(data stored in ACNUC1829 zone)

EMBL: CT010285

ID   CT010285; SV 1; linear; mRNA; STD; MUS; 717 BP.
XX
AC   CT010285;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836H0951D for gene
DE   Tm4sf7, Transmembrane 4 superfamily member 7; complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-717
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-717
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; ab39c0650bde0a52f7ab2d6da6eaa7e1.
DR   Ensembl-Gn; ENSMUSG00000025511; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033236; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033217; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032933; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032263; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032905; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033010; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033043; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031967; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032373; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117634; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087640; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087662; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087382; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087226; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086282; mus_musculus_wsbeij.
XX
CC   RZPD; RZPDo836H0951D, ORFNo 30225
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836H0951D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence BC003482 (GI:13097503)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..717
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836H0951D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1..717
FT                   /codon_start=1
FT                   /gene="Tm4sf7"
FT                   /db_xref="GOA:Q4FJW7"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1928097"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJW7"
FT                   /protein_id="CAJ18493.1"
FT                   /translation="MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLS
FT                   SSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLF
FT                   FAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 717 BP; 132 A; 194 C; 198 G; 193 T; 0 other;
     atggcgcgcg gctgcctcca gggcgtcaag tacctcatgt tcgccttcaa tctgctcttc        60
     tggctgggtg gctgtggtgt cctgggtgtt ggcatctggt tggctgccac acagggaaac       120
     tttgccacct tatcatcctc atttccatcc ttgtcggctg ccaacctgct catcgtcacc       180
     gggaccttcg tcatggccat cggcttcgtg ggctgcattg gggccctcaa ggagaacaag       240
     tgcctactgc tcactttctt tgtgctgctg ctgctagtgt tcctgctgga agccaccatt       300
     gctgtgctct tctttgccta cagtgacaag attgacagtt atgcccaaca agacctgaag       360
     aagggcctgc atctgtatgg cacacagggc aacgtgggcc tcaccaatgc ctggagcatc       420
     atccagactg atttccgatg ctgtggagtt tccaattaca ctgattggtt tgaggtatac       480
     aatgccactc gtgtgcctga ctcctgctgt ctggagttca gtgatagctg tgggttacat       540
     gaacctggta cctggtggaa gtcgccctgt tatgagacag tgaaggcctg gctccaggag       600
     aacctgctag ctgtgggcat ctttggactg tgcacggcac tggtgcagat tctgggcctc       660
     accttcgcta tgaccatgta ctgccaggtg gtaaaggcgg acacctactg tgcatag          717
//

If you have problems or comments...

PBIL Back to PBIL home page