(520942..521502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0507"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85597"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG84"
FT                   /protein_id="CAI85597.1"
FT                   /translation="MLVQLLLVLLLLFIVIGLLLPQSYNVTKSININANTHIVKPLITD
FT                   FSQWHKWSPWKKLDPSVEFSLGEPSTGVGAHQSWQSKWGAGEMTTTALSANKMVLNILF
FT                   AQEHIIAANVIFTQNAKTVTVTFQITGQATLPLVSGYVAVLSEHILSNAVSLGLNNLKT
FT                   VAQLSDAQTIMESHGSQNRTSKN"
FT   gene            521804..523981
FT                   /locus_tag="PSHAa0508"
FT   CDS_pept        521804..523981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0508"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85598"
FT                   /db_xref="GOA:Q3IG83"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG83"
FT                   /protein_id="CAI85598.1"
FT                   /translation="MSTLKAKRALFSYPKYWAECYGTAPFLPTTREEMDALGWDSCDII
FT                   IISGDAYVDHPSFGMAVIGRVLEAQGFRVGIIAQPEWDSKEAFMALGKPNLFFGVTAGN
FT                   MDSMINRYTAEKRMRHDDAYTPDNIGGKRPDRAVIIYSQRCREAYKDVPLILGGIEASL
FT                   RRVAHYDYWQEKVRRSVLFDAKADILIYGNAERPLVEVAHRIAAGESTDTIQDVRGTAV
FT                   IRKEPLPGWRGSDSTAIDKIGKIDPIPNPYGADDVGCSKSEFKQAGIDLKAEAAKVITI
FT                   QPARPKPWEKTYVKLPAFEQVSVNKPLYAHASRIVHQETNPGCARAIFQRHGDRSIWVN
FT                   PPAYPLETHEMDAVFGLPYQRIPHPSYGDAKIPAYDMIKTSVNIMRGCFGGCSFCSITE
FT                   HEGRIIQSRSQESIIEEIEQIRDKVPGFTGVISDLGGPTANMYKLGCTSKKAESTCRRL
FT                   SCVYPEICKHMDTDHTPTIELYKKAREVKGIKKILIASGVRYDLAVQDPRYVKELVTHH
FT                   VGGYLKIAPEHTEDGPLSKMMKPGMGAYDQFKALFDKYSKEAGKKQYLIPYFISAHPGT
FT                   KDEDMVNMALWLKSNDFKLDQVQNFYPSPMANATTIYHTEMNSLRNIKNNTEVVPVPKG
FT                   ARQRRLHKAILRYHDPAGWPMIREALRKMGKANLIGKAPNCLVPEEGRDERAAKGSSRG
FT                   GRPALTRHTGFSQFHKANTKPKVASNRQRAK"
FT   gene            complement(524121..524441)
FT                   /locus_tag="PSHAa0509"
FT   CDS_pept        complement(524121..524441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0509"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85599"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG82"
FT                   /protein_id="CAI85599.1"
FT                   /translation="MSRLKLTIALVSFCCLFLLACATKVSATTNMVVVSSLATQPNLQQ
FT                   SITHTLRTNPNLALSDIRVQVKNGEVDLYGKAQTGFERALAQKFLENMDGVKIIRNKID
FT                   II"
FT   gene            complement(524696..525922)
FT                   /gene="srmB"
FT                   /locus_tag="PSHAa0510"
FT   CDS_pept        complement(524696..525922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srmB"
FT                   /locus_tag="PSHAa0510"
FT                   /product="ATP-dependent RNA helicase"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2461520; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85600"
FT                   /db_xref="GOA:Q3IG81"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG81"
FT                   /protein_id="CAI85600.1"
FT                   /translation="MQFSEFDLDNKLLDAINKMGYETPTSIQQQAIPEALQGRDILASA
FT                   PTGTGKTAAFLIPAIQYLLDFPRRDPGFARVLVMTPTRELAYQIHEQCELLAKRTNLKI
FT                   GVVTGGINYGTHKEIFEKNNDILIATPGRLMEYLETENFHAEHVEMLIIDEADRMLDMG
FT                   FKKEMSRICDEAKNRRQCFLFSATLEGDSVERFAETTLNDPALLEAESSRKEKAKIHQW
FT                   VHLADDYHHKLELLVNTLNGPDVTKAIVFVKTRERLETLIGELTTNDVKAAWLRGEMPQ
FT                   DKRMKAMENFHSGKTRILVATDVAARGIDVADISHVINFDLPRTADIYVHRIGRTGRAG
FT                   KKGIAISLVEAHDIGILYKIERYIEQKLKRRVIKGLEPKHKEAKPPAKKRKDPVKMKAK
FT                   KKAKVKKKK"
FT   gene            525998..526696
FT                   /locus_tag="PSHAa0511"
FT   CDS_pept        525998..526696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0511"
FT                   /product="conserved protein of unknown function ; putative
FT                   SAM-dependent methyltransferase(yfiC)"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85601"
FT                   /db_xref="GOA:Q3IG80"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IG80"
FT                   /protein_id="CAI85601.1"
FT                   /translation="MSGFAFKQFKVAHEQCAMKVSTDGILLGAWANLSNANSLLDIGTG
FT                   TGLLALMCKQRSPQLTITAVEVDKNAYQQALQNIAASPWPNIEVHQQSIQTFNSAQPFD
FT                   VVIANPPYFNHSLKGNNKARNIARHTDGLSFAELISAFKKLSHAGSTFSLILPTTEVAV
FT                   FIELATQNGLFLNTHCQVKATPNKAISRSLMTFSYINQSIVESALCIKDNENNYSEDYI
FT                   ALCKAFYLKM"
FT   gene            526749..527195
FT                   /locus_tag="PSHAa0512"
FT   CDS_pept        526749..527195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0512"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85602"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG79"
FT                   /protein_id="CAI85602.1"
FT                   /translation="MKKRTKSVLLSALAATFFTTQSVLASMTPVGLWKTIDEDTNEAKS
FT                   YVRIVENNGVLSGTIETLLNKDKQNAVCSQCSGDKKDQPILGMTIIDNVIDSGDGSWED
FT                   GQILDPNNGKSYTVRLTTQDAGEKLEVRGYIGFFYRNQYWLRVE"
FT   gene            complement(527259..527780)
FT                   /gene="fldB"
FT                   /locus_tag="PSHAa0513"
FT   CDS_pept        complement(527259..527780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldB"
FT                   /locus_tag="PSHAa0513"
FT                   /product="flavodoxin 2"
FT                   /function="1.4.2 : Electron transport"
FT                   /function="2.5.8 : Riboflavin, FMN, and FAD"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85603"
FT                   /db_xref="GOA:Q3ILE2"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE2"
FT                   /protein_id="CAI85603.1"
FT                   /translation="MQIGLFFGSTTCYTEMAAEKIRDIIGADIVTLHNIKDEPLKNAEQ
FT                   YDFIIFGISTWDFGEIQEDWESKWDDIADVNLNGKTIALFGMGDQQGYGQWFQDALGML
FT                   HDEISPQTFTQLGFWPNDNSYEFEASKALTEDGTHFVGLALDEDSQYELSDERIATWVE
FT                   QVMTEYSETL"
FT   gene            527888..528814
FT                   /gene="xerD"
FT                   /locus_tag="PSHAa0514"
FT   CDS_pept        527888..528814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="PSHAa0514"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /function="3.1.2 : DNA recombination"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85604"
FT                   /db_xref="GOA:Q3ILE1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE1"
FT                   /protein_id="CAI85604.1"
FT                   /translation="MTTLADDFSEPSTAPKSNNDYLETFLDCLYLEQGVSENTLSAYRS
FT                   DLDKFCQFLKGKNLMTVTGLDVESYLAHRVDLGLKPRSTARSISALKRFYQYFVREKLI
FT                   SDSPMLNIAQPKAGQSLPKTLSEAEVEALLSAPNTDEPMGLRDKAMLELLYATGLRVSE
FT                   LVGLRIEQINLRQAVVFVKGKGNKERLVPLGEEAMYWLEQFLKVGRAQMIKHATDFVFP
FT                   SKRGVGMTRQTFWHRVKHYAILASIESSLSPHTLRHAFATHLLNHGADLRVVQMMLGHS
FT                   DLSTTQIYTHVANERLKSVHAQHHPRA"
FT   gene            528904..529605
FT                   /gene="dsbC"
FT                   /locus_tag="PSHAa0515"
FT   CDS_pept        528904..529605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="PSHAa0515"
FT                   /product="disulfide bond isomerase, periplasmic; chaperone;
FT                   activated by DsbD; homodimeric"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15220477, 15299592; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85605"
FT                   /db_xref="GOA:Q3ILE0"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE0"
FT                   /protein_id="CAI85605.1"
FT                   /translation="MLCTSLSAVANDVAVAPNANDPIVIKFAALGVTVKQINPSPVAGL
FT                   KELITNQGVLYASPDGQFLMQGTLIDLNNRSNLTEKALNGVRQAGLKEYEDSMIVYKAP
FT                   NEKHSITVFTDISCGYCRKLHRELDDLLEAGITVKYLAFPRGGLQGSGYNDLMNVWCAK
FT                   DQQEALTEAKSGSNTTAVKGCSAPVAEHYQLGQSFGVTGTPAIILEDGTMIPGYQPAAA
FT                   LSAALNASKAP"
FT   gene            529691..531412
FT                   /gene="recJ"
FT                   /locus_tag="PSHAa0516"
FT   CDS_pept        529691..531412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="PSHAa0516"
FT                   /product="Single-stranded-DNA-specific exonuclease, 5'-->
FT                   3'-specific"
FT                   /function="3.1.6 : Degradation of DNA"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2649886; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85606"
FT                   /db_xref="GOA:Q3ILD9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD9"
FT                   /protein_id="CAI85606.1"
FT                   /translation="MKKTIQTRENVDDSHLPSHLHPVIKQIYATRNVSHADELNNSAAT
FT                   LHDFKLFKDMDKACDLLIEALHAQSHILIVGDFDADGATSTATLMQGLAMFGFAHLDYL
FT                   VPDRFSLGYGLSPALAAQIVQLKPDLVITVDNGISCIAGIDIVKAANIKVLVTDHHLQG
FT                   ETLPNADAIVNPNRHDCSFPSKSIAGVGVAFYLLIALRSTLREQNHFAQQPMPNLADLL
FT                   DIVALGTVADVVALDANNRTLVHQGLARIRSGKTRPGITALIEVANRNASRLSASDFGF
FT                   SLAPRLNAAGRLDDMSLGIACLLSTDINQARRIASELDSLNFARREIEQGMQHEAQAVL
FT                   DKLAFNDDNIPDAICLYQEDWHQGVIGILAGRLKEKYHRPTVIFAGGENGEIKGSCRSI
FT                   EGLHIRDLLEGLSTADPHLISKFGGHAMAAGLSINEQQFSEFKHAFDTAVSAQLSEESK
FT                   RCIVFTDGELPNECFTMDFAQQLKQAGPWGQQFPEPVFEHTFELIQQRIVGEKHLKLVL
FT                   KHQSGRLVDAIAFGIDVKEWPDNNAQFVKAAYQLDINEFRGKFTLQLIIRELEKAS"
FT   gene            531558..532656
FT                   /gene="prfB"
FT                   /locus_tag="PSHAa0517"
FT   CDS_pept        join(531558..531632,531634..532656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="PSHAa0517"
FT                   /product="peptide chain release factor 2 (RF-2)"
FT                   /function="3.3.5 : Termination"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3889910, 11118225, 2456575; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85607"
FT                   /db_xref="GOA:Q3ILD8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILD8"
FT                   /protein_id="CAI85607.1"
FT                   /translation="MFEVNPVINQIKEIRERTELLRGYLDYALKQERLEEVNAELEDSA
FT                   VWNEPERAQALGREKSALEAVVETIDTLVTGTDDVEGLLELAVEAEDQETFDEAQSELA
FT                   DLNEQLEALEFRRMFSGPHDSNDAYLDLQSGSGGTEAQDWCNILLRMYLRWGEAKGFKV
FT                   ELVEATGGDVAGIKGATVRFVGEYAYGWLRTETGVHRLVRKSPFDSSGRRHTSFASAFV
FT                   YPEVDDNIEIDMNPSDLRIDVYRASGAGGQHVNTTESAVRITHVPTNTVVQCQNERSQH
FT                   KNKAQAMKQLKAKLFELELQQQNAEKQTQEDSKSDIGWGSQIRSYVLDDARIKDLRTGV
FT                   ESRNTQSVLDGNLDKFIEASLKSGL"
FT   gene            532684..534219
FT                   /gene="lysS"
FT                   /locus_tag="PSHAa0518"
FT   CDS_pept        532684..534219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="PSHAa0518"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7678344, 7961513, 12142429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85608"
FT                   /db_xref="GOA:Q3ILD7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD7"
FT                   /protein_id="CAI85608.1"
FT                   /translation="MTDQIQDENKLIAERRGKLDAIRQNCPANGHPNQFRREHYTADLQ
FT                   AQFGDKSKEELVELQQVVSIAGRILAKRGPFFVIQDMKGRVQSYASKDVQKDLKEKYGQ
FT                   LDTGDIIGVKGALNKSGKGDLYVEMTEYQLLTKSLRPLPEKFHGLSDQETKYRQRYVDL
FT                   ITNEATRETFRIRSQVVEGIRRFLADRDFMEVETPMLQVIPGGASARPFVTHHNALDID
FT                   MYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSTRHNPEFTMIEFYQAYADYIDLMN
FT                   ITEDMLRTVAENVLGSAVVVNTTKDENGEVIDSVEYDFGQPFTRLSMSDAILKYNPEFD
FT                   AAVFNDPENHFEQLKAYAKQVHVKIPENCVWGPGKFLCEIFEETAEHMLIQPTFITGYP
FT                   WEVSPLARRNDENSFVTDRFEFFVGGRELANGFSELNDAQDQAERFTRQVEEKDAGDDE
FT                   AMHYDEDYIRALEYGLPPTAGEGIGIDRLVMLFTDSPTIKDVILFPHMRPQAD"
FT   gene            534413..534592
FT                   /locus_tag="PSHAa0519"
FT   CDS_pept        534413..534592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0519"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85609"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD6"
FT                   /protein_id="CAI85609.1"
FT                   /translation="MKNKCIENPINNCETEDARQAFYRACIAEFQKLGYQEQYLAELND
FT                   DLVPVLGVNPPEKS"
FT   gene            534723..534815
FT                   /locus_tag="PSHAatRNA13"
FT   tRNA            534723..534815
FT                   /locus_tag="PSHAatRNA13"
FT                   /product="tRNA-Ser"
FT   gene            534851..534927
FT                   /locus_tag="PSHAatRNA14"
FT   tRNA            534851..534927
FT                   /locus_tag="PSHAatRNA14"
FT                   /product="tRNA-Arg"
FT   gene            535030..535106
FT                   /locus_tag="PSHAatRNA15"
FT   tRNA            535030..535106
FT                   /locus_tag="PSHAatRNA15"
FT                   /product="tRNA-Arg"
FT   gene            535254..535330
FT                   /locus_tag="PSHAatRNA16"
FT   tRNA            535254..535330
FT                   /locus_tag="PSHAatRNA16"
FT                   /product="tRNA-Arg"
FT   gene            535445..535521
FT                   /locus_tag="PSHAatRNA17"
FT   tRNA            535445..535521
FT                   /locus_tag="PSHAatRNA17"
FT                   /product="tRNA-Arg"
FT   gene            535840..537015
FT                   /locus_tag="PSHAa0521"
FT   CDS_pept        535840..537015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0521"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85610"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD5"
FT                   /protein_id="CAI85610.1"
FT                   /translation="MFKTLFITLFFIFSATLILSVQADEAKGSIVVGAQQYTKYLPQLK
FT                   NKRVGLVVNQTSTVEKIHLVDSLREKNVNITKIFAPEHGFRGDHDAGAHVKNAVDSKTG
FT                   IPLISIYGNNKKPSAEVLADVDVIIFDIQDVGVRFYTYISSMHYMMEAAAEQEVEFIVL
FT                   DRPNPNIAYVDGPILEPQFKSFVGMHPIPVVHGMTVGELANMIKGEGWINQAAVLELNV
FT                   IPVSGYTRATSYSLPIKPSPNLPNDTAISLYPSLCFFEATPISIGRGTDFAFQVIGYSP
FT                   IALGEFSFTPRAIKGAALNPKFKNQAVQGLDLRQATTKGLDLSYLISAYKQLNNNDITF
FT                   FERADFMDKLAGTDKLRLAIEAGQSAQQIKQTWQAALMQFKQQRAPYLLYE"
FT   gene            537026..538687
FT                   /locus_tag="PSHAa0522"
FT   CDS_pept        537026..538687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0522"
FT                   /product="conserved protein of unknown function; putative
FT                   peptidase with beta-lactamase domain (partial match)"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85611"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD4"
FT                   /protein_id="CAI85611.1"
FT                   /translation="MYLYLKNKNYYSIKKLLIVALSFMLGACSSSVEPLEPKALLTQSK
FT                   LVELPNAQVIVTFPEPNPSSREYVNNRGTFKAYKGHGQLLIQNHSAKSADIYINNQLLN
FT                   IKQLLGANTVYQYSLAKLTHNGVNTFKVANIQPAGASLTLRFAFPTLNKASHQQANFSE
FT                   VDALIERDIKAGFPGAVLAVVKNGELIKLTAYGDAKQYQQNDLMLLRPEPMQTDTLFDL
FT                   ASNTKIFATNFALMKLVSEGLLNINKPVQLYLPEYQGDGREQRRVKDLLTHSAGYPPVF
FT                   DFHRKDSSNGDVFYSQNSHTTKKLLLTSVPLSEKSLGQHVYSDIDYMILGVLVERITGL
FT                   SLDDYLEQQVYAPLKLHNTVFNPLKKGFNAQQFAATELGGNTRDGRIKFDNIRTHVLQG
FT                   QVHDERAYYSLGGVAGHAGLFSNAPDLAILCQLLLNNGGYGDKQLFSASALAQFLTPQS
FT                   SDETYGLGFRLAGNNQARRWHFGPYASAQAYGHTGWTGTVTVIDPVYDLAIILLTNARH
FT                   TPITGSQKSYQFSGKNYETAQYGSVVSLIYEALLNQ"
FT   gene            538892..540199
FT                   /locus_tag="PSHAa0523"
FT   CDS_pept        538892..540199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0523"
FT                   /product="putative Na+/H+ antiporter family"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85612"
FT                   /db_xref="GOA:Q3ILD3"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD3"
FT                   /protein_id="CAI85612.1"
FT                   /translation="MALLLAVASSEFLLALQGEGSSVFNTFLNTIERIVSVASSPGNTR
FT                   ILIFSILIGALLAYIRESGGVAATVNMLMNKGIAKSKRQVGFLTMFTGIAVFIESNLSV
FT                   LTAGILSRGLFDKFKMSRARLAYIIDSTSAPVCILILLNGWGAFVLGLLSNYELGESAV
FT                   SVLWGSVGYNFYAIITLVIVFYTIAFDKVHGPMKQAEQKLELQTTDLKEEVKGSKARFM
FT                   LVPLITLIVSMVGFMFYTGNGVLAEGSGSKSVLYATVLAIVVAYFLMLASRQFSHHKLV
FT                   ETGFKGMGELLPLVGIVLLSLTLGASLKELGTGVFVASLVGDYLPIYLVVPALFLTGAV
FT                   MSFTTGTSWGTFAILIPIGVPLIQALGLPPSLVLGAILGGGIFGDHCSPISDTSAVSAI
FT                   ASGCDLLTHVKTQLPYALFAGGLTLIAYLVTSIIVL"
FT   gene            complement(540313..541461)
FT                   /locus_tag="PSHAa0524"
FT   CDS_pept        complement(540313..541461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0524"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85613"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ05"
FT                   /protein_id="CAI85613.1"
FT                   /translation="MLKLLFASSLIFSSCSVLSKNLTTEEQRIEAATHAMPQVLMAFAD
FT                   EVNQFEQQWKSLNNFRHATDLIADYSSQLWLNAKQRIVTTKNYDDRELYWARLLSSKII
FT                   RSVKPKFILSVAEQNNLLTQLEKGSRGHNDLSFTKGSTKKIILTGFDPFLLDKNINQSN
FT                   PSGVAALLLDGQVINYQGISAEINTVMVPVRYADFDQGIIEALLAPYYALNNVDMIVTV
FT                   SMGRKDFDLERFPGKRRSVTAPDNANIIFGGTQTAPLLPSLNNQPLPGNEFVQFSLPVA
FT                   NMQQAQGPYKVIDNHKITTLEKTYEPATLAELQNSIAVNGSGGGYLSNEISYRSIRLRN
FT                   QLNSTIPTGHIHTPRIQQFEPKTEAKIVKQITAMLEHSLNAL"
FT   gene            541691..542197
FT                   /locus_tag="PSHAa0525"
FT   CDS_pept        541691..542197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0525"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85614"
FT                   /db_xref="GOA:Q3IJ04"
FT                   /db_xref="InterPro:IPR021438"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ04"
FT                   /protein_id="CAI85614.1"
FT                   /translation="MQLIEINKARYRKHLNRVIAGCAVGLAVGSLAISQTLIALFPDES
FT                   GTHFHWNVAGVVISALGLAWLLNKYRTHPFMIEVVYVWELKQALNKITRKMAKLKAAGR
FT                   EGNSDALLAIHYSYAGSKLLWQLDDNTITMDDLAIKQAELDSVAAKYNLTLDANDYDAS
FT                   ILKNF"
FT   gene            542282..542935
FT                   /locus_tag="PSHAa0526"
FT   CDS_pept        542282..542935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0526"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85615"
FT                   /db_xref="GOA:Q3IJ03"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ03"
FT                   /protein_id="CAI85615.1"
FT                   /translation="MSLIVYGVPLSPYVRKVCLCLAAKQLDYKLEIVSPFNQPAWFFEL
FT                   NPLGRIPALKDGDLVLADSSVICQYLDDKYTGNTALLGDTVEQTAQVRWLEKYADYELA
FT                   PLTTFTVFQQRVINLGMQKVCDESLVKLAMNEQLPPHFDYLEGVLGHNDYFVGNALTLA
FT                   DIAFASQIINMQHAGEQINAQRWPNLAALFERVKALPAMQTLLQSEQAMLASMQ"
FT   gene            542990..543451
FT                   /locus_tag="PSHAa0527"
FT   CDS_pept        542990..543451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0527"
FT                   /product="putative low molecular weight phosphotyrosine
FT                   protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85616"
FT                   /db_xref="GOA:Q3IJ02"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ02"
FT                   /protein_id="CAI85616.1"
FT                   /translation="MKKILVVCLGNICRSPTAEAVLKKRAEQLGITVKVDSAGTIGHHE
FT                   GNSPDSRSMQAGEKRGYSFKGIYSRKVRSSDFTEFDLILAADKQNLADLTQRCPAHLQY
FT                   KLALFLEFGEQAVSAIPDPYYGGDDGFEKVLDLIEAASDKILAKLTANV"
FT   gene            complement(543575..544672)
FT                   /locus_tag="PSHAa0528"
FT   CDS_pept        complement(543575..544672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0528"
FT                   /product="conserved protein of unknown function ; putative
FT                   TonB domain protein"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85617"
FT                   /db_xref="GOA:Q3IJ01"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ01"
FT                   /protein_id="CAI85617.1"
FT                   /translation="MKPHKLALLLSLNLSVITASAFASEATNANTAFSQAYQNYLSAVD
FT                   TNENIQQAAKLAYSLGAKVYGDNADNTANLAINYAKAISGFNQEDEAKRYELYKQAYNI
FT                   LANNHGESSVETIDALLGMASNTKSARQADSQLERIVDIAKELKKPRFVADMQFAAASL
FT                   LVKKFVPEKYRSAKHYAEEADEYYQANLPENAVERIKSDFLMASFDEGRKKYDSAITRL
FT                   NRIVTVFDNNLSYDHSAELSAHSKLIALYEKQGESEQATKHCLAIAKMVPWEESQEQTP
FT                   LYRVNPDYPMGKARQGKDGSVVMEFEVDTAGFVKNVSVLDSNGGVTFEHSAKKAVEQWR
FT                   YAPKFEDGIPVTAKTQVRLDFKINR"
FT   gene            544927..545550
FT                   /gene="ribA"
FT                   /locus_tag="PSHAa0529"
FT   CDS_pept        544927..545550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="PSHAa0529"
FT                   /product="GTP cyclohydrolase II"
FT                   /function="2.5.8 : Riboflavin, FMN, and FAD"
FT                   /EC_number="3.5.4.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8320220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85618"
FT                   /db_xref="GOA:Q3IJ00"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ00"
FT                   /protein_id="CAI85618.1"
FT                   /translation="MAQVRARVQLNVGKNSDIPAEIISFTDLKDGKEHIAMVFNNADTE
FT                   QDVPLIRMHSECLTGDVFYSSRCDCGEQLNECIEMMHEQGGILLYLRQEGRGIGLYNKI
FT                   DAYVLQSQGMNTYEANNHLGFADDLRDFSDAVLMLNALNLPHVKLMTNNPKKLNALRDA
FT                   GITVDSVVGTHAHIKAGVAGNKAYLETKIKHGAHMLDIKKIKKP"
FT   gene            545564..546352
FT                   /locus_tag="PSHAa0530"
FT   CDS_pept        545564..546352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0530"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85619"
FT                   /db_xref="GOA:Q3IIZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIZ9"
FT                   /protein_id="CAI85619.1"
FT                   /translation="MSTQLRVFKADAALKWFKAGWLIFKTQPLTFIFMHLFIGIVGLLS
FT                   LFLPLLQVVAALATPFLTAGFYQAVLTKQQGGKIMLADILKPITTKGNRLGLLRLALYQ
FT                   MGAGILMALLANGLFADAIAVMAQPDLDPNMAISQMLESISMASVVLFLLALSVYLTAF
FT                   AYAVPLVYFNKEQRIFSALKKSFMVFYYNILPLSVYAIICGLFIVLSMFLSFLPLLVLM
FT                   PICYISFFVSYQAIFMPVVPPSDDSNITPLSSESSGRFDA"
FT   gene            546352..546804
FT                   /gene="recX"
FT                   /locus_tag="PSHAa0531"
FT   CDS_pept        546352..546804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="PSHAa0531"
FT                   /product="putative regulatory protein, inhibitor of RecA
FT                   recombinase and coprotease activities"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8165147, 12547390; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85620"
FT                   /db_xref="GOA:Q3ILF4"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF4"
FT                   /protein_id="CAI85620.1"
FT                   /translation="MDDKLKQKLKNYVLWLLSRQEYSRRELTFKLQKKEATDEFIETLL
FT                   DWCEKHNFVNEQRYCEGFVRKHIFKCHGLRRIQSEAMGKGIDRSLLEKVIEELEVDWFE
FT                   LAQDAYNKKYSNTPADLEYKDKAKRVRYLMYRGFSYDEIDFAMQAQ"
FT   gene            546824..549430
FT                   /gene="alaS"
FT                   /locus_tag="PSHAa0532"
FT   CDS_pept        546824..549430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="PSHAa0532"
FT                   /product="alanyl-tRNA synthetase"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9153306, 12588865; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85621"
FT                   /db_xref="GOA:Q3ILF3"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILF3"
FT                   /protein_id="CAI85621.1"
FT                   /translation="MQHMTTAQIRQQFLDFFASKQHQVVPSSSLIPGNDATLLFNNAGM
FT                   VQFKDVFLGAESRPYTRATSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYF
FT                   KQDAIKFAWQFLTEEVKLPKEKLLVTIYHDDEEAFNYWSNDIGLPADRIIRIATADNFW
FT                   SMGDTGPCGPCSEIFYDHGEHIWGGPPGSPEEDGDRFIEIWNLVFMQYNRQNDGTMLPL
FT                   PKQSVDTGMGLERIAAILQGVHSNYEIDLFKGLIAAAASVTNAQDMDDKSLRVVADHIR
FT                   SCAFLISDGVMPSNEGRGYVLRRIIRRAVRHGNKLGAQGAFFYKLVAALIEQMGQAYPE
FT                   LAKQQEIIEKVLRIEEEQFGKTLERGLAILEESLSDLKGDVIPGDLVFKLYDTYGFPAD
FT                   LTADVARERQMTIDNKGFEECMAVQRKTAQQAGKFGADYNDQLKSDKQTTYKGYTTTSH
FT                   SATVVEVFAGSESVSLLEDGQKGIVILDRTPFYAESGGQVGDTGVISVAGGEFTVTNTT
FT                   KLGNAFAHHGIVQGRIGLNDKVEATIDDARRERIKKNHTATHILHETLRQLLGEHVGQK
FT                   GSLVQAERLRFDFSHFEAVTKEELREIERVVNDEIRCNFALSTELMAIDDAKAKGAMAL
FT                   FGEKYDDEVRVVTIGDYSIELCGGTHVERAGDIGLFKIVSESGIAAGVRRIEAVTGADA
FT                   IAYVSEQEQKLNDVAAVVKADSASVLEKVTALLDKSKQLEKQIAQLNDKLASAAGASLL
FT                   DSVVEINGIKLLIANVKGTESKALRGMVDDLKNKIGSGVIALGVASDDKVSLIAGVTKD
FT                   LTGRVKAGELVNHMASQVGGKGGGRPDMAQAGGSEPENLTAALDSVTAWFTEKTQA"
FT   gene            549431..550648
FT                   /gene="lysC"
FT                   /locus_tag="PSHAa0533"
FT   CDS_pept        549431..550648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="PSHAa0533"
FT                   /product="Aspartokinase"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85622"
FT                   /db_xref="GOA:Q3ILF2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF2"
FT                   /protein_id="CAI85622.1"
FT                   /translation="MALIVQKFGGTSVGSIERIEAVADLVVKTKQQGHQVVVVLSAMSG
FT                   ETNRLINLAKQIDTRPSSRELDVLISTGEQVSVALLAMAIIKRGHSAVSLLADQVNILT
FT                   DNMFGKARITDVAATRLKHELEHNRIAIIAGFQGRDIEGNVTTLGRGGTDTSAVEIAGA
FT                   IKADECQIYTDVNGVYTTDPRVEPNARRMSQVTFAEMLELASLGAKVLHIRSVEAAGKH
FT                   NVPLRVLSSFYPDAGTLISFEESDMPGNVVSGIAFNRDECLINVEGVLSGTQYLAKILK
FT                   LFADNGIEIDMINQVNHNVDKVDYAFTVHTNDYLHALDVLTEQQAQLTAQNIFGLTTVA
FT                   KVSAVGMGMKSHSGVASLFFDALAAENINVILVSTSEIKISVLIDEKYLELAVRALHKI
FT                   FLTENE"
FT   gene            550739..550930
FT                   /gene="csrA"
FT                   /locus_tag="PSHAa0534"
FT   CDS_pept        550739..550930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="PSHAa0534"
FT                   /product="carbon storage regulator"
FT                   /function="2.1.1.1 : Glycolysis/gluconeogenesis"
FT                   /function="2.1.3.5 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /function="1.5 : Motility and chemotaxis"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; PubMedId : 8393005; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85623"
FT                   /db_xref="GOA:Q3ILF1"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILF1"
FT                   /protein_id="CAI85623.1"
FT                   /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKDVSVHRE
FT                   EIYMRIQAEKSNPEPGNA"
FT   gene            complement(550981..551448)
FT                   /locus_tag="PSHAa0535"
FT   CDS_pept        complement(550981..551448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0535"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85624"
FT                   /db_xref="GOA:Q3ILF0"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF0"
FT                   /protein_id="CAI85624.1"
FT                   /translation="MTLTTTYTLDKPYFYECFDESVAHSKRAQPKYFLLALLVALGLFG
FT                   IYGLDDHYLGSFLIMVAVLECIAFYYRRPWWVTRQMLSKASGSEVTLTFDEEGIKSSNF
FT                   YKNTQLLWSDINEVITTERGILLKNKKGMQYISKHILTAETLNFIHKKATQ"
FT   gene            complement(551650..551841)
FT                   /locus_tag="PSHAa0536"
FT   CDS_pept        complement(551650..551841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0536"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE9"
FT                   /protein_id="CAI85625.1"
FT                   /translation="MNSTTLRAALIGLFASLFIMGCEDNHAEDAGERIDEAVTDVQNKV
FT                   EDACEEVKEGVNAEETNC"
FT   gene            complement(551907..552077)
FT                   /locus_tag="PSHAa0537"
FT   CDS_pept        complement(551907..552077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0537"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85626"
FT                   /db_xref="GOA:Q3ILE8"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILE8"
FT                   /protein_id="CAI85626.1"
FT                   /translation="MLRWTITFLVIALIAAVLGFGGIAGAAAGIAKIIFFIFLILLVIS
FT                   LVSGALRGKKP"
FT   gene            552721..552966
FT                   /gene="oadG"
FT                   /locus_tag="PSHAa0538"
FT   CDS_pept        552721..552966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadG"
FT                   /locus_tag="PSHAa0538"
FT                   /product="putative oxaloacetate decarboxylase, gamma
FT                   subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85627"
FT                   /db_xref="GOA:Q3ILE7"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE7"
FT                   /protein_id="CAI85627.1"
FT                   /translation="MDIAALLTTASNLMLTGMVGVFVFLSLLITCVTVMSKLVSRFAEP
FT                   ELAMPARTPSFKSQGVPNEHIAAISAAIAQYKTNNN"
FT   gene            552979..554760
FT                   /gene="oadA"
FT                   /locus_tag="PSHAa0539"
FT   CDS_pept        552979..554760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="PSHAa0539"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1331067; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85628"
FT                   /db_xref="GOA:Q3ILE6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE6"
FT                   /protein_id="CAI85628.1"
FT                   /translation="MAKLKLTELVLRDAHQSLLATRMRLDDMLPIAKKLDDAGYWSIES
FT                   WGGATFDSCIRYLGEDPWERIRALKKAMPNTKQQMLLRGQNLLGYRHYADDVVEKFVER
FT                   AHKNGVDVFRIFDAMNDVRNLETAIKAAIKVGAHAQGTISYTVSPVHTLDMWLTLAKQL
FT                   EDLGCHSICIKDMAGLLKPYDAEKLIKALKETVSIPIAMQCHATTGLSTATYQKAIDAG
FT                   IDMLDTAISSMSMTYGHTATETIVSIVEGTERDTELDLNHLEEIAAYFRDVRKKYAAFE
FT                   GSLKGVDGRILLAQVPGGMLTNMENQLKEQGAADKLNEVLLEIPRVREDLGFLPLVTPT
FT                   SQIVGTQAVLNVLTGERYKTITKETAGVLKGEYGLTPAPMNKELQERVLDGAEVITCRP
FT                   ADNIAPELATLEAELLKEVQEQGLTLADEQIDDVLTYALFPQVGLKFIKNRNNPDAFEP
FT                   VPCVEDKSNKAPSKSASNNNSVKAEQYSVKVDGKVYDVVVAQGGELKEVTLKDSEHIPQ
FT                   SASVASGETLNAPLAGNIFKIKVKAGQVVNEGDVVIIMEAMKMETEIRATHTGTIAEVL
FT                   VGEGDAVTTGDAMIALA"
FT   gene            554774..555904
FT                   /gene="oadB"
FT                   /locus_tag="PSHAa0540"
FT   CDS_pept        554774..555904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="PSHAa0540"
FT                   /product="Oxaloacetate decarboxylase, beta subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2549031; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85629"
FT                   /db_xref="GOA:Q3ILE5"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE5"
FT                   /protein_id="CAI85629.1"
FT                   /translation="MDGILNLWHATGIANFTFPALIMIAVGCLLLFLAIAKKFEPLLLL
FT                   PIGFGAILTNIPVAGLSDPGGLLHYVYYVGIDTGIFPLLIFMGVGALTDFSALIANPRM
FT                   LLLGAAAQFGIFATLFGAILLNYVPGFEFSLQDASAIAIIGGADGPTAIFLASKLAPDL
FT                   LGAIAVAAYSYMALVPIIQPPIMRALTTVEERQIKMPELRKVSKKEKIIFPLMVLSLTA
FT                   MFLPAAIPLVGMFCLGNLMRESGVVDRLSNSAQNEIINVTTIFLGLAVGSKLAADKFLT
FT                   VETIGILVLGALAFAIGTASGVFMAKGLNKISKTPINPLIGAAGVSAVPMAARVVNKVG
FT                   LESNPHNFLLMHAMGPNVAGVLGSAVAAGILLALVG"
FT   gene            556034..557005
FT                   /locus_tag="PSHAa0541"
FT   CDS_pept        556034..557005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0541"
FT                   /product="putative oxidoreductase, Aldo/keto reductase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85630"
FT                   /db_xref="GOA:Q3ILE4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE4"
FT                   /protein_id="CAI85630.1"
FT                   /translation="MHDTPLAKYLPNVSKLIFGCMGLGGGWNKDPLTNTHTQQAHVCID
FT                   TAIAGGINLFDHADIYTFGKAEQVFGQVLKQRPELREQIYIQSKCGIRFADEQGPKRYD
FT                   LSKQWIEQSVEGSLKRLNTDYLDVLMLHRPDPLIQVEEVAQVFSRLKESGKVRHFAVSN
FT                   MSQQQIQFLQTALDMPIVANQIEASLKQSAWVDEGVYVGNRDGKDINFTPGFIEYCTEQ
FT                   EIQIQSWGSLCQGLYSGKQLQNASPADINTAILVAKLAALYRTSAEAIVLAWLLRHPAL
FT                   IQPVIGTTNAKRLAASCSAVNIELTREHWYALYVSAKGHELP"
FT   gene            557032..557208
FT                   /locus_tag="PSHAa0542"
FT   CDS_pept        557032..557208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0542"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85631"
FT                   /db_xref="GOA:Q3ILE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE3"
FT                   /protein_id="CAI85631.1"
FT                   /translation="MNIFVILISLFVALLILIPLLEKYQSKIGLDGAKKYSKYIWPLVM
FT                   VSLVVQLIYVLMN"
FT   gene            complement(557303..558616)
FT                   /locus_tag="PSHAa0544"
FT   CDS_pept        complement(557303..558616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0544"
FT                   /product="putative peptidase, M23/M37 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85632"
FT                   /db_xref="GOA:Q3ILK0"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILK0"
FT                   /protein_id="CAI85632.1"
FT                   /translation="MVHVVHTLPKKHKLLILGLVSAIAGLAFLPSEKATASKDNSENTL
FT                   EIGKRYELQVKVDDNEKLTALNSEQAADKLPEYDFVDHQVKNGDNLAIIFKRAGFSAQT
FT                   LHKLINTNAETRKLTKIHPGETLSFATAKDGDLAQLRYVISKTDTLFVTLNDEGQYDTS
FT                   IDSKEIETLTKTVGGEISSSFWTSAIAAGLSERQIMNFADIFGWDVDFANDIRKGDGFG
FT                   LIYESHYVDGEFIGTGKIIAAEFVNQGQRYAAIRHTDGSFYTPEGRSMKKAFLRAPVSF
FT                   KYISSSFNPRRLHPVTGQVRAHRGIDFAARTGTPVVASGNGKVIKSGYSKYNGNYVFIS
FT                   HGTQYVTKYLHLNKRLVKTGQKIKQGEQLGTVGSTGRVTGAHLHYEFLVNGVHRNPKTV
FT                   KLPKSEPLPRAELAKFKPIADNFIAQLERNRELQLALK"
FT   gene            559119..560318
FT                   /gene="tyrZ"
FT                   /locus_tag="PSHAa0545"
FT   CDS_pept        559119..560318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrZ"
FT                   /locus_tag="PSHAa0545"
FT                   /product="Tyrosyl-tRNA synthetase II"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12572618, 11834741; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85633"
FT                   /db_xref="GOA:Q3ILJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ9"
FT                   /protein_id="CAI85633.1"
FT                   /translation="MDLQTALAEIKRGTEEILIEDELVEKLKSGKKLKIKAGFDPTAPD
FT                   LHLGHTVLINKMKTFQDLGHEVVFLIGDFTGMIGDPTGKNVTRKPLTREDVLANAETYK
FT                   EQVFKILDPAKTTVAFNSTWMENLGAAGMIKLAARQTVARMLERDDFKKRYASGQSIAI
FT                   HEFLYPLVQGWDSVALEADVELGGTDQRFNLLMGRELQKDEGQKPQTVIMTPLLEGTDG
FT                   VQKMSKSLGNYIGITDAPNDMFGKIMSISDVLMWRYYDLLSGLSIAGINAQKERVEQGT
FT                   NPRDIKIELAKELIARFHSEADAQAAHDDFIQRFQKKALPDEIPELTVTIEQDSILIAN
FT                   LLKEANLVASTSEAMRMIKQGAVKLNGEDKITDTKLEIAKGSTAIYQVGKRKFANITVA
FT                   "
FT   gene            complement(560414..561358)
FT                   /locus_tag="PSHAa0546"
FT   CDS_pept        complement(560414..561358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0546"
FT                   /product="putative cobalamin biosynthesis protein"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85634"
FT                   /db_xref="GOA:Q3ILJ8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ8"
FT                   /protein_id="CAI85634.1"
FT                   /translation="MLSNMVQNHLDFIVFIMALLAERFLPLVSWYHPNTALTAIFSAIG
FT                   KRIYKVAEPNSYQYLAATLASTLILSVVLIIIVLLLEFAFYPELLAGLILYLCLESKAI
FT                   DKKALRIAKLTKQNQKSAARELLKPLVARDVTKLSGAGIIKALIESLILRTARYYFVVI
FT                   FVFLVLGPIAALAYRLLTLIEQAWRSNIKPNSPFLKPLKITLFIIEFIPMRLLALTIAA
FT                   SKASKLSMHYIKHYGRHFYQTNTGWLLSTCSASLGVQLGGPAVYFGERFNKMRIGTERL
FT                   PIAEDVPITINRLNQARVFWLLVVVCIEILKNI"
FT   gene            complement(561359..562066)
FT                   /gene="mtnN"
FT                   /locus_tag="PSHAa0547"
FT   CDS_pept        complement(561359..562066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="PSHAa0547"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase; MtnN"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85635"
FT                   /db_xref="GOA:Q3ILJ7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ7"
FT                   /protein_id="CAI85635.1"
FT                   /translation="MNVGIIGAMEPEVKILREAMQNPQTLTKAGFTFYTGELAGNTVTL
FT                   VQSGIGKVASTIATTLLIDNFAPDCVINTGSAGGFDPSLNVGDVVISSEVRHHDVDVTA
FT                   FGYEIGQVPQMPAGFAAHPKLVAAAEQTIAQISDVKTLVGLICTGDIFMCDPIRIEKAR
FT                   SDFPTMLAVEMEGASIAQTCHTLNTPFVVIRSMSDIAGKESPQSFEEYLETASINSSKM
FT                   VVALLEKLTAVSL"
FT   gene            complement(562174..562770)
FT                   /locus_tag="PSHAa0548"
FT   CDS_pept        complement(562174..562770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0548"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85636"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ6"
FT                   /protein_id="CAI85636.1"
FT                   /translation="MEFALLSILVLVVGASVVASKFNDDGGNPYPFTRKQNVFTQVESA
FT                   FLNLLERAVGDQYKIVSRVKLIDVIDCKQGLSAKSKRAAMAKAKNKQLDFVLVDKEKMT
FT                   IVAAVDLVNNANKDGHKAQRDWFVNGALEAAGIPHIRMKVKSGYRPSEVRDAIMFKLGK
FT                   PAATQTARPIRTRVQKPAVLSPSQAKAHSTALAEI"
FT   gene            complement(562886..563806)
FT                   /locus_tag="PSHAa0549"
FT   CDS_pept        complement(562886..563806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0549"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85637"
FT                   /db_xref="GOA:Q3ILJ5"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ5"
FT                   /protein_id="CAI85637.1"
FT                   /translation="MQTNMPDIANTAPALQTGTLDWVGMGEIELPFIFESHGITPVTVN
FT                   AKARAFVNLHKEDAKGIHMSRLFLALDTLSTEQQVNPQTLAQALDFFISSHEGLSDKAL
FT                   IEFKFELPLRRKSLLSDKAGWKSYPVILTSTIEQGVINYELSVDVTYSSTCPCSAALAR
FT                   QLIQNAFAEKFSQETLSQKEALEWLGTTQGIVATPHSQRSIANVKVKLDSNITQFDVVN
FT                   LINTIEDELKTPVQAAVKREDEQEFARLNGQNLMFCEDAARKIKALLETQQYSDYWLQI
FT                   NHYESLHAHDALAIAVKGVAGGYRA"
FT   gene            564020..566338
FT                   /gene="arcB"
FT                   /locus_tag="PSHAa0550"
FT   CDS_pept        564020..566338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="PSHAa0550"
FT                   /product="aerobic respiration control sensor protein arcB"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="3.3.6 : Protein modifications"
FT                   /function="1.7.2 : Cell division"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85638"
FT                   /db_xref="GOA:Q3ILJ4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ4"
FT                   /protein_id="CAI85638.1"
FT                   /translation="MTDSSLSPWARVLSSLITRFGEFKTAAICYALLLAVSLVLSSMFY
FT                   YVAVGEVNLVDILAVVFFTSVVSPLVISVLINSIRQLDASYAYLDSATKQEKLLNQTLK
FT                   DNINRLNVEIDERKMAFHAKHRAIEELRKEIAERKKTQQELAQQSMLQRSIVDSSPDLF
FT                   YYRDNNGVFAGCNKMFEEVMGKTSDELIGKSAEQIFPNQFLSEVLKTDKQVEQTHQALT
FT                   IDVQYDVGGETRWFELRKLPFINDKGKYIGLLAFGRDITSRKEAAEALETAYKDKGKFI
FT                   ATLSHELRTPLNGIVGLTRMLLDTELNKQQRSWCNTVFSSAETLGNIFNDIIDLDKIDR
FT                   EQLDIATNAINVSDFINDVVNFAGLIAEQKDLSFDIKRLGMLDIYAQLDPTRLRQVVWN
FT                   LINNAVKFTHKGSVTLTCIRENRDDGPWLTMKISDTGEGIPAEQLSRIFDMYYKAPDLK
FT                   GTNAIGSGIGLAVTKALVDAMQGIISVNSTEGEGSCFIVEIPLILCSAPTENSYVGRSL
FT                   NILLVEDVPLNAEIATNLLEQRGHEVIWAETGEDALSFVETEDDLDLILLDMQLPDING
FT                   DEVARQIRADSHFDKLPIVALTANVRSAEQELEGISIQGALAKPINTVKLDKILADLFG
FT                   IKQTRSNEPQLKVSTAALADINAHLLDVETIEDFVNSMGLVVFKRSSQLFEKLNPQYQQ
FT                   ELLTSLNSGDREEYKSVAHKLKGAAGSVGLNDVQLHAKVMEYGALDKSDEVLKQWLDVL
FT                   ADKINEGQHALHLFLQQLE"
FT   gene            complement(566343..567059)
FT                   /gene="arcA"
FT                   /locus_tag="PSHAa0551"
FT   CDS_pept        complement(566343..567059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="PSHAa0551"
FT                   /product="aerobic respiration control protein arcA (Dye
FT                   resistance protein)"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="1.7.2 : Cell division"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2984198, 7565118; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85639"
FT                   /db_xref="GOA:Q3ILJ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ3"
FT                   /protein_id="CAI85639.1"
FT                   /translation="MQTPVILIVEDEDVTRLNLVSLFEAEGYKVIEAIDGDDMHDKLTN
FT                   NDDVNLVVMDINLPGKNGLILARELRQKRKVGLIFLTGRDNDVDRILGLEIGADDYITK
FT                   PFNPRELTIRARNLITRTALGGEESALETNGVITFNGWELDENSRCLTSPGGDAKRLPK
FT                   GEYRALRLMLDSPGRIFSREQLIKHMTGRELRANDRTVDVTIRRIRKHFESDNSTTELI
FT                   STIHGEGYRFIGKIDS"
FT   gene            complement(567820..568845)
FT                   /gene="rsmC"
FT                   /locus_tag="PSHAa0552"
FT   CDS_pept        complement(567820..568845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="PSHAa0552"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase C"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="2.1.1.52"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9873033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85640"
FT                   /db_xref="GOA:Q3ILJ2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ2"
FT                   /protein_id="CAI85640.1"
FT                   /translation="MSVLTNPSLLLLRNSEKLVGKSILVVNFVQDGFLAELKKRNPESK
FT                   ITAFSYNHANGEFAKNTPGVDVCVNHCISGNDFDLVILYYPKSKPEVLMALDNIRAVIT
FT                   ADAELLVVGENKSGVKSIEKQLTDKANFSNKIDSAKHCVLYSFAELKQLSQFNISDYHK
FT                   PFTVSVADSEFTAISIPGVFNHGNLDVGTKILLENAPLIKQGTVLDFGCGAGLIATYLG
FT                   LQNPALSFVCSDVSALAIYATTQTLKLNNIKGEALLSDGLTNITGKFDLIISNPPFHTG
FT                   IATDYTVAETFLANAKQHLTKAGKLNIVANSFLKYPPILEAQFDNYQTVFKNNKFAVYS
FT                   S"
FT   gene            complement(568935..569660)
FT                   /gene="yggH"
FT                   /locus_tag="PSHAa0553"
FT   CDS_pept        complement(568935..569660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggH"
FT                   /locus_tag="PSHAa0553"
FT                   /product="tRNA (m7G46) methyltransferase, SAM-dependent"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.1.1.33"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730187; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85641"
FT                   /db_xref="GOA:Q3ILJ1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ1"
FT                   /protein_id="CAI85641.1"
FT                   /translation="MSESSNTNLEQAKQEGKYIRTIRSFVKREGRLTKGQAAAIEKCWP
FT                   IMGLEHKNGMLDLSEVFGNNNDVVLEIGFGMGKSLVEMAKNAPHLNFIGIEVHRPGVGA
FT                   CLMDADEAGITNLRIFEHDAVEVLADCIADESLTTLQLFFPDPWHKKRHHKRRIVQGEF
FT                   VEKLRSQLKMGGVFHMATDWENYAEHMLEVMQAAPGFKNQSTTNDYVPRPDLRPLTKFE
FT                   QRGHRLGHGVWDLMFERTK"
FT   gene            569838..570896
FT                   /gene="mutY"
FT                   /locus_tag="PSHAa0554"
FT   CDS_pept        569838..570896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="PSHAa0554"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2197596, 2001994; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85642"
FT                   /db_xref="GOA:Q3ILJ0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ0"
FT                   /protein_id="CAI85642.1"
FT                   /translation="MDLNKQQSDWFSNQVVDWYHLHGRKTLPWQLAKTPYKVWVSEVML
FT                   QQTQVVTVIPYFERFMQSFPDIIALANADEDQVLHHWTGLGYYARARNLHKTAKIVRDK
FT                   YQGQFPTTLEEVIDLPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARFFMVEGWYGVK
FT                   KVESQLWHLSEQLTPKNNVTEFNQAMMDLGSSLCSRSRFDCPACPLSSRCGAFKTQQVK
FT                   TFPHSKPKKAVPKKSCHQLIIKHDDKVLMEKRPNSGIWGGLFGFFEFNELSELEVFIAQ
FT                   QGLTADLVALEPFTHIFSHFELTINPHVLNIVQIPDVINDRQLVWYPLAQSIEVGLAAP
FT                   TKKLVKQIAPIG"
FT   gene            570931..571203
FT                   /locus_tag="PSHAa0555"
FT   CDS_pept        570931..571203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0555"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85643"
FT                   /db_xref="GOA:Q3ILI9"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILI9"
FT                   /protein_id="CAI85643.1"
FT                   /translation="MARTVFCQKLQKEAEGLGFQLYPGEIGEKIFNNISKEAWAQWQHK
FT                   QTMLINEKHLNMMDPEHRSFLEQQMVGFLFENKEVEIEGYKPPEK"
FT   gene            complement(571259..574033)
FT                   /locus_tag="PSHAa0556"
FT   CDS_pept        complement(571259..574033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0556"
FT                   /product="putative sensory box histidine kinase/response
FT                   regulator"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85644"
FT                   /db_xref="GOA:Q3ILI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI5"
FT                   /protein_id="CAI85644.1"
FT                   /translation="MQSKFSSVIKGLLPLFLLSNVIITTLFIIAFSLYSQSEVDTKKSA
FT                   PLIDITSLANKLEAPLIDALTIYGQGKVQELLELTSVFSDNFEYTLYRFSATSQTELVY
FT                   STNKPAIAAIKLNEHLVDQGVLHKVLTLNDQPIGELILKQKKSPPTLTKQTSLLSAYFM
FT                   ACIAVITLFVLALLLNQYINNRLRKSTGLLSEELQAVTDSSNFNSTVNEQLGNGLNVIA
FT                   LNINFLLKKVQAALSENEKTRKELQKLQNNLEIEVQTRTLALEKETLNAQKASEAKTTF
FT                   LATMSHEIRTPMNGVIGTIDLLRQTNLDGSQYRLSTIIRESAFSLLSILDDILDFSKIE
FT                   AGKLNIDPIPFSVTDTIEEVVRVLSSIAKHRDLDLNLSIAPDIPINLIGDNTRVRQILY
FT                   NLCSNAIKFTSTSESHKGQVNISVEVAHNTAEHFTLRFCVTDNGKGMSQAQLREIFNPF
FT                   IQAESSITREYGGTGLGLSICKSLTELMLGTISVNSNIGIGSEFTVELPFSTSGKIKFA
FT                   HKNSLDGRHIVVVSNNVDREKVIYRYLSFMGAKITYVHNEQEIESLHDAKDIIWVVDGI
FT                   DNMDSINAFLRRLLYSLEDNNQQVVVLSKLDDAAINHKNIFYINATPLCKSNFMLSILV
FT                   AAGLHQPKHIKKTIAYDNHLTTEQALAANKLILLVEDNILNQQVITDQLHILGYGVEVA
FT                   NNGEEGINMWRKGNYSLILTDLHMPIMSGYDMVEKIRNEAEMLGSVISQPYIIAVTANS
FT                   LKGEKERCLAVGINDFITKPVELNVLENTLIRWNEKSNHKSIDIPHQKPAMPIDMDSVA
FT                   KYINGDDAKKIRFFKMYLEQSQELIKSINFGVMQSNVNEILEGCHQLKSISKTIGAHRV
FT                   AELAVVFEEQCKTDELNSDKLIDLRDQLEIEYSKAAQFLKEQIKSAEQQEQPS"
FT   gene            574291..574366
FT                   /locus_tag="PSHAatRNA18"
FT   tRNA            574291..574366
FT                   /locus_tag="PSHAatRNA18"
FT                   /product="tRNA-Phe"
FT   gene            574439..574514
FT                   /locus_tag="PSHAatRNA19"
FT   tRNA            574439..574514
FT                   /locus_tag="PSHAatRNA19"
FT                   /product="tRNA-Thr"
FT   gene            574659..574734
FT                   /locus_tag="PSHAatRNA20"
FT   tRNA            574659..574734
FT                   /locus_tag="PSHAatRNA20"
FT                   /product="tRNA-Phe"
FT   gene            574794..574869
FT                   /locus_tag="PSHAatRNA21"
FT   tRNA            574794..574869
FT                   /locus_tag="PSHAatRNA21"
FT                   /product="tRNA-Thr"
FT   gene            575168..575243
FT                   /locus_tag="PSHAatRNA22"
FT   tRNA            575168..575243
FT                   /locus_tag="PSHAatRNA22"
FT                   /product="tRNA-Phe"
FT   gene            575553..576971
FT                   /locus_tag="PSHAa0558"
FT   CDS_pept        575553..576971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0558"
FT                   /product="putative outer membrane transport protein"
FT                   /function="1.2.8 : Other"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85645"
FT                   /db_xref="GOA:Q3ILI8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI8"
FT                   /protein_id="CAI85645.1"
FT                   /translation="MIWQQYQPTLLALSIVLLSGCASNINSQQREQAPNNVPQQWQQKT
FT                   SAPVLHVQQQWLTQLQNPQLNKLVEQALKNNQQLLQSSYDVAIQKQQLIVSGAALWPTL
FT                   DLSARTSRSKNNRPISYNNASSVSLNLGYEVDLWGKLSDSNRQANLNYLAQQARFEQAK
FT                   QQLVADVVKGWFDIVTAKQLLDLYKHREANALQNLDIIESGYRQGLNEALDVYLARNEL
FT                   NNERSRIATQQASLLTTARVLERLLGDYPKGIISANNDLPVINTDIPLGLPSELITRKP
FT                   TLRANWYQLLASDANLAYAHKQRFPSLNLTASLSDTTDRVSDLFSPSSLAWSLLGSISA
FT                   PIFNGGRLKANEEIARLNSQKQEQQYLQTLYDAFSDVENAITLQQSLKAQYTSTLEAQE
FT                   NALAAEQLSFEQYQSGLVSYTTVLDAQGRSFDAQSSLISIKNQLIANRVNLHLALGGDF
FT                   ANTSTELQSNSNEN"
FT   gene            576961..578262
FT                   /locus_tag="PSHAa0559"
FT   CDS_pept        576961..578262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0559"
FT                   /product="putative Secretion protein"
FT                   /function="1.6 : Protein secretion"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8407802; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85646"
FT                   /db_xref="GOA:Q3ILI7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI7"
FT                   /protein_id="CAI85646.1"
FT                   /translation="MKTKTAKIIIPIAVIIATILIVMFIKGNPPEANRFGAPPKASINV
FT                   AVQMLQPQNYQVMVDSYGTVKPRTQSLLVAQASGLIINISDDFREGGFFKKGAVLIQLD
FT                   DRDYQAEVKSAQANLLTAKQGLLEEQARGQQAITDWQRLGNDKPASSLVLREPQLAAAQ
FT                   AQVLSAQATLEKAKLNLERTQIIAPFAGRVLSRNVDLGQVVSNNTQLATIYAIDSVEIR
FT                   LPIKNKDLPFINLPEQYRDGAKNQAGSVIKFSSDLVGEQTWQGQLARTEGAIDESAQQL
FT                   YVVAKINDPYKATQSNQYPIKIGQYVKAQITGKTVSDALIIANSTIYQGSYVYIVEQGV
FT                   LKRKDITLAWQNAAFAMIKTGLKAGDKLVITPLGQVSSGTQVNILGEDNKATKPQSMKQ
FT                   RPTAEQLAQQAKEQDISVAELVKKRRAAKQGDKP"
FT   gene            578259..581342
FT                   /locus_tag="PSHAa0560"
FT   CDS_pept        578259..581342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0560"
FT                   /product="putative multidrug resistance
FT                   protein(AcrB/AcrD/AcrF family)"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85647"
FT                   /db_xref="GOA:Q3ILI6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI6"
FT                   /protein_id="CAI85647.1"
FT                   /translation="MIAWFTKNHVAANLLLVTLLLSGLFSLSTKIPIEVFPSFETDMIS
FT                   IQVSLRGATPEDVEQGVTIRIEESVQDLEGIKQIFSRSSEGSGSVTVEVESGYDPRELL
FT                   ADIKSRVDAINTFPGDAEKPIVALAERKREVIAVTVSSDYGEKETREYAEQVRDQILRL
FT                   PSVTQVELSGVRDYELAIEVSQDTLRQYDLTLAQISNAVANSSSDISAGNLKTQGGDVL
FT                   ISSKGQAYRKDEFASIVVKNQSDGTIIRLGDIATINDGFEETPVRTRFNGKQAAFIDVY
FT                   RIGPQSAITVADEVKAYINAQQPSLPQGFALSYWDDDSELVKSRIATLTTNALQGGILV
FT                   LALLTLFLRPAIAFWVFIGIPVSFMGAFIAMPIFGVTLNVMSLFGFILVLGIVVDDAIV
FT                   TGENVYTHLKTAESGEQAAILGTQEVATPVTFGVLTTVAAFLPLAFIEGARGALFAQIP
FT                   VVVIPVLLFSLIESKFVLPAHLKYIKLRHQKGKQSKFDLLQQRFADGFESAILKYYQPI
FT                   LNLALRHKLATVSLFVGVFLIILTMITSGWTKFVFFPRIPSETVRVNLTLPAGTPFEVT
FT                   NKYVIDMSQKAQQLQEKYRDPDTGESVILNILATTGGRGGVSNSGAVRFEITPAEKRDS
FT                   DIGSRELASEWRELIGVIPGAESLTFRAEIGRSSDPIDVQLSGTSLKVLQDVADHIKTR
FT                   LSTYPTVFDIADSMSDGKEELQIELTEQGLALGLNRVNVAGQVRNSFFGSQVQRIQRGR
FT                   DDVRVMVRLPIDERRSVADLQNILINTPAGGSVPLSHVAILITGQSPSTINRIDRYRTL
FT                   NVTADIEKSNTNMTILQADLSQYLDELMQQYPGVDYALEGEAKEQRESFGSLAWALVFV
FT                   FFIIYALLAIPFKSYLQPLIVMSVIPFGMIGAVVGHWIMGMELTIMSLLGMLALIGVVV
FT                   NDSLVLVDYINKKRTEGIELIEVVKLAGASRFRPVMLTSLTTFIGLMPLLFEKATQAQF
FT                   LIPMAVSLGFGIIFATFITLLLVPVNYMLMERFQGWFK"
FT   gene            581951..582514
FT                   /locus_tag="PSHAa0561"
FT   CDS_pept        581951..582514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0561"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85648"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH3"
FT                   /protein_id="CAI85648.1"
FT                   /translation="MSDLPDYEEAQLLLEKNEIFVSPAEAHGVISGLLACGLTIDDKEY
FT                   LGLLSDVFNDGDSFSNNLKQFFGSIYKQVVASFNDEEFAFDLFLPSDDETLIDQANGLV
FT                   SWVAGFMLGFGLKQKDYGKLSADVKEVITDFSEITRLDTTFEETEEDSQALHEVIEYVR
FT                   VSALLCFAELGKDQSTASTKKTLH"
FT   gene            582543..583865
FT                   /gene="pepP"
FT                   /locus_tag="PSHAa0562"
FT   CDS_pept        582543..583865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="PSHAa0562"
FT                   /product="proline aminopeptidase P II"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.11.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2659585, 2851590; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85649"
FT                   /db_xref="GOA:Q3ILI4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI4"
FT                   /protein_id="CAI85649.1"
FT                   /translation="MVEIQKSEFKARRERLLAKMDSNSVAIIPAASEVTRSRDTHYAFR
FT                   QDSDFFYLTGFNEPDAVLVLAPNSDTPSTLFCLNKDKLAEVWHGRRIGFEKAKNEYLFD
FT                   ATHELSELSEQLFNLLNGKAVLYYAQGAYSAFDGRVFSLLNTLRSAPKKGDTAPSTIKD
FT                   IRLLIHEMRLFKSPSEINIMRAGCEISAQGHVRAMCFAHSGATEYQLEAELHHHYAMHG
FT                   ARHPAYGTIVGSGDNANILHYTQNSDALKSGDLVLIDSGCELQGYAADITRTFPVNGKF
FT                   SPEQAALYNIVLKAQEVAFAEIKPGGYMSHANALAMAVMTQGLLDLGILTGDFNELMAK
FT                   QACKEYYMHGLGHWLGLDVHDVGDYKQNNSERAFAAGMVLTIEPGLYISEDSNAPQKYR
FT                   GIGIRIEDNLLVTPSGYENLTLSAPKTISDIEALMQSNKSA"
FT   gene            583881..585071
FT                   /gene="ubiH"
FT                   /locus_tag="PSHAa0563"
FT   CDS_pept        583881..585071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="PSHAa0563"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /function="2.5.4 : Menaquinone and ubiquinone"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1339425; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85650"
FT                   /db_xref="GOA:Q3ILI3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI3"
FT                   /protein_id="CAI85650.1"
FT                   /translation="MPKQFDVVVIGGGLAGASCALSVAKINPALSIAVVEANEVSNDYH
FT                   PSFDDRSIALAQQSVEYLQGLNLFALNSPYATAIKKVSVSDRHHFGKADINCEEFAKDA
FT                   LGYVVEVNPFGRSLHQLLNAQINISLYCPDSVSAIEQQLHNNIVTLQSGEQIAAKLLVI
FT                   ADGAQSPTRSLFGLKFNTQAYKQGAIIANIEVAGGHNNHAFERFTQHGPMALLPMSNNR
FT                   YSLVWCMQQQHVEQHMAQSEDDFISALQSAFGYRGGQFTKVGMRANYPLVYGQVESLIA
FT                   HRTVVIGNAAHAIHPIAGQGFNLGLRDVQVLSNLISQSPNDLGSYAFTREYAQQRSADI
FT                   NNVMTLTDGLVRLFSNSSRILALGRSIGLFSMDLFPSLKAPLAKQLMGQVKQGQGL"
FT   gene            585068..586234
FT                   /gene="visC"
FT                   /locus_tag="PSHAa0564"
FT   CDS_pept        585068..586234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="visC"
FT                   /locus_tag="PSHAa0564"
FT                   /product="putative monooxygenase, FAD/NAD(P)-binding
FT                   domain"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85651"
FT                   /db_xref="GOA:Q3ILI2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI2"
FT                   /protein_id="CAI85651.1"
FT                   /translation="MKQAQVCIVGGGSVGLTLALGLAKAGISVVVLDAAPKQTPPTDEY
FT                   GMRVSALSIASQTLLEQLNVWPHIVALRASAYTHMDVRDADSFGKIAFNSEQLELDHLG
FT                   HIVENDIICYALIKELEQQPNATLMFDTCYQQIHQSESDVFVTLKSGEPIIAKLLVAAD
FT                   GANSAIRKQFNMALSFKDYDHHALVATVKTQEPHANTARQVFLPSGPLAFLPLSDANTH
FT                   SIVWSTNPTHCEELLAMDDNQFNKAIMAAIDGQCGLCEVQSVRAAFPLKMRYAQQWVAG
FT                   KVVLIGDAAHTIHPLAGLGMNLGLKDAAYLIELLTSDNKEFASTRTLRDYERTRKLDAQ
FT                   KHIAMMYSLKELFAGANPIKKLIRGVGLSMVDNLGPIKHLFAKEAIGK"
FT   gene            complement(586328..587338)
FT                   /locus_tag="PSHAa0565"
FT   CDS_pept        complement(586328..587338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0565"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85652"
FT                   /db_xref="GOA:Q3ILI1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI1"
FT                   /protein_id="CAI85652.1"
FT                   /translation="MSTLADHYFSSCIDYLETLGLNSQAVLSAINFNEYSNKQAQQLAP
FT                   RISLNSYNALLNYAQQTLNEPLFGFKLGQQIRTADFGILGYLIESSNNLASAITALLNY
FT                   DSLVADIGRAEFEQQGELVIIRWLPNANCSPQVILRNMTAWVSVIRQLLNPQLSPSTIY
FT                   FTQAFTSNEKTVLTHWFNCPVKTNAQYNQVVFPSSYLALPFKTDNTQINLVLKQVSEQQ
FT                   LSRFKSQQLLTEKISQLFIAKNDLIDCSLIRTAGALNMTPRTLQRHLKREQISFADLLE
FT                   QERKRRVILCIGKEPLSNIAIKLGFNDQSSFNRAFKRWYNCTPLQYLKTLPKNIG"
FT   gene            587399..587878
FT                   /locus_tag="PSHAa0566"
FT   CDS_pept        587399..587878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0566"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85653"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI0"
FT                   /protein_id="CAI85653.1"
FT                   /translation="MVGHYENTYYIKMIQITLKQKIAATPLQVRDALLDHAQLERFFNA
FT                   KFVLLKKQNEGEIIGGKGAIRQVIMAGVRFEERIISADSNHISYQIIGNKPVAEHRGDI
FT                   YFCVSDNTPTSTEVTYNIRCKTPWWLPSLVIKFFIKKDIAQALNKLKANFKGNIS"
FT   gene            587875..588687
FT                   /locus_tag="PSHAa0567"
FT   CDS_pept        587875..588687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0567"
FT                   /product="conserved protein of unknown function ; putative
FT                   sterol desaturase family protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85654"
FT                   /db_xref="GOA:Q3ILH9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH9"
FT                   /protein_id="CAI85654.1"
FT                   /translation="MSIEIILLALSPVFIIFVSYEFIKYRRYYDIKDSLANTALALMHQ
FT                   GCDAIALIVLMPFFYWLHQYRLFDIELSVLTIFGAFLLQDFLYYWFHKASHHIHWLWAA
FT                   HVVHHSSTKMNFSTAFRQSLMYPLAGMWLFWLPMILIGFDPLSVFTVVALNLAYQFFVH
FT                   TQTVSTLGWFEKVFNTPSHHRVHHAINPGYLDKNFAGVLIIWDKLFGTYAEEKADKPCK
FT                   YGIVGQLNSNNPLTIAFHQWAYLVKSAFKAKGVTAKLKVIFGYPTSSN"
FT   gene            complement(588692..589087)
FT                   /locus_tag="PSHAa0568"
FT   CDS_pept        complement(588692..589087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0568"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85655"
FT                   /db_xref="GOA:Q3ILH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH8"
FT                   /protein_id="CAI85655.1"
FT                   /translation="MSIEYSILALIGAFLTFYLAKHSRFDGIRASAALSIVTYLIFYWL
FT                   NLDPELYSVVFFGGTFIGMSAPHRFGIYTLASSAVIFSLLFEYLVPILDGYGGALGVSA
FT                   FLSVCICHLFIILGAPRSKNISFRRVK"
FT   gene            complement(589087..589461)
FT                   /locus_tag="PSHAa0569"
FT   CDS_pept        complement(589087..589461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0569"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85656"
FT                   /db_xref="GOA:Q3ILH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH7"
FT                   /protein_id="CAI85656.1"
FT                   /translation="MRAMIKFLLLKSITFFAGCMSCFVMHTTFALPLVISAALTGLVGS
FT                   FIPFPKLYQNHPYAAIYAGSFAGMCSTSLITSYWEVAIISIIGATLYTLTLNAFAGFGG
FT                   RLGSVAFASVALYSLAKGLV"
FT   gene            589712..590131
FT                   /locus_tag="PSHAa0570"
FT   CDS_pept        589712..590131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0570"
FT                   /product="conserved protein of unknown function ; putative
FT                   glyoxalase domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85657"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH6"
FT                   /protein_id="CAI85657.1"
FT                   /translation="MSNCLHLAIPAGDLNIAKTFYCDVLGCKTGNSEQGRWIDIDFWGN
FT                   ELTLHQSVERLPTVRHDVDMGAVAVPHFGIHLSENEFNALKQRIESAGLEYLDKPYRRF
FT                   IGDEFEQETFFIEDPNGNVLEMKTMVNPEVLFKKS"
FT   gene            complement(590457..591560)
FT                   /locus_tag="PSHAa0571"
FT   CDS_pept        complement(590457..591560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0571"
FT                   /product="putative alginate lyase"
FT                   /function="2.1.3.5 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="4.2.2.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8200539; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85658"
FT                   /db_xref="GOA:Q3ILH5"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH5"
FT                   /protein_id="CAI85658.1"
FT                   /translation="MNKNNITHLIKPGALIALTTSLVIGCVSQQPKSTEQQANPLVPAS
FT                   KFDLSHWKINVPVDLDNDGKIDEIDVKKIQTYSHPDFFYLDDKGYMVFTSPNKALTSAN
FT                   STNTRSEFRQMLRGANTKIKTKSPKNNFALAVHPLSDRFGSIGGKMEATLKVDHVALRA
FT                   TDPSKNAAYSVVVGQIHAGKDQALIDTKLGYGWGNEPLKIYYKKWPGHKTGSVFWNYER
FT                   NLPKTDPNRTDIAYPVWGNTWENPNEPGNAGIALGEEFSYTVNVYKNVMHLTFSTAGKN
FT                   DVSYSINLGNNVDAYGNVDEKDHPHGYAADWHYFKAGAYNQCSTKNAKGIWYPGCLGTG
FT                   DWATDKQNGDYAQVSFSKLVLSPASPQ"
FT   gene            591888..592673
FT                   /locus_tag="PSHAa0572"
FT   CDS_pept        591888..592673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0572"
FT                   /product="conserved protein of unknown function; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85659"
FT                   /db_xref="GOA:Q3ILH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH4"
FT                   /protein_id="CAI85659.1"
FT                   /translation="MVAPLLLLFISYAQKKFGSFISGIIPGLPITSGPISYFIAIEQGK
FT                   LFAANSAVGALYGMSGIGLFCFVYMAVSYKCGLAKSLLIALSVWCLFSILTLFLPVNIF
FT                   VACLFSISTLLALTFATTKLKVAIDAKPLNSKWELPIKIVLVTSFIMLVTFISEHIGSA
FT                   WSGLLSTFPVILAVMGSIAYISDKKDSAFKILNGGIIGSLGGCIFFAAIALLLKYDILI
FT                   WQVYTVATISSVLFTLIFSHFINRKYVNPVAFNTAKTQL"
FT   gene            complement(592682..593683)
FT                   /locus_tag="PSHAa0573"
FT   CDS_pept        complement(592682..593683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0573"
FT                   /product="putative AraC-family transcriptional regulatory
FT                   protein"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85660"
FT                   /db_xref="GOA:Q3ILG3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG3"
FT                   /protein_id="CAI85660.1"
FT                   /translation="MSAYYWQNKHKKSPITRKSLPKTIKIVILRKSQPCKDAFMSTIAN
FT                   MLQQYAEQNQLLSFEGTMETIITGVYFHRASKSSPRQPLIYNSGIIVVGQGHKVIHFTD
FT                   HKIQYGAGDYLVLGVPVPLECEAFTDGDLPVLGIAVDINPALLHKLVNQMTEHKQFALP
FT                   PTCGQMSGVQSAKLDNAMELVTKRLLTVLNNPLEAQVFGEDIVKELVYRVLCGPQGHTL
FT                   FGLAMHDGHYARIARTLSIMHSNYANPITVEGLAEDVNMSISSFHRAFKQVTFESPLQY
FT                   LKKLRLAKAKALITASGSKANEAALKVGYTSPSQFSREFKRHFNKTPKEMLL"
FT   gene            593751..594896
FT                   /locus_tag="PSHAa0574"
FT   CDS_pept        593751..594896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0574"
FT                   /product="putative alcohol dehydrogenase with
FT                   dehydroquinate synthase-like domain"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85661"
FT                   /db_xref="GOA:Q3ILH2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH2"
FT                   /protein_id="CAI85661.1"
FT                   /translation="MKFSYVNPTLIQFGQQQIASLTDLIAKDQKVLVVYGGGSIKKNGV
FT                   YDQVAAALEGFDWVEFSGVGANPTIEVLDQAVKICKEQDIDFVLGVGGGSVIDGVKYIA
FT                   ASAVYDGEGWDIPTGKHKVTSALPIGAVLTLPATGSESNQGSVVSKAATKQKLPFMSPA
FT                   VQPKFAIMDPDVMKTLPQRQLVNGLVDAWVHTCEQYLTFPEGALVQDGYAEALLKALKV
FT                   LGDNFENQDDAWRANLMWSANQALNGLIGSGVSQDWATHMIGHELTAAYGVDHARSLAI
FT                   VQPSLLRNQFAVKKAKLEQMGKNVFGLAQSDDLAELTIQAIEAFYHSLDVATQLTEHGE
FT                   DKAAAIDNIIGKLEAHGMLALGENQAITLKESREILEQAVA"
FT   gene            complement(595007..595393)
FT                   /locus_tag="PSHAa0575"
FT   CDS_pept        complement(595007..595393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0575"
FT                   /product="putative Zn(II)-responsive transcriptional
FT                   regulator, regulates Zn export (MerR family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85662"
FT                   /db_xref="GOA:Q3ILH1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH1"
FT                   /protein_id="CAI85662.1"
FT                   /translation="MQIKQLAHLVNINAKTIRYYEQINLIPAPKRESNGYRTYTQADTE
FT                   RLIFIRRCRDLQIPIDDIKTLLVAQSYGDKSCVEVDDIIENQLIKVRAAQKELKKLEVS
FT                   LASLLTNCTANTINDCQIIKELNS"
FT   gene            595491..595811
FT                   /locus_tag="PSHAa0576"
FT   CDS_pept        595491..595811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0576"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH0"
FT                   /protein_id="CAI85663.1"
FT                   /translation="MHSKRFLIVILLVLVHSFISCDGAAYHLQEDVDHITSAQLQSNIT
FT                   ADGSQNEAQASAEIHAHQHCHSGYYSTVNHSISPEQSNPALPVRYCGLIYPPMSRPPIS
FT                   LS"
FT   gene            595995..597242
FT                   /locus_tag="PSHAa0577"
FT   CDS_pept        595995..597242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0577"
FT                   /product="putative metal ion efflux outer membrane factor
FT                   protein family"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85664"
FT                   /db_xref="GOA:Q3ILG9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG9"
FT                   /protein_id="CAI85664.1"
FT                   /translation="MLVALLCVLPVFNALANVSASENILTLKQALSNTEQQNPILKRYP
FT                   YHQKILSALKSQATLSPNPVLSVAVENVLGTNDARGVKGAEITLGLSQLIELGDKRQSR
FT                   VGFATANIKAQAIQYQNTRLALLATTAERYYSALKFQTLLALNVERKSVVTQALKTIEQ
FT                   RANAGAVSQADVSRMRYALSQVELEQVKLTSEFERARLLLNELWIDEQSSAFLAGNINV
FT                   ITPLKSQQALLDAVNLAPEFALLQQQYIQQTANLALQKANGQSDINVGGGVRYNQKNDS
FT                   SSLLFSFSMPLQISNANSGNIAAAASELALLNQQQGQLRVQLRQQVRTLYAYYQGIANQ
FT                   ATLLNKQIIPQTQTLIEQSLNSYQRGQISVLQLLDAQQAHFDSKRALIATHAELYQVLL
FT                   TLERLTGQSLIETYQS"
FT   gene            597239..598486
FT                   /gene="czcB"
FT                   /locus_tag="PSHAa0578"
FT   CDS_pept        597239..598486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="PSHAa0578"
FT                   /product="putative Cobalt-zinc-cadmium resistance protein ;
FT                   (cation efflux system protein)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85665"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG8"
FT                   /protein_id="CAI85665.1"
FT                   /translation="MNKNIIALLVSLSLAGSVLSTDVFASAEHGESGHKETEQHEQKQG
FT                   PHGGFLLVDPKLTLELKLQEFAGDVELRIYAYKQSKPINISDLNITMSLKRLVEAPQNI
FT                   QFAAEGDYLVSTQSINEPHSFVLAVTANYNGESISYEYEQHEGRTTLTERAIERAGIKT
FT                   EIAQSGEVDITDTLFGVIAPTQHGTVEVMAPYTGLISDIFVSIGQSVKKGEALVSITNR
FT                   ETLQNYTIKSPISGVVTEQYLKRGELASTSALMQVVNLDKVWVELSAFPENIEKLAIGQ
FT                   SAKVYDLHHHLNTQGKVFFIAPMMTGGHIARARIELNNPDGHWRPGMHINSDVSVAKIN
FT                   ASVRVKPHAIQEFNGQTSVFVRKNNVFEVRPVTLGAKNSEWVEVLTGLNAGSEYVTDNS
FT                   YVIKADILKSGASHAH"
FT   gene            598495..601632
FT                   /gene="czcA"
FT                   /locus_tag="PSHAa0579"
FT   CDS_pept        598495..601632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="PSHAa0579"
FT                   /product="Cobalt-zinc-cadmium resistance protein czcA
FT                   (Cation efflux system protein czcA)"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85666"
FT                   /db_xref="GOA:Q3ILG7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG7"
FT                   /protein_id="CAI85666.1"
FT                   /translation="MINWIVSFAVKRRMLVLALTFLFAGFGVYNIQNLAVDAVPDITNV
FT                   QVQINTKAQGFTPLEVEQRITYLVETAMAGIPKLDYTRSLSRYGLSQVTVIFDEGTDIY
FT                   WARQQIGERIQSIRSDLPANIEPNLGPIASGLGEIFTYSVHTEPNTLKDDGTPYNAEDL
FT                   RTLQDWVIRPQLLKVKGVTEINSQGGFERQYQVAPVPEKLIAYKLTISDVISALEVNNS
FT                   NRGAGYIERFDGQYLVRSPGQLKTLEDIANTVVAKRDDAPVRIKDVANVLLGKELRTGA
FT                   ATYNGEETVLGTAMMLIGENSRVVAKAMADKLVDVQKSLPAGVIVEAVYDRTTLVDKTI
FT                   ATVQTNLFEGAVLVIVVLLLLLGNVTGALITAMVIPLSMLFAVTGMVGNRVSGNLMSLG
FT                   AIDFGLIVDGAVIVVENCLRQLGVAQHKHGRLLTLNERLNVVTAATKEVFTPAVFGIVI
FT                   IMLVYLPLFALSGVEGKMFQPMAFTVVAALIGALIFGVTFVPAAIAVFVRGKVNETENA
FT                   VMRGVKKVYKPLLGISLKLPWLMVGIATALVLVLGFKVKNMGAEFLPQLDEGDIAMHAL
FT                   RITGTGIEQSVQMQKELEQAILKQPEVANVFSKIGTADVASDPMPPNVADTFLMLKPQK
FT                   QWPNPALTKEELVQQIRTRVNDVPGNNYEFTQPIEMRFNELIAGVRADVALRIYGDDLS
FT                   VLKEFGEKATGLMRNIAGATDVRLEQMEGLPTLSVTPMRDHMALLGLSVNDIQQTLAAA
FT                   VGGVQTGLIFEGDKRFSLLVRLDKRWSSDVSALARLPVALPKDSNPELAFVPLGEVATI
FT                   SIEKGPNQINRESGKRNVVVTANVEGRDLASFVSDAQASMNESLNLPSGYWLEYGGTFE
FT                   QLQSASKRLSLVVPVTLLLIFGLLYSAFGSLRDSLIIFSGVPLALTGGVLALLLRDMPL
FT                   SISAGVGFIALSGVAVLNGVVMLSFIKQLRDDGLNLIDAINDGALQRLRPVLMTALVAS
FT                   LGFIPMALNSGTGSEVQKPLATVVVGGIISSTLLTLLILPALYKLVHAKFNKYQAA"
FT   gene            complement(601715..602965)
FT                   /locus_tag="PSHAa0580"
FT   CDS_pept        complement(601715..602965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0580"
FT                   /product="putative orphan protein ; putative membrane
FT                   protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85667"
FT                   /db_xref="GOA:Q3ILG6"
FT                   /db_xref="InterPro:IPR022227"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG6"
FT                   /protein_id="CAI85667.1"
FT                   /translation="MQSARFIPFRKQDIVDMCSEELNNNTQQTSFKQFCDLLASLIHYD
FT                   YHTVLESLKNNYAPFDPNSDTRSLAPVSADQKAQCQHEFAKDFAKVLNAANFEVITNED
FT                   LQDALNEESLFKVRLEVEFDDFEEVVFYRRGESQLTETITSFWGLRKKPLHFTNYDRVA
FT                   VFIRFKDSAYFKAKNKTPLGFEPSSTIVKLFQNVPKADLEMLFPNSEVRMRPIDKVIIG
FT                   SSALVGGAVVLITKLGASIVLLLALFAFWGGFRSEAVEMTQQHFITFAIGMGVFGSFIF
FT                   KEWSKFKNRKIKFMKALSDNLYFKNLDNNAGVFHTLIDAAEEEDIKEALLAYTFLLKSE
FT                   SGLSAQMLDEQIEHWFKSKYQCVLDFEISDALEKLVRMRLVTCSNEIEGNEVYSALSLE
FT                   HAKTILDKRWDNLFQYN"
FT   gene            complement(603129..603524)
FT                   /locus_tag="PSHAa0581"
FT   CDS_pept        complement(603129..603524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0581"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85668"
FT                   /db_xref="GOA:Q3ILG5"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG5"
FT                   /protein_id="CAI85668.1"
FT                   /translation="MEYETKSHCKYLIALHLILVVKYRKQLLKGDVGDFVKQKITEIAE
FT                   RSEFNIEEIEVDKDHIHILLTISPNISVASYVRRIKQSTTQSLWSRFKWFKKQFWVKKT
FT                   FWSDGYFVCSVGNAAADTIRKYIQEQG"
FT   gene            603563..604789
FT                   /locus_tag="PSHAa0582"
FT   CDS_pept        603563..604789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0582"
FT                   /product="putative transposase (IS605)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85669"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG4"
FT                   /protein_id="CAI85669.1"
FT                   /translation="MKKTLRYNYRLNPTPEQEAKLVEFGATARGIWNLLLSENMRRYEH
FT                   DKTFLFYKDMASLLKDIKTFEEFNWIKAFDSAAAQQVARDLELALKNAFTKGRLQRFPK
FT                   HKISYKKKKLHNDSFRAVNNSNCIRIENGAISIPKVGKIPIILHRKLASKIKTVTIQYH
FT                   HGKWGCSITQEVECKTAKQVLKTITGFDINSKQTVVGSDGFVVDNPKFLKQSKTKLNQL
FT                   QRQLARRTKGSNRWQKTKQRINKLHGKISRQRLDFAHKISRQITNENDILVFEDLNVKG
FT                   MQKFNGSMVADNVMGLITQLSKYKTELEGKLYHEIGRFEKSTGVCSECGQHHVLTLNDR
FT                   YFTCTACETYQSRDLSAAKSIAKTGELDLIAAGIVARVTPTSQQKSAIKTKVFELSKFA
FT                   VGTEKKEAA"
FT   gene            604947..605531
FT                   /locus_tag="PSHAa0583"
FT   CDS_pept        604947..605531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0583"
FT                   /product="conserved protein of unknown function; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85670"
FT                   /db_xref="GOA:Q3ILG2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG2"
FT                   /protein_id="CAI85670.1"
FT                   /translation="MAIQKKLKQKTRNFIESKHMLSGITVASFLESTIVPIPLEAVLVP
FT                   LMQARREKLWLIALMATLGCIVGALFGYALGYYLFDAVGDWVINSFSSPEQFENVKQQM
FT                   HNQGFWFVITLGIVPIPFQIAMLAAGATKYSLGLFLLASAISRAIRYFALAVVVYYAGN
FT                   KAEQLISKHKTKAMITLTVFVIGIWWLTTVI"
FT   gene            605572..608217
FT                   /locus_tag="PSHAa0584"
FT   CDS_pept        605572..608217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0584"
FT                   /product="conserved protein of unknown function; putative
FT                   integral membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85671"
FT                   /db_xref="GOA:Q3ILG1"
FT                   /db_xref="InterPro:IPR014600"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG1"
FT                   /protein_id="CAI85671.1"
FT                   /translation="MDELIGLVGLFILAIIAGAICGFIALTQLKSLRQQVVQLTAKVNS
FT                   LLQQQEQLVPLASKQAPPQAQPQPQVSTPATVSTQVKTAAISGNEAVVTKTAKTNTFPK
FT                   KPSVLNTLFNKLRAGLEENWMTWIGAIALAFGGIFLAKYSLEAGLLSPVMRLSLGALFG
FT                   LGLIAAAGYLHYKRIIFEGFNNYIPAALASGGFITCFALALLAYSNYAMLSSTVAFVLL
FT                   AIIALSASVMAIKFGPLLAVLGIVGAYSVPIWVSSNSVNLFSLFMYVGFVSLFAAIVAH
FT                   QVQRIWLWYLLWAGHVFWYLAGFVLLESSTIWLLGVYAVASIIGLVAIPRLGVRFTLIE
FT                   FRPHSLKRLINVLPDHPLMLVFTAPFILMMLLHRFDAQFQIFSLITLVLMLFLVLKNSR
FT                   WDLWQAVCLVIAFIVLVSTQQTFDFDDALFIFKQEYGLGLILGFTLTAYGLYFGRKFPK
FT                   RLAFHITGAFSLFLMIATLY