(data stored in ACNUC1829 zone)

EMBL: CT010217

ID   CT010217; SV 1; linear; mRNA; STD; MUS; 846 BP.
XX
AC   CT010217;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836A0251D for gene
DE   Cd37, CD37 antigen; complete cds, incl. stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-846
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-846
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; fa1a3ec9dcbcf5aaf750b89549c0a084.
DR   Ensembl-Gn; ENSMUSG00000030798; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032211; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032126; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031918; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032694; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031246; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031991; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032118; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030969; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031363; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000098461; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083753; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0083822; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0083767; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083794; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084290; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083880; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083493; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082420; mus_musculus_wsbeij.
XX
CC   RZPD; RZPDo836A0251D, ORFNo 30141
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836A0251D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_007645 (GI:31982470)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..846
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836A0251D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1..846
FT                   /codon_start=1
FT                   /gene="Cd37"
FT                   /db_xref="GOA:Q4FK35"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK35"
FT                   /protein_id="CAJ18425.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCAQSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
XX
SQ   Sequence 846 BP; 157 A; 244 C; 232 G; 213 T; 0 other;
     atgtccgccc aagagagttg cctcagcctc atcaagtact tcctcttcgt tttcaacctc        60
     ttcttctttg tactaggcgg cctgattttc tgcttcggca cctggatcct cattgacaag       120
     accagcttcg tgtcctttgt gggtttgtcc ttcgtgccac tgcagacttg gtccaaggtc       180
     ctggctgtct caggtgtcct caccatggcc ctggctctcc tgggctgtgt gggggctcta       240
     aaggagctgc gctgtctcct gggcctgtat tttggaatgc tgctgctcct gtttgccaca       300
     cagattaccc tgggcatcct catttccact cagcgggtcc ggctggagcg aagggtgcag       360
     gaattggtgt tgaggacgat ccagagctac cgcacgaatc cggatgagac agcagccgag       420
     gagagttggg actatgcaca gttccagctg cgctgctgcg gctggcaatc tccgcgggac       480
     tggaacaagg cccagatgct gaaagcgaac gagtctgagg agccctttgt gccctgctcc       540
     tgctacaact ccacggcgac caatgactcc accgtctttg ataagctctt tttctcccag       600
     ctaagccggt tggggccgcg ggcgaagctg aggcagactg ctgacatatg tgcactccct       660
     gcaaaagctc acatctaccg tgagggctgc gcgcagagcc tccagaagtg gctgcacaac       720
     aatatcatct ccatagtggg aatctgtctg ggagtcggtc ttcttgagct cggcttcatg       780
     acgctctcaa tattcctgtg tagaaatctg gatcacgtct atgaccggct ggcccggtac       840
     cgctag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page