(data stored in ACNUC7421 zone)

EMBL: CT573213

ID   CT573213; SV 2; circular; genomic DNA; STD; PRO; 7497934 BP.
XX
AC   CT573213;
XX
PR   Project:PRJNA17403;
XX
DT   03-AUG-2006 (Rel. 88, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Frankia alni str. ACN14A chromosome, complete sequence.
XX
KW   .
XX
OS   Frankia alni ACN14a
OC   Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
XX
RN   [1]
RP   1-7497934
RA   Genoscope;
RT   ;
RL   Submitted (30-AUG-2006) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RC   1. UMR CNRS 5557 Ecologie Microbienne, IFR41 Bio Environnement et Sante
RC   Universite Lyon I, Villeurbanne 69622 cedex, France; 2. Department of
RC   Molecular and Cell Biology, University of Connecticut, Storrs, CT 06279 3.
RC   Department of Microbiology, University of New Hampshire, Durham, NH, 03824.
RC   4. Department of Plant Sciences, University of California, Davis, CA 95616
RC   5. INRA-URGV, 2 rue Gaston Cremieux BP5708 91057 Evry cedex, France 6.
RC   Genoscope, Centre National de Sequenage, 2 rue Gaston Cremieux BP5706 91057
RC   Evry cedex, France. 7. Genoscope, CNRS-UMR 8030, Atelier de Genomique
RC   Comparative, 2 rue Gaston Cremieux BP5706 91006 Evry cedex, France 8.
RC   Bioinformatics and Evolutionary Genomics Laboratory, UMR CNRS 5558,
RC   Universite Lyon I, Villeurbanne 69622 cedex, France 9. DOE Joint Genome
RC   Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598 10. Departments of
RC   Botany and Biochemistry, Cellular & Molecular Biology and The Genome
RC   Science & Technology Program, The University of Tennessee, Knoxville, TN
RC   37996 11. UPSC, Dept of Plant Physiology, Ume University, S-90187 Ume,
RC   Sweden 12. Instituto de Biologia Molecular e Celular, Microbiologia Celular
RC   e Aplicada, Rua do Campo Alegre, 823, 4150-180 Porto, Portugal. 13. Clemson
RC   University Genomics Institute, Room 304 Biosystems Research Complex,
RC   Clemson, SC 29634 14. Departamento de Ciencia y Tecnologa, Universidad
RC   Nacional de Quilmes, Saenz Pea 180 Bernal B1876BXD Argentina
RP   1-7497934
RX   DOI; 10.1101/gr.5798407.
RX   PUBMED; 17151343.
RA   Normand P., Lapierre P., Tisa L.S., Gogarten J.P., Alloisio N.,
RA   Bagnarol E., Bassi C.A., Berry A.M., Bickhart D.M., Choisne N., Couloux A.,
RA   Cournoyer B., Cruveiller S., Daubin V., Demange N., Francino M.P.,
RA   Goltsman E., Huang Y., Kopp O.R., Labarre L., Lapidus A., Lavire C.,
RA   Marechal J., Martinez M., Mastronunzio J.E., Mullin B.C., Niemann J.,
RA   Pujic P., Rawnsley T., Rouy Z., Schenowitz C., Sellstedt A., Tavares F.,
RA   Tomkins J.P., Vallenet D., Valverde C., Wall L.G., Wang Y., Medigue C.,
RA   Benson D.R.;
RT   "Genome characteristics of facultatively symbiotic Frankia sp. strains
RT   reflect host range and host plant biogeography";
RL   Genome Res. 17(1):7-15(2007).
XX
DR   MD5; d14f558a3fa09109614cee9932f3383d.
DR   BioSample; SAMEA3138259.
DR   EuropePMC; PMC1716269; 17151343.
DR   EuropePMC; PMC2440963; 18273689.
DR   EuropePMC; PMC2770080; 19821988.
DR   EuropePMC; PMC3127629; 21498757.
DR   EuropePMC; PMC3625739; 21656887.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01325; CRISPR-DR12.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CT573213.
DR   SILVA-SSU; CT573213.
XX
CC   Annotation data relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny results (Syntonizer software) are available in
CC   FrankiaScope database via the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage/frankia.
CC   Each annotation includes a confidence level as follow:
CC   1 : Function experimentally demonstrated in the studied organism
CC   2a : Function of homologous gene experimentally demonstrated in an other
CC   organism
CC   2b : Function of strongly homologous gene
CC   3 : Function proposed based on presence of conserved amino acid motif,
CC   structural feature or limited homology
CC   4 : Homologs of previously reported genes of unknown function
CC   5 : No homology to any previously reported sequences
CC   6 : Doubtful CDS
CC   7 : Gene remnant
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7497934
FT                   /organism="Frankia alni ACN14a"
FT                   /strain="ACN14A"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:326424"
FT   gene            424..2028
FT                   /gene="dnaA"
FT                   /locus_tag="FRAAL0002"
FT   CDS_pept        424..2028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="FRAAL0002"
FT                   /product="Chromosomal replication initiator protein"
FT                   /function="2.1.1 : DNA replication"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUQ4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58685.1"
FT                   /translation="MSNPRADSVAGLPFGEEPAGDPDLAAVWSQAVAGVADGTLSAQQR
FT                   AWLRLTRPLGLVQDTALLAAPNEFTKELLDSRLRPFLSTALSTAYGREIRVAVTVEHLP
FT                   DPEPMSGPIRIVRPGEGDGGAPRDAGGSRGRGSGGAAADTGRRAGEAGAPVNGELPFPD
FT                   SAESTPPMRVGAGLGRDAAPLETEPAQARLNPRYVFETFVIGDSNRFPHAAAVAVAEAP
FT                   AKAYNPLFIYGDSGLGKTHLLHAIGHYALKLYPNTRVKYVSSEEFTNDFINSIRDDRQQ
FT                   AFQRRYRDIDVLLVDDIQFLENKERTQEEFFHTFNVLHDGEKQIVISSDRSPKQLSALE
FT                   DRLRSRFEWGLMTDITPPDLETRIAILSKKAATERLPVPPDVLEYIATHIERNIRELEG
FT                   ALIRVAAFASLNKSHVDRTLAEIVLRDLIPDAGNPDITAAAIMNATAAYFGVSMDDLCG
FT                   TSRSRVLVTARQIAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKIRGLMAERRAIY
FT                   NQVTELTNRIRVQARQP"
FT   gene            complement(1971..2411)
FT                   /locus_tag="FRAAL0003"
FT   CDS_pept        complement(1971..2411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0003"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58686.1"
FT                   /translation="MCYRTRRRVDLRDGCPQAVTAVPWGSPTDHRPADAPATHPDAGVP
FT                   EPGPAAPGRRLLRCVLDGSSRRPAERIAVRPAGVDPVPHRGAASYVMGATAVWVQRSVP
FT                   ARPPAVGARESGVGSRAGARGCPSQGWRAWTRMRLVSSVTWL"
FT   gene            2856..4097
FT                   /gene="dnaN"
FT                   /locus_tag="FRAAL0004"
FT   CDS_pept        2856..4097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="FRAAL0004"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="2.1.1 : DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUQ2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58687.1"
FT                   /translation="MLIGVPDGLTPNTGGDEGGLTMKFRVERDEFTEAVAWTARTLPSR
FT                   PTTQLQVLSGLLLDATGPMLKVAAYDYEVAAQGTVHATVSEEGRALVNGKLLAEITRAL
FT                   PAAPVDLGIDGTRLVITCGNARFALPMLPVDDYPALPAMPPVTGHIEGSAFAAAVAQVA
FT                   IAAGRDDTLPVLTGVRIEIEGDTLTLAATDRYRLAVRSLKWRPDDSAGEGDAAAPVTVA
FT                   LVPARTLLDTAKSLSGSGVEVSIALGTGPSGETLAGFAGSTRQTTTRLLEGQFPPFRKL
FT                   LPDSSPLIAQLEIAPLQEAVKRVALVAAKTAPVQLSFSPDHLVLEAGTGGEAQATETLP
FT                   VTYDGPELSVAFNPSYLLDALGALESDIVRIGFASAEDPAVAANKPAILTGKADDDGEV
FT                   PDYRYLLMPIRLHG"
FT   gene            4099..5235
FT                   /gene="recF"
FT                   /locus_tag="FRAAL0005"
FT   CDS_pept        4099..5235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="FRAAL0005"
FT                   /product="DNA replication and repair protein recF"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUP6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RUP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58688.1"
FT                   /translation="MHLTHLSLVDFRSYPSLDLTLGPGVVTLVGRNGQGKTNLIEAIGY
FT                   VATLASHRVSADAPLVRQGASHAVVRARIVRGDRAALVELEIVPGRANRARLNRAPVPR
FT                   PRDVLGLLCTVLFAPEDLALVKGDPAGRRQFLDELLVARTPRMAAVLADYDRVLKQRST
FT                   LLRTAGAARRAGGKGDLRTLDVWDGYLASYGAELLTARLALVEALRPGVAGAYAAVAGA
FT                   QAAVGFEYRASVPQPAPDPVRPDRERWEEAIRAELVAARPREIERGQTLVGPHRDDLLL
FT                   TVDGLPARGYASHGESWSLALALRLASFELLRADDREPVLLLDDVFAELDVQRRSRLAE
FT                   LVAPAEQVLVTAAVEADVPAELTGTRYVVAAGEVLRAS"
FT   gene            5555..5941
FT                   /locus_tag="FRAAL0006"
FT   CDS_pept        5555..5941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58689.1"
FT                   /translation="MPGIAAPGREWRDPVSFGTAISRLLAARGWKAQADDAGVLARWDV
FT                   IVGPDIADHCTPVSLRDGNLELVAESTAWATQLRMLSRQILAILHRELGPQVVQRITVR
FT                   GPTAPSWRHGPIRTAGRGPRDTYG"
FT   gene            complement(6005..6178)
FT                   /locus_tag="FRAAL0007"
FT   CDS_pept        complement(6005..6178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0007"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58690.1"
FT                   /translation="MLPARRRPELPQPPGAVAIGEHRIALPVCPSLPAGHPASPRRPGA
FT                   LVAGPARHCPPP"
FT   gene            6353..8323
FT                   /gene="gyrB"
FT                   /locus_tag="FRAAL0008"
FT   CDS_pept        6353..8323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="FRAAL0008"
FT                   /product="DNA gyrase subunit B"
FT                   /function="2.1.1 : DNA replication"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1656869; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUP2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58691.1"
FT                   /translation="MDTSAQNEGTRRVAYDASSIKVLEGLDAVRKRPGMYIGSTGERGL
FT                   HHLVYEVVDNAVDEALAGYCDTITVSLLADGAVRVVDNGRGIPVGMHPTEKRPAVEVVL
FT                   TTLHAGGKFDGKSYAVSGGLHGVGVSVVNALSTKLDVEIQVDGHVWFQPYVGTRPAAPL
FT                   VKTGTTKKTGTSVTFWADPTIFETTEYKFETLSRRLQEMAFLNKGLSITLIDERPEERL
FT                   EVTYKYTNGLVDFVAHLNATKDAIHRSVISLESKGVGIEAELAMQWNAGYSESVYTFAN
FT                   TINTHEGGTHEEGFRAALTSAVNAYAKDQNLLKPVKAGAKSGDERLSGDDIREGLTAII
FT                   SVKLAQPQFEGQTKTKLGNTEAKKFVQEMCYSALKDWFEVNRTEARAIVSKSLDAQRAR
FT                   IAARQARDLTRRKGLLGGTGLPGKLADCQYTDPERCELYIVEGDSAGGSAKGGRDSKFQ
FT                   AILPLRGKILNVEKARIDRVLKNTEVQALIQALGTGIHDDFDIAKLRYHKIVLMADADV
FT                   DGQHIRTLLLTLLFRFMRPLVEAGHVFLAQPPLYKIKWGREDWEYAYSDRERDGLVQRG
FT                   VEAGRKLPKDAIQRFKGLGEMNATELWDTTMDPDKRILLQVTLDDAAVADELFSVLMGE
FT                   DVDARRSFIQRNAKDVRFLDI"
FT   gene            8491..10995
FT                   /gene="gyrA"
FT                   /locus_tag="FRAAL0009"
FT   CDS_pept        8491..10995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="FRAAL0009"
FT                   /product="DNA gyrase, subunit A, type II topoisomerase"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.1.1 : DNA bending, supercoiling, inversion"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUP1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58692.1"
FT                   /translation="MVDVLPPPPGDRIEPIGIEVEMQRSYLDYAMSVIVGRALPEVRDG
FT                   LKPVHRRVLYAMYDGGYRPDRGYFKCSRVVGDVMGNYHPHGDSAIYDTLVRLAQPWSLR
FT                   YPLVDGNGNFGSPGNDPPAAMRYTEARMAALAMEMLRDIDQETVDFAPNYDGRSQEPLV
FT                   LPSRFPNLLVNGAGGIAVGMATNIPPHNLREVATGVQWALDHAEATDEELLEALIGIIK
FT                   GPDFPTSGLIVGRSGIEDAYRTGRGSIRMRAVVNVEENKGRTQLVVTELPYQVNPDNLA
FT                   EKIAELVRDNKVTGISDVRDETSARIGQRLVIDLKRDAVAKVVLNNLYKHTQLQDTFGV
FT                   NMLAIVDGVPRTLRLDQMIRYYVEHQVDVIVRRTRYQLRKARERLHVLDGLLIALDHLD
FT                   EVISLIRNAESADAARGQLMERFTLSEIQATAILDMQLRRLAALERQRIIDEAAELRAR
FT                   ISELEAILASPVRQRQIIGEELAEVVEKFGDERRTRLVPFEGDMSIEDLIAQEDVVVTV
FT                   TRGGYAKRTKTDLYRSQRRGGKGVQGAALREDDIVEHFFVTTTHHWLLFFTNKGRVYRA
FT                   KAHELPEQARSAKGQHVANILAFSQDERIAEVIALKDYEVAPYLVLATKRGLCKKTALS
FT                   DFDSNRAGGLVAINLRDDDELIAARLVAPGDDLLLVSRNAQSIRFHADDEQLRPMGRAT
FT                   SGVIGMRFDAEDELLSMDVVVPGTTADLLVATSGGYAKRTPLAEYPVQGRGGKGVLTAK
FT                   IVSTRGGLVGALVVDPDDQLYAIASNGGVLRTIAKDVRRAQRQTMGVRLIDLETGVQVV
FT                   GVARNADAEDTEAPTDPGAQES"
FT   gene            complement(11151..11954)
FT                   /locus_tag="FRAAL0010"
FT   CDS_pept        complement(11151..11954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0010"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58693.1"
FT                   /translation="MRVGVARDRPDRSSAAAAGRDAGAETAGSEDDDADDAEDDDGTED
FT                   DDGGDDADGDDPDVAGGADFGGTDLAGGADFGGADFGGADLAGAADDRAGSAAAARSPP
FT                   AIPDVLPPRAVEDDEADDPGFDETGGEAGGEADGEDPAAPAPEVLSRPSSPCWDCPAPD
FT                   RPERWKKGLPADGSSEPAPPERAPPEAAGRSPPGGGVPAAPAAAAAAPAPPPEALAVGG
FT                   FSVSPAGSPSPPSPGRRERSPSRAPPGPAAGEEPRWTADRAGRSS"
FT   gene            12280..12897
FT                   /locus_tag="FRAAL0011"
FT   CDS_pept        12280..12897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0011"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58694.1"
FT                   /translation="MPVPDAVRPAAPAAGRGANATAAYERPIAAPSSAGTTTAAAPPHA
FT                   MTTTSPGALDDQLEAVPADRASAPRGPGRPGPGTGSARPPGAGRRAKLRLSKVNPLTVT
FT                   RLSFAFSLCVFVVLLVAVAVLWFVLNSIGVFNSVTDAADTLTDSSASNVRSWLSFGRAM
FT                   EISLLIGAINVILMTALTTLGALLYNLCAEMIGGIELTLSDQ"
FT   gene            12962..13035
FT                   /locus_tag="FRAALtRNA1"
FT   tRNA            12962..13035
FT                   /locus_tag="FRAALtRNA1"
FT                   /product="tRNA-Ile"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            13085..13147
FT                   /locus_tag="FRAAL0012"
FT   CDS_pept        13085..13147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0012"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58695.1"
FT                   /translation="MMLAGGTTPRTPRVWRGSLL"
FT   gene            complement(13328..13957)
FT                   /locus_tag="FRAAL0013"
FT   CDS_pept        complement(13328..13957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0013"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUQ1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58696.1"
FT                   /translation="MTTNGPYGDEHNQGAGPAYGGQGPAYGQGPAYGGQGPAYGGQGPA
FT                   YGQGPAYGQPPGYPPYPQAPGYGAGQPQGAALPGLGVRLGARIVDNLILTVVNVATFFI
FT                   LGYGLGWTALTAVLTYAYFVGFDVALGATPGKKALGLRVVGPGGGRLGPNNAAVRELFL
FT                   LFNIIPILGPLLLFVAYIAIGVTISSDPRDQGIHDRLAGGTQVLRG"
FT   gene            complement(14458..15384)
FT                   /locus_tag="FRAAL0014"
FT   CDS_pept        complement(14458..15384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0014"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58697.1"
FT                   /translation="MEETPARVDLLLDALRQQAREEFSGAVVVLGEANGKVVLREGLLT
FT                   TATTSAAPGLESLLLRSGRISDEEWTAVFAAAAPSGRLPTALVERRLLGSAGVQVVTRM
FT                   ATMDALFALALTQIARVTTEPAGSGFLPPLLPVEPGIEVERAIRETSRRLASASRWRAD
FT                   LGLEPQVRPRLATASARHGTAGGAQADLLARIDGRRTCRDIAFTVGRGLFPVMTDLASL
FT                   AGDGRIVLPPPQGRSPVRSDAGRPAASGPPDYGDRVRTEIPHLAVGADSQERQKMMADT
FT                   ALPRRSPPHRDGGGPPDHGFPARRRTR"
FT   gene            15581..15976
FT                   /locus_tag="FRAAL0015"
FT   CDS_pept        15581..15976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58698.1"
FT                   /translation="MLCQRVEGYLMDIETALKEAMTIDGAIGASLVDYESGMMLGSAGG
FT                   GRTLDLEAASAGNTDVVRAKARTLDALGIKEGIEDILITLDRQYHLIRLLHRGGSPLFF
FT                   YLALDRPRANLALARHSLRAIARGLDL"
FT   gene            16093..16470
FT                   /locus_tag="FRAAL0016"
FT   CDS_pept        16093..16470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0016"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUP7"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58699.1"
FT                   /translation="MSTSTITDGVLAELHALRDQVPGVTSSAVASADGLLVAADADGVR
FT                   SEVLAAMAAAALGLGRSTGQEAGMGPLREVITRCQGGHIIVYAIGETRLLVVLGDEGLD
FT                   LERLHLQSRPAVTRLAGLLAA"
FT   gene            16491..16694
FT                   /locus_tag="FRAAL0017"
FT   CDS_pept        16491..16694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0017"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58700.1"
FT                   /translation="MRAGAGAPGGGLTRPPLVSPSLWITGVGTHGPMRSGGSCVRMPPC
FT                   SRVPCVAMCGRSTTAPGNCLPG"
FT   gene            16757..16927
FT                   /locus_tag="FRAAL0018"
FT   CDS_pept        16757..16927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0018"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58701.1"
FT                   /translation="MGGTAGPTCVTCGQCPAEDTQCRQCREERQRRAEEEFAVWWEQLG
FT                   RSRRTGRRPSR"
FT   gene            17226..17900
FT                   /gene="def"
FT                   /locus_tag="FRAAL0019"
FT   CDS_pept        17226..17900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="FRAAL0019"
FT                   /product="Peptide deformylase 3 (PDF 3) (Polypeptide
FT                   deformylase 3)"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /EC_number="3.5.1.88"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUN7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58702.1"
FT                   /translation="MASRTARSNEANEKRDLRVRVLGEPVDAYPEVPPEVARGTIRRIT
FT                   VVGEPVLHRPCRKITEFGTPELAALIDDMFATMYGAEGVGLAANQIDVDAALFVYDCTD
FT                   EDGVRHVGHLANPELEESDPAERRLVKGEEGCLSVPGAYMEVARLERAAVRGQDATGAP
FT                   LRLEGTGYFARCLQHETDHLYGGLYLDRLSSRGRKKALKEMEERAEEIFARRTEVAGTL
FT                   GK"
FT   gene            complement(18112..18504)
FT                   /locus_tag="FRAAL0020"
FT   CDS_pept        complement(18112..18504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0020"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58703.1"
FT                   /translation="MAARSRSRKPHPRDTAPADPRRAAGGAATAPEADPAVSPPVGPAT
FT                   SPLADLATSPLTDLAAPLVGGPARSPIPDAAGVPAQDRRSRRERRGHGEDGGGPRSGPG
FT                   APRLPGAAGATGAGRNPRRFATRRQG"
FT   gene            18631..18843
FT                   /locus_tag="FRAAL0021"
FT   CDS_pept        18631..18843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0021"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58704.1"
FT                   /translation="MGSGRARRRFYERTNQQDYQALWRLAWPEVRRHEAIAHVGWGRGE
FT                   NSATPPRRRVHRGVHTPTQMPMNAG"
FT   gene            19083..19700
FT                   /locus_tag="FRAAL0022"
FT   CDS_pept        19083..19700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58705.1"
FT                   /translation="MDAALRQVAEGATGFMPPQEGLALYTAATAIPAGGLICEVGTYCG
FT                   KSTLYLAAAARAAGGTVVTVDHHRGSEENQAGWEYHDTTLVDPRTGRLDTLPFLRRTLE
FT                   QAQVEDVVTAIVGRSEQVGRWWSTPVALLFLDGGHTEEQAQADYSAWGRHVAPGGLLAI
FT                   HDVFPDPADGGQAPYHVLLRALDEGFREQSRTGSLRVLRRVD"
FT   gene            complement(19683..20939)
FT                   /locus_tag="FRAAL0023"
FT   CDS_pept        complement(19683..20939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RUN3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58706.1"
FT                   /translation="MRSVESAPVLTPEALTATATAIAAVQEPDGAIPWYPGGHTDPWDH
FT                   LECAMALDLGGLVDAADAAWAWLRRNQRADGSWATSHVAGAVKEDFADSNQCAYVATAA
FT                   WHRWLLTGDRAFAAGIWPVVRRALDLVVDMQAPSGQIWWARGSDGVDYPESLLTGCSST
FT                   LHSLRCGMALAALVGEVPPAWERATGALHHALVAHPEYFAPRDRWSMDWYYPVIGGVLR
FT                   RSAGRARLAARWDDFVVDGLGIRCVDDEPWVTGAETCELAIALHLVGETAAAAKLVADM
FT                   QHLRHDDGGYWTGWQFANRTFWPVERSTWTAAAVILAADTLAGGVTETLFRGDDLPAGL
FT                   HRPLVRRADAGAGADRSRGEARPPQQRPASDSDPLGAPGSASPAAPEGGPVPATAAMAA
FT                   TAAMAATGPACGCQSVDAA"
FT   gene            complement(20926..21657)
FT                   /locus_tag="FRAAL0024"
FT   CDS_pept        complement(20926..21657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0024"
FT                   /product="putative 3-demethylubiquinone-9
FT                   3-O-methyltransferase"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="2.1.1.64"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1479344; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUN2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58707.1"
FT                   /translation="MLTVDFDRFPVPAGCRLLDLGCGAGRHSFEAFRRGADVVALDYSL
FT                   DEVGGVNAMLAAMALEGQAPAAARAAGVRGDALALPFADATFDRVIIAEVLEHLPADTA
FT                   AMAEIARVLRPGGWVAVTVPNRLPEQVCWSLSTAYHTVEGGHIRIYRQSELRERLTAVG
FT                   LEPIGTHFAHALHAPYWWLRCLVGVHDDDHPATRLYHRLLVWDMMRRPLVTRLADRILN
FT                   PVIGKSIVLYLRKPEVARAVG"
FT   gene            complement(21669..23012)
FT                   /locus_tag="FRAAL0025"
FT   CDS_pept        complement(21669..23012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0025"
FT                   /product="putative glycosyl transferase"
FT                   /function="1.7.9 : Misc. glucose metabolism"
FT                   /EC_number="2.4.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUN1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58708.1"
FT                   /translation="MLSGPPYPDLDDGVGLTELPSLDLYRDSDPFRWPGLAELRALPDV
FT                   VEFGMMRTGQFSEPLSFSLRAYQALRPRAAGGRPPFDIVHDNQGLGYGLLALRAALRPH
FT                   RIPVVSTVHHPITVDRRLSLAAASSFTARVGLRRWYSFLPMQARVARRLDGIVIPSESS
FT                   RREIITDMELPSEVMHTVPLGVDADVFTPAPTSTNAPAPTVAGRIVVVTSADVPLKGLG
FT                   VLLEALAKLRSERGAHLVCIGKVREGGQAQRRVTELGLGDAVTFRSNVPEQELIELLRS
FT                   AEVAVVPSLYEGFSLPAVEEMACGIPLVATTAGALPEVAGADGEAALLVPPGDPDALAG
FT                   AIRALLDDPARRARMGAAGRRRVEERFSWRAASAATAAWYAERIAAVGGTPTSPYPGSS
FT                   WSWAPPTPASWPAGSAGLAAADVTPDVTPVQAAAPDAASPSASPTLAG"
FT   gene            complement(23425..23775)
FT                   /locus_tag="FRAAL0026"
FT   CDS_pept        complement(23425..23775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0026"
FT                   /product="putative organic hydroperoxide resistance protein
FT                   (partial)"
FT                   /function="5.5.1 : Osmotic pressure"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type f : factor"
FT                   /db_xref="GOA:Q0RUN0"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58709.1"
FT                   /translation="MDLQLSIPKGVGGDDGPGTNPEQLFATGYAACFHSALKAVARGKK
FT                   ADVTDSAVSVTIDLIRDDDGAIGLGARIEAQIPGLERATAQELLEAAHAMCPYSRATKG
FT                   NIPAEVVLVDND"
FT   gene            24009..24647
FT                   /locus_tag="FRAAL0027"
FT   CDS_pept        24009..24647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0027"
FT                   /product="putative transcriptional regulator (HTH-type)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58710.1"
FT                   /translation="MVQQETGQLDRPRRGRPRDATIDTRVLSAAVDELAEHGVGGFSVN
FT                   RVAARAGVAKRGIYVRWPARDDLVLHALGTLAAGLVPPRTGSLRSDLMHLAPLVDAVFT
FT                   EPRLSILARCMAELRRFPAMYAAFRRESVDRCAAAIEDALHDAVTRGEARADLDTDLAA
FT                   GAFLGALLARHAFGGARQPLDDPAFHGRLVDFCVAAVQRVTAAPASPST"
FT   gene            complement(25728..26111)
FT                   /locus_tag="FRAAL0028"
FT   CDS_pept        complement(25728..26111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0028"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58711.1"
FT                   /translation="MPTRELAMPTGELGTTAARPSRGSPGALGHQPAAPCARPASRDRA
FT                   RARGPRRAHSGWSWMGLGPTRRCAARCPRTIRGHPAPAAPVDTVADLAVTAGSDARCGA
FT                   NPSTVPMDEVWISRLAGVGHRRG"
FT   gene            complement(27039..27218)
FT                   /locus_tag="FRAAL0029"
FT   CDS_pept        complement(27039..27218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0029"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58712.1"
FT                   /translation="MAVAAAPFQLTVPTDELWMSGPAGFGLQPGQPFAEVTMTGREDGR
FT                   CRAPTAVDGYPPDR"
FT   gene            complement(27501..28742)
FT                   /locus_tag="FRAAL0030"
FT   CDS_pept        complement(27501..28742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0030"
FT                   /product="Putative exported lipase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUM6"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58713.1"
FT                   /translation="MLGLIPLAGCGRRGDVTGEQSVATRDSEQSVATRDSEQGVATRDD
FT                   ARASGRPTRPQRAAGELLSREVVTPVPAGIRAWRVTYSSRPTGTGAAAVSGIILAPGTD
FT                   VPVPAGGRKVVSFGHGTTGIRDSCAPSRARPPLAAAAWTFPLVQAGYVVALTDYAGLGV
FT                   PGEHAIYIAGPEGRAVLDAARAARSLPETGAGRDVVLWGYSQGGQAVLAAGALAAGYAP
FT                   ELRIRGVVATAPLADLPASLTTLQRGPDGVGYLLLAMIGLVVDDPRIDLDRYLTPTGRR
FT                   LLAVARTRCAGEVTRASVGSSIHTAFTTDPLTHPPFAAGFARQRDDILRRMAPTLILQG
FT                   DRDAIIRRPVTDTVVSRLCGKGTTVDYRRYPQADHGSILGASMNDLVAWVAQRFAAHPP
FT                   AVADICPLGAPARR"
FT   gene            29328..30245
FT                   /locus_tag="FRAAL0031"
FT   CDS_pept        29328..30245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0031"
FT                   /product="conserved hypothetical protein; putative integral
FT                   membrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RUM5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58714.1"
FT                   /translation="MTTFASNTFASSTLALGPSAISADSLIKAGLAVVLLIVFAESGLL
FT                   IGFFLPGDSLLFTMGMLIARDEVSTPLPVAMILIGLAAVAGDQAGYLIGRKAGPALFRR
FT                   PDSRLFKQEYVEQAEAFFAKNGPRSIVLARFVPIVRTFTPVIAGASRMNYRIFTIYNII
FT                   GGLLWGCGVTLLGFYLGKIDFIRNNIEAMLVLVVLVSVVPIIIEYLRSRRKRARGIAGS
FT                   AGSAAAGSAAAGPTAGAPTPAGDPTASQARYGGLPADGGDEDGWRQGEEQGTDPSVTMR
FT                   LRRGGGGGGGGRHSAAHRRETARD"
FT   gene            complement(30590..30928)
FT                   /gene="glnB"
FT                   /locus_tag="FRAAL0032"
FT   CDS_pept        complement(30590..30928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="FRAAL0032"
FT                   /product="regulatory protein (P-II) for nitrogen
FT                   assimilation by glutamine synthetase (ATase)"
FT                   /function="1.5.1.2 : Glutamine"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.3.3 : Inhibition / activation of enzymes"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="GOA:Q0RUM4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58715.1"
FT                   /translation="MKLVTAILRPHRVDDVRAALGTYGIHGMTLSQVTGFGTELWRTET
FT                   YRGRTFHDESVSAVRIECVVADSDAEDVVSVILRSAGSTASGAGKIWVLPVETLARVRT
FT                   GERGLDAL"
FT   gene            31165..31638
FT                   /locus_tag="FRAAL0033"
FT   CDS_pept        31165..31638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0033"
FT                   /product="Raf kinase inhibitor homologous protein."
FT                   /function="3 : Regulation"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11439028; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUM3"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58716.1"
FT                   /translation="MTSTDLVDGGVLPLDHVYTDAGGANLSPQLSWSGHPAGTESFVVT
FT                   AYDPDAPTGSGFWHWVLVDIPGSVTQLPRGAGGGAFTGLPGGAYHVRTDWGTKEYGGAA
FT                   PPQGDVPHRYVFTVHAVDVPKLGINDEVSPAVVGFNLAFHTLARAVLRVTYQH"
FT   gene            31902..32882
FT                   /locus_tag="FRAAL0034"
FT   CDS_pept        31902..32882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0034"
FT                   /product="conserved hypothetical alanine-rich protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58717.1"
FT                   /translation="MGDGRQTDVSGVGAAGAYDARRIWEVGEPIHAVIYFHPAVRRFGE
FT                   EAGSHGFWMGYIGMRAAPLGAASAATITSAFYNFAPRRIARSVPDVWAYSSPARLLDAR
FT                   LAAMDAVLRELWGLDTTGVAVRRAAALAGRAAAAAVTAGRPLAAANAALPLPAEPHLAL
FT                   WQALTTLREHRGDGHIAALVHAEVGPCEALVLAAATGRSPGEQLRISRGWNEREWADAV
FT                   HNLAARGWLTADGALTERGAQARAGIEDATDQLASTPYLALSADELGDLYATLYGLAER
FT                   AALGGGFTWPNPIGLDWPPSSERAMADLGQPADLRQPVELGSTEG"
FT   gene            complement(32849..34873)
FT                   /locus_tag="FRAAL0035"
FT   CDS_pept        complement(32849..34873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0035"
FT                   /product="Putative ATP-binding protein (partial match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RUM1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58718.1"
FT                   /translation="MPIPVGYPTGDLASAVAGPKGATPEATYETNGYGGVGDEVGHDGQ
FT                   PGYDGQPGYDSRPGYDDQTGYDGQPAYDEAGFEDAGFDDLDPPSYDEAGYDPDGYQAAA
FT                   YEAAGHDPGRDAEGFVDLGGGPRRRRATPPPPPSPRRGRRAERAAAAAEKAAMRRAQAA
FT                   LRRGAQPSKLLGPFAGRAFHRMRLPAHMETTAQIAGIYPFVVDSGLAAPGMYIGRHVWS
FT                   GNSFDFDVFELYRQQVIENPNFAVFGAVGSRKSALLKTLISRGAAFGYQAAVPCDPKGE
FT                   YTRLARRLGCEPTYIGPGMATRLNPLDAPPRPRGIADADWAREVKRARSSLLSSLIETA
FT                   KGVPLTPAEHTAVDLALDVVTRQISGTSPERWATPLLPHVLEAMTDPAEEDCVNLPMTA
FT                   TELRDASRDATLTLRRLTHGALGGLFDGPTTSPLDFDRPIAVLNLERVQGSDEMIALIM
FT                   TCAQAWMEAALMRQDGVQRYVVYDECWRLMRFAGLVRRLSAQQKLARQWGCANAIVAHR
FT                   ISDLLSASPDSVEIAKGLLAETAIRILYKQASDQIADTQEALGLTDVAADLLPRLDPGF
FT                   ALWLIGARAFYVEHVVGDLEIPVVLNGSKMHGEVDDTNLTPDDLDPAELDPPDLGPGRL
FT                   RRVGAEGVADDAGFDGDAFGEEPFTGGYGYPSVEPSSTG"
FT   gene            complement(34957..36459)
FT                   /locus_tag="FRAAL0036"
FT   CDS_pept        complement(34957..36459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0036"
FT                   /product="putative integral membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58719.1"
FT                   /translation="MVAERSYRFGPLERGGVMLGMRWPQLALMIGVMLCVLGALRSPLV
FT                   TIPIWVLLAVALLFVAFVRVEDRNLDQWVPILFGFTMQKVTGETVFRGAFFRLGAGEDQ
FT                   LSRTVLPGPLSSLVMLSVPVGGGRYVAVVKDAKKQTYTAVLQVQGSQFALLESGDQQAR
FT                   VDAWGELLAGLTAGGGKLSRIQWLERTLPDSGDQLQRHWRVRGHHDDSWAADAYQQVID
FT                   AAGPVAQRHETYLSFQLRAKDARRAIQRAGGGDQAACAVLLGELRTMEAALARASINTV
FT                   GWLPPRALAAVIRTTYDPYSIEMIDARGGASTDLAGGLKGLASGIDPAVAGPVRTVTAW
FT                   DHYRTDSGFHTTYWINGWPRVPSPAAFLAPLLMETTCRRTVSLVVEPLPGRKAEKAVNR
FT                   RRMAHLGEQQMRDKVGKVTTQRDVAEADEVERREQELIAGFGAFRFHGFVTVSADDLDG
FT                   LADACGEAETLASRSRLEMVRLVGEQDQGFSVGALPLAVGVA"
FT   gene            complement(36536..37918)
FT                   /locus_tag="FRAAL0037"
FT   CDS_pept        complement(36536..37918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0037"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58720.1"
FT                   /translation="MTAGNEVLAASFSSLNPLNGIKHAISGSVDAYFDSMGTAFCGMAA
FT                   DLSSSVFSFAAQKTTIDLKADYVVENYNIAFGVAVLIVTGLFLCACIMGAVRGDPHIFV
FT                   RALAATGTSILGSFIALALLQMILTASDGIADAFGNGKPLGSDLVAQVRALPEQGNFAL
FT                   DLVLSLLVAMFSFALFVVLYIRKVAIIVMAVFIPLYLAGQPTMSTSAWLKRATELLLAL
FT                   IFAKPVIYAIFTLGAGMASDSTGSTVDQTLTILGGTVVMIAAVFAPFVLMHLMGFADVH
FT                   LMRAVGSAGRRSAASFGQGAGALLGSTSRETFRGIGARLQTRNRGVLGDTGGIGVEPGL
FT                   ARPAALRTGRGGIGAPVGGSSRAGAATASVRGSGGRPRTGGSGAGAAVRQPARTGGPSR
FT                   TAVPVGAGAGANGATRTATRVAPARNGASPRTSQARPPVAPAARPAAVVAPKLPPSRTG
FT                   GQ"
FT   gene            complement(37915..38712)
FT                   /locus_tag="FRAAL0038"
FT   CDS_pept        complement(37915..38712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0038"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58721.1"
FT                   /translation="MPGLMESVARRLIIIIVATGTVSVIGGLVIGRYVIPDKGASPDTA
FT                   SVAPAPSTTPTPSPAAIAPTPTLVPKPDSAEGKPADSASTSQIPGLPTRINEFGIPIGY
FT                   PRTEAGAVSACANYDAITGTLRNREPSRIRMMYDSIALPESSKRISDTIIKNDKDSAKA
FT                   YGVPSIQSPDFSLIGRGIGYAVRSYNDNEANVTIWGTVAFGIYGNSDPNLAPRQGWGTD
FT                   FCQIVWHEGDWKLKDAGDGPAEPDITQRAAESFKEFLLVGAGT"
FT   gene            complement(38782..39195)
FT                   /locus_tag="FRAAL0039"
FT   CDS_pept        complement(38782..39195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0039"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58722.1"
FT                   /translation="MILDAAAKATVILADVKVNPDDTKAPGINALKDLVNGLAAYAVIA
FT                   AVAAVLLGGIAWALGERMGLERASTVGKSGVIAGFGLAFLVGAAAAFINFFLATGATAT
FT                   APAPNPGGHRPPAVVVTVAVDPGVVHDPSSTLF"
FT   gene            complement(39209..41962)
FT                   /locus_tag="FRAAL0040"
FT   CDS_pept        complement(39209..41962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0040"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58723.1"
FT                   /translation="MSDVPQAPYGEEGDARPVSLIGARIPTSASRSNRLPDRDDQYGRD
FT                   ESSTAEDAESPPYARSGRRRHRRRGGPDSPQPPDEAWQSEAFHLDDATSATEPGADRAG
FT                   AADATSPAEPPGAGRGSQPAPGAEPAEELRRARGSLTRRAGRPAAIAPRNQADPSRRPA
FT                   PPAGADGAAPESSRDLAAPSPADGPDHAVGTGTGTRTAGSGPGAGHGSAAAPTDALAAG
FT                   PGPTAIPPHTTGSPPLPDAPVGATPPRSRPPRASAPPRAATRPVSVGRLPGAPDAAPPE
FT                   QGDRAVTAVPTPATGPIVVTDSISVGDSIPGTDSVAVTDSIAVTGPIEVAAPTAVPGSG
FT                   PAAAAPPVPVTRPAPTERTIAATGPVARSAPPTPSRLPAAPGPIPSRTPTPAPSRTSPP
FT                   SRSASSTPSRTPTAPRQASPPIPPRARAAEGGPAAPATPTSHPGSSKPAPSTGSARTPA
FT                   LAPTPAAEPAPAPRTGRPPRPSREAAVPVADGPGSARRPEPDGPLRPWQESRRGADGLQ
FT                   PREEIPVRLSVRDRARIPLPGSWRVTVTSLFPYSGTTTLTGVIGLTLTGVRAHPVLAVD
FT                   LWPGESTAGGTAAASDGDEDEPRGDPLTSRVGSAGTTTITDVVRHQAADGSAAQLRLMV
FT                   SGRRPGGARDLDVLPVRPDAGQITAGSPATAGSPAADDGPLRQDAPAVPSDAQPVSPTG
FT                   LRSALGLLAHSYPLVLVDAPTGAPLTEAAVEAADLVVLTTLATAADLEATLMRLRAFRE
FT                   GPGRRAARDGGPPIVAAIVAPRRGRPSPRTRAAAARLGRQVDSLVRIPYDARLDPSRHT
FT                   PVRIPRLRRRTRRAYMRLAAATVESLFALAKAEVAAPAAAGERLARTSPEAIGPVTARA
FT                   EADATSGTTSTTADHPTPPGVSFGDLRSPTAPSRIAGPDRPGGPRP"
FT   gene            41941..42009
FT                   /locus_tag="FRAAL0041"
FT   CDS_pept        41941..42009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0041"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58724.1"
FT                   /translation="MPVAHRSRAVALPALYRLASAS"
FT   gene            complement(42149..42601)
FT                   /locus_tag="FRAAL0042"
FT   CDS_pept        complement(42149..42601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0042"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58725.1"
FT                   /translation="MAAPTAPSLAAPPVLPPDTDGLVSGGDSGGGASGATGGVAAEDAP
FT                   AGVPGAVADGMPAGPPELARGRLDPVGAKRRAGDPAGAVRPDRGAPCGAPERPGRAEGR
FT                   GVAIGKPSCATDAPFALPHDSRRVNLAAPAGPRRGSSAEPATGSPR"
FT   gene            42546..42821
FT                   /locus_tag="FRAAL0043"
FT   CDS_pept        42546..42821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0043"
FT                   /product="hypothetical protein; putative signal peptide;
FT                   DNA binding and excisionase domains"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUL3"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58726.1"
FT                   /translation="MSGGSTGGAARLGAVGAATSGGGTAPAAGGPAVRPADDDDVLTVD
FT                   ELVAWLRLSESTVLKLLSERAIPARKVGHQWRVRRGRVRDWLDGRE"
FT   gene            42932..43630
FT                   /locus_tag="FRAAL0044"
FT   CDS_pept        42932..43630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0044"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58727.1"
FT                   /translation="MPVSQVSSAPPRRARLFPPALPALPVSLALLVVPVLLVVLAGCGA
FT                   LDRVADPTPSPAVTTGPPAGASQAPGPPLATATAPATGEVDRTNPAAVAADCFTRWQSF
FT                   DARTDAGPSAGVERARDCLTEDFAASLGAGSAGAADGGADGRAWEDLRAHGAHSQVSVL
FT                   ATTPLGGIDTTATGRVVLQLNVRRESTTGNEAPVATVSTPALTLLRQADGTWRVAGADL
FT                   ASVAGDAPGR"
FT   gene            43637..44632
FT                   /locus_tag="FRAAL0045"
FT   CDS_pept        43637..44632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0045"
FT                   /product="putative secreted transglycosylase"
FT                   /function="1.7.9 : Misc. glucose metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUL1"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58728.1"
FT                   /translation="MARRFPPSRSGWLVWLGTGSAIVIGGIILLISVLIMTLAGPFVGD
FT                   HGRGNKSIENADGIPAEYVQLITDAANAAGCEEVTPALLAAQLHQESGFNPQARSPVGA
FT                   MGIAQFMPATWASHGQGDVWNPADAIPAAARYDCAVAASVASVPGDGQEKMLAAYNAGA
FT                   GAVLAFAGIPPYTETRNYVRTILAQTQVYGDSLEFGVEIPAGTIAPVVAFMESQIGKPY
FT                   VWGAVGPDSWDCSSLVQAAYRNIGIELPRVTTDQLRFGPVVAGVDPQPGDLLFTPGTDG
FT                   TADAPGHVGMYIGDGRVIAAKGARWGVVESDISDWTGTVAVTRPLAKDLR"
FT   gene            complement(44682..44807)
FT                   /locus_tag="FRAAL0046"
FT   CDS_pept        complement(44682..44807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0046"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58729.1"
FT                   /translation="MFILFFAVTAPSDAADVVHNTVGVLGGVANGLSDFVSEATA"
FT   gene            complement(44837..45181)
FT                   /locus_tag="FRAAL0047"
FT   CDS_pept        complement(44837..45181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0047"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58730.1"
FT                   /translation="MPGVDVSRPGVACIIRAHPIHVAKWLQMVISLSVQCPAEGYAVSA
FT                   AVSAGASEDGRGCASPGPGGEVAARRGAARPSAIPLATATQGEYTHAVGDLSTLVSVRP
FT                   YRLAVLRGPA"
FT   gene            complement(45218..46777)
FT                   /locus_tag="FRAAL0048"
FT   CDS_pept        complement(45218..46777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0048"
FT                   /product="hypothetical protein; putative lipoprotein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUK8"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58731.1"
FT                   /translation="MLRAAGGGGLALAGAEFGSTLLAGCRGDTSPAPSAVDWQALDARL
FT                   TGPLLRPTDPRYATASVLFDPAFDTIRPQAVAQVTSAADVQACVEFARRTGLPLTARAG
FT                   GHSYGGYSTTTGLVVDVTPMAAVAAAPGQVARIGAGALLVDVYSGLARAGLALPAGSCP
FT                   TVGIAGLALGGGIGVLGRRYGLTCDRMVSAEVVLASGEVVHTDADHEPDLFWALRGAGG
FT                   GNVGIVTSFTFATHRATPLVLFTYRWAWDGAADVVSAWQEWISAPGGAPESLWSTCVAY
FT                   SAPSAGVGGTPTLRVSGVLSGGAGDDAVAGLRARLADLVAAAGHRPTGTYVTTRGHLEA
FT                   MLIEGGCAGRAVEACHLRGRSPGGTLPRVAQRAASAFLLEPMPSRGVEVMLGAVEQRQR
FT                   TAGAGSGGVILDSWGGAINRVAPGDTAFVHRGAIASAQYVAGYAPNATPAAKEANRRWL
FT                   RSTVEATAPFVSRSAYQNYIDPELAGWAQAYYGANLDRLRQVKRAYDPDDLFRFAQGIT
FT                   PA"
FT   gene            complement(46896..47081)
FT                   /locus_tag="FRAAL0049"
FT   CDS_pept        complement(46896..47081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0049"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58732.1"
FT                   /translation="MTTRTAPGRPLVSRRAAAAVRSEFPGLGARLGVRTWAWADRRQPT
FT                   RAATAPSRSGLAYLRR"
FT   gene            complement(47078..49375)
FT                   /locus_tag="FRAAL0050"
FT   CDS_pept        complement(47078..49375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0050"
FT                   /product="putative Protein serine/threonine kinase"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUK6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58733.1"
FT                   /translation="MTEQVDTGRVAAALPGYELGGELGRGGFGAVLAGRHRLIDRIVAV
FT                   KVLLDPGGTSGASGAAGASGADDLRARFLAEARVLAGLDHPHVVRIYDYVECDGLCLLV
FT                   MEQLTGGSLRRRSRLSTGPAQVGAIGVAAAVALAAAHGRGVLHRDVKPDNLLFTGDGVP
FT                   KVTDFGIAKIVEATAATTTGLVGTPRYMAPEQITGGRLGPGTDLYSLAVVLYELFARRS
FT                   PFPPDLPVAALLHHHLSVAPLPLTEAPGPVADVIASAMAKEPSWRPASALDFAVRLAAA
FT                   MTATLGPGWLAASGIPVRLPDDVLSAAGHHPTTPRPAATPRPATPRPAAAPLSGTAPLS
FT                   GSPPHPHGDAAADLYRTGAPARGGQGRRRARGAGRRRLVVISVAAVGALAVAAGLLVGL
FT                   GAFGGGDGDRRPAYAGAPVTLAGLSDAGGLTLGADGSLYLTDPGVGTGQGQVVRLTSAG
FT                   RADRIGGSGPRPTPTGDAPSPSPSPSPVIGDGGPSLAADLQDPAGVAVGRDGAVYLAER
FT                   DAGRIRRIGRDRVITTVAGAGPDYADGFTADVGDATKAHLDDPSAVAVDDDGVLYVAEG
FT                   YRVRRVEKGRITTVAGKATEYGSAGDGGPAVNATLYQPSGLALGDDGSLYVADRGEDTV
FT                   RRIDRSGRITLVAGRPGTYGNRGDGRAATAALLDDPTGLALGPDGSLYIADAGNDVIRR
FT                   VDGHGIITTVAGTASYSAGDHDGALATQTRLSDPAGVAVDPTGTVYLACSDGTVRRVGR
FT                   DGFMTTALRPPA"
FT   gene            complement(49525..52224)
FT                   /locus_tag="FRAAL0051"
FT   CDS_pept        complement(49525..52224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0051"
FT                   /product="putative serine/threonine-protein kinase (partial
FT                   match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUK5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58734.1"
FT                   /translation="MLIDRSLVEAALPGYTVEGDLGRGGYGLVLAGQHRLIGRKVAIKI
FT                   LLDTSDDADLRARFLAEARVLAELDHPHIVRIHDYVEHEGTCLLVMELLSGGTLKQRIS
FT                   AGPVSPETTCSIGLAAAAALANAHTQGVLHRDVKPDNIMFAGDGLLKVTDFGIAKIFDG
FT                   AETTASAILGTPRYMAPEQIMGVRLFPSTDLYALSGVLYEMIAGRPLFGRQMAVQPLTH
FT                   HHLTIMPEPLTTVPPPISTVIMRALAKDPNARFADATDFALELARAGSRAFGPNWLSRS
FT                   EIKVRVDDEIREAALGVSTTPRPPLSGAPGYPGGPARGSGPARPGYPAGPGAFGHPGSA
FT                   GGPGRAGGPSGPGGPGGPGGPSGSGARPGPGVPGPGLAGSGAGPSGAGPFGAGAGGPGM
FT                   GGPGMGGYQRPGGHQRPPGAPAGFGGQPGSGGGPGGLGDPGGPGFTGAPTVRGNQGPGP
FT                   GGWGGYPPGNTPAPYTPPPRPLGGGYGGMPGAGGPGGAQFGPRPGGMPLDPTRQAGHHQ
FT                   TAGTRIRASWIIGGIVFAFVVAATVGIVLAVATSGGGGDDPVDSAAPRVASAYRGQALS
FT                   VQGLSPYSLALEPDGSLLVSSLATDRIQKITPTGAADDFAGTGAGGIAGDGGPATAAQL
FT                   DGPGSTARDKAGNIYIGDAKNNRIRKVTPAGVISTVAGTGTAGYSGDGGPATAAQLNSA
FT                   EKVTTGPDGSVYFSDYDNHRIRKIDPAGIITTYVGTGVAGYTGAGGAATQARIDGPNDI
FT                   TMTDDGTLYFVDLTSETIQKVTPDGIISTIAGTGEAGYTGDGGPARSAKLNKPSLAIGP
FT                   DGETFYIADYNNNRVRKIDPNGIITTIAGTGTEGSGGDGGPATAAQFKNPSSVVVDGSG
FT                   AVYVADNGNDRVRRIDPAGTIATIAQPG"
FT   gene            complement(52228..52710)
FT                   /locus_tag="FRAAL0052"
FT   CDS_pept        complement(52228..52710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0052"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RAN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL29812.1"
FT                   /translation="MNASPRVGSASNRSRRDTSDNSRRCALSAVHSSVAVMSGGAARAA
FT                   GSVVDMTWDALPRRFNTLPPQPPSVSVARHPDSCPSSRHLSHHPDRGGADTRRPQQHAH
FT                   VADPTSQGAPGRAAEWEGRGRRIARNPTKASLQARMPRSGRGRRCGGLPDGVNGRI"
FT   gene            52526..54223
FT                   /gene="pgi"
FT                   /locus_tag="FRAAL6884"
FT   CDS_pept        52526..54223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="FRAAL6884"
FT                   /product="glucosephosphate isomerase"
FT                   /function="1.3.1 : Glycolysis"
FT                   /function="1.7.8 : Gluconeogenesis"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="5.3.1.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2549364; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUK4"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58735.1"
FT                   /translation="MLNLRGRASHVMSTTEPAALAAPPDITATEEWTALRAHLRELSEV
FT                   SLRDLFDADPTRGEAFTAETDGLYLDYSKNRLTARTVELLVALARRAGLAERIEAMFRG
FT                   ERINVTENRPVLHVALRAPAGTRIEVDGVDVVPEVHRVLDRMSAFADTVRSGTWRGATG
FT                   ERITTVVNIGIGGSDLGPAMAYEALRDYSDRGIAVRFVSNVDPTDVWEATVDLDPARTL
FT                   FIVASKTFTTLETLANARAARSWLTAALGEDAVSRHFVAVSTNAEKVAEFGIDTENMFE
FT                   FWDWVGGRYSVGSAIGLSVMIAIGPAAFREFLAGFAALDTHFRTAPFERNLPVLLGLIG
FT                   VWYRDFHGFAAHAVLPYSQYLDRFPAYLQQLDMESNGKSVDLAGRPVGTQTGPVVWGTP
FT                   GTNGQHAYYQLLHQGTTIVPADFLGFVQPNHPGVGPADGPDQHALLLANFLAQTEALAF
FT                   GKTAEEVAAEGVAPELVAHRTFPGDRPTNTLLAPKLTPFVLGQLIALYEHKVFTQGTVW
FT                   GINSFDQWGVELGKVLAGRIVPELTGPNSPAPRHDSSTNALIRRLRGA"
FT   gene            54328..54669
FT                   /locus_tag="FRAAL0053"
FT   CDS_pept        54328..54669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0053"
FT                   /product="putative Anti-sigma-B factor antagonist
FT                   (Anti-anti-sigma-B factor)"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type f : factor"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58736.1"
FT                   /translation="MRVDAGALTMSVRRSGEDVVIELAGELDTAGRLRFREQIGELLGR
FT                   GGGTVTVDVAGLRSIDIPGLAALLRADLLLRRVHCELRISSPTPAFAALVHETGLDGRL
FT                   RVGEAARRH"
FT   gene            complement(54710..55165)
FT                   /locus_tag="FRAAL0054"
FT   CDS_pept        complement(54710..55165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0054"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58737.1"
FT                   /translation="MSLTPPVLLMVLGFPLLVMAGMLMMGGIEKKLIGSRSMLSRVAEE
FT                   AATVVGSATAGGTDGPAGAGLPAHSALVGHFRTDDVPTAPLRFTLRTVMADDGARAPRI
FT                   TATSALAPALDSSMAAAVASSAAVSAAHTHPLDRPQPAPASPPSLAG"
FT   gene            55222..55422
FT                   /locus_tag="FRAAL0055"
FT   CDS_pept        55222..55422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0055"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58738.1"
FT                   /translation="MPSHRPRLLTSGRPSHPTRVSPGVGWKVTDLSTPGTVPADGSLVR
FT                   FEQHVCAARTVARLQRPSLGR"
FT   gene            55367..55690
FT                   /locus_tag="FRAAL0056"
FT   CDS_pept        55367..55690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0056"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58739.1"
FT                   /translation="MSVRPVPLPAYSGRPWVGDADLLARLHLLTEQVDYALAEIVLRRA
FT                   AYRRACEEEADWQWSPSGVEALSRPAVAEALARQLAAVERLRLWAQELHWLQEQARLRG
FT                   LLR"
FT   gene            complement(55728..58931)
FT                   /locus_tag="FRAAL0057"
FT   CDS_pept        complement(55728..58931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0057"
FT                   /product="putative adenylate cyclase"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="4.6.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUJ9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58740.1"
FT                   /translation="MPCPTCAEDNPERARFCSGCGNPLPTAGSGARKTVTIMFVDIARS
FT                   TDIGEKIDSEPLQQVMWRFFTTVREVIYNHGGSVEKFIGDAVFAVFGIPVLHEDDALRA
FT                   VRSALDIRAAMEALNADLQEKWGLRLRVRIGINTGEVTVAGGGVTGDAVNVAARLESAA
FT                   PPDEILIGDTTHRFIRHSVTVTPLGPLVVQGKRDPLRVHRLTGLVDPTAGPGSRAQIHG
FT                   FTAPVIGRNRERRRLQDAFEAVVEERACHLFTVLGSAGIGKSRMVGEFCTSMATRATVL
FT                   TGRCLSYGEGIAYWPLMEMVRQATGLTADESAPDGRRRLRELLDGVGQAAEIVEALAPL
FT                   VGLGGAELGPQESFWAVRSFFQALAARRPLILWFDDVHWAEPTLLDLIENIADWSRDAP
FT                   IMLLCLARQELLEDRRDWGGGKFNATSMLLAPLTEARCQRLIRSLMGSDDLDPALVTRI
FT                   TTSAAGNPLFVEQMVAALVDDGLLRREGSRWIATGSLRNVTVPPTISSLLAARLDRLDP
FT                   PERRVLERAAVVGERFYLDAVIDLSDPAERSMVNVHCLNLVRKELVHPDRSDLPGVEAF
FT                   RFLHVLLRDCAYESTAKRRRADLHQQFAHWLQARLVGGPGEHDELVGYHLEQAFRYRVE
FT                   IGQRDAETIELGRSAATCLIEAADRVRQGDETGAAQLLKRAITLLPETDPLRLRAEIDL
FT                   GWALYSFGRFSDAERILRQVTERARRAGEDGLRAHARLAHLRVLFSTDPEGLVATTLTE
FT                   AAASLANFVRSGDDVGAALACRSQANAYLAAGQFAAAERAMENAVRHAEESGVPRAAQS
FT                   LRRELTLLTSWGPRPVASSLARAGEALDAAGDDRALRRALLAQLAVLTAMSGDLEGARI
FT                   HLKAAEEIVHDLRAPRADPLHGGFVVARVALLADELTVAERELRRSCRALSRMGERALL
FT                   ANRAAALADVLVRLGKVDDAGKYVTRCRDAAAADQLPAQAGWCGVHARLLSLRGRDAEA
FT                   LRFADTAVDLAGRTDDVDGQGHALLSRAEVLYRAGRKDDAAESMEAGIARYLHRGNVAA
FT                   ANLGRRLFETLDRPSSLSG"
FT   gene            complement(59114..59794)
FT                   /locus_tag="FRAAL0058"
FT   CDS_pept        complement(59114..59794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0058"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUJ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58741.1"
FT                   /translation="MRTELFKVASSRWQPVALTAMVILHVPPMLWAGQNAQAAWNGLRS
FT                   RSGLFTAYTVMAFGVLIVAQEYRHRTAALAFLAVPGRRRITIAQYLTVAAVGLVLSAAL
FT                   FAGWLVVGAVRHGGPGMHLDRPADVAAAYGVVAVTVCAAGAVGVGVGTLLRGSTGALLA
FT                   LGGCGAFEPLLDATRFRGPVTAPLGVLAWPTSELETAALVSAVGWGILALAAGLFAVGR
FT                   DLSS"
FT   gene            complement(59829..60704)
FT                   /locus_tag="FRAAL0059"
FT   CDS_pept        complement(59829..60704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0059"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RUJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58742.1"
FT                   /translation="MRTISFAVREGDVTGFLGPNGSGKTTTLRALLGLVAPTSGAALVF
FT                   GRAYRDLDHPARRVGAVLDNASHPGRSARDHLRALAMPLRVGRRRVDEVLATVGLDAAA
FT                   DRPTGGFSLGMRGRLALAAALLGDPALLILDEPTGGLDPQGVRWLRGFLRSWAAQGRTA
FT                   LLSSHVLAEVSQTVDHIVIISRGRVVLDAPVDRLGGGHVEVRTPEAARLAGLLAEQGLV
FT                   PSGVERDELRLPAGTAEQVGRIAARHGIALVELHTHGQDLEEIYFALTHPGDAAGSAGP
FT                   GPAVSPQGAR"
FT   gene            complement(60826..61296)
FT                   /locus_tag="FRAAL0060"
FT   CDS_pept        complement(60826..61296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0060"
FT                   /product="putative transcription regulator protein"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUJ6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58743.1"
FT                   /translation="MPPPDTGDEVVNLLLAAGHQVRHAVDEALRASVGLTLRRFKVLQL
FT                   LADTGPCRLRDLADAVAVAPRTMTETVDGLESDGLVARRSHPTDRRAVLLALTPAGREA
FT                   LAVGRRRRAETVAGFTRHLTAAQRNQLVELLASIPRHVPAPPGSTRSGAAQR"
FT   gene            61387..62049
FT                   /locus_tag="FRAAL0061"
FT   CDS_pept        61387..62049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0061"
FT                   /product="putative NADH oxidase/flavin reductase (partial
FT                   match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUJ5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58744.1"
FT                   /translation="MDALACLMTRRTATRLVEPGPTTEQLAVLLSAATTAPDHKMLRPW
FT                   RFVVVRGDARSTLAGAIAAAAQAVGTLPEPVVRKAAGKATRSPALIAVVAARVESKVPV
FT                   AEQDASAAAAAQNICLAAHALGLASAWKSVPLPDSAQVRAAFGLAEGEELVGWVELGTQ
FT                   AEAVPLPPRPAVPLDQVAAELAVDGALRPVVAAVPDQAAATAGAARPIGSASPGPVG"
FT   gene            62050..63537
FT                   /locus_tag="FRAAL0062"
FT   CDS_pept        62050..63537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0062"
FT                   /product="Drug resistance transporter, EmrB/QacA family"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RUJ4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58745.1"
FT                   /translation="MAAIRVPRPADQRTVVAVVFVATMFLAIMDATIVNVALPSIATDL
FT                   GTGTDSIDTVVTSYLVSLAVVIPASGWLADRFGARRVFLAALTVFTVASALCATAGDVG
FT                   QLVGWRILQGVGGGLLTPVGTTMLYRVYPPQQRARAARVMMIPTAVAPALGPVLGGLLT
FT                   DGLSWHWVFLVNVPLGLATLLYGLVFLADVPATAARGFDLVGFLLAAGGLAGILYAVST
FT                   GPSHGWGSPAVLLTGAAGLVATAAMIYWETRVPHPVLALEIMKNRIFRMSNLVMTFGVM
FT                   AFMALLYLVPLLAQAIEGASSTRAGLLVFPEAVGVMIGSQVAGSLYPRIGPRRLLAGGL
FT                   AAAAVTIGLFAAVTISASPWTLRTLMFLAGFAMSFVFLSTQTAAFATITPMRTGDASAL
FT                   FNAQRQLASAFGVALVATVLALPDAGSAAAGAFARRWVFLVPATLALVGAVLALFIRDA
FT                   DASATMRSVAQRVPTSPGTGPDGPVPAKLPRREREAT"
FT   gene            complement(63530..63925)
FT                   /locus_tag="FRAAL0063"
FT   CDS_pept        complement(63530..63925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0063"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58746.1"
FT                   /translation="MTPSGAALAVSVAPPAAAGVAVDAADVPRSGGKGLAVTEVSDRAA
FT                   TPSPVEPEDSEQPTTTASSRPPITARPSRPELERGGGRRPYPGRGRADPCRPGACAPLT
FT                   ANLPSQVGSRVIPGFGPGRPRPPVQLR"
FT   gene            64122..64469
FT                   /locus_tag="FRAAL0065"
FT   CDS_pept        64122..64469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RAN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL29813.1"
FT                   /translation="MVPTPQPSAVFLGEACAPGRNKAPATAVNGLVLYCVPDDGAGSSA
FT                   GGAGTSAGGAGSSAGGRWSTEPPTSSVQPPPEEGGSCQQADVGRVLRDSAGRPVSCLRD
FT                   PNGLLSWSDVS"
FT   gene            complement(64597..68505)
FT                   /locus_tag="FRAAL0064"
FT   CDS_pept        complement(64597..68505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0064"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RUJ2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR019894"
FT                   /db_xref="InterPro:IPR024282"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58747.1"
FT                   /translation="MSGTSTLATMRDEATQEVRLAVVMTGGASLAVWMGGVATEINLAT
FT                   SPGRSRADDADAAVAARYARLAAILDVELSVDVLAGASAGGINATMLGFANARDGDLSP
FT                   LRELWLSLGSLDTLMRTPNEKAYPSLLRGDAAVLPALHTALAAVAGTAAPQQSAAARPT
FT                   SVFVTTTILRGEVAEHTDSLGGTMYDVDYRGLFVFGTPDLTDPAAIPRLALSARASSAF
FT                   PGAFEPAYVPVGHAVDDAHPDMARFVNAARSFHASDGGILVNRPIGPALAAVFDRPAER
FT                   QVRRVLTYVVPSPRPTSSTPDAHPGGRHAPGTGQLTAVHQTAGAHQHPGTHQLPGTHQP
FT                   PGTHETRRPGLFRGTRPARGTRPARGTRPARGARLFRGTRHELERASDAPPAPPLPSVS
FT                   GTLLGALGAALNQSIGTDLAALREHNEAVRGARAGRRRLLRLAPAGSARLADDSVYDAY
FT                   RRAVAEQIAVPVIEALLRVLTDRSDLPRPPDADALRTDAAGRAQMTNAAVGAVLTTLPG
FT                   RLPGVGDLDELWRLGQPALDGVRGILVSMINEGYVLCPEPVERARLAQLAAAVHDAALA
FT                   ASGGSPPSPTGPGRGEGGAAASRIADARGPASLYTSSPRPGVFTTVSETLAAMPGAPLL
FT                   DVLEEATRRWLRSDPAGTADAAEAAGPSGPAGHGGPAGHGGPADPGGSAQPGSGWASLA
FT                   PVVAELRGEIAALVRRWTPHTPPPAGSRIQPAGLSVGQRRALAARTLTDFVHYLPTTGA
FT                   DALIALLDLHLVERATTGVVLDQPVELVQISADLPTALDPTRRLAEDKVTGLQLGNFGA
FT                   FAKSSWRANDWMWGRLDGAGWLVRILLDPRRLVLRRDLAVPPGPPADPGGGAGEGRLAG
FT                   TATLARRGWLVALVDDLAEVAGTPVPQDALDELAFLTDPDAPVPPSLPVTATWVAAGLQ
FT                   RDIAAKELVGLARAVRQDNDSGLDPRPTADFLAAVDLALAPEPASPPPASPPPTSPSPA
FT                   GSTDGTRAGASTGAEVISLAAAAAARVAASQRTTAEQATPETATAETATAEQRATAEKQ
FT                   SPTGRRAMAAPATTQEPPPAMPAASGPSPPQRPSAPPRPPGLSGVPVAPGMLAPREVDG
FT                   VLRACQVPAERITDRAQGPILVTALVQIIAVIAAWTATMRILPRPLRPAAFVVRTAARL
FT                   AYELVRDVSHGRRRVVIGLGAALVLLGVAGGLVSSGAVGGLGLLIALLGLLMVGLTSWR
FT                   RVPGGLAVLAAGLIAVIAAAGVFPVLHDRLFDWLEDDAVPYLADHPWAWATVFAALVLP
FT                   GAWSLAEALTTRRARHRR"
FT   gene            68520..70523
FT                   /locus_tag="FRAAL0066"
FT   CDS_pept        68520..70523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0066"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUJ1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58748.1"
FT                   /translation="MSRSVRIGGAVYRVALLVNGLLAGSMGTPYSRVASRSRPCAPPGA
FT                   PGKEPFMGHYRSNLRDLEFNLFEVFGVDRTLGTAPFEEMDAETAHEVLAELEHLATGPV
FT                   AESFADADRHPPTLDPATGTVTLPESFKRSYLTVQDGEWWRLFVPTDLGGLGASPTVAW
FT                   AAAELLLGANPAVFMYMAGPTFAAILHRLGNEWQRTLAGYAIERHWGATMVLTEPDAGS
FT                   DVGAGRTRAVEQPDGTWHIEGVKRFITSGDWDVPENIIHLVLARPEGHGPGTKGLSMFV
FT                   VPKFMPDPATGEPGERNGVYVTNIEKKMGLKVSATCELSFGERTPAVGWLVGDVHEGIA
FT                   QMFQVIEYARMMVGTKAIATLSSGYLNALDFARTRVQGADLTRSTDKTAPRVEIINHPD
FT                   VRRMLMLQKAYAEGMRSLVLYTATFQDRVAQAAARGGNDELAVRINDLLLPIVKGVGSE
FT                   RSYELLSTSLQIFGGSGYLQDYPIEQYIRDAKIDTLYEGTTSIQGQDLFFRKIVRDRGQ
FT                   ALTAVLGEIQTFVKAEAGNGALQYEREVLGAALDDVQAMVGSMVGYLTAAADDARQVYK
FT                   VGLNSTRLLLSIGDVLIGWLLLRGAEAALRALDEAGTGQGPAGGHQGTAFYQGKVAAGR
FT                   WFAANVLPELKARRAVAESTGLGLMDLPAEAF"
FT   gene            70663..71043
FT                   /locus_tag="FRAAL0067"
FT   CDS_pept        70663..71043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0067"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58749.1"
FT                   /translation="MSLAFFALGAILAFAVRSDPSGLDLDMVGLIMMLVSAVGLGITLY
FT                   QSQWRRKIVEESVESGVPTPISVDDTVLVDPVTPVEAPRRREPGLTLEEDRKLNSARHP
FT                   EADPEPQPVVHVGTEERSASRR"
FT   gene            complement(71170..71406)
FT                   /locus_tag="FRAAL0068"
FT   CDS_pept        complement(71170..71406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0068"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58750.1"
FT                   /translation="MTRVEALQAADEFVAKVLTSANSSGRFTGTLNLAERVDLTLRVAR
FT                   FLLEGQSSSDTDDLLKRDMRNELDQAFPPLRTS"
FT   gene            complement(71527..73140)
FT                   /gene="aceF"
FT                   /locus_tag="FRAAL0069"
FT   CDS_pept        complement(71527..73140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="FRAAL0069"
FT                   /product="dihydrolipoamide acyltransferase component"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /EC_number="2.3.1.61"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUI8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58751.1"
FT                   /translation="MAQRQFRLPDLGEGLTDADIVRWLVQVGDSVTVNQPLVEVETAKA
FT                   VVEIPSPFAGILVEIHGEAGSTLAVGAPLLTVRTADSGQPEPVDAAPEPAAAASGSTGG
FT                   AAGGGRLPASRDGGAGERMPVLVGYGPRQGQQRRRSPRRQAAPGPARAGGPPRVDDAVL
FT                   TTPPALATPTTPAAPTTPGVPAALATPAALAKPSVLAKPPVRKLARDLGVDLAGIAGTG
FT                   PDGTISRDDVQAAVRTTAQGAPTATPASPTAPNAPTAPGLPTAPDWRTVSDLPAGPKAA
FT                   PPGHRRIGAVPADAAFSPATGAWHVPVVGVRRSMAQAMVASVTAAPHVTEFLSVDVTAT
FT                   MAARERVAALPEFDGIKVTPLLFVAKALLVAVRRHPMINSRWVEDGGAGRAEIQVPDRV
FT                   NLGIAVAGPRGLVVPNIPDAGRLDLVGLARALAGLTGSARADRLDPADLRGGTITITNV
FT                   GVLGVDVGTPILNPPEAAILALGSIRPTPWVHDGQLTVRTVVQLALSFDHRIVDGELGA
FT                   AVLSDVGAVLTDPTLALAWS"
FT   gene            complement(73172..74245)
FT                   /locus_tag="FRAAL0070"
FT   CDS_pept        complement(73172..74245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0070"
FT                   /product="Pyruvate dehydrogenase E1 component, beta
FT                   subunit"
FT                   /function="1.3.1 : Glycolysis"
FT                   /EC_number="1.2.4.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUI7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58752.1"
FT                   /translation="MTSGAVITGEQPAEVGGERTDEPAAPAPITLARALNLGLRSAMAA
FT                   DPKVVVMGEDVGTLGGVFRVTDGLQKEFGEARVIDTPLAESAIVGTAIGLAMRGYRPVC
FT                   EIQFDGFVYPAFDQIVSQLAKLHYRSGGRIRLPVTIRIPFGGGIGAVEHHSESPEAYFC
FT                   HTAGLKVVACSNPVDAHQMIQQAIRSDDPVIFLEPKRRYWEKAVVDPRPPGEVSPDGTL
FT                   GLHSSVVVRAGTDATLVGYGPTVRTCLDAAEVSAADDGRSLEVVDLRSLSPLDLEPVLA
FT                   SVRRTGRLVVVHEAPSNVSVSAEVAARVTEQAFYSLEAPVLRVTGFDTPYPPARLEDHY
FT                   LPDVDRILDAVDRSFGY"
FT   gene            complement(74364..75659)
FT                   /locus_tag="FRAAL0071"
FT   CDS_pept        complement(74364..75659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0071"
FT                   /product="Pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /function="1.3.1 : Glycolysis"
FT                   /EC_number="1.2.4.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUI6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58753.1"
FT                   /translation="MPSVTELMQLLTPTGHRITVASRARTPEPDAPPAAALDRLADAPS
FT                   AAGPEAGSLDGELTAVDIDLPAYVADLTDDELFGLYRDMVLVRRMDEEATSLQRQGELG
FT                   LWASLRGQEAAQVGSGRALGPDDMAFPSYREHGVAWCRGVDPAAVLAIFRGVNLGGWDP
FT                   ATHGFALYSIVVGSQTLHATGYAMGMAWDRSAGAAIAYFGDGASSEGDVNEAFGWASVY
FT                   RAPLVFFCQNNQWAISEPTRRQTRTEIFHRAAGFGFPSVRVDGNDVLACLAVSRWALAT
FT                   ARAGRGPVLVEAVTYRMGAHTTADDPTRYRSPVELEAWSRRDPLDRMRAHLAACGLLGE
FT                   ERDRHLALEADAFAHELRNRCTAMLDPDPTSLFDHVQVTENGLVAQQRSAFAATLDPSD
FT                   GGTDDRPDRQDRLGTRDGLGTREGLARGMGSE"
FT   gene            75765..76694
FT                   /locus_tag="FRAAL0072"
FT   CDS_pept        75765..76694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RUI5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58754.1"
FT                   /translation="MTSAQDVPRPPARRDIGKVGVWSGQFDFSPAGVVREAIAELDELG
FT                   YPTLWTGEVKGREVLVTASLALAATSRITIATGIAQILARNPLTMTAAQLALAEAFPGR
FT                   FLLGLGVSHAELMHIRGAPYTRPLAQMAAYLDEMDLMAAEQYRAVAPVEPPPRVLAALG
FT                   PKMLGLARDRADGAHTYFVPPEHTAAAREILGPDKLLVPEQAFVLHDDPEQARELARRH
FT                   TGSYLRLPNYTSNLRRFGFDDDDLAGAGSDRLVDTIVPWGDADVLLGRISEHLDAGADQ
FT                   VAVQVLDFDRRGLPRRQWRELAPALSTL"
FT   gene            76873..78090
FT                   /locus_tag="FRAAL0073"
FT   CDS_pept        76873..78090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0073"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUI4"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58755.1"
FT                   /translation="MGGRGAFARRLTGHRSGAAGLALGTAGVLLVGLVACSMPYGHDAD
FT                   RTPAPSGATAAAARPGGSGSPAASGATAGGSGSAGGSGPVGNGPRRPTGQPITIAFGGD
FT                   IHFAGTPGQRLAADPATAIGPISATLSAADLAVANLETAVTDGGTPAPKEFTFRAPPTA
FT                   FDAVRAAGIDVVTMANNHGMDYGLAGLQDSLRNARNAHFPVIGIGEDDTSAFTPYTTTV
FT                   KGQRIAVIGATQVLDDQLVPAWTAGPHKPGLASAKEVDKLVAAVRAARARADTVVVFLH
FT                   WGVEQQQCPSDAQRSLVPRLTAAGADVVVGSHAHVLLGAGWTSDGVYVDYGLGNFVFYS
FT                   SGTGRNTESGVLRLTVAGRAVTDATWVPARIVGGAPRPLSGGAGSQALAAWNALRACTG
FT                   LAATAP"
FT   gene            complement(78200..78595)
FT                   /locus_tag="FRAAL0074"
FT   CDS_pept        complement(78200..78595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0074"
FT                   /product="putative metal uptake regulation protein"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUI3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58756.1"
FT                   /translation="MRATRQGDAVCAALTETDAFTSAQELHALLRSRGAGVGLTTVYRH
FT                   LQVLVDRGEVDMIRRDDGETVYRRCATEAHHHHLVCRLCGRTVEIAGPEIEAWTAAIAD
FT                   AEGFVDVEHTVEIYGTCAGCAAASAAS"
FT   gene            79063..79476
FT                   /locus_tag="FRAAL0075"
FT   CDS_pept        79063..79476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58757.1"
FT                   /translation="MEVSMSLTVTPQLVEAASAGELTDEAFLDCVRTSLPFAYELVERL
FT                   AAELGPARAAGSDFTAFDGTPPTDSAGGQLLRAMASTSIRSALERHFGVALVFQNCHRV
FT                   GMFGLDAVGGEQYRQFVSREAQVLHQKPELVNC"
FT   gene            79518..80222
FT                   /locus_tag="FRAAL0076"
FT   CDS_pept        79518..80222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0076"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58758.1"
FT                   /translation="MRCVGVSGPDGRRRIGMARQGGRPGWLREPDPLQNPVGSRLAILG
FT                   VIALIIGGTVAIASGDEQPASGLPAGGPHASTTAAVPSAPVLSAPVPSASVSAVPVSTE
FT                   NDAAELASWYHGSEGLRIRVATDVATVRSQLAAQNGAALKPACATLGTDIAAAITAPVP
FT                   PTTAARARYDAGGRGYTAAAASCAQLFDGTRIEVGILQQRIVTSLADGDREWAALAAII
FT                   GQPMATAAPAAP"
FT   gene            complement(80179..81807)
FT                   /locus_tag="FRAAL0077"
FT   CDS_pept        complement(80179..81807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0077"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58759.1"
FT                   /translation="MDNMRRDLRVALLLAVAAVAVEIALHARIGRPLWYDELWRPHFAG
FT                   EPWPTFWSELRSANAPSSLGSIALTRVTGDVLGWHAWALRTVTAGVWLPVLAVATFLSA
FT                   RRFTGVLPAAGGAVAVALSGTVVDSGTQLKPYVLEAVVSLAIFALWTSPGAPLRKRTVA
FT                   GALAAVSLPAVFLLVPLAVGDLVRDRRTSWRAAPALLLAAGHTLLFVSHQSSQRASHFW
FT                   DDQFLAGRGVLGGLRFTADQVIAVLGGAPPGIDRYDPNLVHSLLEGHRLATIAVGTATA
FT                   VAMLAGARTLRRRADGATLLWSLIGAELLQLAASGGRYWPFGACRPNLFLVPLLTIVAA
FT                   VGAGELAAAARRHRVGGDGGGRGRRGHVISAASVLCLAGIAATPVCAAAGIGTLWRERH
FT                   EVRPIEGMVDATLAVREQYRPGDAVIVGGRLARAGWLYGMELSADGPRRPGARVPRSAT
FT                   TFLTGIGRGGAERAVRTRQHPPQRVLLFVLAYDRRGTAAELATLRGGGWCNRGVRSFPL
FT                   TGTLHELDRCPVTERRGPPSPSAGR"
FT   gene            complement(81866..83080)
FT                   /locus_tag="FRAAL0078"
FT   CDS_pept        complement(81866..83080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0078"
FT                   /product="putative aspartate aminotransferase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="2.6.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUH9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58760.1"
FT                   /translation="MEFTQSDKLADVCYDVRGPVLDEATRLEAAGARILKLNIGNPAPF
FT                   GFSAPPEVLEAVVANLAGAQGYSDSKGLRAAREAVVGYHNRKGIAGITPESVYLGNGVS
FT                   EMIMMSLQALLNNGDEVLLPAPDYPLWTAVVSLCGGRPVHYLCDETAGWAPDVADIARK
FT                   VTPRTRAIVIINPNNPTGAVYERRVLEDIVEVARRHHLMLLSDEIYDRILYDDAEHVAT
FT                   ASLAPDLVCMTFNGLSKAYRLAGFRSGWMVLSGPRGHASSYIEGLNILANMRLCANVPG
FT                   QFATLAALAEDGGAGDLVLPGGRLREQRDTVVKLLNDIPGVSCVPPRGALYAFPRLDPE
FT                   VYPIVDDERFVFDLLAAEKILLVQGTGFNWPHPDHVRIVTLPSVDDLTDAVGRIDRFLA
FT                   RYKQN"
FT   gene            complement(83081..83965)
FT                   /locus_tag="FRAAL0079"
FT   CDS_pept        complement(83081..83965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0079"
FT                   /product="putative Manganese ABC transporter, permease
FT                   protein"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RUH8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58761.1"
FT                   /translation="MILFSSLGDGYVRRALLEVVIVGVLCGAVGVHVVLRRLSFLTMAL
FT                   THATFPGVVIATLLGLGLVLGAGVFGVLLVGVVAALTGPRGAEHGRETTSVTAVVLSGG
FT                   FALGMALMSTQEGFSRDLTAFLVGSVLTVQSSDLVVSAATTAVVLGGLAALRKELHLAA
FT                   FDPDALAAAGYPARRLDLVLLLALEATVVTSLPAVGTIMAVALIVGPAATARLWCSRTS
FT                   TMTAVAMGLGVASGVIGLAVSEQWNVAAGGAIVLSVAAFFMVSLVLRSLPWGELAVAAA
FT                   GRRKSAGRPTYSG"
FT   gene            complement(83962..84774)
FT                   /locus_tag="FRAAL0080"
FT   CDS_pept        complement(83962..84774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0080"
FT                   /product="putative Manganese transport system membrane
FT                   protein"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RUH7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58762.1"
FT                   /translation="MTRALIEALLLGALCGAVGVYVLLRRLAFLTDAVTHTVFPGVVVG
FT                   FLVSGRSGIVPGALVCAVAAAALFTAIAATRRVNEDATLAVLLTAFFAVGVILISRQHS
FT                   YTADLTAFLFGHVLTIDITDIVFTAVVTALAGLVLLGLGKELLLRAFDPEWARAAGYRI
FT                   TALDLVSNMMIALVVVASVQAVGTVLVIAMLVVPAAAARLLSARLGVIVAVAVLLGMIG
FT                   AWLGLATSYEASVGHDLRLAAGATIVLVLVAFYALAALGQATRRLVRR"
FT   gene            complement(84810..85568)
FT                   /locus_tag="FRAAL0081"
FT   CDS_pept        complement(84810..85568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0081"
FT                   /product="Manganese transport system ATP-binding protein"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /EC_number="3.6.3.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RUH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58763.1"
FT                   /translation="MSRPAAIVFDQASIAYGRVPALEQVHGTVRQGEIVALVGPNGAGK
FT                   STLIKALLGLVPVASGSITVLGLPPAQARRLVAYVPQADTLDPDFPVSVAQVVLMGRYR
FT                   RIGWLRPPGRADRDAAAEALAAVGLAHRAADRFGTLSGGQRQRVLLARAIAAQPQALLL
FT                   DEPFNGVDAVSQEALLATIKTLAAGGAAVVVSTHDLGLAQLTCDGICLLNRHQFGFGPP
FT                   GDVLTPDLLRAAYGGAALELGDRGLIVARS"
FT   gene            complement(85612..86118)
FT                   /locus_tag="FRAAL0082"
FT   CDS_pept        complement(85612..86118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0082"
FT                   /product="hypothetical protein; putative lipoprotein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUH5"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58764.1"
FT                   /translation="MLALVAAAPVPDDEVRAAVHTLRTDDAVRPIDLDRSVVELRTEEH
FT                   RGAETTLVLSADVLFAFDSAELTATARRQIADVAGRLAGSAAPIRVDGYTDSFGTPAYN
FT                   VILSQRRASAVADLLRPAAPAGFLVSARGHGSADPIAHDTLPDGSDDPAGRAINRRVTI
FT                   TYGGQ"
FT   gene            complement(86190..86753)
FT                   /locus_tag="FRAAL0083"
FT   CDS_pept        complement(86190..86753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0083"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58765.1"
FT                   /translation="MPRSRHRLSCVVMALATLAALTAASCSGGSDSIDRPGPAAESARP
FT                   AGPASPRSESPEVARTARLTAGENGPVEIGLVDLRISGRLAILRLTFTPHLRTDRPGGI
FT                   SLLDMAGGRGGSVSLVDTENLRRYLVVRDSHNEPLGPIPGVVRTANDRPLNLTFTFAAP
FT                   PAEVKKIDVYLDDQIVFDGADIAS"
FT   gene            complement(86802..87359)
FT                   /locus_tag="FRAAL0084"
FT   CDS_pept        complement(86802..87359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0084"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58766.1"
FT                   /translation="MPGHAGERLILTGPLRLVPGTTEQILSRLADLGRTVSTEDGVTDG
FT                   LSVLALSVDDVVLCLPTVIMDGRPRRWPSATVDRRIDLTSYAFAEPDLISAYAPELIEH
FT                   LNVGHADQMRQLARHARPAETEGDIAGVQVSGLDRYGLDLWRVDSAGAEQVRVAFRQPL
FT                   VEPRSLGRELRRLLDQSANTSE"
FT   gene            87781..88122
FT                   /locus_tag="FRAAL0085"
FT   CDS_pept        87781..88122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58767.1"
FT                   /translation="MPVIFKLVGDGRPYPEHGLGQRDWAAIPPRQVRLDQLVTTKRVLA
FT                   LDVLLDEDSTFYGDLFPHVIEWGGALYLEDGLHRAVRAALQQRTSIHARVYVLTGPALS
FT                   DSAQSSVAR"
FT   gene            complement(88101..88379)
FT                   /locus_tag="FRAAL0086"
FT   CDS_pept        complement(88101..88379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0086"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58768.1"
FT                   /translation="MRTAYLLWFFHTPAWTSRPHDIRYCGGWYERADAPDVTGRQARRT
FT                   AGGNLKPVMRSPVFRPITAYRPSSTCPQYLFAKVGKDVYVTYRATED"
FT   gene            complement(88596..89819)
FT                   /locus_tag="FRAAL0088"
FT   CDS_pept        complement(88596..89819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0088"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58770.1"
FT                   /translation="MLAAFDRRKGWSATGLPTCAHWLAWRCGIGLRASYEYLRVARALQ
FT                   TLPQISATFARGEISYSKVRAITRVATPETEGGWAHDAARCSARELERLVSLQLKIKAD
FT                   SRNDREKSGDKKDSVRCSWHWNEDGTFFLIAHLDAERGAVVAKALAMAASTLDQSARPR
FT                   DDGRSTTDFPDGGQEKAVSRALRVDALAGVAESFLTHGAPGLTDPNSFTVNVHVDVDTL
FT                   IGGDQDRQDDRAPRAEKDELSGRTCEIEGGGTLPPSVVRRLSCNSLLRAFLTDPKGNPL
FT                   ALGRTRRSPSTKLRRAVYARDKGVCRYPGCRHTQWLQIHHLQEWGVENGLTDPANLVLL
FT                   CSLHHRLVHDRSLTLKRRPTGELLVFHPDGTVMQEAPPVSIEPDPVRFFHSPASPGPGH
FT                   GSSAGQAA"
FT   gene            complement(90236..90880)
FT                   /locus_tag="FRAAL0089"
FT   CDS_pept        complement(90236..90880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0089"
FT                   /product="two-component system response regulator"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="GOA:Q0RUG9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58771.1"
FT                   /translation="MRVVIAEDSVLLREGLRRLLTDAGCEVVATVGDGPGLVDAVVTHQ
FT                   PDVSVVDVRMPPSHRDEGLRAAIRARSEVTGSPILVLSQYVEKQYAAELLADGAGAVGY
FT                   LLKDRVADVREFVDAVRRVAAGGTVMDPEVVAQLLVRNRRNDPMSALTPREREVLTLMA
FT                   EGRSNTAIASHLVVSSGAVEKHISNVFSKLGLEPTTKDHRRVLAVLAYLRS"
FT   gene            91201..91689
FT                   /locus_tag="FRAAL0090"
FT   CDS_pept        91201..91689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0090"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58772.1"
FT                   /translation="MIIAFLLLTRIAYGLGGRERRLPMLVAGIAGTQVLLHITFALAHP
FT                   HAHRAGGYPIEMRMVFAHGLAAVCVAVLLRRAERVLWSASGLRPHAVLFRLFRPVADRA
FT                   VPSIPPVPRVDVRRRAPRPHTRPLGPSARRRGPPPGQPEFGRTGRCAVDCSPPLFAMA"
FT   gene            91837..92493
FT                   /locus_tag="FRAAL0091"
FT   CDS_pept        91837..92493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RUG7"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58773.1"
FT                   /translation="MPASAHVTLQPSTASAGSYATLSFKVPTEEDNASTTGIDVQFPVD
FT                   TPLASVSVQPKAGWSYKVEKAAPAKPLTTDDGKVSEVVTRITWTADGSQGIKPGEFDTF
FT                   TVSAGPLPDKVGQLTFKTLQTYSNGDVVRWVDVAEPGAGEPEKPAPSLTVTAAGAAADS
FT                   STGAHDAASTQNAAASSQSDGSDGTARWLGTVGVVLGAIGLLTGAFALVTARRRA"
FT   gene            92498..94207
FT                   /locus_tag="FRAAL0092"
FT   CDS_pept        92498..94207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0092"
FT                   /product="putative transport integral membrane protein;
FT                   putative Copper resistance domain"
FT                   /function="4.S.36 : Cu"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RUG6"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58774.1"
FT                   /translation="MRRVMVVTMALLAMVTTSIGLGLGVAPASAHALLTGTSPADGAAL
FT                   AAAPTRIVISYSESVRVSRDSIRVLDSAGARVDDGQARSGQKASQAMVALRPNLPRGTY
FT                   VASWRVISADSHPISGAFAFGVGGPPEAGAASAEADTSGSRAVGFLFGVARFAGYAGTG
FT                   VLLGACFFLLMLWPQGLRTGGAGPLVAGAWGLSALAGLGQLLLQGPYAAGLGLSGLGRW
FT                   SVLSTTLEERFGHLLLIRLLALCLAVPLLRRMFRVGSLDVWRTCELAALGLVVAVTLAA
FT                   IGHGSAGDLVWLATASLTVHVLGMSVWIGGLVVIAFFLVRRAAAVELAEVLPRWSRVAA
FT                   VAVAVIVISGLFQSWREIGTLRAVIDTGYGRLLLYKVWFVLGMIALGALAQRWVRRHYA
FT                   GVRADARSGSGGTGTGTGTWTPPSVAALTGLRRGVASELVVGAVVLGLTATLVNMVPAR
FT                   TSYAPPFTGTAFAGPMTVKVRVAPTRIGAESLDVYTWAPSGKPQKLVQASAALSLPTAD
FT                   LGPFEVPLDLAEQGHARSDRVQAPLAGKWQLRLTLRINDFDQYVTTLFYTVR"
FT   gene            complement(94218..95675)
FT                   /locus_tag="FRAAL0093"
FT   CDS_pept        complement(94218..95675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0093"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /function="3 : Regulation"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUG5"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58775.1"
FT                   /translation="MDDDADLAARVRRGDRQAFDDLYDLYADDVFSMCLLILGDPTVAR
FT                   AAAGTAFALVARTRLNPLSDPARLRSWLLELARGSALAWSGSPQARSIPVPHGVPPEEL
FT                   LVGSVVPAPASLRVGLARTFDRAAAVAEAAAASRRVAPPAAPAPREINLVKTPTGPAAA
FT                   PAADAAETLIAPATARALPLMRMDAEVEPTAAAAAPGRGTVDWRSRPAMAAAAAVVVAV
FT                   VGLTAAMNWPSSDPRLMSENGVAVVSPPPSLDVVRPATAPAAPSGGTAVAPTVVPTVAG
FT                   AFTSRAAAPREVRPRLVEPIARDVHRSEPTATPSTNRPHATSAAPSTTAPRTTPPKLPT
FT                   STAASTTAAPPVTPGSSGSSGSSASTTPPKARAPQPTATIPPSVSVPPGSATAPPSTPP
FT                   GGKAPSAPADPSSSSPQQRSARPSAGKSTGSTGGTRSTEGTGGSGGTTSPGGTAATEST
FT                   SSPTGAGPSESDDRIVGPVTAPVPVSV"
FT   gene            complement(96156..97274)
FT                   /locus_tag="FRAAL0094"
FT   CDS_pept        complement(96156..97274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0094"
FT                   /product="putative serine protease, heat shock protein"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /function="5.5 : Adaptation to stress"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUG4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58776.1"
FT                   /translation="MAAGLAIALVAAGIGGGVGALVADNDSGNTVVTNAGLERSSDSSG
FT                   GTSPAASGTVAAAAQKILPSVVTISEESSSEAGTGSGTIIRSDGHILTNNHVVSGASDG
FT                   GTLTVTLQDGRTFDAQVVGTDPSSDLAIIKINASGLTAATFGNSDSLSIGELVVAVGSP
FT                   LGLNGTVTSGIVSAVHRPVRTGDSTVQDQQNTVLDAIQTDAPINPGNSGGPLVNSRGEI
FT                   IGVNSAIATVGGGGGSPFGGSQQSGNIGVGFAIPGNYAESVATQLITTGRAQHPYLGVT
FT                   ASTAAENTRSTASSGTGAQIRSMVSGGPAAGAGLRTGDVITKVGNRAVSDVDSLIAAVR
FT                   SHAIGDEVEVTYTRNGQTGTVKTRLAQQPPTS"
FT   gene            complement(98018..98413)
FT                   /gene="mscL"
FT                   /locus_tag="FRAAL0095"
FT   CDS_pept        complement(98018..98413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="FRAAL0095"
FT                   /product="mechanosensitive channel"
FT                   /function="4.1.A.22 : The Large Conductance
FT                   Mechanosensitive Ion Channel (MscL) Family"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RUG3"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58777.1"
FT                   /translation="MKGFKQFLMRGNVVDLAVAVVVGTAFTAVVTSLVKTIFTPLIAAI
FT                   FGKPDFSALTFTLNGSVFRYGEFINSVIAFLSVAVVIYFVVVLPLKTINDRRARGQIPP
FT                   EEDPVLTDEARLLTEIRDLLAERRPTS"
FT   gene            99292..100632
FT                   /locus_tag="FRAAL0096"
FT   CDS_pept        99292..100632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0096"
FT                   /product="hypothetical protein; putative IMP dehydrogenase
FT                   / GMP reductase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUG2"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58778.1"
FT                   /translation="MESAGRPGRSKHAGRRDRTIPPGFGPDGGPTHDASGRDASGRDAS
FT                   ARDASAHRASAPGASPPEAGRRAGRPGTGGRPGGADARARFAAPEGVEDTRLDRTGSRR
FT                   PAPGFGDHTDPGRSDRPAGAARPSRSQRSGGPGRAGAAGPTAGRDLERPDSPPTMIRNR
FT                   TGPHRAGGDRTAGQRRSGGPRTAAMERDFPEADDVNDLDEADELDDRRDGGGGDSMSFL
FT                   HRLGVALVVLAVALGVGVGAGVVWEKVRPSGRTATDAPLAPSPSASAAASGPAATGPGA
FT                   SAAASTGGPPAAGQIAVPADWAPYTDPLQKATFSHPPVWKQRRDNTGIFYGEPGTVSDY
FT                   GPQMIGVARIAGTDPTAALTRVQAGEFDAVSGLTKERSGPTTDTSGQPTQELAGSYDRE
FT                   GQRVSYLMRTVAADGAVYVLIARVSTSAAATLNTLMGALRASFSPVA"
FT   gene            complement(100646..101668)
FT                   /locus_tag="FRAAL0098"
FT   CDS_pept        complement(100646..101668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0098"
FT                   /product="putative LpqP (Hydrolase/esterase)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUG1"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58780.1"
FT                   /translation="MVPGATPSATPTTGPDAFERSGRGTPIRITLPPPGTPRPYPLIVA
FT                   LHSLHYDGTDPKAHWDLDGLARTAGLAVVYPDGIGKAWNAGTCCDTAKINNTDDVGWLR
FT                   ALIAHLSENYPIDRTRVSLIGLSNGGMLAYRYACEHGDELAGIAVVAASRQVAQCQPAA
FT                   PLTVVVVHGGADGHVPYLGSQWSPVLLTAITPVEESMAPFRAVDQCPLPSQPGDTILTD
FT                   STGVPWHAPESPLALSAGQQPGVATGSPAAPTPPAGAPTPLPDGLAATAGPPAVPTTTG
FT                   PVAVRRETRCASSARVVQYLLPSMAHGWPPATGPNSFATTGVIWNLLAPARSAHPGPRM
FT                   "
FT   gene            complement(101819..102166)
FT                   /locus_tag="FRAAL0099"
FT   CDS_pept        complement(101819..102166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0099"
FT                   /product="hypothetical protein; putative coiled-coil
FT                   domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58781.1"
FT                   /translation="MEELSDMERSRLLLGWLAARRAVDNCLSDLLAAGPAGERRVRESL
FT                   ALVDDLESRAQEAFDRYRTAAENTPAPPPRPTGRWSPPAAAERPRLNVVRAPEGDLARS
FT                   SSNTKSNHRHR"
FT   gene            complement(102452..103693)
FT                   /locus_tag="FRAAL0100"
FT   CDS_pept        complement(102452..103693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0100"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58782.1"
FT                   /translation="MYNRPVQETVAIAWDRGFSDAWSRIAETGPKIGVFLAICLLGGLL
FT                   VRAGARLLTALAARLEFDGVLDRCGLPALLRRPAADVRAGAVRVLTGLGLLAVLRVAVG
FT                   VFGPSAAEDTVTELLALLLHTMLATVIIAIGVSLARLARTFVREALRELSYARAAGNTV
FT                   AAVLVIAFGKAGLDEVGLATSVTTPVLWAVLAALTGVIVVGVGGGLVRPMQLRWEEILE
FT                   HAEDTAAQARLTWRARHPDPDGADLDPSTASSSTASPSVASPGTGDPDTADPSSTDPNA
FT                   RTAGPGAADPGSTDRVGPDLTDADADADAPGPGGGGPKGGEPGGGGPRPGELSNDPDVP
FT                   VEPDPAAGPVAPSIPAPASGAAAATAPRPSIPPPGEQVPFDPAGPDRTSASASPPRSNA
FT                   PSRPADRPRAEGPP"
FT   gene            103799..105154
FT                   /locus_tag="FRAAL0101"
FT   CDS_pept        103799..105154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0101"
FT                   /product="Deoxyribodipyrimidine photolyase (DNA photolyase)
FT                   (Photoreactivating enzyme)"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="4.1.99.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7604260; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUF8"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58783.1"
FT                   /translation="MTVSVCWLRRDLRLSDSPALCAAVDGADDVLVLFVLDDALRRPAG
FT                   PVRLAFLYRCLRELDDRLGGRLCVRRGDPVDVVPEVARAVDARRVHISADYGPYGRRRD
FT                   GEVEQALRAGGRELVRTGSPYAVAPGRLATAGGTPFRVFTPFYRAWKEHGWRRPVAEPV
FT                   GARWALLASDGIPADPDLGGTRLPAAGERAARERLAEFLAGSLTGYAERRDVPGQDTTS
FT                   RLSPYLKYGCIHPRTVLAELDRATSPRDAEKFRSELAWREFYAEVLAANPASARADLTG
FT                   ALADMAYDPPEGGFEAWKWGRTGFPIVDAGMRQLLAEGWVPNRVRMIEASFVCKDLHVH
FT                   WTHGARWFLDHLVDGDLASNHHGWQWTAGTGTDAAPYFRVFNPVSQGHRYDPDGTYVRR
FT                   WIPQLRDVPAAKVHEPWTLPGGPPAGYPAPVVDHATERRESLARYEAARRRG"
FT   gene            105685..106200
FT                   /locus_tag="FRAAL0102"
FT   CDS_pept        105685..106200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0102"
FT                   /product="Putative DNA polymerase related protein
FT                   (partial)"
FT                   /function="2.1.1 : DNA replication"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58784.1"
FT                   /translation="MVGEQPGDVEDRRGQPFVGPAGKLLDRALGEAGLDRAEVYATNAV
FT                   KHFGYRTGNGPRRIHQTPQARHVTACRPWLAAELNVIRPSLVVVLGATAGASLLGPSFR
FT                   VTRMRGRLLPGPPGSNAQLLATLHPSAVLRADPASRDEVYGGFVADLRIAAAARPAPVG
FT                   GEQGFPPA"
FT   gene            complement(106261..107028)
FT                   /locus_tag="FRAAL0103"
FT   CDS_pept        complement(106261..107028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0103"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUF6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58785.1"
FT                   /translation="MTISRLGSRTATGILAAVLGGVVLTGCGGGDGSHDAATNLSPQVR
FT                   NQLAAIAGLGQNKSTVVTAVGTSVDIYSAPTDTQPSSTLASPNENGVKRVFLVQAKMPG
FT                   WWQVMLPVQPNGSTGWVKADQVSASETPFRLVVSRGHHLLQVFSDGKQIAQEPVAIGTT
FT                   DTPTPGGRFYLMELLRPRNPNGPYGPYAFGLNGFSTSLSSFDGRKPVIGLHGTNEPKMI
FT                   GKDVSHGCIRLSNDAITRLAQTVPLGTPVDIVA"
FT   gene            complement(107025..107555)
FT                   /locus_tag="FRAAL0104"
FT   CDS_pept        complement(107025..107555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0104"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58786.1"
FT                   /translation="MAGATASADPSASASASATPAGAAASTGGTGDPTLDGFLDLLPFK
FT                   VPLDREINGIEDIDVNPLVLTFTCNGGEPAWKLKNTSDKSFGFGWFDTNLGGGILDIGP
FT                   TQTVDLPSKALAVVGSPWDAETKLLLVTVPTVGVSNCGGATSAPPAIPVPAALPIAAPA
FT                   AGSSVTAEPYYTG"
FT   gene            complement(107968..108462)
FT                   /locus_tag="FRAAL0105"
FT   CDS_pept        complement(107968..108462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0105"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58787.1"
FT                   /translation="MPPAAQEKSDRAPTARPAKGKQVQPGGFSRAPATKHALRYPRRRR
FT                   AGPAPQPAPADSAPTRTDGVGRTAETGEPRRDGADRGDSDGGGREGDEAVSNRAAGGTI
FT                   AAAARSPVHPDRSLHRTDRRIGPIAASNRSRIRTDRCSRFGVVQRRRSSGRHLVAANST
FT                   G"
FT   gene            complement(108692..109417)
FT                   /gene="pdxH"
FT                   /locus_tag="FRAAL0106"
FT   CDS_pept        complement(108692..109417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="FRAAL0106"
FT                   /product="pyridoxine 5'-phosphate oxidase"
FT                   /function="1.5.3.6 : Pyridoxine (vitamin B6)"
FT                   /function="1.7.27 : Pyridoxal 5'-phosphate salvage"
FT                   /EC_number="1.4.3.5"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUF3"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RUF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58788.1"
FT                   /translation="MASNPPSAASPRRTAVSPGADRPDGPDPAGQRQSYHAGRLEPEQL
FT                   ATTWVEQFARWFADASTAGAGVPEANAAVFATASADGRPSARTVLLKGFDHRGFVIYTN
FT                   YTSRKGRESAENPFGSLVFPWYTLERQVVAIGAVERVSRTETEQYFASRPRGSQLGAWA
FT                   SHQSQIIESRDVLDARAAELAARWPAGTPVPTPPFWGGLRLVPDTVEFWQGRTNRLHDR
FT                   LRYRRVCTADRWAVERLSP"
FT   gene            complement(109448..109834)
FT                   /locus_tag="FRAAL0107"
FT   CDS_pept        complement(109448..109834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0107"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUF2"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58789.1"
FT                   /translation="MAFVFISHRAADIASAERLGRAVNAVGHAVHLDRWEVRIGDTVPM
FT                   FMNDTLATADFLVLGHSTLGIHAPWVAQEFLPALAADLSSRGIVMLPVILSGTEAPSRL
FT                   GGRPCLDLTTHWDRGVATVLRELG"
FT   gene            110277..111386
FT                   /locus_tag="FRAAL0109"
FT   CDS_pept        110277..111386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0109"
FT                   /product="citrate synthase 2"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /EC_number="2.3.3.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUF1"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58790.1"
FT                   /translation="MAEKTSDFKPGLEGVIAFETEIAEPDKEGSALRYRGVDIEDLVGK
FT                   VDYGHVWGLLVDGAFEPGLPPAEPFPVPVHSGDIRVDVQSALAMLAPYWGLGQLIDIAP
FT                   EQARDDLARASVVALSFVAQSARGLGQPAVPQKEVDRARTITERFMIRWRGEPDPKHVQ
FT                   AVDAYWVSAAEHGMNASTFTARVVASTGADASAALSAAVGALSGPLHGGAPSRVLAMLD
FT                   EVERTGDPLGYVRRALDRKERLMGFGHRVYRAEDPRARVLRRTARDLGSDRYEVAEALE
FT                   AAAIEELTNRFPDRPLRTNVEFWSAVVLDFAQVPAHMFTSMFTCARTAGWSAHILEQQR
FT                   TGRLIRPSARYVGPDPRPLGDVSPGVPRG"
FT   gene            111379..112503
FT                   /gene="serC"
FT                   /locus_tag="FRAAL0110"
FT   CDS_pept        111379..112503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="FRAAL0110"
FT                   /product="phosphoserine aminotransferase (PSAT)"
FT                   /function="1.5.1.11 : Serine"
FT                   /EC_number="2.6.1.52"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUF0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58791.1"
FT                   /translation="MADAAAIHLPDSLRPADGRFGCGPSKIRPDAVAALAASGVTYLGT
FT                   SHRQKPVKGLVGRVRAGLAELFSLPAGYEVVLGIGGATAFWDAAAFNLVRTRSQHLVFG
FT                   EFGGKFADTTKGAPFLAEPSVVSSAPGTHPDWAPEAGIDVYATPHNETSTGVARPVRRP
FT                   VGADADALHLVDATSGAGGLPVDVSEADVYYFAPQKNFASDGGLWTALFSPAAIDRLAE
FT                   IAATDRWIPPFLDLTTARDNSSKDQTYNTPAVSTLFLFADQIEWMLAQGGLDWCVRRTA
FT                   ESSSILYTWAEKTAYTTPFVADPAQRSQVVVTIDFDGVDAAAVAKVLRANGVVDVEPYR
FT                   KLGRNQLRVATFPAIEPADVEALTASIDYVVERL"
FT   gene            complement(112623..113990)
FT                   /gene="gltA"
FT                   /locus_tag="FRAAL0111"
FT   CDS_pept        complement(112623..113990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="FRAAL0111"
FT                   /product="citrate synthase"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /EC_number="2.3.3.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7730298; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUE9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58792.1"
FT                   /translation="MSEQVSTLTVTDNRTGKTYEIPVTDGTVRASALRSIKTGDDDFGL
FT                   MAYDPAFTNTASCRSAITYIDGDAGILRYRGYPIQELAEKSSFLEVAYLLLAGELPSTD
FT                   ELSTWEDEITHHTLVHESIKKFIDGFHHDAHPMGMLVSTVGALSTFYPDAKTIDDPGLR
FT                   RLQIVRLIAKITTLAAYSYRHSVGFPYVYPDNDLSYAGNFLNMMWKATELKYEPDPNLE
FT                   HALDVLFILHADHEQNCSANAMRAVGSSQADPFSAAAAAIAALYGPLHGGANEQVLRML
FT                   AEIGSVENIPSFIAQVKDGKKKLMGFGHRVYKNYDPRARVIRQVADEVFKVTGTNPLLD
FT                   LAMELERIALEDEYFIARKLYPNVDFYTGIIYQAMGFPVEMFPVLFAIGRMPGWLAQWE
FT                   EGLLDPEQKIARPRQLYVGYDQRPYVPMDDRGATADTEADPIAAQAAQAAPERPLR"
FT   gene            complement(113966..114151)
FT                   /locus_tag="FRAAL0112"
FT   CDS_pept        complement(113966..114151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0112"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58793.1"
FT                   /translation="MRLTDHAHVQPRTARLGKNHVSQQTGVSAPYPDARPGWGQSRHQR
FT                   HRHRERSPACPSRSAH"
FT   gene            complement(114262..115032)
FT                   /locus_tag="FRAAL0113"
FT   CDS_pept        complement(114262..115032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0113"
FT                   /product="Putative two-component system response regulator
FT                   (partial match)"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUE7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58794.1"
FT                   /translation="MRVAIADDSTLFREGLAMLLTAAGAEVVAQASTAEDLLQGLGRSR
FT                   PDAVILDIRMPPTYTDEGLVAAERIRAQHRTIAVLVLSTYAETPYALRLLGDGSGGLGY
FT                   LLKDRVDDVGALQDALRRVIDGRLVLDEEIVAGLLAHRRRADELARLTPRERTVLAHMA
FT                   EGRSNQGIGARLHLAPKTVENHIAGVFSKLGMPASADDNRRVLAVLTWLRSAAAGPGEP
FT                   GAVAAAPAGPSSGITPGTRSTSGSGHQSGFSPFG"
FT   gene            complement(115166..116932)
FT                   /locus_tag="FRAAL0114"
FT   CDS_pept        complement(115166..116932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0114"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUE6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58795.1"
FT                   /translation="MPHPRLPGRLSACAARHRQWCLAIGGSATTAGAIACQWPSFGHSP
FT                   LFATLNVFVALAFVLTAAMLNGEESLGSVTAALVLGGLLWPLSWTASWDAGPSALVSTF
FT                   AYTHFWVCLGWGVLRYPTGRLQNNGERALLGSAVLVIPLANLGLIGIGRPEWFGYSGHP
FT                   DVWWYGEPIGHGAFDTVVWILDGLTLVLAGAFLLVVRGRLRRYSELDRRVFRPVALALL
FT                   LAFVLAATVNFFVYNPSNGDVGPEFVVISLTLLTIPLAFAAAVLRRVFVRARIAQLLAT
FT                   LPTPPDVRAVRAALRAALHDGSAEIHLWLPGEDHHVDADGAVRPPPPPGAPELIMAVRT
FT                   AVGAPLAVIAAAPAMRRNRDLVEAAVRASAMALENAQLHATVAAQLDAVRASRARLVEA
FT                   GLHERRRLERDLHDGAQQRLLALATRLGLARTKATDPDTISAIEAAREDLRHALADLRS
FT                   LARGIHPAVLSQGGLLPALEVVTAALPVEVELDVPAARFEAVLEAGAYYTICEALTNTV
FT                   KHAGASRARVAVRHDGSVVRIDVSDDGKGGATAVEGGGLAGLTDRVRALGGALVIVSPS
FT                   GGGTRLTASIPC"
FT   gene            117066..117680
FT                   /locus_tag="FRAAL0115"
FT   CDS_pept        117066..117680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0115"
FT                   /product="Putative MarR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUE5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58796.1"
FT                   /translation="MRGGGTWWHGSVSSVIASGCRTPCRAGVGCRRGAAGPFSSSWRRI
FT                   PRNHPFFGPPDEYRQKMETETASDAELASALRLSVMRLSRRMRQERSSQLTPTQTSALA
FT                   SLERHGPMTLGEIAAHERVQPPSMTRVIAHLAVAGLVERRPHPTDGRQVIAEVTAKGRS
FT                   LLSDDRRRRDEWLTDRLAALSAEEIAALTRAAPILDALAGS"
FT   gene            complement(117728..118720)
FT                   /locus_tag="FRAAL0116"
FT   CDS_pept        complement(117728..118720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0116"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUE4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58797.1"
FT                   /translation="MPPRDPALSASWRELRRLVRRRQPDLPLAMALVTDGSDSTTAEVL
FT                   RDAGVAVVGLLAPEPLESLAWAAEAGVPRAYADLLALLSDDIEAVCVETPPPGSDIVAR
FT                   RAAEIGLHVLLAGPATAEAETLRAVADLAEEGDLAHVVALDGRAWPAATHVAATVASLG
FT                   RLTQMTVVGAPTGSTGRVEIIDLAMRWCGEILAVCADPAAMPAATLTPDAPVTLALLSA
FT                   SGATVLINERMGGNLDTATITVCGDAGRIVVQGRRVRRQDDAGVRDLLMPTPPTARPGL
FT                   MEATYDVVRATELDDARLVRGATFHDLLTANRLIAAAGTSRRRGGWVEL"
FT   gene            118877..119098
FT                   /locus_tag="FRAAL0117"
FT   CDS_pept        118877..119098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0117"
FT                   /product="conserved hypothetical protein; putative
FT                   transcriptional regulator"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58798.1"
FT                   /translation="MTATKLAGAASDDDPRVGLAAVASLRALLESLEELQVASARHKGW
FT                   SWQEIADVLGVSRQAAHKKYGRRFGKGR"
FT   gene            119102..119701
FT                   /locus_tag="FRAAL0118"
FT   CDS_pept        119102..119701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0118"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUE2"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58799.1"
FT                   /translation="MFEKFTPQSREVVRAATRVAAAFDHDRVHSGHLLFAIVTEGGAVG
FT                   RALTGLGLDEPSLRTELHGSRVLSRGGREVDTDALAAIGVDYEAIRAAADERFGAGVLG
FT                   LTMVRKVPRRSWWRRRPRARGPRFSAEAARALERAVRFAAARGDGDLTPLHLLLGMLAD
FT                   QFSLAAGIIVRRGTSLDQVRFAATEAADGADPGARG"
FT   gene            119716..120345
FT                   /locus_tag="FRAAL0119"
FT   CDS_pept        119716..120345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0119"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUE1"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58800.1"
FT                   /translation="MAAVPPAAVTDALCTAVHRARAAAPELRWSAPDRWHVTLAFLGQV
FT                   PDDRRGDLDARLARVARRHGPIAVETVGGGHFGDRVLWTAVRPRSTTAAPGPTTAAPGP
FT                   TMTRSGPATAPAGALGALAAGVRRAAERAGAAAGADDRPLRAHLTLARVPDRSHRGLGP
FT                   LVELLRADVEPLPWTVDRLVLMRSVDGGPGAAPVYREEASWALTGR"
FT   gene            complement(120355..120660)
FT                   /locus_tag="FRAAL0120"
FT   CDS_pept        complement(120355..120660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0120"
FT                   /product="putative glnR family transcriptional regulatory
FT                   protein"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUE0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58801.1"
FT                   /translation="MWIDRTAWLATVDGRALQLTYLEFEVLDFFVHHPGQAHSRQALLS
FT                   SVWGHQADDETSPDVRTVDVLVTRLRRKLGPEHRYRIETVRRVGYRYRPLDPAVAS"
FT   gene            120913..121434
FT                   /locus_tag="FRAAL0121"
FT   CDS_pept        120913..121434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0121"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58802.1"
FT                   /translation="MEPGGPWTLEPYRALESGRALEPYRALESGRALESGRALGRGGNP
FT                   ERAVAAGLVPASLSAGAGQGPDSARAPRRWGGRAGVDRGATSTVPGVLAGGVKGCDAIA
FT                   TTGAPDRLRARGEDGGPRQAGPAHRAGNRSPCGAGRPAGADAGWCGWWLPVRQPDRQPR
FT                   RRGADRYGSG"
FT   gene            121533..122726
FT                   /locus_tag="FRAAL0122"
FT   CDS_pept        121533..122726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0122"
FT                   /product="putative deacetylase; putative P-loop containing
FT                   nucleoside triphosphate hydrolase domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUD8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58803.1"
FT                   /translation="MDRTGGSEGLERRVRADARRGSPGGRRGPRPSDSDQFVRNLARRA
FT                   AGPSEVDFSGGEGGIYWWIVRHPLVGDATRPRTGDLMALPDFLVIGAPDAGMEILLADL
FT                   RRCPAVFLPATELTPPTELTPPTGLTPPTEPTPPAERALGTGLTAPAALAPPAERASGA
FT                   ATPQGGAGAWGPEAARRRARFEALVDPAPAGVLRGVSAPYHLADFTALRHLHEVLPYVR
FT                   LIALLRDPAARAHAHWLRMRASGLEPIVDFEAALAAEAERACTLSSWPWRYLALGRYGA
FT                   QVQRLYTLFARQQVLLVPYPELSTDPARALGHVHRFLGLGRHRDPAGVDRAYRPAEVPV
FT                   ERCGDLVAPGCAEPAVAAAARRLDPAVAARLHAGFGADLDLLDQVTGRRWALRPAPD"
FT   gene            complement(123037..123621)
FT                   /locus_tag="FRAAL0124"
FT   CDS_pept        complement(123037..123621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0124"
FT                   /product="putative chitin-binding protein (partial match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58805.1"
FT                   /translation="MTQSKVAPRHGTVSEPASRAHIYLAEWQSAGLESGKFFPATQAGL
FT                   ADPFAADDVRNDSPPADGKIASAGQDFAAELDKPGSDWQKHSVAAGQQLTITWSFHAPH
FT                   KTRRWNYFLTREGWDPNAPLSRAQFEPNPFHQVQNSGQPYWSADDLVPANPTRHTIELP
FT                   QRQGYHVLLSVWEVADTPKGFYQVIDLSFTG"
FT   gene            123828..124115
FT                   /locus_tag="FRAAL0125"
FT   CDS_pept        123828..124115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0125"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUD6"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58806.1"
FT                   /translation="MSASANSDPAAGIAAGPASTDPPAPQPLPYDGVVSVAVGTVLWAV
FT                   AALVMLVFLGDLRDDGHLWWLATAICGFGLGLAGLWIVIRRRNRLRGRQG"
FT   gene            complement(124130..127813)
FT                   /locus_tag="FRAAL0126"
FT   CDS_pept        complement(124130..127813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0126"
FT                   /product="Putative heat shock protein, hsp90-family"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type mc : molecular chaperone"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58807.1"
FT                   /translation="MSVTAAHAAADVYGTAAIRRRVLDAWIASPARFREDANAEEDAAL
FT                   GAYHDRLVVELLQNAVDAAGEAGVPARVLLRLSTDPTAPQAGPGGLLEIANTGAALSAA
FT                   GVEALSTLRASTKRDSASVGRFGAGFAAVLAVTDEPAIVSRGGPDPSATGVAWSRTRVI
FT                   EAVTALAAPVTTPNGGDVTSGDVTNRDATNLGSPLDVPLGLDPLGDGDGDGVGDGQAGR
FT                   LGEELARREGAVPILRLPFTITTGPPPEGYDTVVRLPLRDGAAAALAQELLAGLDPTLP
FT                   LVLGGPGEIVVDVDGAVRTVTCHWLRGGRDGGRGATPAGSVGPAADTSVTERVEIADLN
FT                   GERWRGIARSGVIPAALLADRPVEERGRTGFTARVMVRDGGWPDDVARVLRAPQPTDEP
FT                   LSLPVLASVELPLDPSRRHTVGGPLRDRLTEELAAAAVLLAEYLGTGLEPGGRGEPGGQ
FT                   PPDPLAALTLVPTGLPLGEVDGRLRESLLRLLPDSALFPGALRGRDCSVADLGPATDAV
FT                   TELLRAPGPPADPAGQLDPPSPADAIAAGDAAAGTDAAAGGADLVAGLLPAAYAARRWR
FT                   TALDLLGVRRVDSAALVELLSGVTRPPDWWGRLYPLLVAAPDRDALGALPVPLAEIGTD
FT                   GPDAADALAAPASAGPTGDGLRTRMVTGPRGTLLPTADLDIVALVRSGLPLRVVHPDAC
FT                   AGSARDALRTLGALEGTPAGVLRDPAVREAVLDADPDDHPDDLLALAAAVLALVRDAGE
FT                   EHPAELGWLEDLLLPAADGEFTPAGELLVEGGPLDRVLAQDAPFSTLSPEVARAWPAQV
FT                   LERVGVLHSFGVLRTYDLPLDADEQILLDLDDSDVWVDDVAADDHGGAPGGSANLRRPP
FT                   AGGPPAPAMIGVFVAVRDLELVDPAAWPEALVELARPPLREAVFAPEPSYTRWWLARHA
FT                   VLPVAGTGRVLPPRELLLPAADPLLAGLFAPAAPLAGVDDEFLRHLGARLTLDDVLGDL
FT                   GAVMDLLDRLGDADRDVPWPAARTLYIAAVDAVAQVLATPDRSAGGERFDPPLTVRTPE
FT                   GVVPSGQAVVVDAPDLLGLLGTGRGALRLPLDRAAEVAHVLGVPLATEIAPCEIAADEA
FT                   DADEAGADEAGADGAGADGAGWGPDGPDGEPRRAPDGTPYRVHRPLLVEDLTGRSTRVP
FT                   WRVLGGIGGEVHVDADAGPDALARALAWRGGQWDRRHALAAELRDPAGAAFRAAEDDLD
FT                   ET"
FT   gene            127930..128742
FT                   /locus_tag="FRAAL0127"
FT   CDS_pept        127930..128742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RUD4"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58808.1"
FT                   /translation="MPARTRRLDPSAALPELAAAVVPQWERLAGAVADLTDGALAAPSV
FT                   LPGWTVGELVMHVGRSATALSTALAPVAVDGPATMPATATRPVAAVDYLTGTGARAEAI
FT                   ADTARALAARTGPAEMRAGLAGEVAAAAAALARVTDGDPVVATPGGPMLLTEFLRTRAV
FT                   EAVVHGLDLGVEPLRPALKVVTRLFAELFVHRVPGHTVELRVPPFAAVQVVEGPRHTRG
FT                   TPPNVVEAGPVAFVLLCAGRLAWADAVADGRISASGERADLSGHLPLL"
FT   gene            128904..130721
FT                   /gene="purC"
FT                   /locus_tag="FRAAL0128"
FT   CDS_pept        128904..130721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="FRAAL0128"
FT                   /product="Amidophosphoribosyltransferase precursor
FT                   (Glutamine phosphoribosylpyrophosphate amidotransferase)
FT                   (ATASE) (GPATase)"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /EC_number="2.4.2.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUD3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58809.1"
FT                   /translation="MDAVPRVTLRISPVSLTSRGVLVPDVAARFGATPAAGSELSDDPG
FT                   PRDACGVFGVWAPGEDVANLAYYGLYALQHRGQEAAGIAVGDGRTVVVFKELGLVAQVF
FT                   DEITLSSLSGHVAVGHTRYSTTGSSTWENAQPSYRTARFGGPIALGHNGNLTNIVELAR
FT                   GLGAGRDRLRATTDSDLITAMLADHPGPTLADAAMAVLPRLAGAFSLVFSDASTLYAAR
FT                   DPHGIHPLVLGRLDDHPDGAWIVASETAALDIVGATFVREVQPGEMIVIDADGVRSRSF
FT                   AEANPHGCLFEYVYLARPDTAIAGRSVHATRVDVGRQLAREAPVEADLVIPVPQSGVPA
FT                   AVGYAEQSGIPFGEGLVKNSYVGRTFIQPSQTIRQRGIRLKLNPLRDVIEGRRLVVVDD
FT                   SIVRGNTQRALVRMLREAGAAEVHIRISSPPVRWPCFYGIDFATRDELIASDAGVEEIR
FT                   ASLGADSLAYVSLEGLVAASHQPAGSLCRACFDGVYPVPLTESDKLGKHRLEPMAGAQT
FT                   TADMIAEAMRREVTLGMNGGDPSPDDHDDADLVDADLVDAAGLADAADLTDAADLTDVA
FT                   DLTDAADLTDGVDLTGSAQRRQPAGARPA"
FT   gene            130718..131944
FT                   /gene="purM"
FT                   /locus_tag="FRAAL0129"
FT   CDS_pept        130718..131944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="FRAAL0129"
FT                   /product="phosphoribosylaminoimidazole synthetase (AIR
FT                   synthetase)"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /EC_number="6.3.3.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUD2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58810.1"
FT                   /translation="MNGAERIPAEAAIPASTPSGASYRAAGVDVAAGDRAVELMRGHVA
FT                   RATRPEVVGSLGGFAGLFALDTARYRKPLLASSTDGVGTKIALARALDTHDTVGIDLVA
FT                   MVVDDLVVCGAEPLFLLDYIACGALVPARIAEIVSGIAAGCEQAGAALVGGETAEHPGL
FT                   MGSDDYDLAATGVGVVEADGVLGPERVRPGDVVVAMASSGIHSNGFSLVRHILFGPVDS
FT                   GQPGGVSETAAAGLRSYVPALGDTLGRSLLTPTRIYARDCLALAAAVEVHAFAHITGGG
FT                   LAANIARVIPAGLVATLDRASWAVPAIFGLLAERGAVAQSDMESTFNQGIGMVAVLPAD
FT                   VVPAALALLAEREVPSWVVGEIGAAADGNHPAGESDEREGAGVRQAAATGGPGVDAAPR
FT                   ARLIGRHPA"
FT   gene            132070..132306
FT                   /locus_tag="FRAAL0130"
FT   CDS_pept        132070..132306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0130"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58811.1"
FT                   /translation="MSPGPSRRRVSLQRAARASLVAGAPPAHVAAGEELAQPGHRTAPT
FT                   PAPTVHDTVRLLRSAALSVVARPRESGRVSTAA"
FT   gene            complement(132547..132753)
FT                   /locus_tag="FRAAL0131"
FT   CDS_pept        complement(132547..132753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58812.1"
FT                   /translation="MGRGRAKAKQTKVARELKYNSPNMDLDRLKADLGAGSTRENNSDD
FT                   AYVDDDYGYDAYADDEDDRRSSR"
FT   gene            complement(133108..134178)
FT                   /gene="vdh"
FT                   /locus_tag="FRAAL0132"
FT   CDS_pept        complement(133108..134178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vdh"
FT                   /locus_tag="FRAAL0132"
FT                   /product="Valine dehydrogenase (ValDH)"
FT                   /function="1.5.1.18 : Isoleucine/valine"
FT                   /EC_number="1.4.1.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8921870; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUC9"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58813.1"
FT                   /translation="MTSLFDAVRDHEQVLLCSDRRAGLRAIIAVYSTALGPSLGGTRFH
FT                   PYAADDDALADALALSRAMAYKAACAGLDLGGGKAVIIGDPARDKSEPLLRAFGRHIAS
FT                   LGGRYITACDVGTYVDDMDVIARETRWVTGRSPAHGGSGDSGVLTAYGVFEGMRAAARH
FT                   RWGTADLAGRRVGISGVGKVGRRLVGHLVEDGASVIAADVDPAALARLRAEFPTAQTVA
FT                   DPDELFDLELDVYSPCALGGVLDAETVGRLRAEIVCGGANNQLATPEIGGRLAEAGVLY
FT                   TPDFVVNAGGLIQVADEIEGYSPQRARARAARIFDTTAEVLRLAEDEGVTPTRAAERLA
FT                   ERRMAEVGRLRGLLLR"
FT   gene            134431..135324
FT                   /locus_tag="FRAAL0133"
FT   CDS_pept        134431..135324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0133"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58814.1"
FT                   /translation="MGRPPPARGRARGRTRSVGAEMAVVSPAAYLRVYEPLAAFPAAER
FT                   GRWQRYAAAGPPSRRAGSRRERAVALVATIRPTLDVADESAFVQWIDGLMFVCPWSTQL
FT                   RVWQAALEFRGLMPERVAEAFLPRRITEPAEIELDRWKARRPSLKVHVQTCTWMVPPPW
FT                   FLLFDPAERSLVTGDTAERSMIYRTTMSLARRRASRAVEAVETLRGGSSEAPAVEGIGD
FT                   LARWLGSFHPQSRVELDYDGLVDLLDDDMLRRDSSVEDIVEAVSALRRGRTDLAVEAYE
FT                   RVLMRWRPLQARESAS"
FT   gene            135534..135683
FT                   /locus_tag="FRAAL0134"
FT   CDS_pept        135534..135683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0134"
FT                   /product="Putative DNA-binding protein (partial)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUC7"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58815.1"
FT                   /translation="MFRVDPKTVTRWAKAGKLTSIRTLGGHRRYREAEVRALLKGVPSI
FT                   GGDI"
FT   gene            136268..137131
FT                   /locus_tag="FRAAL0135"
FT   CDS_pept        136268..137131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0135"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58816.1"
FT                   /translation="MPGFRPGVSAFRFTNSFDVQPLLALRLPGLPWGLGIGDASRGLCG
FT                   GMIFAVRDLFEAGLAAPPDVESPRRGSPLYGYLVRRLVASFDLPRGVARYYGLMRAADT
FT                   YPQPRRGVAWWPGTGRQDRRGSTSDPRGSTSDGPGSVPNRSGSVPGRPGGALGRLGVGR
FT                   RSLADEWPRIRLDLDSGRLAPIGVITVHSADPLKLGLNHQVLAYAYTQVDTAVTLRVYD
FT                   PNTPLERADDVTMSFDLADAGGDAGRVRITHSIAIGGRPVRAFFHSRYRWADPRPALRA
FT                   HVAGRP"
FT   gene            137250..137322
FT                   /locus_tag="FRAALtRNA2"
FT   tRNA            137250..137322
FT                   /locus_tag="FRAALtRNA2"
FT                   /product="tRNA-Glu"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(137459..137626)
FT                   /locus_tag="FRAAL0137"
FT   CDS_pept        complement(137459..137626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0137"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58817.1"
FT                   /translation="MADSDECGGDQEDNKIYVKCLDGEELRMRGRIEKTLGWKPAGLEQ
FT                   RGGPGEPDQT"
FT   gene            complement(137631..138053)
FT                   /locus_tag="FRAAL0138"
FT   CDS_pept        complement(137631..138053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0138"
FT                   /product="Hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58818.1"
FT                   /translation="MTGGSGTVADIRLNAVSRRPGFSKTRLRDALHEAGIDYLHLRALG
FT                   NPKHNREPFRTGRVDEGCRVYRQQIDHPDATQALDLLASRGREHPTAVLCVEHDESACH
FT                   RQVVLDLLPRLPNVAAGSVTGPRRSLGLSPSGSDHT"
FT   gene            complement(137956..138375)
FT                   /locus_tag="FRAAL0140"
FT   CDS_pept        complement(137956..138375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0140"
FT                   /product="Putative HTH-type transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RUC3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58819.1"
FT                   /translation="MPGRTREEDRPNVDAGRRLGAHIRTRREELNLSRAALAEAAGISP
FT                   VTLARIEQQRTVNPRLFTVAALAATFDTTLDDLLAAAMAPRAGQFVSVGYEGRTLDAFV
FT                   SYLLDWRVGHRRGHPPQRRQPSPWLQQDPPTRCPP"
FT   gene            complement(138428..138769)
FT                   /locus_tag="FRAAL0141"
FT   CDS_pept        complement(138428..138769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0141"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58820.1"
FT                   /translation="MIDQMRLGEPERSRESLEELPFKFRYRYYCQVSTCSGHRHSIIDW
FT                   EIGQAYRSWRARYGDEQVLGKIRQKWFKELASPKRDTYFMIGNAHQFPNSFMVLGVVWP
FT                   PARPQLSLF"
FT   gene            complement(138766..139257)
FT                   /locus_tag="FRAAL0142"
FT   CDS_pept        complement(138766..139257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0142"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58821.1"
FT                   /translation="MGHDGIAHHGRIRMTVLVTVKAYPTVSDKYGEAVCVAGIRTDVIP
FT                   HEWVRLFPVHFRDLPREQQFRKWEFIELEARRGSEDRRPESYRPILDTIQRGRFMETGK
FT                   DWAERRWHLEPFLQPSVCGPGGVHERRRADNTSLAVIEPREVFDFSVEPRPVGPRANVA
FT                   "
FT   gene            complement(139478..140227)
FT                   /locus_tag="FRAAL0143"
FT   CDS_pept        complement(139478..140227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0143"
FT                   /product="hypothetical protein; putative membrane protein;
FT                   putative permease of ABC transporter"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58822.1"
FT                   /translation="MLAAVVGVWYAVTYLALAPRRRFLLPPPHEVVTDGFGDWTTFHET
FT                   LRGLGATAKVALVGLAIAATLGMVFAVLMSQAGWVERSFYPWAVALQTIPILAIVPLIG
FT                   FWLGYGFWSRTVVCVLVALFPIITNTLFGLRSTDAEQHDLFTLRQAGRWARLVHLEFPS
FT                   ALPAVFTGLRISAGLSVIGAIVGDFFFRQGQPGIGSLIDDYTQRLQSAPLFAAIIVSSL
FT                   FGLALFWLFGLAARIAVGSWHTPRRRS"
FT   gene            complement(140329..140775)
FT                   /locus_tag="FRAAL0144"
FT   CDS_pept        complement(140329..140775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0144"
FT                   /product="Putative ABC-transport protein, ATP-binding
FT                   component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58823.1"
FT                   /translation="MPKKRRRELVAAAISLTELEGFERHRPTALSGGMRMRVSLARALT
FT                   VRPSLFLFDEPFGALDEITRQRLGEEVQRLHARERFAGLFVTHSVVEAVWLANRVVVLS
FT                   ARPGRVLAQVDVPFAYPRPADLRFDAAFGDVARTVSAALQESFT"
FT   gene            141420..142196
FT                   /locus_tag="FRAAL0146"
FT   CDS_pept        141420..142196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0146"
FT                   /product="Putative DNA-binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RUB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58825.1"
FT                   /translation="MDAGYSIRASDSKISRLELGRVSFKERDVADLLTLYGVTDERDRS
FT                   PLLELTRQANEPGWWQGFTDVVPGWFQPYLGLEEAAVLIRTYELQFIPGLLQTKDYARA
FT                   VMAGARQVDGADAVERRVQARISRQAILDRPDPPRVWAIIDEAALWRSVAGPAVMQGQL
FT                   EHLIALNANPNITIQVIPFNVGPHPAEGGAFSILRFGEPDITDVVYLEHLTGAVYLDKP
FT                   DDVTRYTLAMDNLVLKSTTPDDTAKVIEKIASQHVA"
FT   gene            complement(142224..143021)
FT                   /locus_tag="FRAAL0147"
FT   CDS_pept        complement(142224..143021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0147"
FT                   /product="conserved hypothetical protein; putative
FT                   S-adenosyl-L-methionine-dependent methyltransferase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58826.1"
FT                   /translation="MSDASTPVVDITVPHSARVWNYWLGGKDHYPVDREFGDRLYELLP
FT                   EIVQIARQARAFLGRAVTYLAGEVGIRQFLDIGTGLPTADNTHEVAQRIVPDSRIVYVD
FT                   HDPLVLAHARALLVGTPEGATNYVDADVREPKKILQAARETLDFTQPIGLIMLGIMGNV
FT                   ADLDEAYAIVRELCESLPAGSYLVFKDGTYAVMGEDRADAIHDLHEHESFPYHMRTPEQ
FT                   VARFLDGFELVEPGLVSTPLWRPGPSAEPPRAIDDLCGVGRKP"
FT   gene            complement(143133..144206)
FT                   /locus_tag="FRAAL0148"
FT   CDS_pept        complement(143133..144206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0148"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUB6"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58827.1"
FT                   /translation="MSPSATGSAAESSYATPLKGICPSTVVIQANWWPGLPDGYLYQLL
FT                   GPNPTIDVSKNRVEGPLGATGVRLQVRAGGPATGFQPVTSLLAQDDSILAGYVGTDEAV
FT                   QASGGRPPVAVFAPYEKSPLALIWGNPAWNFTNVAEIRQSGATVLASASGTSFPDVFVR
FT                   EGSLTKSQVDTSYQGSPDRFVAADGKIVQQAFVTNEPYLLQHDVKAWGKPVKHLLLQDE
FT                   YPAYISALAVRPDKLSTQRACLAKLVPLLQRAQRDYVANPAPVNQLLLKVVSTLHTGGF
FT                   TLSSGLLAYGNATQKQLGLIADGSDGVLGSFDTARVGKLIGRLVPVFTAKGSTPKAGLV
FT                   PSDLVTNEFLDKTVALK"
FT   gene            complement(144323..144637)
FT                   /locus_tag="FRAAL0149"
FT   CDS_pept        complement(144323..144637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0149"
FT                   /product="Putative transposase"
FT                   /function="2.1.3 : DNA recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58828.1"
FT                   /translation="MTGLVAADSEFWFDNHWSSDATTVPGGMSRPTVRHVELAGSGYGY
FT                   CASNSRFCRGLKLYGELAPRAIPPSAVWNPDDGRRLPAVMSGASQARRSHRGCPHLSQC
FT                   "
FT   gene            complement(145090..145392)
FT                   /locus_tag="FRAAL0150"
FT   CDS_pept        complement(145090..145392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0150"
FT                   /product="Putative dehydrogenase; putative signal peptide"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58829.1"
FT                   /translation="MYDIFDPATGSSSQPGALASKVLVSLSSDTPDASREASDWASQAQ
FT                   SEPRDRRRDGARSHRGRPRGIRLPKAVKAHYDQAIAAGRDTENWTVLYEMPKAGY"
FT   gene            complement(145403..145675)
FT                   /locus_tag="FRAAL0151"
FT   CDS_pept        complement(145403..145675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0151"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58830.1"
FT                   /translation="MTRIRARPRRRALPVSTGTGQQSLEFTEAASASLVTASLDQGVNV
FT                   EVLRPVLDIVRRQIAADDLVAGGRHADAHADSRRCRQRADHPQPH"
FT   gene            145888..146715
FT                   /locus_tag="FRAAL0152"
FT   CDS_pept        145888..146715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0152"
FT                   /product="conserved hypothetical protein; putative
FT                   S-adenosyl-L-methionine-dependent methyltransferase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58831.1"
FT                   /translation="MCDRWYMMSDMGADEQAQSAWSRVDTSVPHSARVWNYWLGGKDNF
FT                   PADRELGDKVFEVYPDIVHVARAQREFLVRAITFLAGEVGIRQFLDIGTGLPTADNTHE
FT                   VAQRIAADSRIVYVDNDPLVLVHARALLTSAPGGATAYVDADVRDPDTILAQAAELLDF
FT                   SQPIALVMFGIVGNVADNDEASAIVKRLLDGVQPGSYLALNDGTHGEDVDKAIEITQAD
FT                   GHPYNLRTPEQVTSFFDGLELAEPGVVSTPLWRPAPGPAPQPLHIFGGVGRKP"
FT   gene            146785..147303
FT                   /locus_tag="FRAAL0153"
FT   CDS_pept        146785..147303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0153"
FT                   /product="Putative RNA polymerase ECF-subfamily sigma
FT                   factor"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type f : factor"
FT                   /db_xref="GOA:Q0RUB1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58832.1"
FT                   /translation="MGRVRRSPGMGREPFEVVVERYGPMVLRVCWAVVGPMLAEDAWSE
FT                   TFLAALRAYPELAPGSNVEAWLVTIARNKAIDQLRAQSRRPAPTERLPETIRWEERDAG
FT                   LDLWDALRRLPRKQRETVAYHFLAGLPYTEVARLLGGNPASARRAGADGIASLRSMLLG
FT                   PSAQEERSR"
FT   gene            147300..147914
FT                   /gene="ada"
FT                   /locus_tag="FRAAL0154"
FT   CDS_pept        147300..147914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="FRAAL0154"
FT                   /product="Methylated-DNA--protein-cysteine
FT                   methyltransferase (6-O-methylguanine-DNA methyltransferase)
FT                   (O-6-methylguanine-DNA-alkyltransferase)"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUB0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58833.1"
FT                   /translation="MTGQDSPEFDPLATVLGAEVDLSRLRLRLLAEAERDGLLDVVYRT
FT                   VDAPVGRLLLVATRRGLVRVAYEVEGHDTVLATLAERISPRLLKAGGRLDAVAGQLDDY
FT                   FSRVRYRFDVDLDLRLASRFRLTVLEHLREIPYGGTASYAAVAALAGSPRAVRAVGTAC
FT                   ATNPLPVVIPCHRVVRSDGGIGRYVGGDDAKRTLLRLEGAI"
FT   gene            148083..148817
FT                   /locus_tag="FRAAL0155"
FT   CDS_pept        148083..148817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0155"
FT                   /product="putative short chain oxidoreductase"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUA9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58834.1"
FT                   /translation="MSVALVTGSNRGLGFATAQALGRLGHRVIVTARDQASADKVAADL
FT                   RTTGYDAEGLMLDVTSPDSVEAAANRVLELDGRLDILVNNAGVLPEATDGEQHEFASLR
FT                   LFKETYATNVFGPVAVTEAFLPLLRRSQAGRIVNVSTTMGSLHDQADSASPYYSMVVPA
FT                   YQSSKAALNSVTIALAKKLADTPIKVTSVCPGFVQTDLTPVNREQAPLTAEQASEVVVR
FT                   AATLPADAASGTFFDRRGAVAW"
FT   gene            148972..152301
FT                   /locus_tag="FRAAL0156"
FT   CDS_pept        148972..152301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0156"
FT                   /product="putative NAD-specific glutamate dehydrogenase
FT                   (NAD-GDH)"
FT                   /function="1.5.1.1 : Glutamate"
FT                   /EC_number="1.4.1.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUA8"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58835.1"
FT                   /translation="MGGADSAPASGRPAAADEARAALATQGAPGLAVRRVDGSCPLALW
FT                   LAWRGAGPPLADVVPMLANLGLRAEDQHPLESAGLGDGCITGETVSVDEYRILGPPELA
FT                   TQALAQVGELGETLRAIWAGRADSDPLDRLVLTAGLAAGEVALLRALLRYLLHAGLPLS
FT                   EAYAHRMLTARASIARDLVALFHARMRPGAEGPAGAADLAASLDRDLDTVAGVDEDLLL
FT                   TRLRDVVLAVVRTTYYLPGEALAVKLDPGRLRWLPRPLPAAEVFVSTARFDALHLRAGL
FT                   VARGGIRWSDRTEDLRAEIAGLMKAQRVKNALIVPDGAKGGYVLRRPPDDPRQREAEGR
FT                   ACYTAFIRALLALTDNRADGVTVRRPGLVCHDGEDSYLVVAADKGTARFSDLANAIAVE
FT                   SGYWLGDAFASGGRTGYDHKALGITARGVWESVRRHFAELGVDADGEPITVVGIGDMSG
FT                   DVFGNGLLQSDQLRLVAAFDHRHLFLDPDPDPGRSYAQRRRLAALPTSSWDDYDRSALS
FT                   AGGGVFPLSARRVPLSPQIRARLRVDAECLTVDELIRSILRAPVDLLWNGGIGTWVKAS
FT                   REDHHAVGDKARDRCRVDASELRARVVAEGGNLGLTEPARVEYCLAGGRCNTDFIDNSA
FT                   GVDCSDREVNLKIGLAAAGRVPGPIGGSSPGAGPVDPSGRDDLLAAATDEVVQLVLADS
FT                   ARQVLSLSVSERQAAESVEGMARLTGHLVSAGILDPSVDPVPDQEVMRARMGRGPVLTR
FT                   PEIAILHAYGKREVVGELVGSDLLAEPATAEALDAYLPATLRPLIGPRFDRHPLWRAIA
FT                   ASQLANDLVDRVGAGFLFRLEELTGALPVDGVRAFLITRDLFGLAWVWEAVDGHHQPAA
FT                   GTPSRARRRGDVPGGDRVDAAVEALLQCRMLQEYAAQWLLRRRPRPLDLTAETMRYYDG
FT                   VSEVAMALPETLRRLGAREELDAIETVRRRLLGAGLPLRAAEQVARLKVMVNALDIVDV
FT                   ALQHDIAVTEVLTEYFDLGVRLGLGRLTTRIVDRPGDSYWETMAKASLRSKLASSHARL
FT                   VEALLARAGGDLDTAVRRAARSGGVGRVRAVVDEVEEASEVTSAMVAAVVLRLDDLADL
FT                   VS"
FT   gene            152379..153347
FT                   /locus_tag="FRAAL0157"
FT   CDS_pept        152379..153347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0157"
FT                   /product="putative integral membrane protein; putative
FT                   transcription factor"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58836.1"
FT                   /translation="MFVAYLSAFACAVCYGVGSILQSVGARRTATTAGALDPRLLVRLA
FT                   TQAPYLAGMGLDLIGWLLSLVAVRALPLFAVQAILVASVGVTAVLARVFLGLRLRRAQV
FT                   GTLVVLGLGVVLLAVTAAPGKPRPVGSTAAVLIALGILPTALGCLWAGRALSEGRAVLA
FT                   LGGLSGLAFGGTALCARALEADHTLVDVVADPLSWALLVYGVVGMVAFAAALQRGSVTI
FT                   AMAGQATAETVAPALIGLTLLGDHARSGSGSVAATGFVLTVLAAAWLAAHSHVEPAEVA
FT                   AGLPSEAVGPDVPTAPAAAPAAAPAPAAAQSQTWRRTDRRR"
FT   gene            153451..154317
FT                   /locus_tag="FRAAL0158"
FT   CDS_pept        153451..154317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0158"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58837.1"
FT                   /translation="MLRSGWYPPEVTTAEQRLRYYARQFPLVEVDATYYAPPAEQTVRM
FT                   WAARTPPGFTFNIKAFSLLTGHPTRPGALYSDLRGLVPADRKNLYLKDVDTGVVDQVWE
FT                   RFLAALDPLAEAGKLGAVLFQFPQWFPISAANKRYILECQQRCRPLRICVEFRNHTWMD
FT                   GRNRDETLDFLTSYALPYVCVDMPQGHPSSVPPVLAATADLAVVRFHGHSEKWTSRDIH
FT                   ERFGYRYSEEELQDWAPKLRRLADAAARTQVLMNNCCADYAQRNARQLADLLAALDGAN
FT                   PVVAEGR"
FT   gene            complement(154347..154592)
FT                   /locus_tag="FRAAL0159"
FT   CDS_pept        complement(154347..154592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0159"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58838.1"
FT                   /translation="MLSSTVYNEIVDEPTVLVALVVEHATGEGFCVDLGGGLWAVMGLV
FT                   TFVAKAGLVACLRSVDTQALTSANTMLFKILATPER"
FT   gene            complement(154655..154915)
FT                   /locus_tag="FRAAL0160"
FT   CDS_pept        complement(154655..154915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0160"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RUA4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58839.1"
FT                   /translation="MSRTITLRLSDEAYESVRRYAEADQTSMNAWIEGVLDAEDMRRRC
FT                   AAHGAWLRADPAVAQAALAFGEANQQDLAATGHPGLTDTAP"
FT   gene            155119..155913
FT                   /locus_tag="FRAAL0161"
FT   CDS_pept        155119..155913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0161"
FT                   /product="putative dioxygenase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUA3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58840.1"
FT                   /translation="MPAIYATQGAPPLIDHPHWTAELAAWGRALPRPRAILVISAHWEQ
FT                   NPIAYGATTTPVPLYYDFYGFPERFYQLRYPAPGAPDLVAEVARLLGPGQPLVAQPDRG
FT                   LDHGAFIPLIYMYPDADVPVLQISLPTEDPVGLLELGRRLAPLRDDGVLIFATGLLTHS
FT                   TGHADLSNPDSSPHPDVAAFDAWVADALGRGDLDALVHYRDRAPGVRRALPSQEHFVPL
FT                   FVALGAALDTPGPVIFPHHGFWYGNSMRSVQFGAAATADVPA"
FT   gene            complement(156046..157254)
FT                   /locus_tag="FRAAL0162"
FT   CDS_pept        complement(156046..157254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0162"
FT                   /product="putative integral membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58841.1"
FT                   /translation="MSSGTNAAINFIIARRVDSSEFGAFAIAYTIFAMIVGLARAAGTA
FT                   PLGISYADVPATTFRSAVRAAAGTALALGVVVGVGLLVVGAALRGAVGLNLVAMGVIMP
FT                   ALLVQDAWRYASFAQGRPLLAVGNDLVWAAGLAVGVGLLAAGSDTGGGAAAMVLVWGAA
FT                   AALAALVGVAQHHAWPDPRRALAWFTGHRETTGFMTAEFISLQGAQQTSTLVIGAVGST
FT                   SLVGALRGLQTLLAPTTNLAVALMSFAIPEFARRKHMPPGQVIRGAYLVSGLVVVSSSL
FT                   WGLAFMLLPADFGAALLGDTWGQTHDLLLLAVVAQVGPGLAVGPAAVLYAFGKTRLTFW
FT                   INLFFVPFLLACPVTGLLVGGARGVVIGNIIVFWATIPPWLYYLHRQVRTAGGAHAEAT
FT                   GPR"
FT   gene            complement(157689..158666)
FT                   /locus_tag="FRAAL0163"
FT   CDS_pept        complement(157689..158666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0163"
FT                   /product="Manganese ABC transporter"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RUA1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58842.1"
FT                   /translation="MSALRSEDPVPVIPTPTRLAAGVAGLALLAALLAGCGSSSAGSGN
FT                   AGAGGRLPVVATTSQVADFTRVVGGDRVRVAQLLKPNVDPHDYEPTPADIEAVADAKVL
FT                   VENGVGLESWLDDAVGAAGFDGIRVDASRGVTIRAGSGDEEKAGDPHIWHNPLNAKIMV
FT                   ADIERGLAQADPANAGYFHANRIIYDKKLDVLDGDIRRQIATIPPADRKLVTNHDAFGY
FT                   YIERYGLTFVGSIIPSFDTAAELSGSNIRTIVDRIRRTGTKAVFSESSLPPRTARTIAT
FT                   EAGVRVEAGEDSLYGDSLGPAGSDGSTYLQMEEHNTRVIVAALR"
FT   gene            complement(158747..159802)
FT                   /locus_tag="FRAAL0164"
FT   CDS_pept        complement(158747..159802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0164"
FT                   /product="Peptidyl-arginine deiminase"
FT                   /function="1.1.3.3 : Arginine catabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RUA0"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58843.1"
FT                   /translation="MMTAVPPAPAARRMPAEWEPHARTWMAFPPPNDTFGAQGSPGLAA
FT                   ARSAWARVATTISRHEPVTLIAGPDQGATAARLVPPAVTVIELALDDAWMRDSGPTFTI
FT                   DGDGHLGAVDWVFNGWGAQDWARWDADRLLATAVAARAGAVARHSALTNEGGGIAVDGA
FT                   GTVLLTETVQLDPHRNPGWDRARVEAELHAQLGTTRAIWLPRGLARDYDRFGTRGHVDV
FT                   VAAFVRPGLVAVHSQPDPAHPDHATTRELAALLRASHDAAGRPLEVVEIAAPTVLEVDG
FT                   GPAGYSYLNYYVANGLVVAGVFDDPRDADALDLLARLYPTRRVEPVDARVIFGHGGGIH
FT                   CITQQQPQVLR"
FT   gene            159976..161013
FT                   /locus_tag="FRAAL0165"
FT   CDS_pept        159976..161013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0165"
FT                   /product="Beta-ureidopropionase (Beta-alanine synthase)
FT                   (N-carbamoyl-beta-alanine amidohydrolase)"
FT                   /function="1.2.2 : DNA"
FT                   /EC_number="3.5.1.6"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU99"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58844.1"
FT                   /translation="MLTITSIGVPGSPARVAPPTRAPLRIAAVQHRWHPDPAEHAAALR
FT                   AGAVAAAELGARLVCFQELTLSRYFADVPPEGQPPTDRGPDVRVPDGRLPAVGARPAGG
FT                   GTWPAALAESVDDGPTRTLAAGLAAELGVAVHMSLYERADGPDGLGFNTAIVVGPDGAL
FT                   LARTRKMHIPVTAGYHEDRYFRPGPAGADSFPVVELQQGRFGFPTCWDQWFPELARAYS
FT                   LAGADVLVYPTAIGSEPDHPGFDTEPLWHNVIVGNGIANGTFMVTINRVGTEGALTFYG
FT                   SSFISDPYGRVLVRAPRDVPAVLVADLDLDQRRDWLALFPFLATRRPDAYAGLAEPGAG
FT                   GVDGR"
FT   gene            161099..161782
FT                   /locus_tag="FRAAL0166"
FT   CDS_pept        161099..161782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0166"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58845.1"
FT                   /translation="MEASAGPVARGLRAGVFGAVCVALGVVAHVAAHGAAPAPWALLAG
FT                   LVAVTVVSGVCAGPAPSLPLVVGLMAATQAGLHAAFGAWPGAASGPDLSRLLCAAPGAH
FT                   ATAATALLRREGLLATVGGAAPHPALMPAMAHGGGLLAMSGAHLLVAGLTAWWLRRLDA
FT                   AVGVTGALVGVLARGLCRLLGSPAAPAPVGIARRRPRPAMPPAGWPRPAGLRHSVVRRG
FT                   PPQVC"
FT   gene            162045..162266
FT                   /locus_tag="FRAAL0167"
FT   CDS_pept        162045..162266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0167"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58846.1"
FT                   /translation="MTKGAVRPVGIPSAEATPAPPRHPRTCVPDRADGAGTGRHALTPG
FT                   VPMPDGVPLRDNLRDNAHDLPLLLGSAA"
FT   gene            162407..163720
FT                   /locus_tag="FRAAL0168"
FT   CDS_pept        162407..163720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0168"
FT                   /product="hypothetical protein; putative signal peptide;
FT                   putative Dyp-type peroxidase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU96"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58847.1"
FT                   /translation="MLAGAGLFGLGAGAGTGVTVGTQRLVPERADPVGAVRRAVLAPVA
FT                   GDGVHQPGIAARAPAHLVFTAYDLTATDPVAARAALGAVLRAWTDGGQTLMRGASQGGL
FT                   PQGGLPQGGVSQGGVVGSGVVRSGAAGMGREAAGLGPAGLTVTVGIGAAGLRRAGLDAR
FT                   IPGPLADIPALPGDRLEAARGGGDLAVQVCAEDPMVAFAAARQLGRLAAGLVRPRWVQR
FT                   GFQRTAAAAADPTATPRNLMGQLDGTNNPRPGSAQFDLAVWAAGGPAWMRGGTYLVCRR
FT                   IRMLLESWERLTEDARGEVVGRRIDDGAPLSAPPAAAGGGEDTASDFAARGPDGRPLIA
FT                   DNAHIRLSNPQFHGGVAMFRRGYSYDDGLDAAGEPDAGLFFLAFQADPRTSFVPVQRTL
FT                   AASDALNTFIRHTASALFAVPPAPPAGGYLGQSLLEEA"
FT   gene            complement(163780..164418)
FT                   /locus_tag="FRAAL0169"
FT   CDS_pept        complement(163780..164418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0169"
FT                   /product="hypothetical protein; putative
FT                   Esterase/acetylhydrolase domains"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58848.1"
FT                   /translation="MILGGRSGGGGSRQPALVVGDSMVTVAARSTDTAPVRLVGYSGLT
FT                   PGVYADATSPLISDDLAAAGRPRTVVLNWNGNNPGNLDGTQLVATYRTELTDQIRWYLR
FT                   HGVRRIVLAAAVPSSFNSTSGQVDWTTPASRLHGWMLGSARLNDLYRELADEFPGRVHY
FT                   SERAARAIHPAMAFNTELNGHRCIVDFVHPAPYCAQRYARALVSLAAGH"
FT   gene            complement(164784..166976)
FT                   /locus_tag="FRAAL0170"
FT   CDS_pept        complement(164784..166976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0170"
FT                   /product="putative integral membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU94"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58849.1"
FT                   /translation="MRRLDVSAAAVRRVRAWTALALAVAMVCWPVAVVALTTNLTVQRA
FT                   AYYRQAVDETDLYRRLYDEVLADPALAGVTRDLLAGLPVPPDVVVDNLRLVAPAAAVRG
FT                   AVDSLSAQISGYLAGQRPALTLSVDLRPTFAAIAKLATIYLAGQVSGTPTFQAHDVAAV
FT                   TQVLVGGLDQMAQGRRPAGIPTMDLTGEQADQIGSVLLARLPDAERARVGGQVVGLLRQ
FT                   GKVPAALAVVGPLLFQGDEAALADLRRRLAGDQLDLGTPLARAHESAGVGLLHVLHDLG
FT                   RYGTVTVGALFAAVAVLAVLLAARRARCRRGDTILLVAGGMVVGGAAALLLGLLLPTLV
FT                   GDPTAGVVGANPTLPLRARDLLHDLQANMIGSIRTVWSQVAAGVALAGCLLGLVGLFVR
FT                   RRRRPFTRRRSVVMAASAAVLLSCSWLVTPARFGGEAASCNGGRGLCGLRYDEAVYAAS
FT                   HNAMASSAADFVGATQDPDLVGQLDTGVRALLLDVQHWTTPTQVETFLAGLRPRERDAL
FT                   APLARGARSARPGLWLCHSVCQFGSVNLEDALRSVDDWLARNPSEVVTLILQDSVPPGE
FT                   VIAAFRRVGLLHRIVTPPADPHGRWPTLGHLVATDRRLVVFAENADVPKTWYRRFFRYG
FT                   ADTPFDVPSPAGFTCRVGRGSRTAPMLLVNHWVEGDDPGRTYADSVNREPALLAHLRRC
FT                   ERAGLTPTFVATDFTTIGDLVPTVAALNARRSQSPR"
FT   gene            complement(167089..167523)
FT                   /locus_tag="FRAAL0171"
FT   CDS_pept        complement(167089..167523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0171"
FT                   /product="conserved hypothetical protein; putative
FT                   cyclase/dehydrase domains"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58850.1"
FT                   /translation="MADHVSSTIVIKAQPAAILAVIADISRYPDWSEPVKSAEVIETTP
FT                   AGLPAKARFQAKTTFGKEDYALVYDWVGPNSVTWTMLESDRVRTLDGSYTLTDLGDGST
FT                   EVTYDLTVELKVPIPGLLRRKAEDKLVESALYDLKTQVER"
FT   gene            complement(167874..171476)
FT                   /gene="metH"
FT                   /locus_tag="FRAAL0172"
FT   CDS_pept        complement(167874..171476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="FRAAL0172"
FT                   /product="B12-dependent
FT                   homocysteine-N5-methyltetrahydrofolate transmethylase"
FT                   /function="1.5.1.9 : Methionine"
FT                   /function="1.5.3.13 : Cobalamin (Vitamin B12)"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /function="1.7.20 : S-adenosyl methionine biosynthesis"
FT                   /EC_number="2.1.1.13"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8369296; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU92"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58851.1"
FT                   /translation="MVVLDGAWGTMLQNAGLTPADYQLDSLRDHPKDVTGDPDLLNLTR
FT                   PDIILDVHRQYLAAGADITTTNTFTATSIGQADYGLESLVREMNLRGAQLARQAADEAG
FT                   GRFVAGSIGPLNVTLSLSPRVEDPAYRAVTFDQVRAAYAEQIQALADGGVDLLLIETIF
FT                   DTLNAKAAIAAAREVAPQLPLWISVTIVDLSGRTLSGQTVEAFWDSIAHANPLVVGVNC
FT                   SLGAEEMRPHVEALARIAGTYTACHPNAGLPNAFGGYDQTPEEAGRLIGEFAAAGMVNI
FT                   VGGCCGTTPAHIARIAAAVDGTAPRQVPTPTPRTRFSGLEPFEIGEDTGFVMIGERTNV
FT                   TGSARFRRLVEADDYQAAVDVALEQVRGGANLLDVNMDADLLDSEQAMTTFLNLLATEP
FT                   EAARLPIMIDSSRWSVLEAGLRCVQGKGVVNSISLKEGEEVFLDHARRIRDFGAGVVVM
FT                   AFDEQGQADTTERKVAICGRAYDLLTGKLGFPATDIIFDPNVLAVATGIPEHNGYAKAF
FT                   IDALPLIKQRCPGVRISGGISNLSFSFRGNDVVREAMHSAFLLHAVRAGLDMGIVNAGQ
FT                   LAVYADIPAELLELVEDVLFDRREDATDRLVAFAETVSGKGTQRVVDLSWREAPVAARL
FT                   SHALVHGIVDFIEADTEEARAAAARPLDVIEGPLMDGMKIVGDLFGSGKMFLPQVVKSA
FT                   RVMKRSVAYLEPFMEAEKAQAALDDSAAGRPAARRGNGKVVLATVKGDVHDIGKNIVGV
FT                   VLGCNNYEVIDLGVMVPAKVILDTAVAEGADAVGLSGLITPSLDEMVAVGAEMQRRGLR
FT                   LPLLIGGATTSRQHTAVRIAPVYEATTVHVLDASRVVGVVSDLLDAERAEQLDVRNRAE
FT                   QARLREQHENRRAQPLLGLEQARANREQVSFDELPVPAFTGRRIVTPDLTALREMIDWQ
FT                   FFFLAWELKGKFPAILDEPVARELFDEANVLLDQIIKDGSLQAKGVYGFWPAFADGDDL
FT                   VIEAGEVAGARDGVLRLPMLRQQTTKPTGRPNRSLADYVAPAGDHLGGFAVAVHGADTL
FT                   AAEFEARQDDYRSIMVKALADRLAEAFAEYIHLAARREWFEPDAEPSLADLHAERFRGI
FT                   RPALGYPASPDHSEKQALFDLLDAGQAGLGLTESFAMTPASAVSGIIFAHPESKYFTVG
FT                   RIGRDQVEDYARRRGLGVGDVERWLRPNLAYDPA"
FT   gene            171732..172211
FT                   /locus_tag="FRAAL0173"
FT   CDS_pept        171732..172211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0173"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR021412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58852.1"
FT                   /translation="MGSGIVGRAGYSGTPLARKLGVKPGHRLVILAAPPGWAVPELPEG
FT                   VEPVHIPDLRTDGTDGTATGDGGDGGGLAAIDVCVAFCRREVDVHAAVAAVAEAIRPAG
FT                   ALWIAWPRRAAGHRSDVSENLIREVALPRGLVDTKVAALDENWSGLKVVWRREHR"
FT   gene            complement(172320..173051)
FT                   /locus_tag="FRAAL0174"
FT   CDS_pept        complement(172320..173051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0174"
FT                   /product="Putative phosphoglycerate mutase 2 protein"
FT                   /EC_number="5.4.2.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU90"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58853.1"
FT                   /translation="MSVGGLVAELTAVRHGQSVANVAFPAARAAGRLDAGVSGRDADVE
FT                   LTPLGRAQAAALGRALAAEPPIIRPPEVVVCSPYLRARRTYEIAAEAAARGGLALPEPV
FT                   IDDRLVDRLMGRFELMTRAAIDARFPAEAERRRASGQWDYRPPGGENFPDIARRLGALL
FT                   TDLHHDHADRRVLIVAHDAVVVMLRQLVEGLSYDELGRIAAEGGIRNAGITRFTRDGDQ
FT                   LTLAEFNTATHLAGVSADGAA"
FT   gene            complement(173059..173580)
FT                   /locus_tag="FRAAL0175"
FT   CDS_pept        complement(173059..173580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0175"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RU89"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58854.1"
FT                   /translation="MFSELGLSATVPDVAARAGVGKATVYRNFPSRDELLTAVVERQLQ
FT                   WFDTIATTALHDPDPATGFEMLITSWFDRLVANRLVQDVMRLRTLASAEIQIDRITTLV
FT                   DRVVVRAQRAGAVRLDVTPADLRTMMSGCAQRLVETGQQDIDSRLRFTRLILDAFRPPA
FT                   TAATPAVPAA"
FT   gene            complement(173759..175267)
FT                   /locus_tag="FRAAL0176"
FT   CDS_pept        complement(173759..175267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0176"
FT                   /product="putative membrane transport protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RU88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58855.1"
FT                   /translation="MSVVEPRPKPGRTLTVLLLAAMSFALAQTTVAPAIPDMARELDSS
FT                   VSNVTWTMSGYLVAAAVLTPIIGRLGDMFGKRRMLVMSLAIFALGGVVAALAAQLPLVI
FT                   VGRILQGAGGGIFPLCFGIIRDEFPVEKRSVSIGLISAVTGLGGGLGLVLGGLFVDHAT
FT                   YHWIFWSGAAMAALAAVGSQLLIPESPTRVPGRIDVVGTLLLSVGLALPLLAISQGKSW
FT                   GWTSPTTLGMIIGGIVVLAGLLAFERRQAEPLIDVAILARRSVLTTNVSTLLVGFGMFG
FT                   AFLLIPQLAQTPKASGYGFGASATTAGLLMVPGALMMLVTGPLATVISRRFGGRAALFT
FT                   GSLLATVGLVLLAGVPGSQGALIVECIVLFGGIGMVFAAIPNLIVDAVPAAKTGEATGV
FT                   NTLLRSVGASLGSQICASILVSQADATGLPTSDAYQTAFVVSAVVALVAGLAALTLPGL
FT                   RHGRHEAQPTEVAATPRVATIPAQGATAVDAARANAVAPAASGG"
FT   gene            complement(175624..177327)
FT                   /locus_tag="FRAAL0177"
FT   CDS_pept        complement(175624..177327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0177"
FT                   /product="Putative transcriptional regulator (GntR-family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /function="3.1.2.3 : Repressor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RU87"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58856.1"
FT                   /translation="MESARGPAISVRHPPRGDARGKLAAQVAWRIEDDIVRAGWPVGTV
FT                   IGSEPTLIERYKVSRAVFREAVRIVEHHQVATMRRGPSGGLIVRAPDEVAVTTALGVYL
FT                   EYVGVTIESILRARFIIESLAASLAPARITEDGIRTLREIIARRETADPTEFGSHHQLH
FT                   HAIAAATGNPVLVLFVDVLNSLTFRYAAHQYATTRSSASPARRAQVAEEVHRNHAAIAE
FT                   AVIGGDAARAQHLAAVHLEAMYEWMTTPIAADGPDRAGSEGTATNRDTATNRDTAANGR
FT                   VATQGGTGAPEGTATGEGGAAGEGGASVRAGGRRIRPGEPGLGSGPGPGGTMPAGKLAE
FT                   TVAGRIRDDVARDGIPVGVVIGSESDLLARYGVSRAVLREAVRLLEYHSVAQMRRGPGG
FT                   GLVVTEPDPAATVEATALYLEYSQASVDDLRIVRDALELSCVDVLIERRGPELTARLEE
FT                   LLVADACEVPGGPADAGHHLHMELARLTGNEALASFVRVLTAIWRRHVDGSRPAPAIGD
FT                   GEAAAGGCGQAVREARTAHRAIIDAIIAGDRGLARHRMRRHLEAVSDWSR"
FT   gene            177989..178063
FT                   /locus_tag="FRAALtRNA3"
FT   tRNA            177989..178063
FT                   /locus_tag="FRAALtRNA3"
FT                   /product="tRNA-Asp"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            178115..178191
FT                   /locus_tag="FRAALtRNA4"
FT   tRNA            178115..178191
FT                   /locus_tag="FRAALtRNA4"
FT                   /product="tRNA-Phe"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(178531..178674)
FT                   /locus_tag="FRAAL0180"
FT   CDS_pept        complement(178531..178674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0180"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58858.1"
FT                   /translation="MFERLEIVYTTLFERAPALALAVPEAELTYKYHSIQALGPAEMPI
FT                   TW"
FT   gene            complement(178590..178976)
FT                   /locus_tag="FRAAL0181"
FT   CDS_pept        complement(178590..178976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0181"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58859.1"
FT                   /translation="MRAATARTTVASAQVPQVPQVPVFHTVDVTATMELLDQLRELPEF
FT                   AELRSPCGYGGRSVEVDRVVGVVRAVRFRQRGEIKEAAAAVAELCGEFGRVRGNQRCSN
FT                   GWRSSTRHYSSGLPRSRWRCPRRS"
FT   gene            179081..180004
FT                   /locus_tag="FRAAL0182"
FT   CDS_pept        179081..180004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0182"
FT                   /product="putative oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU84"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58860.1"
FT                   /translation="MMEMLAVQVEAPGGITSLVVRSVEDLTPRPDEVKIELIASSINPA
FT                   DVKIRTGAVVPLRGAYPFTLGYDLAGTVVETGAEVTDLAPGTQVLAMSAVALTGVGTWS
FT                   ERVCLPRTSVARLPANVDPLPLARLPLAGLTAYQAVQRAKPGPGTAVLVCGAAGSVGRL
FT                   AVELLLDRGARVHGLVRRPEQVDQLPTHELFTPHVGQPPTRSVDVVIDAAGADFSPALV
FT                   DGGLYICLVPDRAPARDVLARRSQRRTVLVTEESGADLEELVELLGAAVLTLETTSIFP
FT                   MKNIHAAHREFEQDGQRNVVLIREDW"
FT   gene            179964..180788
FT                   /locus_tag="FRAAL0183"
FT   CDS_pept        179964..180788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0183"
FT                   /product="putative enoyl-CoA hydratase-isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU83"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58861.1"
FT                   /translation="MVNETSSSSVRTGDSMLLENAFEHIEIEISGAITTVWLARPPVNS
FT                   VSQAMYREIEAFFSSHDTYVPSTKAIVLAGRGRHFSAGNDLHEFGTLTPENSDERMAEV
FT                   RAAFFAIQDCPVAVVGAVQGAAVGTGLAIAASCDFVVAADNARFGTPEIGVGIMGGARH
FT                   LARLVPEPILRWMYLTGEPINVRRLEALGAVLEVTSPEVVVARAREHAGRIVRHSSAAI
FT                   RMAKRSLNAIELLDLQPGYTFEQGLTRELSGHPDSVEARRATLEQRIPNYSA"
FT   gene            complement(180813..181424)
FT                   /locus_tag="FRAAL0184"
FT   CDS_pept        complement(180813..181424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0184"
FT                   /product="hypothetical protein; putative Thioesterase
FT                   superfamily"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58862.1"
FT                   /translation="MMERIHAMVASAPTALERRAYRNAVDAAVRILDRLAVIEPDADTL
FT                   RKCERALTQVEDALRSLPTLPEDVEAPAHAPGNPRFNPAERGLVPAFAIDAGDTGQLVG
FT                   RVQFSPRFGGTASVHGGALSLFFDDALGMVANGSVTGGVARTAFLRIDYRSLAPLDVEL
FT                   HCRVWIEAVDGRKRFIRGELCHGDRLVAEAEGLWVAPRTR"
FT   gene            181537..182685
FT                   /locus_tag="FRAAL0185"
FT   CDS_pept        181537..182685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0185"
FT                   /product="putative NADH-dependent flavin oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU81"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58863.1"
FT                   /translation="MSHTGARLFDEFTLREVTLRNRTVLSPMCQYSATDGLANDYHLVH
FT                   LGRFALGGFGLVMAEATAVTADGRLTYGDLGLWSDDQIDPLRRIADCVRGAGARFGIQL
FT                   AHAGPKAATLPPWASEPDRPASGRWEIRSVTDAPYLEGWQRPVALRSEELAAQLDLWRS
FT                   AAERAHRVGADAIELHMAHGYLLHSFLSPLSNTREDNYGGSLEGRMRFPLQVVDAVRAA
FT                   WPDGKPLLVRVAAVDNGTDGIDIEQTVEFARRLRALGVDAVDCSSGGYGGSYTHGIRPG
FT                   YQVGWAGEIRARAGVPTVAVGLVTEPAQADAIVRDGHADLVALGREALANPSWPVHARE
FT                   QLGQYDFADRFDLLPIQSRSWLAKRQRQLDRLARGERPAGGR"
FT   gene            182682..183179
FT                   /locus_tag="FRAAL0186"
FT   CDS_pept        182682..183179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0186"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58864.1"
FT                   /translation="MMSSPEELVDRLEELWVRAKCVELGARYCHGVDRADQETFLSIWH
FT                   SRGEYVIGRRSGRFSGHTELATALDFVRAAYASTHHWTTNQVVTRSGPDSATGVSDSFA
FT                   ICVDHDGRPSLVAATYDDEYRLVDGEWKILRRIVRRWLVTGGIEVAVRHPASQGMGRKA
FT                   DP"
FT   gene            183176..183766
FT                   /locus_tag="FRAAL0187"
FT   CDS_pept        183176..183766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0187"
FT                   /product="putative Transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RU79"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58865.1"
FT                   /translation="MRIAGSNRDETWKRVRAAGVSLLYRHGFEAMNTRQLAEAAGLKPG
FT                   SLYYYFSSKEDFLHRLLVDLLDEILLDLEQNLEGLTEPVSRLEAYVRTLVRWHVVRREE
FT                   TFIASIEVRSLTHDRQESYLQRRDRFDLILAEILQDGAAAGIFDLTHPRITRNAILSSL
FT                   TAISSWYDPAGPFGLEVLTMDFLELTRRMVGLK"
FT   gene            complement(183836..184108)
FT                   /locus_tag="FRAAL0188"
FT   CDS_pept        complement(183836..184108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0188"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58866.1"
FT                   /translation="MIHYSTVTRHAWSTGTADAGAADPALGPARGRAPAARARAAPAAV
FT                   EVQKVIALTRWLVLEAAGASPRPPWRGDQRPARTTTGWSGRRMCR"
FT   gene            184165..185880
FT                   /gene="dhbE"
FT                   /locus_tag="FRAAL0189"
FT   CDS_pept        184165..185880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhbE"
FT                   /locus_tag="FRAAL0189"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /function="1.1.5 : Others"
FT                   /EC_number="5.1.1.11"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8921902; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU77"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58867.1"
FT                   /translation="MKRKQLKGTRLAAGMRLFDPAEVQLFRAEGQWRHRTFLDDFLDHA
FT                   DSTPDKAAVVSYAKGRLLPETVTYGQLRAYVDRFAAALLDIGTGPGKVVSIQVANGWEG
FT                   PALALATMRVGAVPNPIPIIYREHEVRHMLEEAGSAVYVAPQHFRGYDFAEMGARLHRE
FT                   IASLEHVYFINADDAVSSELHFARHFIEPRRELDPALGATLDSLRPGADDLAMLVFTSG
FT                   TTGKPKAALHTFNTAWSGYRNVIVNALDLKSDDIAFMASTLGHLTGFIHGMLVPLSLGQ
FT                   KVVYQDQWDVDQMLDLLETEGLTWTLSATTFALDMVDAQKHRPRPLASKLRAFACGGAS
FT                   IPPGVAVDMDQIFSTSLVPLWGCSETGIASIHHLGAALDVLDASDGYPVPWQETRVVDD
FT                   DLAPVPAGTIGNLQVRGPGVFAGYFGREDLTLDAFTADGWYDTGDLGKVLPDGAIRIAG
FT                   RSKDIIIRGGQNISAVEIESALYKHPEVQEVAVVAYPDERLGERVCAMVVPRPSGSSLT
FT                   LENVARFLDAAGMAKPFWPQRLVLVDQLPRTPSGKVQKFVLRRELADVLREEQA"
FT   gene            185921..187084
FT                   /locus_tag="FRAAL0190"
FT   CDS_pept        185921..187084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0190"
FT                   /product="hypothetical protein; putative Thiolase-like
FT                   domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU76"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58868.1"
FT                   /translation="MSANQGPPVYISGSAQEIVGRGRPAPAYLNLLAAAAADAVADAGL
FT                   DRAAIDGLVLSSSIPQPFERNPAEVAEYLGLGAAYTAMAPYGGRPATDVLHLARSAVRA
FT                   GLATNVLVLSADTFATTLGLEGAIDLYMKSFDASYERPFGPLIPTAFALMAARHVHDYG
FT                   TSMEQLARVAVSIRKHGLLNPHTEVSGELTVRSVVDDVLVSTPLTRSMLALISTGGAQG
FT                   FVVTRERVDRRSVALLGYGEASAFMSLSQAPSLVHFAHIRRAADLALRQADAELTDVDF
FT                   VQFYDPATIVPLILLESIGFCGPGEGGAFVEDGAIEIGGRLPMNTHGGTLAFRHPGMGA
FT                   ALDSVVEAVTQLRGEAGPRQVRDAGLGLVHGQGSWLANNGFLILGSS"
FT   gene            187150..187554
FT                   /locus_tag="FRAAL0191"
FT   CDS_pept        187150..187554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0191"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58869.1"
FT                   /translation="MRKVDPSSDVEATFWDGCSRGEFWLQHCTACDAWQFYPRSLCSHC
FT                   WAPTSELEWRRPAGGAVLESFSVVHRGSGPFADYAPYVVALVRFDEGPIMMSNVVGDVE
FT                   GLAIGDRLELDFAERAGRVVPVFTRAGKLS"
FT   gene            187551..188306
FT                   /locus_tag="FRAAL0192"
FT   CDS_pept        187551..188306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0192"
FT                   /product="Putative short-chain type
FT                   dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU74"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58870.1"
FT                   /translation="MSESVLITGASAGLGAGMARIFAARGADLAITARRLDRLNELRTA
FT                   VVTEHPGRTVVTYALDVNDHDAVFEAFEAAAQHLGHLDRIVVNAGLGKGSAVGAGHLRG
FT                   NRDTALTNFVGGIAQCEAAMRILYRQGRGQLVVISSVVAARGMPGPMNVYAASKVALTH
FT                   LAEGIRGDVRAKGLPITVSTIRPGYIDSEMQSRSGRRHPLLMDADVGCTAMVDAIQREV
FT                   RDACVPRWPWTAFAAGLKVLPMSVVRRMV"
FT   gene            188341..189117
FT                   /locus_tag="FRAAL0193"
FT   CDS_pept        188341..189117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0193"
FT                   /product="putative Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU73"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58871.1"
FT                   /translation="MSYQHVRLERVGATRVVTIDNPPVNALHPDVAADIERAAREVEED
FT                   TTARSMILTGAGRCFVAGGDIRYFTEIDRRGAADMALRVQRMQNALFDLRVPVIAAVNG
FT                   HALGGGLELLLSCDFAIADEQAKIGVTEVQLGLIPGAGGTQMLFSALPVGTAKRLLFTG
FT                   DRLTATEAARIGLVDQVCDEGKAVEAALDVAARINSAGPLAVEAAKRSANYRLRHSLDE
FT                   GHRREVEIFAALFETADHREGIAAFLERRAPAYERR"
FT   gene            189177..189869
FT                   /locus_tag="FRAAL0194"
FT   CDS_pept        189177..189869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0194"
FT                   /product="putative short chain dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU72"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58872.1"
FT                   /translation="MSRRLADDGWSVVVVDIVPEGARAVAESITSVGGRAVVAVADISD
FT                   PARVDELRDEAAAAFGRPVAALVNLAGAVRNSVLSKLSDADFELVLRTHLFATMHTVRA
FT                   FGPGMKAAGFGRIVNTSSVAARGVVAGISYSSAKGGIEGLTRSAAVELARHGVTVNCIE
FT                   PGVIATGMFLGTPAEFQAAQVAQIPVGRAGHPEEIAAAVSFLVSPESAYITGQTLTVCG
FT                   GLSVGALR"
FT   gene            189953..190732
FT                   /locus_tag="FRAAL0195"
FT   CDS_pept        189953..190732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0195"
FT                   /product="Hydantoin racemase"
FT                   /function="1.5.1 : Amino acids"
FT                   /EC_number="5.1.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1339422; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU71"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58873.1"
FT                   /translation="MRLAVVHINAERGSEPYTEMVTEVFNRVKRPETEIVHRWARLRRA
FT                   SDTVFGYPYLLNAVDVIHNILDAGRSGVDGAMVACSGDPGITEARTLVDIPVVGPWEAT
FT                   LHLASSYAYRFGVVTVEDRAWAETCHSLIARNGLLDRCVGVERIETPSAKAFTEGFGNP
FT                   DFVVEDIRRQAGKLVDRGAGAIVIGSAGLSTMAAAAGLHSIDGGIPVFETLSVGLKTLE
FT                   LRVELTQKGGLPPTSRTGYTQRLAEADTDRVRALFGL"
FT   gene            190760..191938
FT                   /locus_tag="FRAAL0196"
FT   CDS_pept        190760..191938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0196"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU70"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58874.1"
FT                   /translation="MVNASVAHSLLTEEEREFQTVVRRFMDTHVRPIVPDMERAGRPPA
FT                   ELLKLMGDQGLLGCFAPEEYGGGGGSLMTRAIVAEETARVDAGLDATLFVNMSLIARHL
FT                   IKRGTEGQKRKYLVPLIAGTSSASICLTEPHGGSDALSPRTTARLDGDEWVIDGSKTFI
FT                   TNAPIADVFLVFARTSGENRRARGGTAFFVEKDTPGLSVGQPFDKLSLRSSPTAEVFLD
FT                   NVRVSWDQVLGEVDMGFYYMLEGLDLERVFEGASNTGIAQACLELAVEYSGQRTVFGEQ
FT                   LSSYQLTQDKIARIATGVEMSRVMFYHLIRELERGEELTRSSAILKLYSSQVAVEASRE
FT                   VVQILGGYGLMEEYPAARLYRDAKHHEIGAGTSEIMKVIIARETYKAAGAGR"
FT   gene            191935..193104
FT                   /locus_tag="FRAAL0197"
FT   CDS_pept        191935..193104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0197"
FT                   /product="putative Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU69"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58875.1"
FT                   /translation="MSIETNRYLTEDALELRSVVRRFVSEKMSRSDAAGWDKAAHFPRP
FT                   VLDELAELGVMGLAIPEEHGGVGRDIHATLMVIEELSKRSMAVAIPYIMAACYAGMTVV
FT                   DCASKEQKAQWLPEIAAGRMLFAYGWTEPDVGADLASVRTTVRRDGDELVINGAKRFCT
FT                   GAGLSDYIYTLANSDPGGARYRNLSLVLVPPDAEGVTITPIDAMGIKGSQTTDVVFDDV
FT                   RVPADLLMGGEDGWNRGWSMITGTGLDVEKLEVAAMALGLGIAAYEDALAYAEQREQFG
FT                   VPILKHQSVAHTLANMRVQLYASRLVLDDAAELADRNDVCGVQTSMAKLFVTETCRQVV
FT                   LDAQTILGAYGYVADFDVERYVRDALLMPIIGGSSAIQRNNIHNWSRRR"
FT   gene            193282..195591
FT                   /locus_tag="FRAAL0198"
FT   CDS_pept        193282..195591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0198"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RU68"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58876.1"
FT                   /translation="MTCSPVPADLTRFVGREQECVQIAELLSCSRLMTLTGPGGVGKTR
FT                   LAKEVLRRQAGDLVDSVVFVELAEVAHGDQVTAAIAAALGLALDSGGESLPSLGRALQE
FT                   RDILLVLDNCEHLLAACGRLMGALLPAAPGVRVLATSREPLGIFGERTWRVPPLSLPAP
FT                   SSNSAADSDAVKLFLDRALSVAPDFVVTADRLRMVGELCRRLDGIPLAIELAAVRTRSF
FT                   DLPQMLSDDVPIFRVLDRGNEAGPLRHHTLRKAIEWSHDLCTPQEQALWSRLAIFSGSF
FT                   SLAAAREVCAGDGLTGDEIVPLIGNLVEKSVVTCNVIEAAPRYRLLESLRVFGLERCEQ
FT                   VETWRRRHRDHYLGLALESTHTSTGDEQLVTVRRLQGELPNIRSAVGYSLSRSSERLIG
FT                   LEMTGALWFYWNACGHLRDGCRWLQRALAENPESTPARAKALWVLGWYEMVQGDKANAR
FT                   LHLEAARDMGRAIGDASAAATAMQFLGTLEELDGNSEGALLLLEDAQRRHRKAGEDGAL
FT                   SILCGAQLAMLHTLAGRIDEGRRQCDVAVAQAEAHDERWAASWAHWNRGLVHHFAGEPA
FT                   RSVESLRIALTAKASLRDWLGASACVEVMVWDAVDLGRLEYAARLLGIGRMLCRAMGGR
FT                   QPLFGSAFLTARRAEYVEGIRHATGVENFQREFAAGLALDIEEAIDFVLDMSSVRASLT
FT                   VPPDRSHGDALTAREREISRLIYQGLSNADIAGSLTISRRTVEGHVNRILAKLNFRSRS
FT                   QVAVWMARREPVESGR"
FT   gene            complement(195726..196838)
FT                   /locus_tag="FRAAL0199"
FT   CDS_pept        complement(195726..196838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0199"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU67"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58877.1"
FT                   /translation="MKTKAAVLYEAGKPFEIEELEIVKPGAEEVLVRYDYSGLCHSDLH
FT                   MVKGHLPFRAPMVFGHEGAGEILEAGSNVTGFHPGDHFVASFYPVCGRCRWCATGNSRL
FT                   CDLGANGLEGFLPGGRFPFRGNSGEYGSMMTLGTFSQYATVHQNSIVKIDDDLPLDKAA
FT                   LVGCGVPTGWGSAVNSAEVRPGDTVVIYGIGGIGTNAVQGAAYAGAQHLIAVDPAPDRR
FT                   ESAKRFGATHTAATADEALELVTQLTRGVGADSTIITVDELTAEVVSQATEATSKGGTI
FT                   VITSMGQYEGETIKLSGVQLALWGKRIQGSLYGGCNPLYDIPKLLSLYRTGHVKLDELI
FT                   TSIYTLEQVNEGYDDLMAHKNIRGIIAHEH"
FT   gene            complement(196889..198448)
FT                   /locus_tag="FRAAL0200"
FT   CDS_pept        complement(196889..198448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0200"
FT                   /product="NAD+-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU66"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58878.1"
FT                   /translation="MTSTIESPALTSSEVSVPHYRLFIDGEWVDTSEQYVIVNPATEET
FT                   VATAAKGGIDQADAAVAAARRAFDQGIWRSLPPVRRAAVLEAVADALEARSEELAATAT
FT                   REGGAPLYLSMGLNAITPVSNLRYFAELARRYQFEAPGPVVGGIAHGGVIRREPIGVCA
FT                   AIVPWNFPLALAVWKIGPALAAGNSVVLKTDEKTPIGALELARELQAAGLPDGVFNVVT
FT                   GDGEVVGAHLAAHPDVNKIGFTGSSEVGRKVAEAAGRSNLKRVTLELGGKGPNIVLADA
FT                   DMQMAVDGAIWGFLMHAGQACESGTRLLLPSSVHDRFVERLVDRLATVRIGDPLDPTSN
FT                   LGPLISAAQRDRVLRYVELARVEGATVACGGRVPAGTDKGYWVEPTVLTDVTNDMRVAR
FT                   EEIFGPVLCVLRYDTVDEAIEIANDSDFGLAAGVWSSNVDAALDVARRLEAGSVWINDF
FT                   HMANENYPFGGFKQSGVGRELGVNALDAYTEAKSIQISMEPDIQKRAYGLALSTPAPAW
FT                   GD"
FT   gene            complement(198511..199740)
FT                   /locus_tag="FRAAL0201"
FT   CDS_pept        complement(198511..199740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0201"
FT                   /product="Putative cytochrome P450 reductase"
FT                   /EC_number="1.14.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU65"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58879.1"
FT                   /translation="MTTTPTTVPEKPDVLSAEFARDPHTYYKIMRDFYPVLHHEVSGYY
FT                   FVSRYEDVARIYKDSVGFSNENYAFQMEPVIGKTVIQMGGREHAINRQLITPALRGNYL
FT                   EELLPQVDELATEMIDKFRTAGRVDLAEDFTKWFPINVIVKMLDLPREDLPKFHEWYSS
FT                   LMAFLANLTNDPEIHAWGMRTQQEYPAYILPIIAERRRNPGTDLISRLTQAEINDEQFS
FT                   DEQIKALIGLLLIAGGETTDKSIASTLKYLIMHPEQLEAVRQDPSLATRALVETLRYHP
FT                   PVQIILRTTTDDVEVAGTVIPVGSVVGCVNGAANRDERRFDDPDTYNIFRTDINIRQAF
FT                   AGSADHIAFALGRHFCVGSLLAKREAETAINQILAAMPDIRFADGIEPTDAGLFTRGPE
FT                   SLIVEFTPAS"
FT   gene            complement(200171..200353)
FT                   /locus_tag="FRAAL0202"
FT   CDS_pept        complement(200171..200353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0202"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58880.1"
FT                   /translation="MARYSAASDDELAVLRGSAAPDAPAVSDEPLEPHAATPTSTAAAA
FT                   RLRPILFLVRTAVLR"
FT   gene            200424..201338
FT                   /locus_tag="FRAAL0203"
FT   CDS_pept        200424..201338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0203"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58881.1"
FT                   /translation="MVVLEANVPIARRIDEERAAAAEALGWKYSKIVIGTGAEDAAKAM
FT                   SQALDQKPDFIFEAGYNMSAFGDQVARAQSQGVKIIAQCITDKPSGPLIAVDCDLHSTD
FT                   LMAKATAAYIAAHGNGEDVIQLLSSTAFPIDDYYGKSLANQLKPWCPKCEVKTVSFQLS
FT                   DLGTKLPGMVVSALQRDPDTTYIVSSFGDALTGVEPALAAAGLTGKVKIGGYLPGVDQY
FT                   QALRDKKQVFWAQDQAPIAGWREMDIAVRAAVGDPISTVTNTAPVSQVLTSDNIGSASF
FT                   DTSGFWLGVRDFADTYKKLWLLS"
FT   gene            201379..202896
FT                   /gene="rbsA"
FT                   /locus_tag="FRAAL0204"
FT   CDS_pept        201379..202896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="FRAAL0204"
FT                   /product="high-affinity D-ribose transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RU62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58882.1"
FT                   /translation="MSNSSSPALRVVNLAKTFGGARALKDISLEIAPGEIHGLVGENGS
FT                   GKSTFVKILSGYHSPEPGGVIEVGGNELSFGKPADSHAAGLRFVHQDLGLIDDLNCAEN
FT                   LALGRGFDTAFGRRIRWRSEHEAARRALAALGYEIDVRRPIGRLSVSERTAIAVARAVS
FT                   DHGGRTYVIVLDEPTVNLPKAEIQRLFRLLRLIRDRGVALIFISHHLEEIFELADRVTV
FT                   LRDGEVVVSRSVTELNHDSLIELMLGRALRAVRSDARAAAGAPVLTASGVCGQVVQDVD
FT                   LTVHAGEVVGVAGITGSGRDELARLIAGSAPFTGRVAIDGEPLRSNRPDLFIRAGVVGV
FT                   PAERTVNAALPDHSVRENLTISHLAPYSSFGLLRRSAERTDVRTLLEKFDIRPARPEQP
FT                   IDSLSGGNQQKVMIARAMRLGPKVLVLDEPTQGVDVGAQAELHRLVRASVENGLGVLAC
FT                   SSSSEELSEIADRVLIMRSGRVVDELTAPLVADDISAATLAKQKETT"
FT   gene            202893..203915
FT                   /gene="rbsC"
FT                   /locus_tag="FRAAL0205"
FT   CDS_pept        202893..203915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="FRAAL0205"
FT                   /product="high-affinity D-ribose transport protein (ABC
FT                   superfamily, membrane)"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RU61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58883.1"
FT                   /translation="MSTTDTAATSEATRVTGRDSAGPTKRSGRIIPRLGLDRFSGLYVL
FT                   AALIIAYGIWLPDTFLTSQTARSVADGQAIAAIVALALVVPLAAGVFDLSVAATLGFSV
FT                   CLVAWLQGHHVNAILSVLTAVAAGIVIGAVNSLVIIVLRVNSFIGTLGMGSLLAAGSYW
FT                   ITDGQTLIKGFSPDLLKAGRAQPAGIPVTVWYLVGIALVLWFVLEYTPVGRYFYAVGAN
FT                   PQASRLAGLRVDRLVARSLILAGFLSALGGAILAAKLGLGSPDVGPPYLLPAFSAAFLG
FT                   ATQIKSGRVNVLGTLVAVYLLGVGVKGLQLAGAPSYVGDLFNGAALIIAVALAARTSRK
FT                   "
FT   gene            complement(204061..204468)
FT                   /locus_tag="FRAAL0206"
FT   CDS_pept        complement(204061..204468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RU60"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58884.1"
FT                   /translation="MTIAVDTSVAIPLLVRSHQHHTDVARWWDGQQLTLSGHALAETYS
FT                   VLTRLPGDARLSGPDAARLLDARFTAPLALSGPPAQEIHTTLSQLGIAGGAVYDGLVAL
FT                   AAKAHGLALATRDARARGTYDAVGVKLILVG"
FT   gene            complement(204465..204701)
FT                   /locus_tag="FRAAL0207"
FT   CDS_pept        complement(204465..204701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RU59"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58885.1"
FT                   /translation="MEAVVDQAGRIVLPKFIRDALGLLPGTKVDISPYGAGVQVVPAGR
FT                   TARLVEENGVLVSAGDTPVDDDVLFGLIDAGRK"
FT   gene            complement(204752..204922)
FT                   /locus_tag="FRAAL0208"
FT   CDS_pept        complement(204752..204922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0208"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58886.1"
FT                   /translation="MPPALPHIPRSPEGQRRAIVPPLCGNRYGSSQGEADSPTPETRRR
FT                   LAADHGRAGLR"
FT   gene            204978..205048
FT                   /locus_tag="FRAALtRNA5"
FT   tRNA            204978..205048
FT                   /locus_tag="FRAALtRNA5"
FT                   /note="Pseudo tRNA Evidence 2b : Function of strongly
FT                   homologous gene; Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(205278..205745)
FT                   /locus_tag="FRAAL0209"
FT   CDS_pept        complement(205278..205745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0209"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58887.1"
FT                   /translation="MDQTSPEARHTDPNGGIKLDMRDERAKQLKEQGMLDPMPEWMRDK
FT                   VVDQLIDRPLHHRNHPCEPRAHRLFAGLHTLMVCVFGPVATTTGRPATSKLDKDDKTMP
FT                   VTVDPHGGVHRPTWTRTLRCAELRRHDGHSPPRPRITASVAPQSGEQAHGS"
FT   gene            205524..206102
FT                   /locus_tag="FRAAL0210"
FT   CDS_pept        205524..206102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0210"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="GOA:Q0RU56"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58888.1"
FT                   /translation="MQAGEKAVGPWLTGVIPMVERAIDELVDDFVAHPFRHRVEHSLLL
FT                   QLFRALVAHIELDAPVRIGVSSFRTGLVHKEWPMPVVDGDRRGLFADVSTAVGGLLAMF
FT                   SVVVPSAKAMRRHRRRRAPTAAGRIGGAWREPVDRLIETSVSAPSALTRCELADAARAA
FT                   HSRARLSTRARRCLGWCRSSWPMWTGVAH"
FT   gene            206288..206485
FT                   /locus_tag="FRAAL0211"
FT   CDS_pept        206288..206485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0211"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58889.1"
FT                   /translation="MVQIPYELEQTEDGTWAAHASFPSGGAHGLGDTPEDAVADLYEAV
FT                   SLVIEEFGVPPVLTIVQDVA"
FT   gene            206485..206685
FT                   /locus_tag="FRAAL0212"
FT   CDS_pept        206485..206685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RU54"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58890.1"
FT                   /translation="MPPLPVLSGGEVVKVLEKLDFEVVRIKGSHHMMRNAEGRFTVVPV
FT                   HPGRDIRSGHCVGSFVTRACR"
FT   gene            complement(206619..206813)
FT                   /locus_tag="FRAAL0213"
FT   CDS_pept        complement(206619..206813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0213"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58891.1"
FT                   /translation="MTAGIIQYQLLRLLQSPRCPDPPLALTVGTPTGRGSKRGDELRYR
FT                   QARVTNDPTQCPDRMSRPG"
FT   gene            207229..208632
FT                   /locus_tag="FRAAL0214"
FT   CDS_pept        207229..208632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RU52"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58892.1"
FT                   /translation="MDGSEPVHILITQCLQNDFFFNLNCRLHLPEDAAAKLLIHPDSRS
FT                   GFGLRRGRRVLDARTQRSGPLGRMLSATVGARLGGGGRGVLHLVNVRDWHVPSDDYDRE
FT                   RSEYGTHCEAGTWGADYPDALVGLLDPTGTRPRAGGPGTAPFDPTGRRRGSVIVHHVHS
FT                   NTLFDLREDASGLDRSELGEVLGAILPPSGHQDVRIAVVGLYTDIKVQLLLQSLRTSFG
FT                   GARQVVVSDSLTAGVSLERHLAALDFARKVLRVEVMQGVSDLARLLGTDPGQDEELESA
FT                   AGAVAFADYAEYFQAKQRIVSSEDAQSRSYRQQIIGRLDATVRLVTLTNVFLIVCGALT
FT                   LGAAVVLAVLAAAAPGTIPVALPALVLGLSAVQVVSVFFHRPAQSLIQLLGREAIVRMS
FT                   LESRSLRLALARYHLTTPDALHPDEGSGLRAELLQRQMDILAQMDRADIEAIEKLGGPV
FT                   SPPDAPPVE"
FT   gene            complement(208638..209723)
FT                   /locus_tag="FRAAL0215"
FT   CDS_pept        complement(208638..209723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0215"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58893.1"
FT                   /translation="MTVTFDDLVTDLRALREIGLAAARRVPLAALEKAVGLVEEAEADP
FT                   VTIETLLRRAVDGLEPGRLRDAARYTFGLVPGTRDWAAYDRRRKSAEIYRVGTDRFRKH
FT                   YERIIVDEVADAIHVICRAAVAGDRPESPRQRPPDAHRLTSSRTLDVVFGGRSVPISVH
FT                   HRSIELISGVDILVSPENVYFATATMFKSSVSAAIRRRAAVRGPAGEVADDVVPRELAA
FT                   QCAPGLAVEPGTVLATSGGELRHQGVRRVYHAAVACPRAGTNEYDTDPAAVGLAVANIF
FT                   RLARTENRALNPPLTSIALPLLGAGRGGLDPMTSLTWIWGSLEVELARDASWHIHFVAR
FT                   NPEIGAAILAHIPPGDETAAG"
FT   gene            complement(209775..210017)
FT                   /locus_tag="FRAAL0216"
FT   CDS_pept        complement(209775..210017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0216"
FT                   /product="Resolvase"
FT                   /function="2.1.3 : DNA recombination"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU50"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58894.1"
FT                   /translation="MTAHRWFNAGKLPVPARTIGELIIVGDVDRTPAAGESVAYARVSS
FT                   ADQKPDLDRQVAREREPGTATAGQTGSADPQGTAA"
FT   gene            complement(210056..210211)
FT                   /locus_tag="FRAAL0217"
FT   CDS_pept        complement(210056..210211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0217"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58895.1"
FT                   /translation="MPRPSHAAQAGRYLAALSDARLAHPALGRLRPPRMLKEAVLPRWA
FT                   RSRMFL"
FT   gene            210823..211404
FT                   /locus_tag="FRAAL0218"
FT   CDS_pept        210823..211404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0218"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58896.1"
FT                   /translation="MRGDVYELSWVATGASRVEIDGYGIHPPEGSTLVAFDGTVSRRLA
FT                   ARGPGGVSNRFSPPVWTLEPPDPRLPRRPNAGRALGRARPGSAVTTVPQVPRASELLAD
FT                   AAPPSPAGAGRGPGPADGGDPPRLAWQAANLRPSRWFWASRRRADGGGRGWGPPMWTLL
FT                   PRRRPGRATPTDARRDTGKNRANRTGRQAS"
FT   gene            211401..213494
FT                   /locus_tag="FRAAL0219"
FT   CDS_pept        211401..213494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0219"
FT                   /product="hypothetical protein; putative membrane protein;
FT                   putative coiled-coil domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU47"
FT                   /db_xref="InterPro:IPR025519"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58897.1"
FT                   /translation="MTFRERLASPFRLFGELALWLSSADMEILERFRADRAKFVGLGSA
FT                   VIITSGMAGFSAAFAVHMALKLPVVACVIVGLLWGAAIMAFDRWLVATASRGNLWLLLP
FT                   RFLLALLIGAVVSTPFVLRVFQPEILDQVALMQHTRQSDITTQAQSDSTGTRISALQLD
FT                   EAKQNAIIAAGGPPLTVEDDPQVKGLEAKIAPLQAKWDQANEAVICEEAGNSNCGVAST
FT                   GVHGDGFITAQRKAARDQIGAQLDPLKASLQAARAAATVNIAQQKAKAVVDAQQKVKAD
FT                   RAELARLTPIQDADTKRREEANNGNTGLLIRMEALSALTKHNPTMRTTHWTLWAFFTAI
FT                   ECFPLLFKLFMSLGRPTRYEEALALQERADLDVSRQRTRRQRATDLLNDADPLAEAQAE
FT                   REEKDTQLARLTRQTIRAQASLAEEALALWTEQERERMLANPGEYLRSGPTVSPPPRFA
FT                   SRDQAAPDNTGTGVARPWPPAPREQPRGARPRPAAGSRPARGPAPFVAPTGPVPSTVPT
FT                   TVPPTPMAGTESVNSTVRRNDAVSGNGAVSGNGAVPGNGAEPATGTAPADEPPGYGDAA
FT                   AGREIDGFTVGRIDRARQPETDADADADAPTVVPDGSVGTDSSVGSAGSVAPGGYAPPA
FT                   AYGVPATYVAPAAYDAPDSGVPLDGYGDEVTIERDLSEEETYFPGRSQPPRPGRGEDGG
FT                   EPR"
FT   gene            213491..214198
FT                   /locus_tag="FRAAL0220"
FT   CDS_pept        213491..214198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0220"
FT                   /product="putative reductase radical activating protein"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /EC_number="1.97.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU46"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58898.1"
FT                   /translation="MTGVSRPGSLPLNVAATATGTRALGPGVRSAVWVQGCPFDCAGCV
FT                   APDWIPDRPARAVTPEVLAEELCADPAVEGLTFSGGEPMAQAAGLAELIRLARLRRPEL
FT                   SLVCFTGYRLQRLRAAAPSPGVTDLLAAVDVLIDGRYVAALNDDRGLRGSSNQRIHHLT
FT                   DRLRGEADYFDGPRRAEIRLGTRDVLVVGVPPRGLLDAVDTALNGPPRSGAGSAVAAPG
FT                   GRPAESVETGDQR"
FT   gene            214309..215790
FT                   /locus_tag="FRAAL0221"
FT   CDS_pept        214309..215790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0221"
FT                   /product="conserved hypothetical protein; putative
FT                   coiled-coil domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58899.1"
FT                   /translation="MAARAVARAVAERTREAQRQAEAMTEAIRVAAQRDLADALGPVEA
FT                   RAAAAEAATTRLSAAAAHIERQTNARLAEQARQIAGLRVETAERFDAAQREFRAALRAE
FT                   RDGREQAMESLRAEIRSARAGRGLALEDAGRWLDDAGVLVELIGATLPHERFTPGRLAA
FT                   LGRNLGRARENVEAGFAEAALAAAQGVYQQLSDLRVEVEYLDRQWRTLRAGALDALGIV
FT                   VDLLERGAVQPVLDEDGDPLPGVTLDVDRWSRGELTALRAEVTTLLADVRADEPGPAGL
FT                   AGLAGPGSSAGPAGGARRLDPADLREVVETRAPAYEARLAAVIEAAGTAQLGSQLRVSI
FT                   ADAVVGTLVGDGFVLADHTYAGQDDRNGFYARVEHPDGGIVVVDVSPAEDDPGACELRV
FT                   LSYDDVGAEDIRADRARALAGVLRAQGLEVTDPAPGPMPAEVALRDLDRVRRGPIPREA
FT                   PAAGGGHGHHHQQHHLHHHHHHQHQHQHHHQHHQH"
FT   gene            215804..217264
FT                   /locus_tag="FRAAL0222"
FT   CDS_pept        215804..217264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0222"
FT                   /product="hypothetical protein; putative coiled-coil and
FT                   Aromatic compound dioxygenase domains"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58900.1"
FT                   /translation="MPARAGPAADKRRCPMSGVKRTYVSVDQTAWAEAQRAAARLRDVR
FT                   RDLPRMVEGVREQARRDAQAAIRPVEERARAAERQIAKLSARARRFERETQVRLDRQRQ
FT                   DLAGLRTDTENAFAAQERQFRAAIQAERAARQKAVDELRADVDALRDERSRARDAAREW
FT                   IADAEGLATLIRDTLASERFRPGRLAGLERDVATARQNVTDGFGEAALTAAQRAYDGLS
FT                   DLRYELEVTDREWHAARDAANEALLLVGRIAQEQGVQPALDEDGRPMADVTLDVDHWSN
FT                   GELAALRAEVETLLAEVRDDSPGAGPRAGREVTTREVTTDELREIVEERAPELEARLAD
FT                   IVERAALNQLASQLRVNVADVVVQTLVDSGFALADHTYAGEDDRNAFFARVTHPDGGVV
FT                   VVDVSAAETAPACDLKILSYDEVGAENIRLARAEELAAALRAQGLDAAAPRADAAPPDE
FT                   SLHHDLNPVRYAPPARPVPLATPVARPR"
FT   gene            217271..220939
FT                   /locus_tag="FRAAL0223"
FT   CDS_pept        217271..220939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0223"
FT                   /product="putative sporulation protein (partial match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RU43"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58901.1"
FT                   /translation="MTVPTDPAGGGGSPRSAERLSSAFRYTGDPLFVLHGPGVLDALVC
FT                   RDYLERDFEAALWEELSAAGFERIVFWTPWEKGLYFRDADSSAGRPRGTGSPLGTGSPR
FT                   GIGASETANAAGPVPPPAAPGGPAGGTMRFFNGPMGAVNRLGAGRLGPGRPSGPGGPGA
FT                   GAAVGTGRPPAASTVGSMTDGAAVRLLATWLSPRGPRNPLRTAAVFLSTPELLTHLRPE
FT                   AVRPLAGLFGELTGGPRTDHLCVLISGESDRSRIIAEVRRTGLFTTLADWLEGTAADGC
FT                   YGYVGHAPPAEIERAIHRTRLVDGLDIGDWAGLPRLAAAMSAESNATRKWLSTMQLWAR
FT                   ERRPLDGPELAKAGHLTGGSPDGRSAWERLDAMTGLGTVKEHVRRLAGATRLLAARPAG
FT                   SGRRAQAGSHHLVFTGGPGTGKTTVARLIGEIYRDLGILARGHVRAPEVSQLVAGYEGQ
FT                   TAIAVNREADEALDGVLFIDEAYRLTERRDSPFGQEAVNALLSRMENDRERLVVIVAGY
FT                   QGEMKRFLDANPGLRGRFPEANIIHFPDYEPDELTDILLRNLADIGLTWEPDTEEALRT
FT                   VVAGIHRLRDERFSNAREMRSLADDLQANWSSRVQRAAGAVDLGKRPAGDDGRAAAWAA
FT                   EQETAAPGDLAALWERPLLRADIPGRYAMHLPGQAPPIDEVLAGLAELIGLGQVKAHIR
FT                   ELAGTMQLLAARPAGSGRRAPAGSHHLVFTGGPGTGKTTVARLIGEIYRAIGVLRRGHV
FT                   RAPEVSQLVAGYEGQTAIAVNREADEALDGVLFIDEAYRLTERRDSPFGQEAVNALLSR
FT                   MENDRERLVVIVAGYQEHMRRFLDANPGLRGRFPEANIIHFPDYEPDELTTILLRQLTA
FT                   GGLTWEPETEQALRAVVAGMYRRRGEDFSNARAMRSLADELRARWSGRVLADGGPGGDP
FT                   ARLAALWERPLLPADIPERLQRDLPGRVPPIEQVLAALDALVGMGPVRASLEALQRRLR
FT                   HRQRIGAPGVVAPHLLFLGPPGTGKTTVARLVGEMFAALGLLSKGHVVEVKREDLVAGY
FT                   LGQTEQKTSDAIAKAIGGVLFIDEAYALARGGPQDFGREAINTLVPAMENLRGRLVVIA
FT                   AGYPGSMREFLAVNEGLPSRFGETIEFPDYEPNDLVEILERMAGAAGYRLDPAARPAAA
FT                   DWFRRRRDADGPAFANARTARGLLDRMEDRLTARMAQRPDADQAELTTLTEADLPA"
FT   gene            221044..223062
FT                   /locus_tag="FRAAL0224"
FT   CDS_pept        221044..223062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0224"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58902.1"
FT                   /translation="MLPGQAGEQRCDGCGWTLRGPVLLGPLTPEVTAAFDRRLGAASRG
FT                   YDLGAAARVLAAFGDAEPGLADELGRAVRAGPPAPGELEAARAELAAAARAAGRGARPR
FT                   GPTLTTALLGLVGRMGRAGLGGGVRPGVAEVTADAVTLSVVEVDELGLPVARELVRRDW
FT                   AELLPGLPSDRPTRLLRLAGGVGPVGAVPSAAVGAVTGALSAAGVTDVVVAWRLDDGWP
FT                   PLERFAEALAEPGALRANVTWCRAWPGESPAAVLAQAPLPTGYGLVVAEVAQGSRNVRL
FT                   TTVPLFDAGLVVGPNGTPSVEVTVGAPRGGFELALVVVARPGGTTDPAAWRPVAIGRCV
FT                   AAPGSTLPVRVALEGPRTVRFLEPPGTRSEQVPPGGSAGPDSPLAASWRELRDGQPSTY
FT                   GAEPLDLVLLVETGGLPRTVAARLSLAERLLELVGREHPEPEAVRVSVIGYADHDVLDP
FT                   LRAGQPVVRSVIARAPAEAAGAPQGWRTPHVTDVAAPIEDALHTALDLPWRPDAYGVLI
FT                   TIGARGPHPPTKRGDTSLANECEFGHDWERLLRRLVERVDPVRIAARGGLDFVPTERSS
FT                   EDVGRAERAWAALGEHGQLPAGAGYRELAELAELLEDGPAGAGRRGRALAVPLLTPTPP
FT                   PSAGTEPVSNRSRRSRSTGTAGLTGATGPAGPGWRVP"
FT   gene            223059..224066
FT                   /locus_tag="FRAAL0225"
FT   CDS_pept        223059..224066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0225"
FT                   /product="Putative ATP-dependent RNA helicase"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU41"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58903.1"
FT                   /translation="MIDVRIGLWGAPSSGKTTLLAALPLAAQQSRTPGDSWNVFGADAR
FT                   ATSWLNEEVGRLMGGRFSPATALSTRLSLVIAGERQPDYGTRVLRTRITVDVLDVPGDL
FT                   FQQGVVVGAAGAEGAAQEVSFDGAPAGGGGPPVAKQASGYEELLRHLTACDGIILLFDP
FT                   IREIRDRNSYTAFNAVLSELLQRCYQAGRVQGGKLPHHLFVCVTKFDDPRVMNAALTPG
FT                   ELAELSRRAAPVIDQSIAGRYFDQLADRPGTGAGHVRAAIRSAFRRERVEFYATSSIGF
FT                   RAGPGRPFNPHHYQKTVLTQGETRIVGEAAPVGVLEPFLRMAGKITRQRGGPAA"
FT   gene            224063..227758
FT                   /locus_tag="FRAAL0226"
FT   CDS_pept        224063..227758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0226"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58904.1"
FT                   /translation="MNGPTGTVELDWALFSKRPGQRDDYTVIAASAARVRPASLAKMIT
FT                   YFAVGQPAGPAPGQPGALPWVTFTAATVSGTPYIGIAIKEWPAAPTTDATGRIIVPTRF
FT                   FCLPEVDFHRELGSYLAFHDAVRDVAPDGLPSQIGTGLLALRVSRLDRRTVLASPAWEP
FT                   VGAGRAASLRAALATAALLVERPVTLTPARVVDLRARVSYLDLTAAMLPAGAAGALAAS
FT                   TWADVRASQQVRLAFGDDLGAGEAARLDPARPPSLRQLATASGTGGATAAGASTIGATN
FT                   AGGRYAAVLAHLVGASRSAPGGEDEPATERLLTGLVEALAADLTPRAFSRPQEFAEHLA
FT                   VTAATSLAAAVRSGSRSPRDARGYLASMPVGSDPSQCLFPLLLDGPEPDDLRLALRQWP
FT                   GPGVAGSTHPATALVRAFVGAGVPVGIIEERLTDAPTPVRAAVVAALLEPQSGETAPRE
FT                   DAVNLAAELIRGSQPGRDDDDWAAVRSRLLAAPELALLIVLRHIEARPGVGLNNLFRWL
FT                   EPGPSSRTAGVLKPYRLLADKRPPAAADLTTLTLVDPAVVDRAMQALVSLAAAWRLPRY
FT                   VLPAVGGWLETETQSGQLHFGPRRKEEWRALLERLDEERAERDRLLRLIGALPPKQSKS
FT                   LLKGGKGRKAAPVTVALGWLGGTQAVLRTEDRALTELVLSHLPTVTDADPGAARSPGEP
FT                   DATELSFAGDGAGVAVAIAYSASGGWRAGHTEFAPFVAAGGRLVEFCETVHTRLETGGE
FT                   PGSMTLPGVADPLVVARLAGEVAAFGFAAVARVAARLLEGPVVIVTGPDRPPLRQRLTF
FT                   LRAVFALLPAGVSASMTVATWAADPSPFRLAFTARTPSTDTTAVRWPPRPDDGLHGLAG
FT                   IYADRLGWARALSEGTEPIVGQLAAMTDAVTLDDLADRLALVGGANQAFGPPGESRPVA
FT                   LATARERRRAILAGRADTVEAMVRALVVLLADGGVADVEAAYRLADRARQQGRLDDVLA
FT                   ALLRRSEADRERLARVHRGAVRLGLILPGEGLRLVLREALQATPAAAVRLLVQLDLDGR
FT                   GPGELAEWSRWLRADGQLADLAAFDALLADQPASEAARTRAEAYGPDARALLQRLAPRE
FT                   SAVPAPPAARLPEPAATERSDAVPTEPAPTEPAPTEPAPTEPAPTEPAPTGAVPGVPPP
FT                   AEPAGVASAGSGGWAGDGAQATTAHSAGGPGEQAVAGTNPDEPWRSSGWRPGGWSAGGP
FT                   SGGAGW"
FT   gene            227689..228909
FT                   /locus_tag="FRAAL0227"
FT   CDS_pept        227689..228909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0227"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58905.1"
FT                   /translation="MAQQRLAARRLVGRRSFGGSGLVTAASPASAAPGTARYAAYAAAG
FT                   WAVGRGPAVTAALPDEQVGRPYLLVCQVATAAAAATLVGLGTVASGARLVRILGHETAS
FT                   GPGAAWFAQRAGAGDGHAADLAAMVGAGGARLSELLRQAAERPRIRGSAVAAFGPASEF
FT                   RLTLGDLLDGSGPVGATAEAAVRAVLERRADLFTGRDAPGSVGTAGGGPMLQGLVVGPL
FT                   GVLPWLATAVRAAAVERLAAVDRLAATGATAAVEILAADDPSGAAARGDELVAAGRAHV
FT                   VDRCERAVRLYTHQVRDGRLAEATIAVAAAGDAWPERVTTDAGPLLVRVDGDAAVEIAV
FT                   EVRPADSGPARRARLRLPGGLAAGDYHVGLRPGRYPAGGLVLSPAGGGEARVLEIPADP
FT                   DNEHPRI"
FT   gene            228967..229854
FT                   /locus_tag="FRAAL0228"
FT   CDS_pept        228967..229854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58906.1"
FT                   /translation="MSEGAFDALRAGLADAAKTLRALTENGDADRLDLLNAVMGLDDAM
FT                   GDAAELLATLPAFLAAAEPVEPIRSDLADWASRQAEAARRVAQARALLDARLADERQLD
FT                   GLAAEHAELTRRLADLERAERLAASLPALREQHRVLAERVSAFSDPALRAEQAVELAAV
FT                   QLDLLTGLRAGGWRAELADALAAAAAAQARLAEQLAVDRERLSGLEGENDRTRAELAVI
FT                   DERAARLEDEHRELQARLSARLKANQRVAGSMAGLREADRRLTEIDGMLAAALRERETA
FT                   LADSRRRRRNGEAT"
FT   gene            complement(229863..231995)
FT                   /locus_tag="FRAAL0229"
FT   CDS_pept        complement(229863..231995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0229"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58907.1"
FT                   /translation="MHGGAADRGGDHPPDEPPRAGRPPARIEAGWAVKGKLPGTFADYA
FT                   VLRCSSVYFGRGDYGAILRRFTPGTPPPPEAAGRPDTGGLPWVTVSYAPRPGGGLLGVA
FT                   RCDWTAEVDGAGRRIARTTYLCAPFDELAAAQVTYEDLHSALRLDPAVAAVLRPEADAA
FT                   TDAEAGAPARLGHLPGLDPAVVAQYLADEDRFRFAAGVAGLVLCGPVALLGAPALPPEQ
FT                   RVAERLRLLDAVAALLPFGQRAQLVASTWVRSGADHRIRLAFSDQAWPGAVAARVPVGG
FT                   HPGELPALPDAAAEYQRLLIGLRDRYGEPVERIVAHLTEPAYQGAHPIADPRHALLSLA
FT                   DLPGPAFFATLVPVLTRARRAHAGAAAGTEDQQARRRAALRSAEDTSALLRAQRLRGKL
FT                   AGLDTREQDDAVRAALAHHHGAPYVSLELARLAVADDQRAAGARPAGAAARNGGPGLDG
FT                   GQAAAHSVGWLAWLVREPALAQAVRPFVEVLSNRPDGQVFAAAGSEAGLPLLADHRYLL
FT                   ALSRLARLVGVGEPLRVPMTRWLLEQAAARSLAAPVAAAWAGELRASAGQGTGGAPGAN
FT                   RPGGQLAAVALADAVALLLDGRPVRPIAARMTVPDYGVALHRTVMGLTRRFASDMGVRL
FT                   LHELGRSLDAEGWPADLAVADRTLRLLESLVRDTGHMLPDSLRVAVRTYLLGRPKLPSE
FT                   TARAWRDMIEGYLPRQ"
FT   gene            complement(232008..233426)
FT                   /locus_tag="FRAAL0230"
FT   CDS_pept        complement(232008..233426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0230"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58908.1"
FT                   /translation="MTQPAEPTGPGRGARGWRRGPAGRGDGLRPGRGGDRARERRRVGA
FT                   AGFGGAADRGGPAAGGRRTGRREENEAETGSRIGLWGATQSGKTTMLAALQVAVARQRG
FT                   GEQDWLMFPGNARTSRFLAEAGTQLANGEFPQASTDVPEPLSLRMLRPRSRGAWLARML
FT                   RQRARRRDFRITLLDVSGTMFRNQPEEAVLGPSSDDYVSDLFAQTPEAGDDVENLVDHL
FT                   ARADGMVYLFDPLREAGRGDSYQFLESMLGRVALRAEELSRLPDGKLPHYLAICVTKID
FT                   DPEVFRQAYDGGFVGISEDETLQPEIVDDDAADFFAELCRGGRAGSGVLVRGMLERYFH
FT                   PDRIRYFATSSVGFYIGPSGYFRIQDFRNVEDGVGGVNRIRGRARPVNVLEPFLWLEDS
FT                   IRRARPPRAVEPTRPREPGDDLDDLDDLGGPDGPDNPDGLGPPTGTGGDWPRPAGGAGD
FT                   GTFNPPPPPGPLVL"
FT   gene            complement(233605..234006)
FT                   /locus_tag="FRAAL0231"
FT   CDS_pept        complement(233605..234006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0231"
FT                   /product="Putative ATP-binding component of dipeptide ABC
FT                   transport system"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RU35"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58909.1"
FT                   /translation="MSVQAQVLDLLSELQRQLGIARLFITHDLTVVTHVSDRLLIMKDG
FT                   EVVEEGAAKAVFDNPRHPYTKMLLQAAPRLPDSRFQEPRFQEPRLRNHAGRSRAETESG
FT                   RFSPSLLPLRPPPWTYSTAGSAVVGSRGP"
FT   gene            complement(233910..234287)
FT                   /locus_tag="FRAAL0232"
FT   CDS_pept        complement(233910..234287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0232"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   (partial)"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RU34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58910.1"
FT                   /translation="MVEVDRVTRSFGDRRAVAEVSLTPRAGETVGPVGESSSGKSTLAR
FT                   TVTGLTHPDQGRVLLHGQPWSGAAARSRRGRWRRIQLIQSATSPSPRWTCRCRPRCSTC
FT                   CPSCNGSWESPGCSSLTTSPS"
FT   gene            complement(234455..235480)
FT                   /locus_tag="FRAAL0233"
FT   CDS_pept        complement(234455..235480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0233"
FT                   /product="Flavin dependant oxidoreductase"
FT                   /EC_number="1.14.14.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU33"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58911.1"
FT                   /translation="MVAVSIVDQGPVSAEITPAQSLGHSTALAQLADELGYTRFWLAEH
FT                   HGVRNMAIAAPEILIGHIADRTSRIRVGSGGVMLPNHAPLHVAEQFRTLEALHPGRIDL
FT                   GVGRSTGTGDDPTRDALLRTPDGLERFGDHLRHLLGIGGRCQLPADDPHRALVASPAGV
FT                   PLPPVFLLGSSVGSAELAARAGLGYGFFCVYQDPAVAARALRRYRESFVPAAPGDRPLG
FT                   ILAARVWVGEDDEHAEALAAPERLAVLDHLTGNPSPLEPVERALARRLTDAQRAARDTL
FT                   DVRGDVVGGVDRVASRLGELVAASGADEVMAISNIHDPEDRRNSLRRLAVAAGLGPAPA
FT                   R"
FT   gene            complement(235481..236794)
FT                   /locus_tag="FRAAL0234"
FT   CDS_pept        complement(235481..236794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0234"
FT                   /product="Nitrilotriacetate monooxygenase."
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU32"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58912.1"
FT                   /translation="MHLSVHPVAAGHHPGAWRWPGSDPLAFARIEGYLEVAKLAERGRL
FT                   DSIFLADVPGLHADIDNYPQLNGLEPTLILTAMATVTERIGLVGTASTTFNEPFNIARR
FT                   FQALDLISHGRAGWNAVTTSGPRVSANFVAQEPSSQTRYARAEEFVAVVLDLWRSWAPD
FT                   ALVADVESGLYADMAKIRPIDHQGRFFSVRGPLSLPPSEQGYPVLYHAGVSDQVRTLTA
FT                   RTGEAMFTAAVDLDTARAELDVVRSRAAGLGRPPDAVRFLPGLVTSVGGTEREALERRQ
FT                   ALDELSDPRGSLRALAAQLGLPAEDLELDRPVPPTLRENLARVRGHARPFARLAAAGHT
FT                   LRDIIRRGGGGGHIVAVGDPEQVADVIETWFAAGVVDGFTLMPDVTVDGLPALVDQVVP
FT                   ILRRRGIFRSDYRGTTLREHYGLPIPDVAARRPLARAL"
FT   gene            complement(237246..237890)
FT                   /locus_tag="FRAAL0235"
FT   CDS_pept        complement(237246..237890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0235"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RU31"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58913.1"
FT                   /translation="MVDQAESQERGMRSHARRNRERILAVAREALASRDGDISLNEVAR
FT                   RAGVGTGTLFRHFPSRDALLEALLHDRTAALCAEAERLLGAADAATALFDWLADLISHV
FT                   AIYQGVSAALLAGSRDEGSELHRSCRAVDLAAESLLIRAQRTEQVRADVRPDEVISLVS
FT                   ALSWVKEQSPDRDDHVRALLTVMVDGLRTFPSPGEQGEQQGTTPPRRATDS"
FT   gene            complement(238008..238994)
FT                   /locus_tag="FRAAL0236"
FT   CDS_pept        complement(238008..238994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0236"
FT                   /product="Putative esterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU30"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58914.1"
FT                   /translation="MSSSAPRPGTLDPELATVADALTSGGPDVFTRVREQAQAELAEQL
FT                   ARAELPPVEAVDLSAPADPAVPVRLFRPQRRPSSLPVFLWIHGGGFTAGSAEALDPFCA
FT                   EIASRLDIAVANIEYRLAPGTPFPGPLHDCYAALRYVYHAARSLGLDENRIAIGGASSG
FT                   AALAAGTALLARDRREVPLVFQLLDVPLLDDRLSTESMAQFVDTPGFTRAGAAAAWTAY
FT                   LGPDQRPGDPDVSPYAAATRATDLRGLPSTYLSTMELDPARDEGILYALRLLAARVSVE
FT                   VHSFPGTFHGAEIFAPGAAVSRRAAEERLRALARGLSVDADRRVRLT"
FT   gene            complement(239175..239699)
FT                   /locus_tag="FRAAL0237"
FT   CDS_pept        complement(239175..239699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0237"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU29"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58915.1"
FT                   /translation="MYEPGSTPTSERAADMTLSAEDTAFIEKNPTAAMITLAADGPTKA
FT                   ARVIVAILGGRLWSAGTVDRARTRRLLRDPRSTLFVFEQGHGYRSLETTVTILDGPAGT
FT                   DANVRLFRKIRGRPAGPIEFFGTEYDEEAFRSAMIADGRIVYEFNVLRSSGVDHVLTEA
FT                   PTLDARSQHRS"
FT   gene            239864..240271
FT                   /locus_tag="FRAAL0238"
FT   CDS_pept        239864..240271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0238"
FT                   /product="Putative tetR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RU28"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58916.1"
FT                   /translation="MEEISRRAGLATATVYRRFPTRAALAAAAFAEQLAACGNILDLAL
FT                   AAPDPWRGFCRFVLRLCPQPPAPIPARSASRLRRLHAGGCARLQPRRFFSSRAAERWLS
FT                   VRAAAGRNGQKGTGTPCLTLRTSGSSRTCAR"
FT   gene            240435..242327
FT                   /locus_tag="FRAAL0240"
FT   CDS_pept        240435..242327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR026337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58917.1"
FT                   /translation="MRPRLGTHRLSASDVDALALGTLDADIVRRLAEAEISHRRMAFRA
FT                   VLDLLRDQPAASAPLTPADQAWDLLIALERRDRAMVHAVLDRPFAGAWAARLLRRLRAR
FT                   PHDDVPLWVDVGYLHALAAAAAVRVGVPAEIAVPVRAGVVHLPTLGHTRLPAGEPWETA
FT                   MVRVGVDGAEVIGSAGRAMVGRGVGSDGWTDGGSWTDGWTDDPAQPPVRGTAAAAVQWH
FT                   PTRTSRAVGVVIEDADPYRLVNRAAAPVWLPAADFARWERRLADTWRVLRDGHAELAAG
FT                   VGIVLSTVVPVPCAARFRSFSATFGDAIGGVELSEPHDALDGAAMLAHELRHAVLDALL
FT                   HVVGDFVDPAAPADPRYAPWRDDPRPPLGTLHGVYAFFGVAEFWRTQRRLSVGADAMLA
FT                   HFEFALWRRAVLDTATDLLRTGPLTPPGRRFLTGIATTVQGWISEPVPVEARRLADLAV
FT                   VDGQALWRVHHRAPEPAAVRHLAEAWSAGADPVAVGVPTRIVPDPGARALDTRACLARL
FT                   WLADRDEFRRLERDGPHRAYRGASRADCALVAGDRARARRLYEAELARTGGDRRALVGL
FT                   GLAIGDDEPAGRVLRERPELVHAVAAAVARGGGRAASPALAEWLLPVVAQPAGS"
FT   gene            complement(242324..246364)
FT                   /locus_tag="FRAAL0241"
FT   CDS_pept        complement(242324..246364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0241"
FT                   /product="conserved hypothetical protein; putative ATP/GTP
FT                   binding protein."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RU26"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58918.1"
FT                   /translation="MTRWADDRVGVGEQPDQPDQPDQPDQPDQPDKPLLRYLPGPVRVD
FT                   LPPAVRDEDAFTRALSPLVDSEPARSPGPAVLDEEATALSLLQGTVAPSLLVRPTEARW
FT                   ELALVVDLSPTFSVAWADAVPGLVRVLARQPAFRDVVVAHLTADDQQGGAPRLRGEPDG
FT                   PSIGSPSRLVGPGGRRIVWLLTDGLGPAWRSGRMSEVLAGWAVCGPVAVVSVLAAHVWD
FT                   QTDLGAEGVRMRGAGQRAAGQVLSWNHSDLSLLHGDVDEPTGRQTTGTTTPVPVLELDP
FT                   SWICSWARFVAADEPTWFETIAVVTGSERSPRREDAAQTPAPAPAERLTEFFALASPAA
FT                   RRLAGLLAAAPFLDPRVLRTVAGIAGAERRSISEVFAFGLLTVDGPAFAVDPEVRRRLR
FT                   LLVSRGDVDRVGRAVRSARGAGQAESLGTPPVADPPAAPPPKHLGALAGGPTPPHKLDT
FT                   KGDDLNTMSSIAGTDLPRSSADATSTTAAGAEVTGGETNAPPGGPPVTSGTTLRPTSTA
FT                   GRLPRVWGNVPPRNPHFTGREDLLTALHSRIGEGTTAVLPEALHGMGGIGKTQLATEYV
FT                   HRHLSDFDLIWWIPAEQTVPIGNALIELGQELGLDVGTEANVAVRRVIEALRIGDPYER
FT                   WLLVFDNADDPQAVRRFFPAGPIGRILVTSRNPAWINVSGQLEVALFKREESIELLRSR
FT                   GASLAHADAHRVAAALGDLPLAIEQAATWLGETGMSADEYLGLLEDKLTELLGTPPADY
FT                   TLPVTAAWNMSLDRLAENNAAALELLQVCAFFAPTPISRQLLSRAHSETISPALDEALR
FT                   DPVKLNRAIRDINRYSLARIDHRDNSIIMHRLVQKVLIDRMTENQRGKMKHGAHVLLSA
FT                   SDPNDGTNPGLWRTYADLYPHVVATNTEECDDPRVRQLLLNLSDYLWWWGDHQVSNDFS
FT                   RKVRAAWHAGFGEEDPYSLQMGLRFGWGLATLGRYTEAAEVNRRTFELSTRVNGPDAEL
FT                   TIVLMGNIGADLRAHGEFTAALDVAQDAHRRAVKAFGPDDPATLNTARSVGGGLRLLGR
FT                   YAEAAALDEDIWRRSVLLYGEDNANSLAVLTGLTIDRRELGDYLGARAAQEAIDARYRR
FT                   LFSESADHPARLYSSLDLAVAHRKAGDHDRALALSRDAEQRLTNRYGEEHPSSLAAALS
FT                   LSIDLRHAGRLHEARETCGRTRRRYAERLGDTHPYTLAAQVNLAVIDRLSGQTDAAFDQ
FT                   NEQTLAAFAQRLGETHPSTLACATNLASDLYALGRFQEAHDRDLVTLASSTEVLGEGHP
FT                   STLVVAANLALDLRALERKDEALELQAATLTRVDAVLGRDHPASRQVAAGVRLDSDVDP
FT                   MPI"
FT   gene            complement(246361..247497)
FT                   /locus_tag="FRAAL0242"
FT   CDS_pept        complement(246361..247497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58919.1"
FT                   /translation="MVDDHRAGGADGARRPDAPPWWLFRGTGEPVDGKLPWPPAPAWRR
FT                   FPAPAHEGAAPPGDDDAIARHRRAIAALLLGPEQIAAVNVGLLLRRPLLVTGPPGMGGA
FT                   GLAQLIARELRLGRVLRWTVNSRTTLREGIYDYDVLGVAHSALLERPTEPAGEAGGLSG
FT                   PRGSVGDHLADRPAAGSPPVPRHIRLGPLATALLPRVRPRVLLVDRFDRCGHDLPDDLL
FT                   DVIEEGRVVVPELARLPSADGPFRVAVDDPGGHAEVGDGVVACAEFPVMVITSNGERDF
FT                   SPAFRRRCVAVQLPEPSRDELEALVAAEFGADSRAAALVERFENSRGAGAELTVDHLFD
FT                   ALHLASAGVLDEDAARTLDAVWGRESAGSARRLPGRLL"
FT   gene            complement(247497..249161)
FT                   /locus_tag="FRAAL0243"
FT   CDS_pept        complement(247497..249161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0243"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58920.1"
FT                   /translation="MSSSQRDKLRSDILVHVVNCLDASTDLYSPAARNLLISRFEQRSG
FT                   QRVFIPHSDVTRDWWFRFVEACLNDLDNRFEERREYLANGFASLVDAIHDLRPGSVLVD
FT                   LLLRLRDEWEAAEVADEAGGLWDLLREELADMPARRVVRAFHDACHPAHPPAHCVDAWH
FT                   LFLWAASREPEPARLPSHARFLLQCAHVLTPGTRVRVEAWLRGEAHRSGLTHELNQTQL
FT                   AVGRPGHQRTYVVSLSFQPVGPSPEDHLASARLYGADHEVRHLGTPRMARPGGFEEIAA
FT                   GVVDEAEEILKEETPLSEPVSLAVEVFLPLTRMDLPVTSWRRESDGDPRLLIEDHTVVV
FT                   RSFERTRQRGPSLRQRRRWAQLLRPSPPAMAAAHAADLKEFELARNDRIVAVVLSGPPT
FT                   PGSPAGKELADALREGIGVVAWQHADPDRPATDTALLDLLTRVDAHSGVGAFTGVDAHA
FT                   DVDSLSNVFPLTLPRRFREENLIRLERRLPETAGSANSRDTANSQDTANARDMANSRDM
FT                   ARRRVATLLWEDLRQDTGQTAPPSTAPVNRRPVEEPR"
FT   gene            complement(249702..250013)
FT                   /locus_tag="FRAAL0244"
FT   CDS_pept        complement(249702..250013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0244"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58921.1"
FT                   /translation="MDILDAAPGFAGMAARRLLQDRIARRLGPGRRLHLAEYDVARLWF
FT                   VALVEQLSEEPDGLSALSRAVGDLRPGSRLALEVARIAAAVGPPHGPTDTVFGTGESR"
FT   gene            250708..252165
FT                   /locus_tag="FRAAL0245"
FT   CDS_pept        250708..252165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0245"
FT                   /product="hypothetical protein; putative protein kinase
FT                   domain."
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU22"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58922.1"
FT                   /translation="MPGPRRDPIVVNFRAHELNTGSEEGARGDFEMMIAQLVDALHPGA
FT                   RRISPNPGDGGIDVFLGRLDDGIIVWQSKYFMPRVVGKHRRQIEESFASAQKNARASGY
FT                   RIDEWILCIPSSMDHPTTLWWDGWKRTRQAETSTKICSWDETGLRSRLARPEAAAVVAA
FT                   FYPQPGGSPRPSAEQFGIAVPSADLGPGGSAAPGPVDQQPRGGETIRIAGRNCLLQGDP
FT                   QQWRGGDAWVLRTGAATVMATPPRPAWFRQVLIRRPDSAADAHVAAIDTQLRLLDRIGG
FT                   RHGLPRLIEGRVSSAEAAVLSARPAGRTWREVFGPVDPTRARPLDQVTAVGLLTVVERV
FT                   ADVLTRLHDAGHSHRALTPDGVILTTPRGTPTLRDLGLVGVRRRPGEGPAEYRAPEQER
FT                   LGFHRPEVGFRTDVHRLAAMAYHCLTGRPAGGLPAPLRAFGFDVPAELDEVLLAALDSD
FT                   PDRRPGRPGLLIPALRAGTDHLARAGH"
FT   gene            252165..255155
FT                   /locus_tag="FRAAL0246"
FT   CDS_pept        252165..255155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0246"
FT                   /product="hypothetical protein; putative helicase."
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58923.1"
FT                   /translation="MATAPITLPGGIALAPSARVTEQLAGARVQGNEDLDPERFVDQLR
FT                   RMSGTGVPVRLETDRNNSTTFRVYTDTHVALLRPTNRDDGYIVTHVARWGFRDHRSLAQ
FT                   GFLRVHCPQWSLYPHVRYIGAGHRSYSGVLGKAWAALATSAAASARVPARHLDFLDTVE
FT                   RIIMRTRDLERERLAATPFLYRARRATREQRYSARGVYEFRLAETYQISEGAQVQVNDD
FT                   RELRGVVLRSENLDVTVRFDGIPDFARIPAQGALTVLPSDVVYKAQLGAVAALRDGEAT
FT                   SPRLLATLAEHRILRPSQPDRSAIPSRPLDGGQLEAYQRALGEPDLLLVLGPPGTGKTW
FT                   TITEIAVAEAAAARAGAGGPRRILVTSQSNRAVDNVLAGLADLLRCVRVGNPEALTGPA
FT                   RELTAEVQVEELKDNLLRYTEPIVSALEPFSGAGGTGDAAGVQLALLRTQIGAAQQSDV
FT                   VVRSRDAELDDISRRVRAPLEPQIAAAQTTVERLAAEAARRQERHTRARLRHSKAAGRR
FT                   VPGWWAAIHRRGVARRQRALQAAQVRVDEAEQELAAARSDRDGVLAQITMLVARDSVGS
FT                   RLLAEREYAWGDRERALTQAARAAEPLRARLELAGCGSGFPDGEADDVAGWERREQGLL
FT                   DAVGLARTRASLLADWRGRVPTADEELKHELVGYADVIAATCIGVSTKKLLTGLSFDLA
FT                   IVDEAGQIALPDLLVPLVRARRAVLVGDHHQLPPYLDSEVARWAKGLAPGAELSAPVIS
FT                   ETRDIVERSEFERLFERLGAEHGVTLTTQRRMPATVATFISHSFYGGVLTTEHPGTGPD
FT                   PLFTSPLAFVDTSDRPPRERQESRAGTNGGISNRLEANLIATLVARYAGHHRDWAVIVP
FT                   YREQVQLLRRTLISRLGGPGNVEDNIGTVDAFQGNERDLIIYGFTRSNRTGSVGFLSEL
FT                   RRLNVAMSRTRRQLVLVGDLDTLGSSTDAGFAKLIVELRTALSAVGDLRGSREIEARLR
FT                   GTVEEPR"
FT   gene            255152..256381
FT                   /locus_tag="FRAAL0247"
FT   CDS_pept        255152..256381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0247"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58924.1"
FT                   /translation="MSRPPAGAAPAGSAAPAGGAGDWLLFPAFRALELTMAMPEIRPLR
FT                   IFSVRWPLWQVEVQATFEDSQPFDVVDHYLLRGVVEGRLQTQDELARFFGLSGSLVARG
FT                   IEHLLHIGHLQRDGRDAGVLWPTELGGASVRDGVRYVLKESRQLLLFDAFTHRPFPRAY
FT                   YDGSVRIVPDGEGNPGDRRDRFRPLTSPRPFEFDDAVRAVGSRPDRDRFNVPRRLRNLH
FT                   PVSNAPAWLPAHLVLADGATVLAFTQAAQDRDRFLEELCRHAPQVVHTLVGERGAEPRQ
FT                   IWVEWLRAQGLGQAVLTNLPNGVWRATLPSQTFGPAARQPYYRLGSFQVKDTYFLQLWC
FT                   DDEQTRATAVRSRALAISRRYGLGRAEFEDSVATVANLLEVLVPTFDELLEYAAESGTP
FT                   AQLRALEALR"
FT   gene            256427..259906
FT                   /locus_tag="FRAAL0248"
FT   CDS_pept        256427..259906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0248"
FT                   /product="conserved hypothetical protein; putative ATP
FT                   dependent helicase domain."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RU19"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58925.1"
FT                   /translation="MDVWLVGDVWVSDVGGQPQARGVARCPARMIGLSVRGMRMLGSTT
FT                   ERAWSRDGAISAGAELPGIGALVEVRGQKWVVAETDAQAAPDAQTAPDGAGARHGSGPA
FT                   VPSSLVTLQSVEDGRYGQTIEVIWEVEPGRRILPSGSLPEVTGGGFDSPERLAAFLDAI
FT                   RWSAVTSADARRLQAPFRSGVAVEDYQLEPVARALEAPRVNLLLADDVGLGKTIEAGLV
FT                   AEELLLRHRARRIMIVCPAGLTLKWRDEMAEKFGREFTIIDAERCAAVRRSHGSAANPF
FT                   EVYPLTIVSLPWLRGPKAQRLLDEVLPGDGQPTYPRTFDLLILDEAHHVAPAAPKQVYA
FT                   VDSQQTKLIRRLAPHFTHRLFLSATPHNGYLASFTALLEILDDQRFARGVAPDRKAVEE
FT                   VVVRRLKGGIENADGTPRFQLRRSIDMPVVYPDSEREIHGLLKEFSALRRVRLNTERGR
FT                   KATDLVTLLLKKRLFSSPAAFAHTVVVYRETLVARQGRPGRAGSAGGSQVSGGLGGFDD
FT                   DLDEVPEWLEDYFDDVATLDDTQLAEAEDDALDRVRLMQPDPTESEIALLERMQRWGDA
FT                   HEAEPDAKARALLDYLAAVCRPDGKLWLNERVVVFTEYRDTQIWLAGLLRQEGLGGERL
FT                   GLLHGGLPTDEREQLRLAFQADPSEHPVRILLATDAASEGIDLQNHCHRLVNYDIPFNP
FT                   NKLEQRIGRIDRYGQRQSPEIRHFVGSGWTGAVDSYEADLEFLSRVVKKVAQMKADLGS
FT                   VNAVLSDRVQRRMLGERVADPADLDVTINAAAAKDEAVPVAENVREQVRRLRATLDDTV
FT                   RDLGITPRAVQRVVSTALDLARQQRLTPHVDERGDLFGDHLPGYFPGAPDSDPGDGMFD
FT                   VPTLTGSWARASAGLTEKLHRDGAPPRQLPITFDAAVARGRDDVVLAHLGHRLVDMSTR
FT                   LLRGAVSNADVGLHRVTAVQTDDPRCEEVLVGAFSRFVLVGADGVRLHEEVLQAGGWLP
FT                   AAGRFRRLENLTVLGEIVSSALAAGRPVTKETQERLAERWPAAREGVLSALNWRTRTRQ
FT                   ESLTRILAQRQSAEETRITAILDQFAGTLKAALDSPENEEGVLFSLEQLTRSREELAQF
FT                   RKDRQSWEERLHRLEREKQRELDVIAGRYRDPQQHQFPVAVVLVVPAREAGR"
FT   gene            259903..264222
FT                   /locus_tag="FRAAL0249"
FT   CDS_pept        259903..264222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0249"
FT                   /product="conserved hypothetical protein; putative N-6
FT                   Adenine-specific DNA methylase domain."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RU18"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58926.1"
FT                   /translation="MSAGTASAGTAGAGTKSRGRGGSGGPGGSGRRRPPVQDGAAQHRD
FT                   WLSLIDVSGPFLSLPVLRRVWPTLDALEKKTRERLRREHAAWLDAPAAGQRDWARFVLA
FT                   ELLGWGDALVWPEAAGRLDVGTVDARTVDARTDARTDARAETETETGAADPLSALAVDI
FT                   DQHDTRVVPSFVLVDPNVDVAGAGAGVKPDAVRLLGLVVAPGQSPTGRIAGQAWAATPV
FT                   DRAALACRHHGVELALVTNGRQWALVWAPRGGVTTTAVFDAVSWPEAAERDVVRAFVSL
FT                   LCRRRFFGVPDSETLVPLLKASLGSQEEITEALGVQVRQAVELLVAAFGRWHVAEGARG
FT                   GVGLRDVREHDVYRGAVAVMMRIVFLLYAEERGLLPADNDLYAGTYSVGRLCAELEQQL
FT                   SDGATEDDLEQSTAAWHRLRAVFTAVYTGVDHPRLRMHAHGGSLFDPATHPWLPLGVDD
FT                   RTVLHMLRAVQYIQVGSGRSRERRTLSFRSLDVEQIGYVYEGLLSYDAKRAGAGEVVVG
FT                   LVGKEGLEAEATLSELEDLASRHRGRPLLAAALAETYAASGLGSAKAIEKRLVPLEDAE
FT                   REEARKALLAVTRGDYPTAERLLPFFGLLRRDLRDQPVVILESGLYVTESPLRKNTGTH
FT                   YTPRFLAEEVANNALEPLVYAPGPLQTADTTAWKLRSSTDILALKVADIAMGSAAFLVA
FT                   AARYLGARLVEAWTLEGDPRARGRSDANLPGHDETGEWLGRDAEEDEVVVEARRQIIEH
FT                   CLYGADINEMAVEMAKLSLWLVSMDTRRPFTFLDDKLVAGDSLLGITSLDQLEYMHLDP
FT                   AKGREIHSDIFGWTAGIRELVRDVAAERRELVEKDGSSLDGLDEKKALLDDAKARTAQI
FT                   TLFADALIGATLAHAGRGERGQKIASETAAKLAADIAEGRRDVDEAQREITRWLATDHV
FT                   KGSFARKPIHWPLVFPEVFEKGGFDAIIGNPPFLHGSRITGSSGFSYREFLIDVVASAT
FT                   RGNADLVAFFALRSAMLVNISGQFGLIATNTLAQGDTREVGLDQLVRAGATIRRSIKSE
FT                   AWPSRAVTLEYCAVWISKTPVNEAAGCVADGRQVAGITTLLDAESRSVGSPKRLVSNEK
FT                   IAFYGTYVLGMGFTMSPESAVGLIRQEPRNRDVLFPYLGGDDLNSSPTVEASRWIIYFR
FT                   DWPESKARSYLDCYHQVLRLVKPEREKNSIKQVRERWWIFKRPTTELFRLASGLDRVLV
FT                   IARHSKTVLPVFVSGDQIMSDATVVFATDSAASMSLLSSSHHYWWADSWASSLKGDLRY
FT                   TPSDVFETFPLPELASEMRELGERLDGFRREVMLGRQSGLTKTYNLVFDPACKDADIVE
FT                   LREIHRLIDEATFRAYGWDDMIDRGLDHGYHPAGKYTRYTIGPWAQREVLDRLLELNHA
FT                   RYAQEVAAGLHEKGARKKGSRAKPAAAAPPGEALFDI"
FT   gene            264711..265328
FT                   /locus_tag="FRAAL0250"
FT   CDS_pept        264711..265328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0250"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58927.1"
FT                   /translation="MLPENDDGSDCHGGFRMGKARLFVVATVLAGMVGLTGCLEDTSVS
FT                   TTGTTAGSAQGAAANGSTGAPAGKPGSAAGGAKQAQYGEVLEVRKGGDVAATLSVAAPK
FT                   AVGSFFGGASKPTSGPAFATFIVSFSSQKQGFNVNPFDFFVRTPEGARVQPTFGCEPAF
FT                   NAATLGAGEKFQGCLTVDVAHGNLVYTSGLFDSTSLVEWPGF"
FT   gene            265546..265716
FT                   /locus_tag="FRAAL0251"
FT   CDS_pept        265546..265716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0251"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU16"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58928.1"
FT                   /translation="MERGHLGCGYAIRAPAVPSAPSLFTVLPSAFLPCAIAGVVARARC
FT                   RVRGGRPGDRE"
FT   gene            265658..266284
FT                   /locus_tag="FRAAL0252"
FT   CDS_pept        265658..266284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0252"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU15"
FT                   /db_xref="InterPro:IPR025637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58929.1"
FT                   /translation="MSSPGPDAAFGEVGREIASEVTAWALAVTPLVGLVAELVIAALFA
FT                   DLGVSTSVLLGLLVGWACGLPLAIADYRALRRLGEDPAHWAVALVAPWAYLCARAIRRR
FT                   PAPWTTWAALGLCATLTLLTILVSTPLTRSVLTANAVFDQGRVQREIAAQVKSQSGVTV
FT                   KVSCPKDPPLSAGSTFRCLVRGGGGAGFATVTMEDGSGSYTWVIP"
FT   gene            266415..266582
FT                   /locus_tag="FRAAL0253"
FT   CDS_pept        266415..266582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0253"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58930.1"
FT                   /translation="MRRSGFAPWRLPDGSIENPVNVSTEEYCALGITEVVRPGEDGYEK
FT                   LDTWLKSRGR"
FT   gene            266661..267359
FT                   /locus_tag="FRAAL0254"
FT   CDS_pept        266661..267359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0254"
FT                   /product="putative Ankyrin-repeat containing protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58931.1"
FT                   /translation="MESQPFYAAPETAQECTEWFGYRRDAVSVEVAAVRERITDAARDG
FT                   DWEPLFRELDAASYQNWVNSTRLDGHREFAPLHQAAWHGASSGIVAGLLSRGAWRTLRT
FT                   TRGERPIDIAAARGHSHLADVLRPVVRHPLSVEVVVALERRLHPLLAEVSMGLTEQQRM
FT                   RLPQVAVLTEISEGRLWFPVPGMYGGADIRLEAAEGALIVESWCRVVEGSGCRHRVTPD
FT                   GTVLLAEGFV"
FT   gene            267445..268365
FT                   /locus_tag="FRAAL0255"
FT   CDS_pept        267445..268365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0255"
FT                   /product="conserved hypothetical protein; putative
FT                   Corticotropin-lipotropin precursor."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58932.1"
FT                   /translation="MPRDLPAPGADLPEPLPGAAADRTDRISGPEAKARLLDLAATRAG
FT                   DASKPVDSSFPEQRGEELSGPERKARALDRLALGRLALEHGGDSADVVRRPPAAPQREL
FT                   TSAERKAILLDQASDRLQRSDRESAGEAELSGGAPEQHRDRSVPIGPDRPVPTDLRPPI
FT                   TEKAFNHVLNGEWSRKGKPVGFHSAPEGVPPEGRRVSWAAEPTVEGAYGAKVEFRNEST
FT                   GEWREKKVRQHTMFPDFWSTEKVRGAVQSAYDEVYDTQISPALRAGSDLSKTKWTGSYE
FT                   GVHIRFYVEPDGSVRTAFPVIDEED"
FT   gene            268352..268735
FT                   /locus_tag="FRAAL0256"
FT   CDS_pept        268352..268735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0256"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58933.1"
FT                   /translation="MRKIERCAMWKFVENEKGWLKVDPADHFPEGKLLGIRDWLEDDIQ
FT                   HSLRSLELFRDDWRRVRSGECEGTAGNSTEQTLVGDEVLFESLYERWDDFAMPLAEMYE
FT                   ILDRYEDFLRERAARRRQAAAGG"
FT   gene            268791..269072
FT                   /locus_tag="FRAAL0257"
FT   CDS_pept        268791..269072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0257"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58934.1"
FT                   /translation="MSDGIELRIEWIDAPGVRAPEPAATWARYELWVGGRCVTQVEEPD
FT                   GTFRRSVYGSVYPLAEWIATNWWPLTGHIRPSAIRSEHWTWSNLRRYP"
FT   gene            269109..269312
FT                   /locus_tag="FRAAL0259"
FT   CDS_pept        269109..269312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0259"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RAN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL29814.1"
FT                   /translation="MAWPDLTAVPEGAVTRVVWAADDDGTLGQPRFASSGQALVPSEEA
FT                   RHPASTTTKLDGRNQPRPRDRR"
FT   gene            269648..269830
FT                   /locus_tag="FRAAL0260"
FT   CDS_pept        269648..269830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0260"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RAN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL29815.1"
FT                   /translation="MTEFVADRKQAVVISVAAVCRSASSDRQGLPGLARQRLIAGVGRW
FT                   QRLGLAHAPGHPEGR"
FT   gene            269947..270162
FT                   /locus_tag="FRAAL0259"
FT   CDS_pept        269947..270162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0259"
FT                   /product="hypothetical protein; putative HTH-type
FT                   transcriptional regulator."
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU09"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58936.1"
FT                   /translation="MIAARDLGAAIKYFRTSAGVTQVAAAEATGVGQSYISSLEAGRFG
FT                   SSLTHALRLLRFVGCEVVVRPRRARG"
FT   gene            270131..271429
FT                   /locus_tag="FRAAL0260"
FT   CDS_pept        270131..271429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0260"
FT                   /product="putative HipA protein."
FT                   /function="3.1.2.3 : Repressor"
FT                   /function="5.1 : Cell division"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8021189; Product type r : regulator"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58937.1"
FT                   /translation="MSSGRGGHVADHLVAWLYETPTAVLTPGPEFRITLEWRAEAVERW
FT                   GAGSPALSVGLPIGAVIGPRDMRGLDFFENVLPEGPTLQRMAAIAGVRPADTYGILKAF
FT                   GRDCAGAIQVLPEGEEPGTGDEGGYRMMSSDDLRRVIGALDVAPLGVAPERGFRPSLAG
FT                   FQRKALLGRAADGSWQLPTGDAPSTWILKPDGPHAMAANEATCLALAAACGLAAAEGEL
FT                   LDVAGLPVLAVRRFDRQERTSGRLPVRVHQEDGCQATATPPGMKYEEQGGPSLRDFAEV
FT                   LRTFGDPRDVTVLLRRATFNAAVGNADAHAKNFAILHQADEPDVRLAPLYDVVSTIALE
FT                   LRDHLGQPLRADTHLGQRVGGQADIQAVTAANLVDEATTWGLRRRTAAAVVTDTLDQIL
FT                   ASIPDTPGDDRVRAVIKQQTERVRLGRNSPSKP"
FT   gene            271675..272928
FT                   /locus_tag="FRAAL0261"
FT   CDS_pept        271675..272928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0261"
FT                   /product="hypothetical protein; putative HSDR_N domain."
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58938.1"
FT                   /translation="MILIVAGEGCHPQPQDGRRSVAGVRVARTLQETLKECAERLGRYR
FT                   QGQRIGEQNTKASLIEPVIEALGWDIHDLDEVNREYRFGPSANPVDYALLLLRRPRLFI
FT                   EAKGLGEDLSQLRWATQVLSYATSAGVRWVVLTNGDEWRIYNAHAPVPVDQKLYRSVSI
FT                   SADPGGAADVLALLGKDAMNGDRIDDLWRAEFVDGQLRSALAELFDGGDPAAELVSLLH
FT                   RRTRDLSEADVRAGLIRTRATFDFPVAGAVPSTSSLPPAASPPPSPSGVGIGPSPRSGS
FT                   ATSAATGPPAPTAVASATATQPARVTPEERSLKLTDLVKAGMVRPGSTLTGDYRGGRRT
FT                   AEVLPDGKVIFGGDELSLSAAGAAAKVDIAGPGLPETARQTDGWEFWKAPDPVNGQLVS
FT                   LKKLRRDLARSLPRRPSP"
FT   gene            complement(272998..273162)
FT                   /locus_tag="FRAAL0264"
FT   CDS_pept        complement(272998..273162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0264"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RAN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL29816.1"
FT                   /translation="MTSAHHTLDELAAQQRVRPVRSLAELALSEPLTNEEYADFLTAAM
FT                   SARGGQLPQ"
FT   gene            273419..277441
FT                   /locus_tag="FRAAL0262"
FT   CDS_pept        273419..277441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0262"
FT                   /product="conserved hypothetical protein; putative
FT                   superfamily II DNA and RNA helicase."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58939.1"
FT                   /translation="MVALDGQSALFPPEKGASPSLAGSGGASGGGAGTSDGPSPAEILD
FT                   KPVEFVPATSYEVRDAFADLVRRDLLGPWDGEQEVFHHRAMGPRERYLVGMLGPKPAPR
FT                   GAREAAAADTVADTETAVQGDAETDLPEILTPQNRGRIWASSMGLSFAVPAGPDGAAVD
FT                   VVAVTATWGQYVRQETEDDEGRKRTAWAREPVVHANREIRLDGSLGSDAYRVPLVGDDE
FT                   TGVFLAVVLREWAGPRERSGRRIVELTLVNGQPEPPSHADTAWLFQPRLTVTALDGERA
FT                   VFLPVDDPEDGVGADHDGHDHEDHEELHLRLLYRTQRRYANGRNVAVHPSVRDGERCAH
FT                   RLETTWLPTYDVPSTIAPAGPGTPLEHVELAMDALAVADAADLRRGLSPLADGYDAWLD
FT                   EREAQVPSLPERLRPAARTAIGEARVAAGRIRAGIALLADPAQPRQGEALAAFRFANRA
FT                   MAAQRRHTAIARLRDEHGLSYPEATAKVEAEGARAASWRPFQLGFVLLNLPSLTEPAHP
FT                   ERAANASAVVDLLFFPTGGGKTEAYLGLTAYTFAIRRLQGTIGTGLDARSGEAGVAVLM
FT                   RYTLRLLTAQQFQRAAALVCAAEVLRRADEATWGAVPFRIGLWVGGGVSPNRFEEARDQ
FT                   ISEAREVGNGKRANVLQTLSCPWCGTALAAHTDAHVDEDTSRVLLYCPNGETGPNGEGA
FT                   DACPFSRRLSPGEGLPVLTVDDEIYRYAPSLVIATVDKLAQLPWRGEAGILFGRVRERC
FT                   PRHGYRHDDLDARTGCASRHHRRSDLPAVASEPVRRLRPPDLIIQDELHLISGALGTTV
FT                   GLFESAVDELCSWPVPADATGAAGGTTLTGPKIVASTATTKRARDQVLGVFGRRLAVFP
FT                   PQVVDVADTFFSRQVPVTPATPGRRYLGVCAHGTRMKSAEIRLAEILLLAGQTLFDRHG
FT                   ETAEAYQTLVGYFNATRELAGMRRYLDDDVTTRVRTHGTRKGLSNRIVPASGMLTISEL
FT                   TSRVSSADISDVLKRLEIAFDPDLDTSSRRQAIADNWRDAYRVRDSRVRERPTAHPVAE
FT                   RARARQDRIPVDVVLATSMLQVGVDVSRFGLMAVIGQPKNTAEYIQASSRVGRDAARPG
FT                   LVVTLYNWARPRDLAHYEDFEPYHASFYRQVEALSVTPFTRRSLDRTATGTFVAALRHL
FT                   DDANSRNTDAHAVDLAGPIATGLISRLLARAEAVAGPRGQEYLGERLRDLVDRWQLMKT
FT                   GPTRLGYRRSGGPQKVTGLLEPAGHGRWEVLTVAQSMRETEHEINLLVPGADEIYSPAY
FT                   GEPGWSFGAPPDADTDTDPDPDTDIGEDDRDENAPVGDELGETRLAPARPRQGRGA"
FT   gene            277441..279366
FT                   /locus_tag="FRAAL0263"
FT   CDS_pept        277441..279366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0263"
FT                   /product="conserved hypothetical protein."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58940.1"
FT                   /translation="MATRFHRRVGAVRPSHLMFTSGVGALVDLPSFSALVRGLDDWDYR
FT                   NVPEYEPIAEPRLLAAVRRVYDRNVTELRPAPWADTDPGDRSGQGARIGVPTTPFPNWL
FT                   RCTACNELDVIASRTFTFENPWLHRPQDARFFHEVCGRKKSGRRPLAVAARFVLACTAG
FT                   HLDDFPYVMFVHRGGECAKASHPRLRMEDRGGNLGANVEIRCVNCDQRRNIRDAMGRRG
FT                   TQNLPRCRGRHPHLGTFADDGCRAESRLLVVGASNQWFAQTLSVLSVPRTGASELAAKV
FT                   EQHWEHLSQIPGETMMGFSRSVMPVFRQLERWTDAEVWAAVERHRAALNAGPGDGAEEG
FT                   DERGYPDLRTPEWEIFSSPVLPEASDDFALRRDPDGVPPRLAGFYTDVVQAERLREVRA
FT                   LTGFTRLDAPDPDDPDLVIRAPLTRGPATWVPASEVRGEGIFLRVPEEILGPWVARVAD
FT                   STEMREHRDAYSRFRVNRYSDRIAGDFDPMQGWPGERFIALHSLSHLLIRTIALECGYS
FT                   SASLSERIYAGSDDDPRGGILIYTAVPDAEGTLGGLVSLAEPDQLLRLTRRALADARHC
FT                   SSDPLCAERLPYAPADFLHGAACHVCLFVSETTCERGNRFLDRRFVVPLGDGPQYRDLA
FT                   LFDELP"
FT   gene            279423..280265
FT                   /locus_tag="FRAAL0264"
FT   CDS_pept        279423..280265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0264"
FT                   /product="hypothetical protein; putative endonuclease."
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RU04"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58941.1"
FT                   /translation="MTASSEPGRARDFAAAVAAAVSTLGPARLGELADRIGPRSAPPGA
FT                   AVGEPGWEEAVIAAIAGPAARDAVRAVLRARRAEEIAPAEAAAYLHGVSAGYAGRAAET
FT                   RVESVWSGPGSREVPVRATARVLMDLVAEATMELMLMTYAARPYPPLLTALSAATGRGV
FT                   AVSVVVETLQGAGGGLAGSEPAAAFASVRGVQLWHWPTARRGHLGARMHAKIAVADRRE
FT                   LLVSSANLTSSGVEENIEAGLFVRGGAPPRRAAEHLAALQASGVLARLLPGPELAAGS"
FT   gene            280269..282407
FT                   /locus_tag="FRAAL0265"
FT   CDS_pept        280269..282407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0265"
FT                   /product="putative type I restriction system adenine
FT                   methylase."
FT                   /function="3.1.1.2 : Methylation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU03"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58942.1"
FT                   /translation="MPNGSDVSATVTASDIARLAGVGRAAVSNWRRRFVDFPQPVGGTS
FT                   TSPLFALTAVEDWFDRHDRPFSVEVGDRVWQQIRGTVEDPRLGELVGHLGGFLLHHQRD
FT                   RDAAVGLLGEPDAAAARLLGPAIERAAPDLPVGFPLIWEPDWVPIARSAAAAADRDGHA
FT                   ALFEVLRVRYREVYSRQVAETPPAVADLMVGLAGLGRMAGELTVLDSACGVGGLLEAAR
FT                   VAGVRRLLGQDVDPTAARITGAGLLLHGADARIVAADSLLADAFVGGQADVVLCGPPSG
FT                   QRAWPHDELVDSPWWGYGVPPRGEPELAWVQHCLAHGRRGAPVLVLMPAAAASRPAGRR
FT                   IRANLLRAGALRAVLGLPLDLFGAGSAPDLWVLRVPGDDVPPAQVLMGLASNDPSTVQR
FT                   AWSSFTDSAPASEPAKAAEPGGAVLPAGFRRMPITDLLDGEVDLNPRSHVLVYPDSVIE
FT                   REFPAVREEFLAALSSLSALTPSIPPPGISSPAKTSGSTAEPAAAFETAGAAQPAWVTV
FT                   GQLAKSGVLTVLTAPLQTRTDAGDLPLLTAADVRRGRGASGRTGLLPGMLMLRSGDVVC
FT                   AMAAGRIAAEVIDEVGAVLGPKVALLRVDPERLDPHFLAGSLRAAGYRAAGGLGVGDEE
FT                   GLGSRSGGMLSRPDLRRVRISALALAAQRELGADFRRLQRLEKSVREAAELGEEIIRVG
FT                   YLGVADGRLRVRGDPDSR"
FT   gene            282486..284120
FT                   /locus_tag="FRAAL0266"
FT   CDS_pept        282486..284120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0266"
FT                   /product="putative serine/threonine protein kinase"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="2.7.11.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU02"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58943.1"
FT                   /translation="MAGRWMIDRRYELEALPLAKGGMGEVWVGRDVKLDREIAVKFVRF
FT                   PDGRPDEELVRRFIRESRITARLVHPGVPAVYDAGTHEGRPYLVMQRVHGISVADLVAE
FT                   QGALPIGWAAAIAAQAAAVLAVAHRASLVHRDLKPANLMLEPDGTVKVLDFGLAVALDR
FT                   TDLSKITLTGQHLGSPAYMAPEQVLAGLSAPATDLYALGATLFEMLTGRRLFAGSSSYS
FT                   VMHQQVEEVPTRASALRADVPPGLDALVADLLRKAPEERPSGAESVYEALVGWMTDLVP
FT                   LPGIVDPAANNPVRMYNRITAYVHPPAPALSAPITTAPTSPVPGSDLPGPGVVEPARSD
FT                   AVAVPQRRSQSAGGIDQVELRRARDEAHSLARASRYSQATAILTEAVARAGREMGADSA
FT                   DVLGLRLELAELLFEGGDFRRAVSEYERLVADLARRDGRDSERLMLARLREATCRALTG
FT                   ETPRALEQLGALLPDETRAFGADDPRVLELRRQIGLLQLGAGHRAAAVETLSALLVDLL
FT                   RVWGPEHPMVPVVRELLAGADAAAAVH"
FT   gene            284200..286377
FT                   /locus_tag="FRAAL0267"
FT   CDS_pept        284200..286377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0267"
FT                   /product="putative DNA helicase."
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RU01"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58944.1"
FT                   /translation="MGFEQWTRGGDVARLGIDKEFLLGFAALEKQVQNRVLDVFAKFEA
FT                   ATHAGLHLEKIGNVRDDRFRTIRIDRFWRGVVLAPDSGDTYTLLRVLPHDDAYAWAQRR
FT                   RVSVNAATGRNEIRDVVAIDATLPELTRRAEQAPSRLFADVADKDLRRLGIDEQTLAFA
FT                   RVLTDVRQLEMARGFLPPNQWDALFGLAAGMTPEEVWAEIGAASEADRASFDADDVVAA
FT                   VERSADRVVLVDGPEELLEVFRHPFALWRVYLHPTQRRIAQARFRGPARVTGGPGTGKT
FT                   VVALHRARDLASQGVGRVLLTTFTSTMCDSLAADLDLLVHDPLERERITVATVNKIAYD
FT                   VFRAWQPQPTILTDAEERAVWRTATRGLGLPFSESFLSEEWRQVILAQEILTEAGYQKA
FT                   RRAGRGRPLGPRQRAQVWAAWRQFDRELRASGRWTHEMICVEAARLLERAPHRPYRHVV
FT                   IDEAQDLSPVQWRFLRTAVKPGADDFFLAGDAHQRIYHNRVSLRELGIQVVGRSARLTV
FT                   NYRTTAEILAWSLGMLRGEPIDDLDGGLDSVAGYRSELHGPVPRLQGFATWNDEIREAA
FT                   EQVRAWIRAGVAPDEIGVAVRSNKFAESLLPALHRLGVPARLLARLPEQQPAPIERAGG
FT                   PAVAVGTMHRMKGLEFRCLTVLGVGERQVPAPGAVTPAGEDEIAHAQDVQRERCLLFVA
FT                   CTRAREELYISWHGAQSPFLAQLGPAAVRST"
FT   gene            complement(286455..287486)
FT                   /locus_tag="FRAAL0268"
FT   CDS_pept        complement(286455..287486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0268"
FT                   /product="conserved hypothetical protein; putative
FT                   cobalamin synthesis protein."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RU00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58945.1"
FT                   /translation="MRVPVIALTGYLGAGKTTVLNHLLQAPGARLGVVVNDFGAINVDA
FT                   ALVTGQVDEPASIAGGCLCCLPDTDGLDQALAKLTHPRLRLDAVIVEASGVADPPHLAR
FT                   LIRFSTVDRVRPGGLVDVVDAAAYFDTVDTVDTGGLPPARFASASLVLINKTDRVAPAH
FT                   RAETVARIADRIRASNPHAHVVDTTHGRVDPALVFDAASPHDPVDELPLAALARHDHDG
FT                   DHDGEPHPRVRAVTVGATGPVDPGRLVDLLEDLPADIYRLKGTVTVDTGRSLRGHVVNV
FT                   VGRQIHVAARPVTDGPSGLVAIGMHLDESSVRTRLEAALQPQTGRPAPDGARRLARYRR
FT                   LST"
FT   gene            complement(287527..287595)
FT                   /locus_tag="FRAAL0269"
FT   CDS_pept        complement(287527..287595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0269"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58946.1"
FT                   /translation="MGLAMLFHSGGGPYGAPREVGG"
FT   gene            287710..287997
FT                   /locus_tag="FRAAL0270"
FT   CDS_pept        287710..287997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0270"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58947.1"
FT                   /translation="MSSKLNWLVCKVGCIECGMIEDPALRIIGVYADEPAAITAARDTA
FT                   QTIAKRWGMTNSDEPYRVNAAEMLGTRMGAGWMWTPADHEQVFAVQVPGP"
FT   gene            288308..290737
FT                   /locus_tag="FRAAL0271"
FT   CDS_pept        288308..290737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0271"
FT                   /product="putative uvrA-like protein"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58948.1"
FT                   /translation="METWMSRVAGAGTDLPAPHVADSHDLIRVQGARENNLADVSIEIP
FT                   KRRLTVFTGVSGSGKSSLVFATIAAESQRMINETYSAFVQGFMPTLARPDVDLLDGLTT
FT                   AIIVDQQRMGGDARSTVGTVTDAGVLLRILFSRLGQPHAGPPGAYSFNVPSVRASGAIT
FT                   VERGASRAVKTTYTRTGGMCPRCEGRGAVSDFDLTQLYDESRSINEGALLVPGYSVDGW
FT                   YGRIFGGCGFFDPDRPIRRFTKRELHDLLYKEPTRIRVDNVNLTYEGLIPKIQKSFLAK
FT                   DVDALQPHIRAFVERAVVFTTCPDCGGSRLSEAARSSKIAGISIADACAMQISDLADWV
FT                   RERAEPSVAPLLAALHHTLDSFVEIGLGYLALDRPSGTLSGGEAQRVKMIRHLGSSLTD
FT                   VTYVFDEPTIGLHPHDIARMNDLLLRLRDKGNTVLVVEHKPETIAIADHVVDLGPGAGT
FT                   AGGTVCFEGTVAGLRASGTLTGRHLDDRAALKETVRTPTGRLAIRGATANNLRDVDVDI
FT                   PLGVLVVVTGVAGSGKSSLVHGSLPALFGEKAVEPAGGALVSIDQTAIRGSRRSNPATY
FT                   TGLLDPIRKAFAKANGVKPALFSANSEGACPTCNGAGVIYTDLAMMAGVATTCEECEGR
FT                   RFEASVLDHHLGGRDISEVLAMSVTEAAEFFGAGEARTPAAHTILGRLADVGLGYLSLG
FT                   QPLTTLSGGERQRLRLATHLAAKGGVYVLDEPTAGLHLADVEHLLGLLDRLVDAGRSVI
FT                   VVEHHQAVMAHADWIIDLGPGAGHDGGRIVFEGTPADLVAARSTRTGEHLAAYIGA"
FT   gene            290879..292714
FT                   /locus_tag="FRAAL0272"
FT   CDS_pept        290879..292714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0272"
FT                   /product="putative serine/threonine protein kinase"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="2.7.11.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTZ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58949.1"
FT                   /translation="MARRLGSSYILETVIGRGAMGEVWRGRDEDGAPLAFKLLLPELMV
FT                   DPQIVARFMRERSVLLRVDSPFVVRVRDLVAERGDLAIVMDFIEGSDLRRELIRRRTVP
FT                   PSEAVATIVDILTGLDAAHELGIIHRDLKPENVLLDRHDGGYRPKISDFGIAGLTDAST
FT                   RLTIGPGLLGTPLYMAPEMIEEGVAGPPADIYAAGLMLYELLCGVTPFSGRAPLALLRA
FT                   HVDLLPGRPPNLSDELWSVLAAMLAKDPAERTGADQLRALLPDLHGLPASPPLATPPLA
FT                   TLTPGSLPPATLPPIAVPPDAVPSDASLLDAVPPDAAVAIGPDPDRPGHSSAEPGGRGR
FT                   RRLLVVALGIVVVIVATAAALVSTTGSSSDPSRRLLIQAGTRDQQARAGQPAATAGPSP
FT                   GASARADGAGSPAPTSMPASASTPEPGSGLAPEPGSGLAPGSAPQPAPAPASAVRVAHP
FT                   TAPPPQRPAGPAVAAPPAVAAPAQGVLGRTFTDVATHSCLDSNAQGQVYTLGCNQGNYQ
FT                   HWVYAAGNDGVRLRNAQTNNCVGSRANPAPDGTRYQGTVYAIGCDGGAAQLWTTSSDGA
FT                   GMTFRNAATGECLDSNADGRVYTQGCNHGDYQRWG"
FT   gene            complement(292865..294175)
FT                   /locus_tag="FRAAL0273"
FT   CDS_pept        complement(292865..294175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0273"
FT                   /product="Putative dioxygenase."
FT                   /EC_number="1.14.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11959542; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTZ5"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58950.1"
FT                   /translation="MMTASTPTYLSGLLAPVADEIDAVDLPVTGALPDALRGRYFRNGP
FT                   NPPPGADPGHWFTGAGMIHGVRLRDGRAEWYRNRWVRTRELAGAPFVGPAGFDLTAVPA
FT                   NTSVIRHAGRILALVEVGLPYELTSELATTGPCDFGGRLATAMTAHPKRDPLTGDLLFF
FT                   GYGMAPPYLTYHRLSAAGELVESRVIDVPGPTMMHDFAITESHVVWLDLPVVFDLALLG
FT                   QGMPYRWDDAYGARIGVMARDGGETRWFDIDPCYVFHVGNAHVDDAGRVCLDAVRYDRA
FT                   RFAAIWPRLGGAPTEAGMIADGFAHRWLIDPANGVVREQALDDRAVEFPTLNDQRVGRP
FT                   NRFLYSVSQDAIVKYDGRTGASRVRSLGATPGEAIFVAAPEARSEDDGWLISIVTDPAG
FT                   RGSELLVLAATDLANVASVALPRRVPAGFHGCWIADQ"
FT   gene            complement(294368..294610)
FT                   /locus_tag="FRAAL0274"
FT   CDS_pept        complement(294368..294610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0274"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58951.1"
FT                   /translation="MAAVAVRPPALAPHSLTVQLVNLQLQACISEVQLRFTHGSVPPEA
FT                   AGQAAESGANRVAPAHRGPPGGAAGGRPAAAATRR"
FT   gene            294666..294854
FT                   /locus_tag="FRAAL0275"
FT   CDS_pept        294666..294854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58952.1"
FT                   /translation="MKATYEAPVLQDQGSFRKATGFIGFFGGWGWGGWGGHRHHWGRWG
FT                   HRGHGGWGGWGGWGGWG"
FT   gene            complement(294908..295252)
FT                   /locus_tag="FRAAL0276"
FT   CDS_pept        complement(294908..295252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0276"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58953.1"
FT                   /translation="MTALHCIAEMKADSDAIVRVQETDRTQTKAISGLPFTITDVHVTE
FT                   VVRGTWPSAIRIRQTDTGGVGGDDILKPGSSYRLFLERFARDGHRRTRRPETTSGDGRS
FT                   PARRHSVSAR"
FT   gene            295497..296351
FT                   /gene="surE"
FT                   /locus_tag="FRAAL0277"
FT   CDS_pept        295497..296351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="FRAAL0277"
FT                   /product="acid phosphatase SurE, survival protein."
FT                   /function="5.6 : Protection"
FT                   /function="5.10 : Defense/survival"
FT                   /EC_number="3.1.3.2"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTZ1"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58954.1"
FT                   /translation="MRPLHILLTNDDGWRGTGGSDTPLIVALRDALKAAGHDVVVVAPG
FT                   TDQSGQGGRISAPPLQLTVARPEPSVWTVTPGSPSDSVFFAFDQVFTNAKPDLVVSGIN
FT                   PGNNLGQAVNHSGTVNAAATALEFGVPAIAVSLQTSSTWREGTVVAAKSSAAYVADLVA
FT                   RLEGRSQHGALMPPGVGLNVNYPLLAGPVDPATGKPGSVLPPRGVRPTTLDTGVALDLG
FT                   YTPTSGQAGQPGTYTIGLTPNDQAAPAGTDTRAVQDGYVSLTPLEADRDVDGSTESWLH
FT                   RIL"
FT   gene            296526..299090
FT                   /locus_tag="FRAAL0278"
FT   CDS_pept        296526..299090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0278"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58955.1"
FT                   /translation="MPDARRDPGPVLDGGEMRDDPSAPCHMVTTLTRMGLEGPSAEGAA
FT                   RATALVAEAVAYARGLADLKETGYQAAADLDRRLTGRAALMLALDTPRAARLLADSEVV
FT                   RRTLATGAASAAEQSAADRVRAACHTLGFDPKARDPKARDAPGRLVGDLTVEQVVAAAA
FT                   AVGRMSRLADSLTDRAARASARRWSAALAAGPPVEREFTAIRRRLDSVLTSSGPGGPET
FT                   DPSRLATRLLSESELVHWPVLAARLARIGEAIRHARIAAMVRAAKARLTDLQAQRRRQA
FT                   SVRGGVHLAGRMGRAANLRPPAWPLAAPHGETLAWLRRLVCAPLHTPDVERALAARLGA
FT                   DLFDLRRPPPEPAFLAGVDIGNLRPEHVAPFLRRISMTRPVPSAEELSEESLEADRGAV
FT                   SWARRSADERRWGQAADTGAPLLPEVVGIPHVVHGIWLGQPMPARTAFRDNYGAAARRY
FT                   AGQVTVVLWTDIPRAQCAAVLAEPAPLVGAADPLRYVRTLATWARDNDVALVNVDEVFH
FT                   ADHPLYLRPQYVLEMAKQRPRGYTSATDHLRVELVHTFGGLYIDGDIRFDAGSPEGGHP
FT                   GSVPDLLAAVAASTCGFTLNILPIDLGISNDLIVGSARHPALRLWMECARLNYFPLQRE
FT                   IVGGLGMMARPYVGASHQGLRHLAPHRTGRVHHVPLKLLGITRDDLTPTGGAVVTANEI
FT                   TWVPRGRERVEFDVTGADPADPATRDEVLTRTMRLVTFLLWQLVAREGNLYLSAVEPVV
FT                   LALPDPDAVWIALLGFIAAAGAARALVTSVTDHRRGEDGTLEYIRLPREAEAFLDREAS
FT                   PPSWFGSELAELDRPVWLLDEAVTPVALRTPSAAAAVLAGRA"
FT   gene            299190..300632
FT                   /locus_tag="FRAAL0279"
FT   CDS_pept        299190..300632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTY9"
FT                   /db_xref="InterPro:IPR024026"
FT                   /db_xref="InterPro:IPR024740"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038546"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58956.1"
FT                   /translation="MSEQDCSVVLLTLATTHPPARDLGFLLHKHPDRVHSFTEPMGTAH
FT                   VFYPEATDDRCTVALLLEVDPVGLVRGRKGAPGEGFALAQYVNDRPYAASSMLAMALKD
FT                   VFRTAMTGRCNARPELAAAAIPLEIHVPAVASRAGSDLPRRLFEPLGWRVAVATGPLDP
FT                   DVPAWGESPYLDVRLSGTLRLAEALNHLYVLLPVLDDAKHYRVGGDEVDKLLRAGADWL
FT                   ASHPESDLIARRYLSHRRELTRSALARLAEVDDTEPEQLDDALGGAVELDPPDRPLSLA
FT                   EQRRGAVLAVLRSHAARRVGDLGCGEGLLARELLGERTIEHVLAADVSARALRIAGSRL
FT                   GVERMSDAQRARLTLIQSSLTYRDERLTGLDAAVLMEVVEHVDPSRLSALEATVFGYAA
FT                   PGLVLVTTPNVEHNVRFATLPAGALRHRDHRFEWSRAQLRAWAGRVAAEHGYTVRHLPI
FT                   GPDDPEVGPPTQLAVFSRAVAA"
FT   gene            300629..303331
FT                   /locus_tag="FRAAL0280"
FT   CDS_pept        300629..303331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0280"
FT                   /product="serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9573144; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTY8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024028"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58957.1"
FT                   /translation="MTPDRAEPSPPSGSSPLSGSSPPSGSPSPRQLGVPALSLVVLVGV
FT                   SGSGKSTFARTHFRATEVISSDFCRGLVADDPNDQSATPEAFELLRYIAGKRLAAGRLT
FT                   VIDATNVQPDARRPLVALAREHDVLPVAIVLDVPEGVCAARNASRADRDFGPHVLRRQR
FT                   DQLRRGLRGLSREGFRTVHLLRGEGEIADVGITRTPLFNDLRHESGPFDVIGDIHGCRA
FT                   ELETLLDRLGYAVRRDEAGRAVGAVHPDGRRVIFVGDLVDRGPDTPGVLRLAMGMVAAG
FT                   EAFCVPGNHENKLLRALRGRDVRIGHGLAESLAQLATEPAQFRAEVERFLDGLISHYVL
FT                   DDGRLVVAHAGLPERYHGRASGRVRELCLYGETTGESDEYGLPVRHPWALEYRGRATVL
FT                   YGHTPVPTPEWVNNTLCVDTGCVFGGSLSALRYPERELVAVPAAEVYWTPARPFPANPE
FT                   AVDSTERPTAGSVAAGAAAVGSAAVGRRDPDVLDLTDVLGTRVVETRHQKRISVREGNA
FT                   AAALEVMSRFAIDPRWLLHLPPTMSPVATSTVADLLEHPDQAFEAYRDAGVDAVVCEEK
FT                   HMGSRAVALVCRSLDAARARFGAPDDRAGAVWTRTGRPFFPGELTAELVERLRAAAEAA
FT                   GLFDELATSWLLFDAELLPWSAKAGQLLRDQYAAVGAAARASLPLAVDLLEQAARGGLA
FT                   VGDLLARTRSRAANAAAFSAAYRPYQWPTDGLRGVRIAPFQVLASEGAAHHTRPHAWHL
FT                   DLADRLVAADPDLVAPTRRIFVDTTEPDSVATATAWWTELTAAGGEGMVVKPAANLTVG
FT                   RRGIVQPGLKVRGREYLRIIYGPDYTEPANLERLRERGVGHKRSLAQREYALGLEALDR
FT                   LALGEPLWRVHECVFAVLALESEPVDPRL"
FT   gene            303683..305119
FT                   /locus_tag="FRAAL0282"
FT   CDS_pept        303683..305119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0282"
FT                   /product="putative integrase/recombinase."
FT                   /function="2.1.3 : DNA recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTY7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58959.1"
FT                   /translation="MTVTDPFVTVVGVPGPVRPVGYVRISLDREGAGLGVARQTADLND
FT                   VADRLGLPRPEVVTDNDVSAYSKKRRPGYEEVLAGIASGRWNVLLVWHVDRLTRSPKEL
FT                   EEIVDLANRTGLRIETVKGGRVDLSTGEGRLHARILGGLARYESEHRSDRVRRKMLQNA
FT                   EAGLPHGGMRRPFGYEPDGMTVRPAEAEVIRWAVGGVIAGRPLRALVAELNDAGVATSQ
FT                   GARWSSSTLRGILVHGRVAGFRVHQGRILGPAAWPAIVDVARWELCRAVLTDPARRSSP
FT                   GNKPNRLLSGIAVCGRCAGAMRSGGNRAGQQMYRCRSQNHLRRRGDLVDDVVTRFVVGW
FT                   LARDGVTFDVPDVAVPTHDLRARADEVRLRISQVEDALVGDPTDDLRDVSVDGLKRNLA
FT                   RLRGKLEDLERDEKLTVLPSALHGVTAENFPGLPLDRRRSIVDYLCKVTVLPTSKGGHA
FT                   GEESIDVIPHPDRFPAAVAA"
FT   gene            305266..305547
FT                   /locus_tag="FRAAL0283"
FT   CDS_pept        305266..305547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0283"
FT                   /product="hypothetical protein; putative TonB box"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58960.1"
FT                   /translation="MRIGGGSRSTVGVDLQAHPGEAADVYLPAAGPRFSVLRPTLILPA
FT                   GVRVSVASDMPYDVAARWWDSVTVSATMASQWYASHVNGWPGGGQQNR"
FT   gene            306759..307010
FT                   /locus_tag="FRAAL0284"
FT   CDS_pept        306759..307010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0284"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58961.1"
FT                   /translation="MSSRPSRPLQVGVVASVTAAVAGLSGYDSTPTGFQISMLVMSSLL
FT                   TGWLGSDLVSPFSKKPSVRALQGILPCNALIARPLDRE"
FT   gene            complement(307034..307252)
FT                   /locus_tag="FRAAL0285"
FT   CDS_pept        complement(307034..307252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0285"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58962.1"
FT                   /translation="MVSRAALRAAAGAVPHTPRPAVRAAPAMPPHRDGAPPPFGRHPVG
FT                   ASSPRARRPVGHVGASQPPQSLLAGHI"
FT   gene            complement(307318..307977)
FT                   /locus_tag="FRAAL0286"
FT   CDS_pept        complement(307318..307977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58963.1"
FT                   /translation="MTATPLPSALRTPVDVLWNYHDMHHDPRPTDIGIGLGSHDLSVAT
FT                   CTATLYHRRMFPRIVFTGANAPTTIATFPRGEAVHYREHALTLNVPDTAILVEPTARNT
FT                   GENITRTRELLTAHGITPRSVTLISRPYQQRRAYATCRKLWPDVDVLCASQPMSLDDYM
FT                   ASIGDTDRVVSMLVGDTQRIWLYAERGYAIPQPVPDHVRDAYDDLVAAGYTGRLIT"
FT   gene            complement(307974..308765)
FT                   /locus_tag="FRAAL0287"
FT   CDS_pept        complement(307974..308765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0287"
FT                   /product="Putative regulatory protein KorSA, GntR-family
FT                   transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /function="3.1.2.3 : Repressor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 2770697; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTY2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58964.1"
FT                   /translation="MSSRRGASDRIWADLREQIASGRLAPGAALPSTAELARHYGVASE
FT                   TARLAVTRLKEEGLVSGRAGAGVYVRSRPPLRRLGIDRYDKAKWQGADLVAFAADRVAS
FT                   GRSWEPGDQTQTVRRVPAAPDVAAALAVDQGADVYERARLIREHDQPTHTLTSYYRPEH
FT                   VEGTHLTDDSAGPAGPGGGFRVLTDQGLEPAWIDEELQARMPTPEEVATLQLPPGEPVV
FT                   ELHRTTFTAEDTPVEYAIGVHPASRFAWSYRFQIPDSAGRP"
FT   gene            308976..309158
FT                   /locus_tag="FRAAL0288"
FT   CDS_pept        308976..309158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0288"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58965.1"
FT                   /translation="MAPGVQWGLATFGAGRRLEGLIGPFDSPAAAQRHARERCYGDWVV
FT                   APMLCVTDAEGVAVL"
FT   gene            309155..309658
FT                   /locus_tag="FRAAL0289"
FT   CDS_pept        309155..309658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0289"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58966.1"
FT                   /translation="MSLIEGDGPDDVRYRWLPEVALPDTDGLLVCAEPVWDGQARRPKM
FT                   EADFWPVAAGVLVEAAFGAAGRPGVMAVVVHRGSRDLVASRLAMVVGLRLAVRSARRGL
FT                   VVCGGSLNGLDATFQGRRPVAHEVLVWESGDVWVPRRVWEVMAPDRYEQWISRRQILGL
FT                   GRRP"
FT   gene            309655..310023
FT                   /locus_tag="FRAAL0290"
FT   CDS_pept        309655..310023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0290"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58967.1"
FT                   /translation="MTASGGQASIGPEGLPSLVDRLRLVLSARIAGELPDADRATVEVV
FT                   VGRVLALLARSAAVNRSHPLADATLYLMAHALEDQSLHRSLTGIRLQLPGLTVDTATFR
FT                   SEVEFLRRMGGREEPSQE"
FT   gene            310723..310818
FT                   /locus_tag="FRAAL0291"
FT   CDS_pept        310723..310818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0291"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58968.1"
FT                   /translation="MSLSAVLFPSTPVPAGRVRLTGGVRLEAVFP"
FT   gene            complement(310867..312369)
FT                   /locus_tag="FRAAL0292"
FT   CDS_pept        complement(310867..312369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0292"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58969.1"
FT                   /translation="MIMMAVPVFPVSADPAASSALGVDVESASLGEVEEVICRWAGRIA
FT                   AATCAWLLAVAAFDRRQGWSGMGLGSCAHWLSWRCGIGLRTAREQVATGHALERLPAIR
FT                   AAFAAGTLSYAKVRAVTRIADEHSEQAWLTHARFCTAGQIERLVRCARQARGQEKTRRS
FT                   APRLGWQYDDDGMLRVSAVLSPDDGARLIAALDAARAGLDTTTPLDSPGDAEAGEVPAD
FT                   GESVVRARDRRRDAEALVALADGFLDRQAPGLTAPEHTLTVHLTTTLPDTTASPDGTAS
FT                   GGEDSTPARAADGGAAGPVGMARIGIGAWAQVDGGIGLSRQVVARLGCDGFLRGLVTDP
FT                   DGNNPLHLGRRQRHPGQRLRDAVYARDHGHCQYPGCGHTRFLQIHHLTEWTRGGDTDID
FT                   RLTLRLRHHHSIMFPTGAEDPASDEDPSSVGRSDAAHARAAARHDPPSMIYPRGAAHPP
FT                   ARPRAPAILPAAPSSTPHPPRRHPGRPGRRPVHRRTAGTSPR"
FT   gene            complement(312840..314888)
FT                   /gene="thrS"
FT                   /locus_tag="FRAAL0293"
FT   CDS_pept        complement(312840..314888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="FRAAL0293"
FT                   /product="Threonyl-tRNA synthetase (Threonine--tRNA
FT                   ligase)"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /EC_number="6.1.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15112998; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTX6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58970.1"
FT                   /translation="MSARMPAVPEERVSAPAGSSFAEAVKAAGLTMSGPNAIVVVRDAA
FT                   GTLRDLTAVPAVDTEVTAVPMSSPDGLAVLRHSTAHVMAQAVQDLFDEARLGIGPPIEN
FT                   GFYYDFDVPKPFQAEDLERIQARMREIVKQGQRFRRRVLTSREAAREELAAEPFKLELV
FT                   DIKGEASGAAATEVGSGELTMYDNVDPRSGEVVWTDLCRGPHLPSTHLIPAFALLRNSA
FT                   AYWRGDEKNPQLQRIYGTAWPTRPALKEYLTALAEAAKRDHRRIGEDLDLFAFSPEIGK
FT                   GLPLWLPNGTIIRDELEGWARQTERRLGYRRVVTPHITQEDLYFLSGHLPYYAEDLYAP
FT                   IQIEGENYYLKPMNCPHHHMVYKARPKSYRELPYKIAEYGTVYRFERSGQLHGLMRARG
FT                   FTQNDAHIYCTREQAKEQFLEVMRMHDEYYRALGITDFYMVLALRDPANTTKYHDDAQM
FT                   WEDAERITREAMDESGIPYVEELGGAAHYGPKVDFIIRSVTGKEFAASTNQVDLYTPQR
FT                   FDLKYHDADGTDKQVVVIHRAPLGSHERFVAFLTEHFGGAFPVWLAPEQVRVIPIMPEL
FT                   DEYAETVSQALLDADVRVDVDASDGRLPARVRTAVTRKIPLIVVVGRREVEEGSVSVRD
FT                   RSGQETSMPLADFVRRVRELIDTRSLEGAGHLRAGSDATPTEVDATD"
FT   gene            315963..317237
FT                   /locus_tag="FRAAL0295"
FT   CDS_pept        315963..317237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0295"
FT                   /product="putative tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase cofactor modifying protein."
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTX5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58972.1"
FT                   /translation="MGLKMNTPPTCNWKCPYCYAGDPELHGRPRQPTVMTANESGSVPL
FT                   HRDPAWERRMEGWLEQAIALGLQAVTVNGTFEPLAAPDWQDTISFLQRRGIAVTLVTNG
FT                   GLLTPESIDWIVASGVNLLTKLNVPVVGPDDPRRARLAEVQKYLSGLPRDAETVYARQI
FT                   ALIERLEVAGLTVTDEPGRTRLGVESVIARDNLEFLPELVAQLRERNIYSHIELSKLQG
FT                   FARTNPHLVIRRAEIEELFETVRRQDAAMGYEPYQAKPPCLAGACYENLYRLDLHADGA
FT                   VRPCPGIETTIGDLNRQPLAEVLGSPALAVIRNLDDHIQGDCRDCDLLATRQCYGGCRG
FT                   TAYQAMANSGRGEYERWTASDPSCWRVHRVLDDGTLAQDVLDRALTTDEIARLRLPDLV
FT                   EAGAAGAAGAIGAIGAAGATGEGAR"
FT   gene            317234..318409
FT                   /locus_tag="FRAAL0296"
FT   CDS_pept        317234..318409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0296"
FT                   /product="putative aminocarboxymuconate-semialdehyde
FT                   decarboxylase."
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12383521; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTX4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58973.1"
FT                   /translation="MNRPLISADSHLCEPPELWTSRLPRRYQERAPRVVNLDGRPGEYF
FT                   VCEDIQPRSVYAASAAGVPSEELPRRAAQGFAAAPPSVWDPRARLAEQDVDGVAAEVLF
FT                   PTFADLVFGCRDAEFRRACLRAYNDFVAEYCAADPNRLVGTALVDDADPGLAAAEVTRA
FT                   AGLGLRGVVLRADPERSYADASFDPVWETAVGLDLPVVIHRGAVRRDITIDVHGALLDY
FT                   VMIPSQAQRALTALVFGGVWERYPALRLVLCEFDLLWMPHFLQRLEHADHRFGRSFGVD
FT                   LSRPARDQVTDGVWVTFQHETDEVTRILPSWSRERLMWASDYPHADSTWPHSVGKVAEL
FT                   RAAVGPDTTTLFTHDTVSRLFGLRLPATAPTGPTAPTGPIAPVASLEAARP"
FT   gene            318406..319251
FT                   /locus_tag="FRAAL0297"
FT   CDS_pept        318406..319251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0297"
FT                   /product="putative Phytanoyl-CoA dioxygenase"
FT                   /function="1.1.2 : Fatty acids (fatty acid oxidation)"
FT                   /EC_number="1.14.11.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTX3"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58974.1"
FT                   /translation="MSERTDTARLDVERYRAEGLVIAPEPIPAEVLDDVRSDLVDYLRD
FT                   DPSDVPDFVPDLMASGFGLRYGSHPVLLDAVSAVLGDDVLLWACGMFGKPARVGKPTPW
FT                   HQDGHYWPIRPLATCTVWLALDRSGPHNGGLRYVAGSHRARTLLGHQRSDGRDTTLNQG
FT                   LELDEPQRAAVRVAELEPGHFSLHDVHLVHGSSANVSGARRAGITFRYMPATSYYDRDL
FT                   ARRQHRELGVPDISGRVLHRVRGVDRTGRNDTVDATAGPWTAAAAPAGGPAPPVSGRPS
FT                   "
FT   gene            319248..320816
FT                   /locus_tag="FRAAL0298"
FT   CDS_pept        319248..320816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0298"
FT                   /product="putative F-S oxidoreductase; putative
FT                   methyltransferase."
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTX2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58975.1"
FT                   /translation="MKVAFVNVNAKQDAIGGRELTFYENKCSIELGTLYLEANVAWRPE
FT                   DRTLQVNLLHLLSRGEDWRSALGRFAPDVVALSALTYYAPELAFVAGWVKAEFGSVVVV
FT                   GGPHATALGRSVLDDDNIDYALVGEGEAGFSDLLDLLREGGGDGGDGGGGGSGGDGGSP
FT                   RADVVGLVYREPDGTVRANARGVVPDLDTLATPTLAHLDPTLFAGYTSLLNLKVRYVPI
FT                   VTTRGCPYQCVYCHDIMGKSVRYRSAAAVVAEVDYWREAAGVDTFLVYDDIFNIHRGRV
FT                   REIFAEFARRPGLRFAFPNGLRADLLTEDIVDLLLEGGTFYAMVAVESGDRRVQEVIKK
FT                   RLNLERTRRMIEYMGNAGVILGSFNIFGFPSESEADIERTIEFNASTTGLSKANFFVLS
FT                   PHEGTEVWDMAIDQGYEPPRGGAGEGYFSARESSPTAEVSWHRLEELRREAYSRFYLTP
FT                   ARVRKVLTDTARNMTPQEKHTFHSVDYSFVLRQFLDVDSLDALPRGETTELLHDLLPAG
FT                   VLSGY"
FT   gene            complement(320810..322231)
FT                   /locus_tag="FRAAL0299"
FT   CDS_pept        complement(320810..322231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0299"
FT                   /product="putative carboxylase."
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTX1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR040570"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58976.1"
FT                   /translation="MVEGALLVYSPLNEPRRPALIRLAEIHPRVVLLAEDHTDVPPWAD
FT                   ELLADVVRIDRLDAPAAIRATRDLLARRGSVADGIVSLSETGLAFCSAVAAELGLPFTP
FT                   GDVLERARDKSRMRAAFAEHGLPTVRFGTAGRLDEALAIAADIGYPVVLKPLLAGGSLF
FT                   VWTVHDPAELAAAFDDVLRGGAQVVAGDPLVHATFRGGAAPRLLVEQLIGGRRWFASSL
FT                   DLPVGEVSVEGSVVGGEVRVLAHHDKPLPADGPFFEEVLWSSPSRLPAELLARVDDVAA
FT                   GAVRALGLRDCVFHAEMRTTDTGPVLLEVAARMGGGPIFRSARLAHGVDLVETMVRIAT
FT                   GAPTANGRAAPAPEPDRPEPERPEPERPEPERPEPERRSPAVMTFGLFADEGMLRAIEG
FT                   LDEVRAHPDVVEVCVYEHPGTYIHRAPRSDHCTVHVMIAAADFATAEDLGRWAQQRIRF
FT                   VTGDHPTGARHVGRQ"
FT   gene            complement(322224..323027)
FT                   /locus_tag="FRAAL0300"
FT   CDS_pept        complement(322224..323027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0300"
FT                   /product="putative s-adenosylmethionine transferase."
FT                   /function="3.1.1.2 : Methylation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 2155856; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTX0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58977.1"
FT                   /translation="MTISIERNVDPFDTIDSGADPTFEESILLERMAGHYYPAVLDWFF
FT                   DLLPREARTVLEVGCGTGQVLDRLVGHLGTDQVERAVGIDRSAYLARRAAERFGRFEIF
FT                   AADGTQVPLPDEQFDLATTATVLVHAADPAGILREMHRLTRRGGTAAVLDQDFGSAVIH
FT                   PGDRDLSRRILDAATDFWQDGWIGRKLPSLLRDAGFTVTGFHSTVRIDRTFDRAFFTRI
FT                   RDWVVTAGFAAAEADRWLAELAAGAERDEFVFTRNFYACIARRDG"
FT   gene            323275..325251
FT                   /locus_tag="FRAAL0301"
FT   CDS_pept        323275..325251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0301"
FT                   /product="putative transcriptional regulator; putative
FT                   two-component response regulator domain."
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11214968; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTW9"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58978.1"
FT                   /translation="METLRIELFGHFQVTVGDRAVPDATWSQRRPAALVKLLALAPGHR
FT                   LRRDQVMDVLWPELDPAAAGRNLRKALHAARRALDGEQGADLIASVGDLLCLPADRLSV
FT                   DVDEYRSAAATARRTRAVDAHVGAIERYRDGLLPQDVYEDWAAAPRDALRDDWLALMAE
FT                   FAELLETRGDLNHAARTVQRLVAADPLSEDNHAWLMRLYSAAGRRGEARRQYQRLCDVL
FT                   DAELGIEPSPSTQRLYEEIRSNLAAEPEQAIEVWERVGDLRAQSGDAAATITAYERALR
FT                   AGPDASTAVRLHRKSAATLVTQQQLDAAETHLDAADRLGPDATDQGRLAGVRASVMRER
FT                   GDLAAARQLADRAHQVAVVHGDADAVVEALEEQAILAHIQGTWRTALQLQMPRLAAVDL
FT                   GGRVSRFFEINHCIGQYQLYEDALAGDVEQYARETLALAERADAVAVQAFAWCLLGESL
FT                   LLRGHWDAAAACLDRSCELYAPMGSRSVALPWLRRAELAICTGAFDEVAPYLGRASAIA
FT                   AVTPLARHAWGRLHATAALAALERDDLDGAVESVRAASRTAAHYGDCASCGLLLNPVGA
FT                   ETLARTGDVAGARAFAEAARRAASFHDSMAWTAMAESAAASASVAAGDPVEARVGFDSA
FT                   AALYEKAGQPFWAARSRRQAAAV"
FT   gene            complement(325656..326315)
FT                   /locus_tag="FRAAL0302"
FT   CDS_pept        complement(325656..326315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0302"
FT                   /product="Anti-oxydant protein, AhpC/TSA family."
FT                   /function="1.1.2 : Fatty acids (fatty acid oxidation)"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.11.1.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12597275, 11214968; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTW8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58979.1"
FT                   /translation="MSLTIGDTAPDFVAATTEGPIKFHEWIGDSWAVLFSHPKNFTPIC
FT                   TTELGYVASIKPEFDRRNVKIIGLSVDPIELHDAWAKDIEETQGTAPNYPLIGDADFAI
FT                   SKAYGMLGADVSGDPSDRTAADNQTVRNVFVIGPDKKIKLVLVYPMTTGRNFDEVLRVI
FT                   DSLQLTAKHKVATPVNWKQGENVVIAGSVSNDQAKEIFGTWDEPKPYIRIVPQPTA"
FT   gene            complement(326455..327201)
FT                   /locus_tag="FRAAL0303"
FT   CDS_pept        complement(326455..327201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0303"
FT                   /product="Formamidopyrimidine-DNA glycosylase."
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="3.2.2.23"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTW7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58980.1"
FT                   /translation="MSVASPQGRFTEGARRLDGRPLTDAEAHGKHLLLRFDHDQVLHVH
FT                   LGIYGTYAFGPGPAPVPTGAVRLRLTADTGYADLRGPNACELLEPGGVKTLRDRLGPDP
FT                   LRGDADPDLAWRRIERSRTPIAVLLLDQMVVAGPGNIYRAEVLFRAGVDPLLPGRDLTR
FT                   RQWTAIWADLVTLMADGVRTGRIDTVRPEHTPEAMGRPPRVDDHGGEVYVYRRAGQPCL
FT                   ICATTVLTNRLAARNLFWCPGCQRPS"
FT   gene            327333..328346
FT                   /locus_tag="FRAAL0304"
FT   CDS_pept        327333..328346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0304"
FT                   /product="Acyl-CoA dehydrogenase."
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTW6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58981.1"
FT                   /translation="MAARGEPDVGHGGTMRAPGRVRAEALAEACAAAGELPLPGRGRTL
FT                   ERWAALAALAADDLVLARLAEAHADAVAVVAELAGAPLPPGSRWGVWAAEDPTGVLTAV
FT                   PLDGQGAGWLLDGAKAWCSGATLLTHALVTARRGQSRQLLAVALDAAGITVAADDWAAG
FT                   GMKAADTRRVRFDRVPARAVGGPDGYLRRPGFWIGGIGVAACWYGGATAVAAPLRERVG
FT                   ARGDDPHAAAHLGAVDVALGGARDVLRAAADAVDARPEADHARLARRVRATVAGAAAEV
FT                   IRRVDRALGPGPRARDRQHSARIADLEVYLLQEHAERDLAALGAAVVAAAEPDWSL"
FT   gene            328372..329034
FT                   /locus_tag="FRAAL0305"
FT   CDS_pept        328372..329034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0305"
FT                   /product="Methyltransferase."
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTW5"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58982.1"
FT                   /translation="MLTRTRVHRGKPGREGFTEGSMTLPPQYFDEMYAGDGDPWGFADR
FT                   WYERRKRALTVALLPDDHYATGYEPGCSIGLLTRDLAGRCGRLLATDVAPAAVAAATRR
FT                   TADLPNVRVEAARLPGDWPAGTFELVVLSEVGYYFDQADARLVAARATASAGTLVAVHW
FT                   RHPVEDYPCGGDEVHALLGQAAVGAGLTRLVHHLEDDLVADVWARDGRSVAARTGLR"
FT   gene            329113..329982
FT                   /locus_tag="FRAAL0306"
FT   CDS_pept        329113..329982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0306"
FT                   /product="Glycosyl transferase, group 2 family protein."
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTW4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58983.1"
FT                   /translation="MNRISRVAVVVPAHDEQDLIGDCLDALGEAVHHPGLRGVVVEVLV
FT                   VLDDCGDESARHCRRRAVPTLAVRERNVGRARSRGFAHLISRAAADAAPAGPRAVWLAT
FT                   TDADSRVSPDWLTAQVQFALDGADAVFGVVDIDDWDGFPAPAQRRFLRHYRGTEPADSG
FT                   WHRHAHGANLGIRLDAYNRVGGIPPLAVGEDNALAANLHRHPDLRVLHTTAVRVTTSAR
FT                   RDSRVDGGFAHVLSGFEQPGGHHTGGPAPAHGPSTATALGSPGSGQDEVRGRGGGRSHD
FT                   PRRRSSAG"
FT   gene            complement(329876..330889)
FT                   /locus_tag="FRAAL0307"
FT   CDS_pept        complement(329876..330889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0307"
FT                   /product="Lipase/esterase."
FT                   /function="1 : Metabolism"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTW3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58984.1"
FT                   /translation="MGYALDPEIAPWVALLADVPITDVARARTLVRRLAAAVPRPDAGA
FT                   AVSITDQPVPGPAGAPDVRVRVYRPVTAPADCPAVLFLHGGGFILGDLDMAHGEALRFA
FT                   ELGCVVVSVDYRLAPEHPYPAAVDDCYAALLWLAREARPNLGVDPARIAVAGGSAGACL
FT                   AAALTLLSRDRGGPALCFQFLTAPKLDDRLDTVSMRTFTDTPMWNSGKVALTWRYYLAH
FT                   RVGGADRAGGPAADVPPYAAPARAADLSGLPPAFVSVCEFDPLRDEGLAYAQRLVQAGV
FT                   PTELHLYPGTFHGSRLIQSAQVTRQMIADEDRAIVRRLGLEPRPAPSRDSQVPWQY"
FT   gene            331093..332193
FT                   /locus_tag="FRAAL0308"
FT   CDS_pept        331093..332193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0308"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58985.1"
FT                   /translation="MEGLILRLADLDEGALGAVRIIAFFDSFVEHRASLEAVLSATAQF
FT                   AGCEVGLAGGSVPPLVVRAGEGVPFAGDPPDGAARAPVGDDRWVWLARAGQPLAQDRML
FT                   LDRLAHAVRALSPRPRLDHPGTGDPALLELVLGAGADDAGRARALRLLGIEPTCSVTVY
FT                   AVRSPDPAAGAEFLAGLHPWVRAVRIGDVRAVVGREPPVGEPTIPTGVRVGRSVPMPAS
FT                   AAQRAWRGARTALRFTGSGLPAGLATLAGGSALVTEESLGVWRDVAEQVPGERLAASPD
FT                   VAALRRLGAEPQGPQTLAMLVAVGATASLRQAAAVLYVHHSTLIARLAKAERVLGFSID
FT                   TPAGRTRLTAALIIRALCADLDDLPT"
FT   gene            complement(332256..332354)
FT                   /locus_tag="FRAAL0309"
FT   CDS_pept        complement(332256..332354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0309"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58986.1"
FT                   /translation="MTVELRGVPMKVSVSNESCQGHAQCHAQAPEV"
FT   gene            complement(332354..332977)
FT                   /pseudo
FT                   /locus_tag="FRAAL0310"
FT   CDS_pept        complement(332354..332977)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0310"
FT                   /product="Putative cytochrome P450 (fragment)"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAJ58987.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(333463..333702)
FT                   /locus_tag="FRAAL0311"
FT   CDS_pept        complement(333463..333702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0311"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58988.1"
FT                   /translation="MRWIGPVGPTYLALHIRGRIVTAVDGGGFGDTDLDQHSAGFREHN
FT                   YEVMADLRNRCPVARSSTWGGYWLVTSYEAVFDA"
FT   gene            complement(334310..334483)
FT                   /locus_tag="FRAAL0313"
FT   CDS_pept        complement(334310..334483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0313"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58989.1"
FT                   /translation="MNFIDSINLAYRRVADHSYALPSAATTESSGCRADAGAARGVAGV
FT                   PEPSRTLKTPGV"
FT   gene            334503..335324
FT                   /locus_tag="FRAAL0314"
FT   CDS_pept        334503..335324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0314"
FT                   /product="putative transcriptional regulator, TETR family."
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15150251; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58990.1"
FT                   /translation="MEGIEYLIECNESNAMSDAGEPGGHRWLLDGPWGLEPCSELEARR
FT                   QTEVTRSDWRHAVGNRFETPAKILDAALGCIAARGPAKMSLRDVSAAAEVSRGTLYRYF
FT                   KTKGELLTAISDHVRRGVSAALDEAVAGQPADSGRLRATVDAIMHYGDDHPEVSRVIEA
FT                   EPAFALQFIRDIFPSFVAQMTELLAPVLDDLGIVQEGTVRREVLAELLLRATSSLYLIP
FT                   SPNPDELTDAVVTLWASVAAPAKVGDPGPEGEARPDSEVSLQGRSRRLGEG"
FT   gene            335638..337122
FT                   /locus_tag="FRAAL0315"
FT   CDS_pept        335638..337122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0315"
FT                   /product="Aldehyde dehydrogenase."
FT                   /function="1.1.3 : Amino acids"
FT                   /EC_number="1.2.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTV7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58991.1"
FT                   /translation="MTTASEAVSLQGEPRLLIDGKLGESATGSRYDNINPATEEILGQT
FT                   TDATAADMDRAIAAARRAFDESSWSTDRELRKRCLAQLQAALDDEKEALRAELIAEAGA
FT                   PIAVTHFAQLDWPLADGLRGPLELIDTFPWERTLPDTNLFGPSHRAVWKEPVGVVAAIV
FT                   PWNYPFEVTINKLGPILATGNTVVLKPAPDTPWNATRIGRIVAERTDIPAGVVNVVPTS
FT                   DNAVAELLVTDPRVDMVSFTGSTGIGRRIVELSAGTMKRTLLELGGKSAMIVLDDADLA
FT                   SVLPGAGLGACLHAGQGCAMTTRILLPRSVYDQGLEILTEVFRHLPYGDPNDPANLSGP
FT                   QINARQRDRVLDYIEIGKAEGARVVAGGGRPAHLPTGYYVEPTLLADVDNGMRVAREEI
FT                   FGPVAAVIPFDDEADAVRIANDSPYGLSGGVFSASLDRGLSVARRIRTGSINVNGGNFY
FT                   GSNGPYGGYKLSGNGRQGGIEGFEQHLESKSVGFAG"
FT   gene            337214..338080
FT                   /locus_tag="FRAAL0316"
FT   CDS_pept        337214..338080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0316"
FT                   /product="Carveol dehydrogenase."
FT                   /function="1 : Metabolism"
FT                   /EC_number="1.1.1.275"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 99403074; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58992.1"
FT                   /translation="MSGRLEGKVAFITGAARGQGRSHAVRLAQEGADIIAIDIVEQIES
FT                   NPYPLSTPEDLAETVTLVEKLGRRIIATKADVRERDQLREAVNKGVAELGRLDIVVANA
FT                   GILPMAMGDPQATDFIDAVDVDLIGVMNAVAVSVPHLPDRSSIIVTGSTAAMMPNTTDN
FT                   PAMGPGSAGYGWAKKILIGYVEEMALHLAPKFIRVNAIHPTNVNTHLLHNDGLYAQFRP
FT                   DLENPTREDVEPAFVTFQAMPIPYVEPVDISNLVLFLASDESRYITGQQIRVDAGSLLK
FT                   FPNGPTG"
FT   gene            complement(338179..339879)
FT                   /locus_tag="FRAAL0317"
FT   CDS_pept        complement(338179..339879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0317"
FT                   /product="conserved hypothetical protein; putative
FT                   endonuclease domain."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58993.1"
FT                   /translation="MLGTASPSTFLLAGSRSLEDVAELAACGRPLPHIAHGDEHTFDIW
FT                   RLRIYRRLMNTHGPSPGRDTAPTPVPAPGLTATSDPESDAGPAPTFGLDPRGCPRLLTA
FT                   LSELDELVGQAVDMPGWSLSDGDLDSAVLDCSALLARLAALRLGLINELHGRGSAQREG
FT                   ATSTAALLRARLRIRPGEAQRLLGLALAVDGDLTATGTALTAGTISIDQAFAIHAALRA
FT                   LPRGADLTRRREAEALLLRCADTFDPADLALLGRHIRERLTDVDTSPGGDSPDPADDSN
FT                   SDEGGSSDDDDGGDHNPGGGDAGGGNAGGGADGDDPTSRRHLSITDLADGMTRITGELD
FT                   AEGAALLRTALDSLAAPSPAVDGTPDPRSPARRRGDALVELLHRALDASSVPVSGGVRP
FT                   HLTVTVPWATLVGRGGPAAATSWGQPLPRSVLRRLSCDAEVSRIVLNADSVPLDVGRTQ
FT                   RTVPADLRRALVARDRCCAFPGCSRPPSWCQAHHIRHWTDDGTTCLDNLVLVCGWHHRF
FT                   LHHHGWTVRLGADRRPEFLPPVWVDPTQTPRRNPYTRPLEALLSRPADR"
FT   gene            complement(339935..340120)
FT                   /locus_tag="FRAAL0318"
FT   CDS_pept        complement(339935..340120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0318"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58994.1"
FT                   /translation="MSEIHAHITDDCADPTDHGPIASPPDAPPPSTVTPPPAEPRPQPS
FT                   PRPRDIRPPLAARPGS"
FT   gene            340464..341978
FT                   /locus_tag="FRAAL0319"
FT   CDS_pept        340464..341978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0319"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58995.1"
FT                   /translation="MTMTVMARWRTRRRRIATTTVAALLTVTAAGVAQLATDSAAQAAT
FT                   PSAASPTVTGPVTGGKGVPVVGATAFDLGKVGYRQSEYFLAGSATAYQASGTLGSDGKW
FT                   TVTPAATAPYTTRIVVNRPADAKKFNGTVVVEWLNVSAGYDGAPDWTAAHNQLIRDGYA
FT                   WVGVSAQAVGLNATKNADPDRYQALSHPGDSYSYDIFSQTGQAVRKSAATVLGGLKPKK
FT                   VLGDGESQSAFRLTTYVNAIHPLVNVYDGYLLHSRAGTASALSQAPERPDIAAPAVVRI
FT                   RPDLAVPVLTFQTETDLPTGLLGYVDARQDDTNRFRLWEVAGTAHADAYTIGIGATDVG
FT                   DGQGSVAAFNALRNPPTGAAGFSCAKPINAGEQQYVLQTAFSQLNRWVTTGQAPSKAPR
FT                   LQIANNAYVLDANGNVKGGIRTPAVDAPVAKLSGLGQDTGSSPFCALFGTTVPFTPAQL
FT                   HALYPSHDAFVAAWMKAATSAVNAGFILPADAKPLVAAAASSTVPE"
FT   gene            complement(342240..343775)
FT                   /locus_tag="FRAAL0320"
FT   CDS_pept        complement(342240..343775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0320"
FT                   /product="putative carboxylesterase, type B."
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTV2"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58996.1"
FT                   /translation="MHVFKGIPYGGSVAGANRFQPARPPEPWTGVRDALAYGPTAPQAH
FT                   PAEAGGGGADDPAAAARMAPFLAFLHGLAGDEPAQDEDCLVLNVWTGGVDQQRARAVLV
FT                   WLHGGAFSTGSGSWPLYDGTALAARGDAVVVTINHRLGPLGFLHLGELAGDRYRDAGNA
FT                   GMLDIVLALRWVRDNIAGFGGDPNRVLVFGDSGGASKTSILLGMPAAKGLFHRAAVMSG
FT                   PLIRSCPADVATANAEELLGRLGIAPADVAKLHDVPAELLIEEAEAIGVPIASGLAGAA
FT                   GGEQFMPFQAVVDGRVLPAHPMDPQASPLGADVPVLVGSTRDDMRMIMLGMPWFGSLDD
FT                   AGLAALAGGMFGAAGPEFVRAYRAERPDATPSELACAFVTDRVMWWGGIDWAQRKIAAD
FT                   AAPVYVYRFDFATPALGGILGATHGGEIPFAFDNYPLTPMAGERPENAQVARAISEAFV
FT                   RFAQEGVPDHPGLPTWPAYTLDRRATMIFDAESRVDDDPRRAIRELHARVSAG"
FT   gene            344209..344997
FT                   /locus_tag="FRAAL0321"
FT   CDS_pept        344209..344997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0321"
FT                   /product="short-chain dehydrogenase, SDR family."
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10850995; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTV1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58997.1"
FT                   /translation="MASGLGQAGRLAGRVAVVTGAGQGLGRAIAAALADEGAAVALLGR
FT                   TESKVVDAAEELAGKGARVLALRCDVAERADAQAAVAATLAAFGGVDILVNNAQGGNNT
FT                   VRIPTVDATDAELLESFETGPLGSVHMMQACFEALRDSGHGAVVNFGSGIGVRGAPGLL
FT                   GYAMAKEAIGGLTKVTAIEWGRYGIRVNQVCPAAWSPAAEEYMKQSPERWELQRRQTPL
FT                   RRLGDPYADIGRAIVSLVSDDMQYLTGATLMLDGGQILLR"
FT   gene            345060..345890
FT                   /locus_tag="FRAAL0322"
FT   CDS_pept        345060..345890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0322"
FT                   /product="short-chain dehydrogenase, SDR family."
FT                   /function="1.6.15.4 : Acyl carrier protein"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTV0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58998.1"
FT                   /translation="MPDNLVGKTAIVTGGSSGIGLASAEAFVAEGAHVVIGDIQDERGR
FT                   AAAERLGDAALYVHTDVSDDDQVANLVDTAVRHFGGLDIMFNNASGAGDQAGLVDLGPD
FT                   GLDRSLRLIVGSAVSGHRHAARVFIEQGRGGSIITTSSGSGLRGGLGQPSYTIGKHAVI
FT                   GVVRHAAAELGRHGIRSNAICPGITMTPVLGMGIARDRRPAFMEHLAEALRDEQPAGRV
FT                   GQPEDIAAAVVFLASDLSRFVNGVILPVDGGADAVSLGRYSEITAAVRADFGGR"
FT   gene            complement(345896..346165)
FT                   /locus_tag="FRAAL0323"
FT   CDS_pept        complement(345896..346165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0323"
FT                   /product="conserved hypothetical protein; putative secreted
FT                   protein."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ58999.1"
FT                   /translation="MSPYDWQEIIGVIGVFTLVTSVVLVSIWQFAATWRAKASLAREKE
FT                   YRTIADRAVLFQEGTERQLAELGGRLAEMQSRLRSVEGILKEVE"
FT   gene            complement(346162..346506)
FT                   /locus_tag="FRAAL0324"
FT   CDS_pept        complement(346162..346506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0324"
FT                   /product="Putative ArsR family Transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /function="3.1.2.3 : Repressor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTU8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59000.1"
FT                   /translation="MGPQVTRSDPSGDELVQIMATLANPHRLRVLAALADERNYVSRLA
FT                   RDLDISRALLQVHLRKLEAAGLVTARLELSEDGKAMKFYEITAFVIQLTPRTIAQAART
FT                   LSPQEKGATA"
FT   gene            complement(346853..348925)
FT                   /locus_tag="FRAAL0325"
FT   CDS_pept        complement(346853..348925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0325"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59001.1"
FT                   /translation="MDGKIEVASYIPADSFFGSPYIDSDVWRESPLPHRHVHGGFQDTD
FT                   TRFTFYFPTEDSYDGRLFHPLEGAHAGHEDAFGGPMGDVIGGLVLISRLGGYMVESNSG
FT                   HIGDDIDPRGGDDPTLYGHRASVETARFSKHVAAQVYGAPPHHAYVWGGSGGGRRSPLC
FT                   LEYGTGVYDGALPFMGGGEIAEHGVSTLMKGAQVMAFASMFNVQRLLRRQAAGVIDATR
FT                   PGGSGDPYAGLTTHQREELANLYQLGYPRGDEFMIFSPMGQIWLWSSIADRLATEDAEY
FT                   FEAFWTKPGYVGHDAPDAVAEDLLDVTTTVSRVVTGGELLSDPAYAGPEFAGLRVMASL
FT                   MSAGPDLPMAIEVEGLGDGYRLGAGLKLLSGKAKGRQLYCMGHAGELLSADGVAEANLL
FT                   RFRDVEVGDEIHVDNRRFLAFCYYYRHHLMAEPAFDFLRPDGRPIYPQNRVPTMSPLMG
FT                   VAYSGQYEGKLLWVHHTHDASLWPPQGLVYEAAVRAVRGPEAAAERFRLRWTENAEHIP
FT                   PAYLPSAPDRATSTWLIDYLPVIEQSLLDLVAWVEQGVEPAGSRYEFRDGRVVLPASAA
FT                   ERGGIQPVVVATVDGGERADVAAGTAVTLRVDAEVPPGAGTIVAVEWDLDGSGAFADPA
FT                   DVVGTPTAVSLTRTVSYPTPGTRFATARVWSHRDGDRDAVHRRIPNVASVRIVVT"
FT   gene            349161..349931
FT                   /locus_tag="FRAAL0326"
FT   CDS_pept        349161..349931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0326"
FT                   /product="putative high-affinity branched-chain amino acid
FT                   transport protein (ABC superfamily, atp_bind)"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59002.1"
FT                   /translation="MTTTSGIPAPQPVGNVGLSSERPSPPRLETRDLSVGYGSTPVVHD
FT                   LNLVLRPGEVVALLGVNGAGKTTTVRALAGELRPLRGEVLFDGRRTTAPLHRRARGGLR
FT                   YITEERSVFMDLSAADNLRLGGGERERCLELFPELAPLLPRRAGLLSGGEQQMLTLARA
FT                   LAADPRVLLADELSLGLAPLVLERLLLAVRAAADRGGAVLLVEQHVRDALEVADRAYVL
FT                   SHGRVVLEGEARELRGRIGEIERTYLSSAELATD"
FT   gene            350027..351406
FT                   /locus_tag="FRAAL0327"
FT   CDS_pept        350027..351406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0327"
FT                   /product="putative amidohydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12383521; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTU5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59003.1"
FT                   /translation="MSHMGQRLVLVSADGHTGAPPQAYRDYIEPEFLGDLDRLTAENDE
FT                   WLNVVITAAGSSDETLEVIDGRRAIRTGGELGAFDLARRVRELDAEGVAGELLLSGHQM
FT                   CTLPFFGVVNNPYPPRLRAAGTRAYHRWLADAMATAPGRFYGIAEAGPCLDLAATVAEL
FT                   AWVAEHGFVGVLLPGMVADPALPPLHDAYYDPFWAACARLGLVVTVHAGWGGVQGQFQA
FT                   FLRQVHEAMGGAGEIDLNLQQRLREQLDARADSPLQLDLGPRRAMWQLMLGGVFDRYPD
FT                   LRLALTEVRADWLPPTLARLDERAARAGGALKRTPSEYFRRNCVVIPSSPHRAEIEMRH
FT                   EIGVGRLLFGVDFPHPEGTWPNTHDWIRAAFAGVPEGEARAILGENAVDVFGLDRAALA
FT                   RAAARVGPRPEEVLGEHDVDPRLLAHFHKRSGYARPAEDVDLAAVDHAWDDDLVALAPD
FT                   S"
FT   gene            351503..351583
FT                   /locus_tag="FRAAL0328"
FT   CDS_pept        351503..351583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0328"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59004.1"
FT                   /translation="MTPSAAFFQECLGGDPPILADRDTSW"
FT   gene            351815..352843
FT                   /locus_tag="FRAAL0329"
FT   CDS_pept        351815..352843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0329"
FT                   /product="putative substrate-binding ABC transporter
FT                   protein component."
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59005.1"
FT                   /translation="MIGDLTSTIPFKVPEVVPVARGVLRGFPNVRIETCDAKGTSGGYQ
FT                   ICARQAINEKVAGVIQGFVTAQDQTALTKAGIPVVGVSDDTSPNSFPVSSSFALYVSLG
FT                   VGLAKTGCTKLGIVYLDGSDFLIDYIKRGFESRGGKEVARAPVAANAADLAPAVAKLTG
FT                   AGATCVAVSLVPSGAAQALTALRQSGRTLTIGGISAIFNEDLLSSLGSLADGLIVVDSQ
FT                   LNTHDTAAAGIAKVQADARAVDSRTKLTEQAVVAWIAARLVGSALRSTTGEVTPASLTA
FT                   ALNGLHDVDLAGVVPPWTSQPLDNPSFRRVFNHYGINYEISGGKAVRKGDFYDIAPILR
FT                   TK"
FT   gene            352860..355682
FT                   /locus_tag="FRAAL0330"
FT   CDS_pept        352860..355682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0330"
FT                   /product="putative branched chain amino acid ABC
FT                   transporter ATP-binding protein."
FT                   /function="4.3.A.1.am : ATP binding and membrane component"
FT                   /function="4.S.12 : amino acid"
FT                   /EC_number="3.6.3.25"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTU2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59006.1"
FT                   /translation="MTEVFRFAALGVGAGALYALAAVGLVLVHRGSGVVNFAQGAMGMV
FT                   GAYVYFEGRGADLPDAVSVVLGLLAAAVLGAAFHLLILRRMRGASGLARIVATLALLVV
FT                   LQSVAVLRYGDLPKVIPSMLPIRPVSVFGAQIGRDRLYILAIVVVLTAALWAVYRFTRF
FT                   GVATSAVAENSRSAAALGVSPDLIGAANWAIGAALGALAAILLAPITGLGPANLTYLVI
FT                   PVLAAAVVGRFASFPITLAAGLVIGIGQSEVTRYVTAPGLATAIPFVLVAVVLLARGRT
FT                   TAGKGDSFGRMPRLGAGRPHRLATAVAVLAAVACIWWLLPAAWVNALGLQMIVGVILLS
FT                   FVVVTGYAGQVSLVQIGFAGVGALMTAWLVADHGWPFWLAAVAGVLAVVPVGIVVGLGG
FT                   LRTRGVHLAILTLGLAISLEAVVFGNPRYTGGTEGYQVGAIRVAGLAVDALSFPKRYAS
FT                   LVLAVLVVVALAIVNLRRSRAGRRLIAVRTNERAAAALGISVVGAKLYAFVLGGMIASL
FT                   GGILLAFHDPVPSFGAFAGLQSVTALQNAVLGGVGATTGPLVGSSFAPETLGQQIFSFL
FT                   GAKVALYLALASGVGLLFMLTSAPDGLVFLRHRADDRLRALLSERVPRRLAGFAARRRR
FT                   ATTPAPEPATSEVGGAAGREQHRVPPLALELRGVSVRFGGVAALRELSLRVRPGEIVGL
FT                   IGPNGAGKSTTIDAITGFTTLAGGEVRLGETRIDGWSRERRARAGLGRSFQSLELFEDL
FT                   TVLENLQSACDRRDSLAYVTNLVVPDRGRLTPAAWAAVADFGLAPFLDTPVQDLGYAHR
FT                   RMLAVARAVAGGHSVLLLDEPAAGLGDAQTRELGAVLRRLADERGMAVFLVEHNVDMVL
FT                   RTCDRVYALDFGSLIGAGTPAEISGLPAVVDAYLGTARFRADGAPTDGAPTDGAPSDLT
FT                   PDVALRRQTA"
FT   gene            355679..357097
FT                   /locus_tag="FRAAL0331"
FT   CDS_pept        355679..357097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0331"
FT                   /product="putative amidase protein"
FT                   /function="1.5.1 : Amino acids"
FT                   /EC_number="3.5.1.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTU1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59007.1"
FT                   /translation="MSEELTWLPAWRIRELIGKREVSCAEVTEHFLGRIEEFNPTLRAF
FT                   EQVDRAGAREQARRADRAVAAGEVLGPLHGIPTSVKSHIRVEGLRYVQPGTDVVSSFDD
FT                   ICVERLRRAGAIIVGTNTMMGAGADLTLARDRPGVFSPFNWDAEALSPWDTTRVPGWSS
FT                   SGGAAAAAARLLPVTIGSDGGGSTRLPAAYSGVVGLHTSRGLIPHVNYDKPTMLLTASY
FT                   GPLARYVRDAALVTRAMSGGDGRDYVCLQVDTPDPVDALDRGVAGMSMAWTEDFGFAGT
FT                   YATDDSARIIDVARAAAHSLAALGATVDPTDEVWEDRAERGTVRWTVEPSVYEVMVGTN
FT                   AAPLPALDPLLYREQAESRARNWERFQRLFRRYDVILSVTAQRIAAPVEQWERAWTVDG
FT                   PTFPGGSFAPVYCSHTMIFNWLGFPAVTVPCGFVDGLPVGLQIAAWHGREDLVLRVAQA
FT                   FQQAFPRDEHPAVS"
FT   gene            complement(357153..357674)
FT                   /locus_tag="FRAAL0332"
FT   CDS_pept        complement(357153..357674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0332"
FT                   /product="Conserved hypothetical protein; putative
FT                   tetracycline resistance repressor protein."
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTU0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59008.1"
FT                   /translation="MGEALKIIRADGVEGLTMRRLSDRLGVAVGATYKHVPTKDHLLRL
FT                   VTLELYARVGPCEPTGADWCAGIRSFLLRFRQVVGAYPGMVGHISAHGTDPMPHRLYTS
FT                   LNGTLRAVGFSPAGADRVVRVLFFYTSGAMLAPLAPDEHADADAEFAAGLDLVLDGVHR
FT                   SLERDRAATA"
FT   gene            357945..359039
FT                   /locus_tag="FRAAL0333"
FT   CDS_pept        357945..359039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0333"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein."
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTT9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59009.1"
FT                   /translation="MAAVSAGRPEADEPIPPDPDDPHPPAGSELSAGDVVPGGFGWARV
FT                   AGRVVPLAATGVALYLLMPQLLAVFSAFPRLRAFQPLWYPAMVLLEAASFACVWQLQRI
FT                   AISGLSWFLSVTSQLVSNSISRIVPGGIAVGGAVQFRMLNRGGCDPAAAGFALTATSMV
FT                   TTGIVFGLPLVVLPVITFGQPAPSGLTAIATTGGLAFALLVIVGVVLARSDTTVRLLAR
FT                   AVTWLARLARRSVPADLPDVLVARRTDVIRSLGRRWPGAVLTAAGKWGLDYLALLAALA
FT                   GAGQHPRVSLVLLAYVAANVLAMIPITPGGLGFVEAGLTGTLALAGVPAAAAAVSTLAY
FT                   RLVSFWLPLAAGAPAWVAYRVRYR"
FT   gene            359286..360056
FT                   /locus_tag="FRAAL0334"
FT   CDS_pept        359286..360056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0334"
FT                   /product="Activator protein."
FT                   /function="3.1.2.2 : Activator"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12940979; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTT8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59010.1"
FT                   /translation="MRYEILGPLRVLDGDRQVHVSAPKLTVLLAVLLARARQVVAADLL
FT                   VAEIWPEDPPRRATAALHVYVSQLRKLLTCPRRPQCPIITRSPGYLLAVEPEAVDLHQF
FT                   EQRVAAGRRHARSGRHPQAVEQFTAALALWRSPALSDLRDGPIVDAFATRLEESRLECL
FT                   EMMMESGLSAGRHRELVGQLFELTLEHPMREAFYRQLMIALYRSERQADALRVYQRARG
FT                   LLAEELGVEPGRPLRQIQRAILRDDDRFELPSTG"
FT   gene            complement(360118..363174)
FT                   /locus_tag="FRAAL0335"
FT   CDS_pept        complement(360118..363174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0335"
FT                   /product="putative LuxR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8026751; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTT7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59011.1"
FT                   /translation="MTGSRSGAGRRPRAVRPKERRRLLAALEALATGQGRIVEVRGDPG
FT                   IGKTRLLGELTRQAARRGLPVVSGRCTESDRAVRFGVFSRLLSIQPPPSAEADRSSPGP
FT                   LLATMLSTPGSGASWPDAGSARRDAEGSLFDAARLLLGRAAGDGLVLIVDDVHWADEAS
FT                   SALIDHLVRWPVDAHLLLVLAHRPRQSPPRLLRSLAEGEELGTVDRIDLPPLTLEQAAQ
FT                   LTGLATDDPRLWELHQASEGNPHYLLGLTALAHGLAPGRAELAADEGQGPEASDLDRPP
FT                   SDLVSPVLAELAELDPACLHLVWAAVVLDEAFDVDTAAAVAALAIDPACAAVATLTARD
FT                   LLVATDGAAYRLRHPLLARMLYPTVDPGWRRAAHRRAARILGLSGAPPAVLAAHIEHCP
FT                   QGSGLDEVEVLAWAAEERLATAPPDAVRWLWLALRILADVDGEDPARVQGLRGEVSLGL
FT                   ARALGAAGQLAESLAQIRQTLRLAATLSATARADLASLCAMLAYSLGQHADSQAILTDE
FT                   IDAAIGEPPGQLAHTPGAAHRPGAAHPPGAAHPPGAAGRPVRPQARPAIITLLLTRAAV
FT                   GLLDGTPPSPDDLGLLLRLAREQQDHTAEVGALALRGVVEAFGGDIPAAATTVTACIAI
FT                   ADRLPDAELADHPEHLALLGWADSVLGRQLDAERHFSRGAALARRTGRDDTLPLLLGGL
FT                   GAVYHRVGRLADARQTAAEVQHLIRNTRRGHHTNLAGAIEALAGVWIDGHGSRRAATLA
FT                   EEAAIERFTARPTPRRSWWGDVAAIWTAYAAETDSGDPHRTMALILDTGGGETLAELSP
FT                   VLRPMAFEALTAASERLGDASAARRWADGAEQAAEGLNLGYQRGHALAARAHAVRHAEP
FT                   AAAGALYQQAADLFAAAGMLSLRTYLLVQGGLCLAAAGRTNPAARQLAVAIELAGRCGA
FT                   HRLGAQARAALRALDERRSAGVDALAGLTPREREIALVAVGGKTSRQIAYDLRLSPRTV
FT                   DAHLTRIYRKLGVSSRVALVRLVDGNGPR"
FT   gene            complement(363171..365054)
FT                   /gene="ddpD"
FT                   /locus_tag="FRAAL0336"
FT   CDS_pept        complement(363171..365054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddpD"
FT                   /locus_tag="FRAAL0336"
FT                   /product="ABC transporter ATP-binding protein."
FT                   /function="4 : Transport"
FT                   /function="4.3.A.1.am : ATP binding and membrane component"
FT                   /EC_number="3.6.3.30"
FT                   /EC_number="3.6.3.27"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RTT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59012.1"
FT                   /translation="MPADDPLLVVEGLSVTFDARSAHPVRAVRDVSFTLRRGECLAIVG
FT                   ESGSGKSVTARTLVGLTGARATVSARRLGFAGEDLTRVREASWRRIRGRHIGLVLQDAL
FT                   VSLDPLRTAGAEIAEALRTHRVVDRAGVHSRVLSLLTDVGVPEPAQRAAQYPHQLSGGL
FT                   RQRALIASALAAGPELLVADEPTTALDVTVQAQVLDLLRGLTAEGMSVLLISHDLAVVA
FT                   GLADQVAVMYGGLVVEQGPTATVLADPRHPYTQALLAAVPAMHAKGTRLSITPVDRPPA
FT                   TAGCPYAARCPRSDERCRAELPSPADDEHTHRTLCWHPGPPPPTTAPAAAPSTPAATVT
FT                   STASAADRALVATTAAPVAGADRPGRGADAGPLVEVTAINQRFRSPDGSWRHAVRDVSF
FT                   ELFAGETLGVVGESGSGKTTVARIVLGMQAPDSGTVRFAGAPWSGLPERRRRALRPRIQ
FT                   AVYQDPLGSFDPRFTTERIIGEALGAAGVGRGQQRRDRVVDLLERVGLAAGLLRRRPPE
FT                   LSGGQRQRVAIARALATEPELLVCDEPVSALDVSVQAQILDLLAGLQQDLGVAMLFISH
FT                   DLGVIHHISDRLVVMKDGLVVETGPVGQVFAQPAQEYTRTLLAAVPRPDLT"
FT   gene            complement(365258..366133)
FT                   /gene="ddpC"
FT                   /locus_tag="FRAAL0337"
FT   CDS_pept        complement(365258..366133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddpC"
FT                   /locus_tag="FRAAL0337"
FT                   /product="ABC transporter dipeptide permease"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RTT5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59013.1"
FT                   /translation="MTAIDVAVGLGRLGRRGLTRGRRPPRVGLVLAAGILLLIILIAVA
FT                   PGLFTDRSPTDTASVDALHGPSGAHWFGTDQLGRDVFTRVVDGAGRSLRLGVGATLLGV
FT                   LAGAVLGLAAALGGRTVDAVLMRLADVLLALPPLLLALLAMAVLGSGAWNLTLAVAIST
FT                   VPGYARMVRAEALVVRRSGYVEAAVGLGLRRWLLVARHILPNTLGPLLVLATVGFGTTL
FT                   IAASSLSFLGFGVGPPTPEWGLMLSEGRNYLSTAWWIGVFPGAAITVTVIAVNVVGRHA
FT                   QARYTRRTSR"
FT   gene            complement(366130..367107)
FT                   /gene="ddpB"
FT                   /locus_tag="FRAAL0338"
FT   CDS_pept        complement(366130..367107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddpB"
FT                   /locus_tag="FRAAL0338"
FT                   /product="ABC transporter oligopeptide permease."
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RTT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59014.1"
FT                   /translation="MTGGVAAAVGRRVAAAAAVMLGAATTAFIALHLLPGDPVAIILGP
FT                   SNMASPEVRAQIRLDLGLDQPLIMQYLHYLGRLLHGDLGESFQLQQPVSKLIGDQLRPT
FT                   VELALAAIVLAVVLAVVSAVATAGRRPGLRALANLWELVAVSTPSFWLGILLLTAFSFR
FT                   LELFPVAGAEGFSALVLPALTLGLPVAGILGQVLREGLETALEQPFVATARARGLSQTA
FT                   VRLRHALRHAAVPLVTLSGWLTGTLLGGAVLVEKVFARPGIGALTLQAVSSRDMPVVMG
FT                   VVLLSALVFVVISTAVDLLYLTIDPRLRTEGTAAGARDAKGAQA"
FT   gene            complement(367110..368774)
FT                   /locus_tag="FRAAL0339"
FT   CDS_pept        complement(367110..368774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0339"
FT                   /product="ABC transporter oligopeptide binding protein"
FT                   /function="4 : Transport"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1702779; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTT3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59015.1"
FT                   /translation="MRLARPVHLLFAAATAATLVLTSCGSDSGSGSDAGGSGAGSGKPK
FT                   AGGSLTYALDVEPTCFDLQVNQQGITGDIERGVVDSLVTVDAKGVFHPWLATSWEVASD
FT                   LKTYTFKLREGVTFTDGTPFDAAAVKANFDRIVDKKTKSQYAATLLGPYTGTDVVDAHT
FT                   VKVNFSKPFAPFLQGASTPNLGFYSTRSLSHGPDALCAGGSAIVGTGPFVFTSYTKGQS
FT                   VVLTKNPKYNWAPQQAAHTGAAYLDKVTFRFLTEDTVRVGAVTSGQVDVATSIPPSDTR
FT                   TVEADKGLQIRKVEDAGGAYNVYLNTAHGPLDDVRVRRAIQLGANVDQAVKTVYFGQYA
FT                   RAWSPLTPATPSYDKTLTNAIAFDPTAAGKLLDEAGWTGRDGQGYRTKDGKRLTVNWPW
FT                   NPPHTREQREVVAQAIQADLKKIGVEVTRPALDIGAYVSLALNGNYDLYDFSWTRFEPD
FT                   ILRGFFNSASLPATGGQNAANLKDPQVDTWTDAGAATLDRAKRDDLYGKVQHRVVVDDA
FT                   VVLPIYIPTKLVAIATDVSGLTVDPNGKPLLFDTWRS"
FT   gene            369188..369505
FT                   /locus_tag="FRAAL0340"
FT   CDS_pept        369188..369505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0340"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59016.1"
FT                   /translation="MCRRAVRTVRAAVPAICRGGRTRAWPNGARGMEVNVRRRVREVGR
FT                   CCRSSTEFILEKPGTFVVETVMHATSEVIDCDFVVVVVTSNPTHSPCYVGVRSRAQGPV
FT                   R"
FT   gene            complement(369602..371098)
FT                   /locus_tag="FRAAL0341"
FT   CDS_pept        complement(369602..371098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0341"
FT                   /product="putative MFS transporter protein."
FT                   /function="4 : Transport"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9529885; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTT1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59017.1"
FT                   /translation="MDASAPRPRPGLGLTLALLAFAQFMIAIDYNIVYVALPDIGRELD
FT                   FSSQSLQWVVSAYAVTFGGLLLLGGRAADRLGSRRVFLTAVLLYGLSSLAGGLANDPGL
FT                   LIAARAVQGVGGALLFPAILTLINTTFRPGAERTRALAAWGAAGGGGLAAGALLGGVLT
FT                   NYLGWEWVFFVNVPVAAVIAVAAPRLLAADGTRPSRTGFDLPGGLLATAGVALVVFGLV
FT                   SGPDAGWWSVRAAGAIALGVVILAGFAVLEGRLRNPLLPPRLLGYRNLTTAVLAVFVFA
FT                   GTLAGEYFLFTTYLQNVLGYSPLKAGLAFLPLTLISMAGAGPLATTSVARLGYGATMAL
FT                   ALLLCGIGIGLLVPGMSVGGSYPALLPGIAVWGIGGGIAFTVCFSAAGHGIAVEEQGVA
FT                   NAVASTSQQVGSAVGLAAIVAVANSGLDLGVGGAPTPDSVVDGLRVGGLVSAVTAVVIS
FT                   VVVALLLRDRPSAASSPATPSAPGAGVPEATGDEDVRAYS"
FT   gene            371337..372068
FT                   /locus_tag="FRAAL0342"
FT   CDS_pept        371337..372068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0342"
FT                   /product="Putative TetR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTT0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59018.1"
FT                   /translation="MKLSRRERLRVETVRDIKEIALRHMAEQGAAGLSLRAIAREMGMT
FT                   AGALYSYYDTRDDLITALIVDVYDSLAQALEAARRSRPDDPAGQLEAVGVTYREWAIGR
FT                   PPEFQLVYGDPIPGYKVRDDGAELAAEHRACGVLIRIVAAAWPANGATPPAGLYTWSDF
FT                   RPDFAAMARTSFPDFPPDGAALSLRIWGRLHGLVALEVYGHLRPQVNDPARLYRDELRD
FT                   LCELLNLTPNTPNTPSAAPTA"
FT   gene            complement(372111..372599)
FT                   /locus_tag="FRAAL0343"
FT   CDS_pept        complement(372111..372599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59019.1"
FT                   /translation="MSAKLSAADLAEIGQTLALFSHVFDNRQADDLGLVFTADVAVEFQ
FT                   RSGRSLRGLAEVAQFQRGLPPDAADHQTVSTVVLADPDGTVRAVSRYLAVLADGSVTNG
FT                   EYRDVLVRTGDGWRIAARQIVPRYPLAADAPDAGRAVVQQPLPGPWRASADRLPHLAP"
FT   gene            complement(372632..373054)
FT                   /locus_tag="FRAAL0344"
FT   CDS_pept        complement(372632..373054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTS8"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59020.1"
FT                   /translation="MSIEGNKEIARRLYEEVVNYGKAELLETFVADDSDDTTRQHAGWS
FT                   IGRAGFREHLEWLRSAVPDVHTTVTDLVAEDDRVVVYWRIEGTHQGELFGAAATGKPID
FT                   ATSISLITFRDGQIVNYTVLPDRLTILRQVGAVAAA"
FT   gene            complement(373116..373892)
FT                   /locus_tag="FRAAL0345"
FT   CDS_pept        complement(373116..373892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0345"
FT                   /product="putative ketoreductase, short chain
FT                   dehydrogenase/reductase family."
FT                   /function="1.6.15.4 : Acyl carrier protein"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTS7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59021.1"
FT                   /translation="MARGAVVVTGAAAGIGEATVELFAERGFGVVAVDVSEEGLAKLGT
FT                   RADVVTLVGDVADPATNDAMVALAVERFGRLDAAVLNAGLGGAPPIEAAGATESLDTIY
FT                   AVNVRGLVLGIRAAAPALRAAGGGSIVVTSSGAGLRGDPYTWAYNTTKAAANNLVRSAA
FT                   LDYAFEGIRINAVAPGLTETPRTAGQRADPAFAAAVTRRVPLGRWAQPAEQAEVIYFLA
FT                   SPAASYITGAVIPVDGGLSASNGILLPPTYPGEPPQ"
FT   gene            373977..374180
FT                   /locus_tag="FRAAL0348"
FT   CDS_pept        373977..374180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0348"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RAM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL29817.1"
FT                   /translation="MIGCVIPVALAPAGVPLMFPNLTGLGNVVGCFLVACSPKLHNKEL
FT                   RGPDGWPGRRRTANQEWSGTAR"
FT   gene            complement(374291..381133)
FT                   /locus_tag="FRAAL0346"
FT   CDS_pept        complement(374291..381133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0346"
FT                   /product="putative Type I modular polyketide synthase"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTS6"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR015083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036299"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59022.1"
FT                   /translation="MSSNDAKLREYLKRAVSDARTAQKRLREVESSRREPIAIVGMACR
FT                   LPGGVTTPEELWELVADGRDAISEFPTDRDWNVEELFDPDPDAAGKSYTRHGGFLHDAA
FT                   DFDAEFFGISPREALATDPQQRLLLETAWEAFERAGIDPTTLRGSRTAVFAGIAGQDYA
FT                   ARLHEIPDELEAYIGLGTLGSVLSGRISYTFGFEGPSVTVDTACSSSLVALHLASQALR
FT                   GGEADLALAGGVAVMSSPAAFIEFSRQRGLSPDGRCKAFADAADGTGWAEGVGILLLER
FT                   LSDARRNNHPVLAVVRGSAVNSDGASNGLTAPNGPSQQRVIRAALASARLSAADVDAVE
FT                   AHGTGTPLGDPIEAQAILATYGQNRPTDRPLWLGSLKSNIGHTQAAAGAAGVIKTVLAL
FT                   QHGLLPRTLHVDEPSTQVNWSTGAVELLTEARAWPETGAPRRAGVSAFGVSGTNAHVII
FT                   EQAPVKQAPADDGAPEGNVDGQDATPASNAPARPSHAAQPQDVDRQGADRPDGAERRPD
FT                   AEPERAALPVLVPLSARSPEALRDQARRLAVHLRTHNAGDPDRAGDPDHANGAGGADRA
FT                   VDANDAGGAARVPLPALARALATRTAFPHRAVTLATSTPELLTGLNQLADGHPDSRVIT
FT                   GQAGLGKLAFTFSGQGSQYPRMGHTLYATHPIYRQALHDTADALNPHLDQPLLDILHAD
FT                   PDSPEATTIHHTAWTQPTLFALQTALYHLITSHGITPDYLIGHSLGEITAAHLAGILTL
FT                   DDAARLVTTRAHLLASLPPGGGMLTLHTDEPTTRTLITHHPSIDIAALNSPTNTVIAGD
FT                   TPTLTHIAEQAALQGIRSRTLTVSHAFHSPLTNPILTPFHTTAATLTYHQPTIPIIAGL
FT                   TGTLPTDSDHTTADYWTRHIRHTVRYTHGTTTLSEQGVTTYLELGPDTTLTTLTTQTLT
FT                   TLDRSGHRPRFTATPTLHRTKPPTTTLATALATLQAAGHTPTPPSISSAVPSAQGATGD
FT                   DTSPDSSTSPHSSTSPASSAADAGDPARLAAALPTYPFQRQRYWLREASTGGHSVAGLG
FT                   LASADHPLLGAAIGLADQDGVLFSGRLSLATHPWLADHAVQGNVLVPGTAFVELALRAG
FT                   DDLGVGALDELVFEAPLILPERAAVAIQVTVTAADDTGRRPVAVHSRPQDSPDAAWTRH
FT                   ASGVFAAADGDEGAGAGDAPEALTAWPPPGALEVPVGDVYPALAASGLAYGPAFQGLHA
FT                   AWRAGDDLYAEVTLPDAGTDQHQAAAFGVHPALLDAAVHLSVFHGLADVPAGHSRLPFA
FT                   WNGVRLHATGATSLRVHVDVHGTDEISLHATDPAGAPVITVDSLLARVVSAEQLAAARR
FT                   RRSDSLYEVTWPPLRLSAAGPGATNWAVIGSGDAVPAELGASVTRTDHPDLASLGVAVE
FT                   AGAAVPDLVVLSLGALPLGPPAHDGLRTDAGDLAGPTGAPDLPDVPAAARAATERAVDL
FT                   LRAYLSEQRWDATRLVVLTSGAVSVAGEDVDLTTAPLWGLVRTAQNEHPDRILLIDLDA
FT                   DPDSRTALPAAVATAQATGDNQLALRRGTAHTPRLVPATTPDAADAADATNPAGPADQA
FT                   DPAGPAGPAGWNLDPDGTVLITGGLGTLAHHLAHHLITHHHTRHLHLTSRTGPHHPHAT
FT                   ALRTELENLGATITITATDTTNPTQLHHLLDTIPPAHPLTAVIHTAGTLDDTTLTNLTP
FT                   ERLHTVLAPKIDGAWHLHHLTRHHPLKAFVLYSSLAGLVGGAGQGSYTAANTFLDALAH
FT                   HRRAQGLPATSLAWGLWDDTSTFTENLTAADRARIAQSGLRSLAPADGLALFDAAGTLR
FT                   QPLLVPAALDVATISRRAAADGVPPLLRGLVRPGRRGAAQAGTASRADAAALRGRLAAA
FT                   ADEQRESILLEHVRQEVAAVLGHRDVDTVEAERDFGELGLDSLTAVELRNRLNTATGLR
FT                   LPATLTFDHPSATALAAYLAEQLAKILAATPTGGGANAAASGPAAARPTAIGPQEGPLS
FT                   ELYQALCARDNFAAAAQLLVVASALRPVFGAADSARHAVPTLQLAEGPEHTEGPEHAEG
FT                   PARHRLICFPAMSAISGPHEYARLGTLLRGERDVFVLPSPGYDENDHVPIDEPTYIEMH
FT                   VREVTRLVGDEPFVLVGRSMGGVVAHAVAAELENAGIAPSGLVLVDSYPPESAVREGMA
FT                   DWWLTAMITGMLDRVDRYQMVWSDASLTTMGAYVRVFNGWQAKPVAAPTLLIRAADPLR
FT                   RTIIDPADPDGWQAYWTTPHTTVDVPGEHFSILEEHSPTTVAAIRQFIDSLV"
FT   gene            complement(381168..390587)
FT                   /locus_tag="FRAAL0347"
FT   CDS_pept        complement(381168..390587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0347"
FT                   /product="putative Type I modular polyketide synthase"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTS5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR015083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59023.1"
FT                   /translation="MSDDQIRYLLKRVTAELHETRERLRDERDARVEPIAIVGMACRFP
FT                   GGVGSAQELWELVAEGRDAVGEFPTDRGWDVEALFDPDPDATGKSYTRHGGFLTDAAGF
FT                   DAEFFGISPREALALDPQQRLLLETTWEAFEQAGIDPTALRGSRTAVFAGTNGQDYGDT
FT                   VRQPPPELEAYLGLGTLGSVLSGRISYTFGFEGPSVTVDTACSSALVALHLAAQALRGG
FT                   ETDLAVASGVTVMASPAAFVEFSRQRGLAADGRCKAFADAADGTGWGEGAGVLLVERLS
FT                   DAQRHGHPILALVRGSAVNSDGASNGLTAPNGPSQQRVIRAALAGARLTPADVDAVEAH
FT                   GTGTALGDPIEAHALLTVYGRNRPADRPLYLGSVKSNIGHTQAAAGAAGVIKIVQAIRA
FT                   GLLPPTLHVDAPSTQVDWSVGGVEVLTEARAWPETGAPRRAGVSAFGVSGTNAHVIIEQ
FT                   APAAVNTVSADPTDPADPAASGAGATEALPVLVPLSARSPEALRDQARRLAAHLRADGG
FT                   GDSDSDSHNDDRSDGPSTDRSTDRVPLPTLARALATRTVFPHRAVALATSTDDLLAGLD
FT                   HLADGRRGPSVVTGQAGTGKLAFALSGQGSQYPRMGHALYTTHPVYRRALQDAADALNP
FT                   HLEQPLFDVLHADPDGPLASTIHHTAWTQPTLFALQTALYRLVTSHGVVPDYLVGHSLG
FT                   EITAAHLAGVLSLDDAARLVATRARLLASLPPGGGMLTLHTDEPTARELIAEQPALDVA
FT                   AVNSPTNTVVAGDADVLAHIAALATERGIRSKFLTVSHAFHSPLTDPILASFHTTTGAL
FT                   TYQQPSIPLIAGLTGDLAVDGDHTTADYWTRHIRDAVRYADGITTLRTHGVTTYLELGP
FT                   DTTLTTLTTQTLTTLEGSDTSDTSDRARFTAAPTLHRTKPPITTLTTALATLHTEGHLA
FT                   TPPVTSSTSTSGTTADSTSPGSDGDSTTSEDATASGTDLARLAATLPTYPFQRRRYWLE
FT                   GSPDAPGDLSGAGLRSAGHPLLGAVVRLATDDTVVHTGRLAAATQPWLADHLVQGSVVV
FT                   PGTAFVELALHAGDGFGADLLDELVVEAPLVLPERGAVVIQVTVAAADDDGRRPVTIHS
FT                   RPQAEADGGAADDADWTRHASGTLVSGRGSTGPADQDVTGQDAQSPNAQSPNAGSPDAG
FT                   SPDAGSPDAGSPDAGSPDAWPPAEAIAVDLTDGYAKLAASGLGYGAAFQGLRAAWREGD
FT                   HLYAEVTLPEPQADHSPHGAFGVHPALLDAAFHAAALHRLPDTPAGHSRLPYAWNGVRL
FT                   HATGATSLRVHVAVHGTDEISLHATDPAGAPVITVDSLVSRLVSAEQVAAARREAGRAD
FT                   LLYEVTWPELEVSGPGSAAGPWAVLGEDADDLVTALTAAGIETRTVADFAALVAAAADA
FT                   PRAADTPRAADTPQAANGPDAADGPDAADADTPQVVLVRVPTLSAAGSGEAETVGVADG
FT                   VADGATPALAKATAAAVLPLLQDWLRTDRPGSTLAVVTSGAVSVAGEALDLTSAPLTGL
FT                   LRTAVAEHPGRVLHVDLDGDPASHASLPATVLAALAAQEPHLALRHGSAHTPRLTPVPA
FT                   AGSAGSPAPSPDRAGTADAQRDTAVDPADPAGWNLDPDGTVLITGGLGTLAHHLAHHLI
FT                   THHHTRHLHLTSRTGPHHPHATALRTELENLGATITITATDTTNPTQLHHLLDTIPAAH
FT                   PLTAVIHTAGTLDDTALTNLTPERLHTVLAPKIDGAWHLHHLTRHHPLKAFVLYSSIAG
FT                   ITGNPGQANYATANTFLDALAHHRRAHGLPATSLAWGLWDDTSTFTAHLTAADRARIAR
FT                   SGVRPLATAQGLRLFDEAAAADRAVLVPVPLDLAALRARAAHDGVPPLLRALVRPVRRV
FT                   AATASAAGGSALATRLAGRSAPEATALLVDLVRAEVAGVLGHAGVASVPADRAFSELGL
FT                   DSLTAVELRNRLSAASGLRLPATLTFDHPSPAAVAELLRTQLLGSAPARREVPRPRRRR
FT                   DVEEPIAIVGMACRLPGGVTTPEELWELVAGGRDAISEFPVNRGWDVDDLFDPDPDATG
FT                   KTYARHGGFLHDAADFDAEFFGISPREALATDPQQRLLLETSWEAIERAGIDPTTLRGS
FT                   TTGVFAGVMYHDYSQRIHAVPRALEGYLGNGNAGSIATGRISYTFGFEGPSVTIDTACS
FT                   SSLVALHLAAQALRSGETDLALAGGVALMASPAAFVEFSRQRGLSPDGRCKAFAAAADG
FT                   VGWAEGATMLLVERLSDAQRHGHPVHAVIRGSAVNQDGASNGLTAPNGPSQQRVIRAAL
FT                   AAAHLNPADIDALEAHGTGTPLGDPIEAQAILATYGQNRPTDRPLWLGSLKSNIGHTQA
FT                   AAGAAGIIKTVLAIQHGTLPQTLHIDEPSPHVDWTDGDVALLTEPTPWPDTDRPRRAAV
FT                   SSFGISGTNAHVIIEQAPAERNVLAARTTEPTPTTEPTRTTEPTPTTEPTRTGGGPALP
FT                   WILSARTPDALRAQADRLGAFVRSDAGAGLDPADVADALVAARTVFEQRAVVLGTDRDG
FT                   LLGAVDALAAATASARVVRGAADTTATTVFVFPGQGSQWAGMARELLATSPVFADHLDA
FT                   VAAALAPYVDWNLLDVLHERPDAPTLDRVDVVQPTLFAVLVALARLWQHHGVHPQAVVG
FT                   HSQGEIAAAHIAGALTLDDAARVVALRSRALTAITSPGAMASINLPVDEITPLLTPGLS
FT                   VAAVNSPATAIVAGDEAELHALLTVVRERGTRTRVLPVTYASHSPHVEAIRDELLTALA
FT                   PIRPQPAAIPILSTVTADWIDPTTLTADYWYTNLRQPVLFEPATRALLQAGHDLFIEIS
FT                   PHPVLTTALAETLDTTPDLPGPVAITETLRRDTGDLTKIHAALAESWVRGARVDWRIVL
FT                   GASVTDPGTGSHATAGGHATAGSHATAGSPGAADGSARRRRWVSLPTYAFQRRRYWLDP
FT                   TPVRLVDGELVADGPGGDGTLAGLAAAPSGPSLAERLAGLAPSERDELLLTLVRAEAAV
FT                   VLGHDSPATVGATRAFRELGLTSLTAVDLRNRLNAATGLTLPATLVFDYPTPVAIADFL
FT                   AGELGSAQTMDTSSPLRVLDRLEAVLEATGGDNADTAEAVTRLRALVARWADVVPADPA
FT                   DDDDLDLDSATDDELFALLDDNVESS"
FT   gene            complement(390614..401641)
FT                   /locus_tag="FRAAL0348"
FT   CDS_pept        complement(390614..401641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0348"
FT                   /product="putative 6-methylsalicylic acid synthase"
FT                   /EC_number="2.3.1.165"
FT                   /EC_number="2.3.1.94"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="GOA:Q0RTS4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR015083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041618"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59024.1"
FT                   /translation="MLSGPPRLRASRRLIPHMANEAKLRDYLNRVAADLHQTRQQLREQ
FT                   EAARREPIAIVGMSCRFPGGVSSPADLWRVVDEGLDVTGPFPTNRGWDVDGLYDADPDR
FT                   PGRTYARSGGFLHDAPEFDAAFFGISPREALATDPQQRLLLETAWEAVEEAGIDPVSLR
FT                   GSATGVFAGVIAQEYTPRLHQPTPERVDGYVLTGSTTSVASGRVAYALGLEGPAVTVDT
FT                   ACSSSLVAIHLAAQALRGGECTLALAGGVTVMSSPGMFVEFSRQRGLAPDGRCKPFAAA
FT                   ADGTAWAEGVGVLVLERLSDAQRLGHRIHAVIRGSAVNSDGTSSQLTAPNGPSQQRVIR
FT                   AALAAAALTPADVDAVEAHGTGTTLGDPIEAQAILATYGTDRPADRPLRLGSLKSNIGH
FT                   SQAAAGVGGIIKLIGAMSHGRLPKTLHVDAPTPHVDWSAGTVTLLTEPADWPTTPDRPR
FT                   RAAVSAFGISGTNAHLILEQGPIPADAGTADGDTATGGTGTDGTGTGGTGTGGTGIEDA
FT                   AGADTADGAGDAGRGPAVRGRALPWVLSARTAEALGGQATRLGAFVDAHPGLAPVDVGR
FT                   ALATTRAALEHRAVVVAEDPAGFRAGLAALAAGSGGSAGSAGVAGVEVIAGIATPDGAA
FT                   TDARIVRGVADTTATTVFVFPGAGTAWPAMARELLATSPVFAEHINAVAAALAPYVDWN
FT                   LLDVLRERPGAPTLDRVDVSQPAVFAVLVALARLWQHHGVHPHAVVGHSQGEIAAAHIA
FT                   GALTLDDAARVVALRGQILGALPAPGAVVWVNLPADQVRERLARFREGAAAVSVAVLNS
FT                   PTSTAVAGTEEPLAEFVAGLQAEGIRTRDVPVGYASHSARVEAVREELLAALAPIRPQP
FT                   ATIPILSTVTADWIDPTALTADYWYTNLRQPVLFEAATRALLDDGHDLFIEVSPHPVLT
FT                   TALAETLENTPGLPGPVAITETLRRDTGGLTRFHTSLAQAYVRGAGLDAAAVYAGSGRG
FT                   HVDLPTYAFARRRFWLDASSTSPSGDAAGLGLGSADHPLLGATVRLADSDGAVLTGLLS
FT                   LRTHPWLADHVVFGSVVLPGTALVELAVRAGDETGVPVVEELIVETPLVLPERGGLQVQ
FT                   LTVGAPDEDGLRPVSIHTRAEDASAQAAWTRHAHGVLRAPEATDAAVSSGVPSGASPEV
FT                   WPPAGAVRVDTGDLYPSFAAAGLVYGPTFQGLRAAWRDGEDLLAEVTLPADALDRAGAF
FT                   GLHPALLDAALHLTGLPSAATALDGTVLNGTAPSGTAPSGTAGGTRLPFVWRGVRLHAS
FT                   GAGGLRVRLRVSGPDQIALTAVDGTGAPVVSVAGLALRPVTAEQIRSAPGPRNDSLFAL
FT                   TWPELPATPGGNSSGAVEPPGAVEVVTDLDELAARIDAGSAVPNLVAVAAPAPPGEATE
FT                   PDAVAARARTAAADTLALLQRWLTEPRWAEATLAVLTSGAVSVAGEDVDLTTAPLWGLV
FT                   RTAQNEHPDRILLIDLDADPDSRTALPAAVATAQATGDNQLALRRGTAHTPRLVPATTP
FT                   TAPPTAAPGAAHPADPAKPADQTDPADPADPAGWNLDPDGTILITGGLGTLAHHLAHHL
FT                   ITHHHTRHLHLTSRTGPHHPHATALRTELENLGATITITATDTTNPTQLHHLLDTLDPH
FT                   HPLTAVIHTAGTLDDTTLTNLTPERLHTVLAPKIDGAWHLHHLTRHHPLKAFVLYSSIA
FT                   GITGNPGQANYATANTFLDALAHHRRAHGLPATSLAWGLWDDTSTLTENLTAADRARLG
FT                   AGGLRPLSPADGLALFDAAGTLDEPLLVPAALDLAAIRAQSAQRGVPPLLRTLVPPVRR
FT                   AAGAGIGVTAPGGSSLARRLAELTPGDRPAEALAAVRREIAAVLGHATVDGIAADRAFS
FT                   ALGLDSLTAVELRNRLNTATGLRLPATLTFDHPTPDALAAHLVTTLAADDARPTGTGNS
FT                   TGITSATPAATDEPIAIVGMACRLPGGVTTPEELWELVAEGRDAISAFPTDRGWDLERL
FT                   YDPDPDAAGTSYTRHGGFLHDAADFDAEFFGITPREALATDPQQRLLLETSWEAIERAG
FT                   IDPTTLRGSTTGVFAGVMYHDYGTRLREVPPELEGYLGTGIAGSVASGRISYTFGFEGP
FT                   SVTIDTACSSSLVALHLAAQALRSGEADLALAGGVAVMATPTEFIEFSRQRGLARDGRC
FT                   KAFAAAADGVGWAEGATMLLVERLSDAQRHGHPVLAVVRGSAVNQDGASNGLTAPNGPA
FT                   QQRVIRAALAAAGLGPADVDAVEGHGTGTPLGDPIEAQAIVATYGRERPADRPLWLGSL
FT                   KSNIGHTQAAAGAAGIIKTVLALHHGLLPRTLHVDAPSPHVDWADGAVALLAEPTPWPD
FT                   TDRPRRAAVSSFGISGTNAHVILEQPPTAANAPAVGPAPAEAADPQTAAGDPAAPADGP
FT                   QGDGGAVEALPVLVPLSARSPEALRDQARRLATHLRTHTTDHTTGADGADDADDAGAGA
FT                   GAGATSNAARVPLPALARALATRTAFPHRAVTLATSTPELLTGLDRLADGQPTPAVITG
FT                   QAGTGKLAFTFSGQGSQYPRMGHTLYATHPIYRQALHDTADALNPHLDQPLLDILHADP
FT                   DSPEATTIHHTAWTQPTLFALQTALYHLITSHGITPDYLIGHSLGEITAAHLAGILTLD
FT                   DAARLVTTRAHLLASLPPGGGMLTLHTDEPTTRTLITHHPSIDIAALNSPTNTVIAGDT
FT                   PTLTHIAEQAALQGIRSRTLTVSHAFHSPLTNPILTPFHTTAATLTYHQPTIPIIAGLT
FT                   GTLPTDSDHTTADYWTRHIRHTVRYTHGTTTLSEQGVTTYLELGPDTTLTTLTTQTLTT
FT                   LDRSGHRPRFTATPTLHRTKPPTTTLATALATLQAAGHTPTPPSISSISGATADSTSPG
FT                   SDGDSTTGEDATASSTDVARLAAALPTYPFQRQRYWLEDTASAGSDRQASPLDAADTGF
FT                   WDAVQHADATTLADALGISDPTDQNALATVLPALNSWWARRVTESQADSWRYRIVWRPV
FT                   PESTGAPAAADGDWLLVVAPEFVDHPRVAVAARALEGAGATVRRLVVPATADRHTLAAE
FT                   LTRLLAADGPAVAGVLSLLALDESAHPQAAATPVGIAGTVALLQALDDSGLDARLWIAT
FT                   GGAVSTSAADPVTRPADALLWGLGSISAVERPGRWGGVVDLPEQVDGQVDEEVELLLAT
FT                   ALRAGHGETELALRRGGLLARRLVPAPATPKTTAPKTTAPETTATDTTATATTEPGSVA
FT                   GWAPGGTVLITGGTGALGGHVARWLAREGAAHLLLTSRRGERAPGAADLAAQLRALGAR
FT                   VTIAAVDVGDRAALAEVISGIPVELPLRAVVHTAAVLDDGLVSELTLEQIDRVLRVKVG
FT                   GALNLHELTRDADLAAFVLFSSIAGTAGITGQGNYAPGNAFLDAFAAHRRAAGLVATSI
FT                   AWGQWEGAGLAEPDVDRILRRHGLLAMDPQPAVRALARALAGDETHLAIVAADWRAFYR
FT                   SRPHPLVHELPEVAAERSASAERSGRPVGATGGGDGPVLGARLAELDGPARREALLAIV
FT                   RDHVAAVQGHASPDAVDVDRGFRDQGFDSLAAVNLRNRLIAETGLSLPVSLVFDYPTAA
FT                   TLTDHLLAELVPAEPAEPAGLPAVLAEIDRLESALADVADVDREAAADRLRDLLTRLGG
FT                   PAADGAAVAAELSAASDAELIDFIGKTLGIS"
FT   gene            complement(401703..411803)
FT                   /locus_tag="FRAAL0349"
FT   CDS_pept        complement(401703..411803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0349"
FT                   /product="putative 6-methylsalicylic acid synthase"
FT                   /EC_number="2.3.1.165"
FT                   /EC_number="2.3.1.94"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTS3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59025.1"
FT                   /translation="MSSGSAVSANADDTPRGAGDPIAVVGLACRLPSAPDPAAFWRLLR
FT                   AGGDAVDRGPTVPRRLGAAFGAHLDDVYGFEPEFFGIAPREAAQLDPQQRLVLELAWEA
FT                   VEEAGLRPETLAGSLTGVFVGAITSDYATRVLRAGPGAVTRHTLTGQSRGIIANRVSYT
FT                   LDLHGPSLTVDAAQASSLVAVHLAADSLRRGECDLALAGGVQLNLVPDSTETAARFGAL
FT                   SPDGRCYTFDARASGYVRGEGGGIVLLKRLSSALADGDTIHAVIRGGAVNSDGATDGLT
FT                   LPSADAQERVLRQAARAAGVDTRDIQYVELHGTGTPVGDPIEAAALGRAFGAGRAADAP
FT                   LHVGSAKTNVGHLEGASGIVGLLKTVLAISRRELPPSLHFATPNPDIAFDELRLRVQTD
FT                   HGTWPAGDRPLIAGVSSFGMGGTNCHLILAEPPPAETAPARLASTETPPTETPPTTAPG
FT                   RPAADDEAAAQALPWPVSGRDEAALRAQAGRLHDRLTDHEPPAFDPVDVGHSLATTRTA
FT                   FERRAVVIATSPAQFLTALRRLRDGEQDAALVTGPPDGAADRGGVVLVLPGQGSQWAGM
FT                   ARELLATSPVFAERIAACAEALAPHVDWSLPDVLAGAAGAPPLDRVDVVQPALFAVMTA
FT                   LAAVWRSYGVRPDAVIGHSQGEITAAHLAGALTLADAAAVVARRSRVLAELAGTGAMAS
FT                   IPLPAAAVLERLGGPDAVLAVAAVNGPSSTVVSGDPAALDALIAGYAADGVDVRRIPVD
FT                   YASHSPQVAAVEAPLLDLLAGITPRSGDVAFYSTVTGEAVDTSRLDAGYWYANLRGTVR
FT                   FDAAVRAALAAGHRTFIEVSPHPVLTGGIRAIVEDAARSAAGGGAGPAAVVGTLRRDDG
FT                   GLDRFLRSLAEVHVAGGTVNLAAAYPARARRVALPTYPFQRRTFEVDAPDGPALNGTTP
FT                   NGTTPNGSTPNGSPPNGTVAPIGVGPSGAETAAAAADSAASDAVPSSALARRMAGLPAP
FT                   EADRVLLDVIGASLTIVLGHAAGSVQAERTFADLGFDSVSAVEFRDRLAAATGVALPTT
FT                   LTFDYPTPRRLAGYLRAALTGTDRPAAVGEAPGPHGPVRSGDEPIAIVAAAGRWPGGAR
FT                   SPEQLWELLDARVDAIGPFPTDRGWDLTALHDPDLTRPGTSYTRHGGFLPDAAEFDADF
FT                   FGISPREATAMDPQQRLLLETSWEALERAGIDPDALRGTATGVFAGVTPHDYGPRLVEA
FT                   PEGYGGYVLTGSLTSVVSGRVAYTLGLEGPAVTVDTACSSSLVAIHLAAQALRGGECSL
FT                   ALAGGVTVMPTPGMFTEFSRQRGLAPDGRCKPFAAAADGTAWAEGVGVVVLERLSDARR
FT                   LGHHVLAVVRGSAVNSDGASNGLTAPNGPSQQRVIRAALTAAGLRPADVDAVEAHGTGT
FT                   TLGDPIEAQAILATYGTDRPADRPLRLGSLKSNIGHTQAAAGVTGVIKLVEALRHGRLP
FT                   ATLHVDAPTPHVDWSAGTVTLLTEPADWPTTPGRPRRAAVSAFGISGTNAHLILEQAPE
FT                   DVAEPEPAPPAEDRPAEDRPADGEPAEAATTGADALPWVLSAHSESALRAQAAQLAEHV
FT                   AASAGEADRPSAADVGHALATTRALLAHRAVVVGDGPEQHRAGLLALAAGDSAAHVVVG
FT                   VAGPAGRTALLFTGQGSQRAGAGRELYAASRVFAAALDEVTAHLDGAVGRSVGELMFAE
FT                   PGSAAAEELDATAITQPALFALEVALYRLAESYGLRPDYLIGHSVGELTAAHLAGVLSL
FT                   PDAATLVAARGRIMQSVPATGAMAALEGTEEEIGRLLADAAGTIGIAAVNGPRSVVVSG
FT                   DRDAVDEIGRRWRDAGHRVRGLRVSHAFHSGHLDPVLAEYREVVAGVTLHPPTIPVISN
FT                   VTGRVATDAELTDPDYWVRHLRGTVRFHDGIRTLADLGITTYVELGPDAVLSALAEQAL
FT                   AEPGSAEPPLTEPVVNESAVNEPVVNESAVHGAVPASDAAVGPAPRVVALLRANRPEVR
FT                   SFTTALARLHVDGVAVDWSAAFNGRRPRHTDLPTYPFQRQRYWLDAPTRTADRAGLGTG
FT                   AGGPQHPVLTGAVELADGGLVLTGRLDPAALPWLADHAVRDTVLLPGTALLDLVLSAAR
FT                   HCGAHRVEELALTAPLALSAAGTLDVQVLVAPVDPAGGGGPDGVERRAVTVHARPVADQ
FT                   TDPPGPWQRHATGFLRTDDGAAADDRGGADDRGGAWPQPDAVSIDVSGLYPRLAGDGYQ
FT                   YGPAFRGLRAAWRQGDDVLAEVTLPDAAGARDRFEVHPALLDAALHAVVGLLPGPDADP
FT                   GRIRLPFAWQDVTLAARGASSLRVRVSPTGPDTVRLAVDDAAGEPVARIGGLSLRPVAT
FT                   QVLADAGRAVAGRGAGDAMFRLDWQVVPPAADLADLADLADLADLADLPSLADLPSLAD
FT                   LADLAALRAEIDAGGHVPALVIHRSAAVGPTGTAPVESPTDEEADPVPAAHATVRAALH
FT                   LLQDWLGDERFSGSRLVILTERAVATGPGEDVADLAAAGVWGLVRSARTENPDRVALLD
FT                   VDGRASSRDAVRAALALLAARPAEHSELAVRDGEIRVPVLAPLGTQPALLPPAGTDVWR
FT                   LDVTAAGSLDNLALLPEPAAQRPLAPGEVRLALRAAGLNFRDVLIGLGMYPGGARIGAE
FT                   GAGIVVEVGAQVSDLAPGDRVMGLVQGTLGPLAVTDRRLLTAIPPGWSFSQAAGVPVAF
FT                   LTAYHGLAGLARLRPGESLLVHAATGGVGQAAVQLARHWGVEVFGTASPAKWPVLRGQG
FT                   LDDTHIASSRTLDFADSIRAATDGRGVDAVLNSLAGPFTDASLRLLAPGGRFVEMGKTD
FT                   LRDPAAVAADLDGGSYQAFDLFEVDPARIGEMLAVLADLFTRGALSPLPTTSWDVRHAP
FT                   QALRQLSLARHTGKLVLTLPAPLDPAGTVLITGTGALAALAARRLVTHHGVRHLVLASR
FT                   GGPASPDAEAVRAVLAEAGATATVVAADVADPDDVRRLVAAVPADHPLTAVVHTAGVLA
FT                   DGVVTSLDDPTMDRVLRPKVDGAWLLHRATAGLDLAAFVLFSSVAGLLGNGGQGNYAAA
FT                   NAFADALAHHRRAAGLPAVSLAWGHWAQAGGMAGQLAPADLARLARTGIAPMSTAQGLA
FT                   LFDLAIGGGTAAGAQPLLVPARLDPAGAARPAGGGLLRGLVHVPSQRSTAGAGGAVGAG
FT                   AAGAATPAGAAGTPPADRAAALVERLRGQGPDEQRRALLTLVRTTAAEILGHASAAAIR
FT                   PDRGFLESAFDSLSAIELRNRLARETGVHLPTTLLFDHPTPAILAAHLRDTLFADSRSP
FT                   DSPSTDSRSTDSRAADSRAADGRAPGEGVPDRQPLDERLALVDLADEADAALLSEQIAG
FT                   ATDDEIFDFIDRELGIS"
FT   gene            411763..411903
FT                   /locus_tag="FRAAL0350"
FT   CDS_pept        411763..411903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0350"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59026.1"
FT                   /translation="MSSAFADTADPLLIAGALLVVNVQTPDAPPSDGTFLGNACQRRST
FT                   Y"
FT   gene            complement(412186..413781)
FT                   /locus_tag="FRAAL0351"
FT   CDS_pept        complement(412186..413781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0351"
FT                   /product="hypothetical protein; putative signal peptide;
FT                   galactose oxidase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59027.1"
FT                   /translation="MSWSRTSRRCPPRAFVLAATLTAALASPGLLGTSAAATPTGAPGG
FT                   PTPTGSPATASAATPSSGASSPTATSSAASSPAGGGCPAYPSTAGPLGSWETITALPDP
FT                   RAHLAATTGCDGRIYAIGGQATAGAAGGAGGASGSATGSPSQSASPSSTSASPTSTSTS
FT                   TRAGSPTASPTSPAGGPTTTSTIIPGALTGDPTFGPLSNAPNAPGDSGAPSATDSPTGT
FT                   SSPTDESSVTPSTSSSATPSTSSSATPSGSSSATPSGSPTGTGSPSGAPGAAVAPVGTV
FT                   QVFDPSRNAWTGAADLPTPRTHLAAATGTDGRIYAIGGRSGAANDPTDTVEVYTPSSNT
FT                   WTSGTALPKPMGEPRAARATDGKIYVLDGDTLAVYDPDAASWTTADAPPTPVTAPVLTA
FT                   LPDGRILAAGGSAAGGGSAGRASSGVYAYTPGTGGSGSWTQVSDLPTGVTQAAGATGPD
FT                   GRVYVVGGRDAGGDVTDAVQVYSPDDDQWTAGPTGAASKRADAAATTGGDGRVYVLGGT
FT                   AGGGALDTVGALSG"
FT   gene            414142..416142
FT                   /locus_tag="FRAAL0352"
FT   CDS_pept        414142..416142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0352"
FT                   /product="Putative ABC transporter ATP-binding protein"
FT                   /function="4.3.A.1 : The ATP-binding Cassette (ABC)
FT                   Superfamily + ABC-type Uptake Permeases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59028.1"
FT                   /translation="MPSQPPPVPSRVTVLHARALARLTGAAEARRSERFFADQGRVVAA
FT                   LVGLSVLGSAAVAAGPFILRHLIDTSLPTGRVRDLAVPVLLLCAVLVFESTVLSLRMAL
FT                   IARLGGVVSVRIRQTVNAHLQRLPFAFFPRSQQGEVMTVMSSDVLAAQNAISATVQAVI
FT                   CRLADIVVGTAVVFVLDWRLSLAVMVFAPATLVIIRSGRRRLAALSQRQRELEGQLMAQ
FT                   VSDTASVSGALHVRLFDRVDYERERFDAAGAELLAAAREQARLTSRVRFLVSLGIVATM
FT                   TAVVTLGAWLVSSERTTLGTVAALGGALLVSFGPLSTAVDLRSELAGAGASFRRIFALL
FT                   DVPEDEAATMAAGSPAVLAGQAPAAAGDLLAGAGRRSRPAPALAVPRPLDLDLDPRVGA
FT                   DAAPVGLDLALDEVWFAYDQAVPGPARAVGAAAGDHPGPDDPSWNLRGVTLRVAAGTTT
FT                   AVVGASGAGKTTIAYLASGVHRPQRGRVLLGGVPLDAIPPARLHAAIGVVPQDPHLFHD
FT                   TIAANLRYGRLDATDDELRAALDAASLSALLDRLPEGLATRVGARGYRLSGGERQRLAI
FT                   ARVLLQSPRVLVLDEATSALDTVSEAAVRTALDRLAVGRTCLVIAHRLSTVIDADRIYV
FT                   MDHGRVVEDGTHRDLLADGGAYARLYRPSTV"
FT   gene            416422..418290
FT                   /locus_tag="FRAAL0353"
FT   CDS_pept        416422..418290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0353"
FT                   /product="putative multidrug resistance protein"
FT                   /function="5.10 : Defense/survival"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTR9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59029.1"
FT                   /translation="MTSTAGKATATGGSDAAGGPNAGGPNAAGPTAQGGYTHRQIMVIL
FT                   SGLLLGMFLAALDQTVVSTAIYRIGESLHGLTAQAWVTTAFLITSTIATPLYGKLSDLY
FT                   GRKPFFLFAIAVFITGSALCTFATSMYMLAAFRAVQGIGAGGLFSLALAIVGDIIPPRE
FT                   RAKYQGYFMAVFGTSSVLGPVVGGALAGQDTLLGVAGWRWIFLINVPIGIGALVVVARV
FT                   LHISHERREHRIDYPGALTLIVALVPLLIVAEQGREWGWGAGSSLVCYAIGLVGIAAFV
FT                   VAERRAKDDALLPPRLFRNGVFAVGSAQSAIIGIGMFGGITLLPLYLQLVKGNSPTKAG
FT                   LLTLPLVLGIMLLSLVAGQITSRTGRYKILPVIGSALLVVGMLLLWRLSADSSLVYVDL
FT                   AMFVVGAGLGLNMQTIVLAMQNAVPPRDIGVATSSTTFFRQLGGTLGVAVFLSIVYSIV
FT                   GSRITSAYADARGTAAFDAAARSHPDQLKVLGSASSGGSGSLNDTSFLGGLDPVLTHPF
FT                   KSGFTEAITVAFLVGAAVLVIAFVLSLLLKEVPLRETGAAFADQPDAPGEAPAGPGTPA
FT                   PSAAAAPDPSADATGQNARQSEAAAAQETAAAEAGNAEAPGPRVGG"
FT   gene            complement(418489..419649)
FT                   /locus_tag="FRAAL0354"
FT   CDS_pept        complement(418489..419649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0354"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTR8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59030.1"
FT                   /translation="MMRQLPEASAASGGALPVATLDVTPSALVATPTALATPTALATPT
FT                   AVATPTALDTLVLAGPSGDVAEAVAPRRGRFWLVRPLLACAAPLVAVVWLVRSWSTVRT
FT                   GIDALASAHPFWLVGAVAVAQLTWVAGAACQQGTVPRALPVRRLLAAQVAGSVANHVLP
FT                   AGFGVGAVKLRFLHRHGFSLRESLTAVGLDATAGVTTHLAVLAVLLAGGFLPVDSARLP
FT                   DSGPVALGVAVAAAAVALAALLGWLVPAIRRLAHGVWARVVDHLRSMRSTVRSPSRAAM
FT                   LWGGSAAIPLLHAATLWAIMRALHLPLGVGAVFALYFAASAASALVPSPGGFGSLDAAL
FT                   TAAIIAAGQSPAVALAAVLGYRLVTVWLPMAPSACVLALMVRRGHL"
FT   gene            complement(419646..421067)
FT                   /locus_tag="FRAAL0355"
FT   CDS_pept        complement(419646..421067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0355"
FT                   /product="putative glycosyl transferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTR7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59031.1"
FT                   /translation="MPAPAAPPDSRPAGPAGAVDLPRTLVVADKFPPVLGGIQTFACHL
FT                   TAGLPADRVVVVAPAAPGAEEFDRTLPFPVVRAGERILTSPRSRRLLRSLVRSEGCEAV
FT                   WFPTAAPFGVLGPTLREAGVTRVVASSHGHEVAWSRLPVGWSLVRTVAARADVLTYLTA
FT                   FTRRRLVAVSPRGTTLARLTGGVDTRRFRPGAGGADIRRALGWSDRPVVICVARMVPRK
FT                   GQDTLIRGWITVRRRHPGARLLLVGQGPAEGRLRRLAGQVGVADDVHFAGAVGEEELPA
FT                   YLDAADVFAMPSRTRWLGLDLEGLGLSSLEGAASGLPVITGAQGGAPDVVLPGRTGEVV
FT                   DGRSTAAVARAVVELLDDPDRAARMGLAGREWMREAWSWGGLAGRLAGLLAGGSGADLD
FT                   AVTRHSGEPSRTRRGILDEDMPGSIPADGIIPNGIGTDRVRTDSTTTDGIGTDGIATDR
FT                   VDVAQGHADARTGGP"
FT   gene            complement(421393..422292)
FT                   /locus_tag="FRAAL0356"
FT   CDS_pept        complement(421393..422292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0356"
FT                   /product="putative dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTR6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59032.1"
FT                   /translation="MRTIGVRNIVCDLKHTNVRTSRFRKECRMGTLDGRTAFITGVARG
FT                   QGRAHAVRLAREGADIIGVDICADIASMDYPNASAADLAETVELVEKLGGRIVARQADV
FT                   RDFAGLSAAFQEGLAAFGRVDIVIANAGIIRLSPEADPFTEWQDVIDTNLTGVFKTVRA
FT                   ALPALIEGGRGGAIVLTSSSAGLKGTGSPDAGPQAYTAAKRGLVGLMQVLANDLAKHWI
FT                   RVNTIHPTGVATGMTMNESMAKLLAESDNATAAMQNALPIEILQPEDISDTVAWLVSDA
FT                   AKYVTGVALPIDAGFAVR"
FT   gene            422435..423043
FT                   /locus_tag="FRAAL0357"
FT   CDS_pept        422435..423043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0357"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTR5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59033.1"
FT                   /translation="MRGRPRDPDLPARVLDAALAEYARSGWAGFTMHAVAGRAGVGKSS
FT                   MYLRWPTKEQLLVDAIDAYTRPLVVDHDTGSLRGDVLALASSLLAHFLDPMGWVTVRIA
FT                   VDAAVESVDLGGFHERIVTKHNDAAQRIVDRAIGRGELPAGVDGRPLLEGLFGGVLLHT
FT                   LALPPSEHAAARTDLAAHVTPLVDLLLRGVGPAATPAVG"
FT   gene            complement(423099..424409)
FT                   /locus_tag="FRAAL0358"
FT   CDS_pept        complement(423099..424409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0358"
FT                   /product="Putative Dibenzothiophene desulfurization enzyme
FT                   A"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTR4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59034.1"
FT                   /translation="MFHLGWFVGGGFGPQAWNSQWSGTHGAEWTRGAFYADLARSLERA
FT                   CFDYLILEDGLMITDAYRGSMEVDLKYAWESPRLDPMAAVAVMSQATSRIGLVATLSTS
FT                   FYPPYMAARMLVSLDHLSAGRVGANLVTSSSHRSAQNFGLDEHFEHDLRYEMADEWMDL
FT                   VDRLCASWEPQAVVADQQAGVFADFRKVHTVDFAGRFHRSRGPLNAPAGPQGRPVVCQA
FT                   GGSPAGREFAAKHSDTIIAVPHGIEGMKAYREDISARMIRHGRKPTDCKVLFLVNPVIG
FT                   ETDDQARELLALRRARQRSPEVMETVLAQMSYFSGIDFAQFDLDGPFPDLTGRVNGHQS
FT                   SMTRFANAAAGRTLRETVMDHDTVESVELVGSPDTVAAQMGEVMAEVGGDGFLIATPVH
FT                   RRVVAEIADGLVPALQRRGLVRTSYSHELFRDNLLEF"
FT   gene            424777..425511
FT                   /locus_tag="FRAAL0359"
FT   CDS_pept        424777..425511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0359"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTR3"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59035.1"
FT                   /translation="MGTLTVTERREWLDWALDIFDTQVRAVPPGSWAAPTPCGQWDVRA
FT                   LVNHLTVEHLWVPPLLAGLTRGDIGTRFDGDQLGDDPGARWTVTARRSRDAWDRPDAWA
FT                   SLPMLSFGPTPADEYAFQLTADLLLHGWDLARAIDLSGRLPGDTTSARTVGNNRELVHW
FT                   VHDSLRRQIDAWRVVGIFATPVPVPDDADEWTRLIALTGRSPDWRPRLDPGRHLDRGRH
FT                   PDEGQRSDEGQPPDEGQRPDGG"
FT   gene            complement(425662..426096)
FT                   /locus_tag="FRAAL0360"
FT   CDS_pept        complement(425662..426096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0360"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTR2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59036.1"
FT                   /translation="MSAAAGSPDRGTVRLLAVLVVVMSAVAAFAVGGLVAVSGVQVGWG
FT                   RDGGGSAGSAGALSAAIGRLGADDGAGVAARPSADRAASDGAASPGSAPTAPSGAVKHA
FT                   APDAGGSSTPTTPVPLRSCSAPPTAAAGGAGAPILIYPLC"
FT   gene            426390..426599
FT                   /locus_tag="FRAAL0361"
FT   CDS_pept        426390..426599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR025330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59037.1"
FT                   /translation="MGLRYTRRPRYGPFHLNVSERGVSSVTLKLGRVSWRVWSRNRRGG
FT                   LSSVDLPGPFSYRREGRGRRRAEG"
FT   gene            complement(426681..427802)
FT                   /locus_tag="FRAAL0362"
FT   CDS_pept        complement(426681..427802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0362"
FT                   /product="putative integral membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTR0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59038.1"
FT                   /translation="MRTARTNPAAPAGADAVGGPENVRLIVAGAAVLTLALVVDLGPGV
FT                   ALTGYFGLGPLILAAACPPLITAGIGGLTVIVAILSGLWDHRFGTQPHIAAIILVLVQS
FT                   AIAVYICVYRERQRSKLHRVQAVAEVAQRALLPAVPGQLDGAGFAARYLSAAREASVGG
FT                   DLYEVVPTANGIRVIIGDVRGKGLPAVRLASVVLGAFREAAVTWLDPEQVAAACARAVG
FT                   REAGPEDFVTALVLDIHPDGRLGMCSAGHHPPRLVSADGSATLELRSPSPPLGLAERFT
FT                   VTTAHWEVGDRLLLFTDGLIEARDAQGRFFPLDDRLDLLRGGGQQEALDRLIAALGTHA
FT                   GGALHDDLAILLAERQPVPIVAPTTPTARAAAD"
FT   gene            complement(427886..429409)
FT                   /locus_tag="FRAAL0363"
FT   CDS_pept        complement(427886..429409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0363"
FT                   /product="putative amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTQ9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59039.1"
FT                   /translation="MRAARPDAAGGWLMSDAPGTLTDPERDGPLDGVAALAARLARGDV
FT                   TSHELVEAALDRIEATQSTLNAFRRVRVREALAEAAAADAALAAGSARGRGGPAADRHR
FT                   PLLGVPIAIKDDTDIAGLPTAFGAVGEFPPAARDSEMVRRLKAAGAVIVGKTNTPEFGQ
FT                   WPFTEGPAFGVTRNPWDLDHSPGGSSGGAAAAVAAGLVPGAIGSDGAGSVRIPAAWTHL
FT                   VGIKPQRGRISSAPVREQFNGLTVYGPLTRTVADGALLLDVLAGSLPIDRDSAPAPAEP
FT                   FLSAAGHPPPRLRIGLSLHRPYSGMPASLDPAVRAAVERMAEVLARLGHDVVPVEPPYG
FT                   LLGTIFLPRSMDGIRDWAGRVADPSQLDPRTVANARTGRALRPLLPLARAAEPLARLNI
FT                   GRIFRRIDVVLAPTTATPPPRVGELNRDTNWATDQAIVAACPFAWPWNVLGWPAINVPA
FT                   GRTAAGLPVGAQLMGPAGSEALLISLAAQVEDSERWHLHHPGERAAHAA"
FT   gene            429828..430490
FT                   /locus_tag="FRAAL0364"
FT   CDS_pept        429828..430490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0364"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59040.1"
FT                   /translation="MSVDPNAATPDPAPNTPPAGAAPSASGGPRPSSPEPERPASAPAL
FT                   NGHSPAAPPLTATSPSAATSPTSPTSAPEPSGPGEAPSARERVAVGAAEVRERVSGAAA
FT                   TLAPHVAAASERTRGAAEKAAGTVREKVAENPRLAAATERTIGARDRAVGTVRERLAQH
FT                   PQVNATAEKTLATSGKAARSAGQRARNNPRATGGVLAGTALVLLVRRARRRRRRSAD"
FT   gene            430640..430948
FT                   /locus_tag="FRAAL0365"
FT   CDS_pept        430640..430948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0365"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTQ7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59041.1"
FT                   /translation="MVTFVVVMILLGLVAGAVARVVLPGPDPIGIVGTIVVGIIGSFVG
FT                   GFLGYVLFNKDLGEGALQPSGIVGSIIGAILVLLIWRNVGGHSNSRSRGRSRRYARR"
FT   gene            complement(431643..433226)
FT                   /locus_tag="FRAAL0366"
FT   CDS_pept        complement(431643..433226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0366"
FT                   /product="Putative membrane protein (partial match);
FT                   putative Mechanosensitive ion channel domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RTQ6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59042.1"
FT                   /translation="MRVSAAPDLSYSNMQSTIAVLTVLVGAVVVAVAAAILLHRVALRI
FT                   GRHSQIVADLAHRGRRPVRLTLILVALLIGLNATHEQDWTQPAIHVCDILLIAGIGWCV
FT                   AVLAFVFEELALARYRVDVVDNRHARRVRTQVTLMRRITVAIISIIAAASMLMTIPSVR
FT                   VAGASIFASAGVVGIVAGLAAQTSLANVFAGLQLAFTDAIRVDDVVVVEEEWGRIEEIT
FT                   LTYVVVHIWDDRRMILPSTYFTTTPFQNWTRKESAVLGAVELDLDWEVPLEEMRAEMHR
FT                   VLAATDLWDQRVCVLQVTDAVDDHIRIRVLVSGKDGPTTFDLRCHVREALVLWLQRNHH
FT                   RALPRTRIEFDATAHLTGPADDRPRATDDRRNESRYGNERHSGAGPYGANSHQNGAGDR
FT                   DGGAIGTLVREREDRDGTPGDRLRKRDGARRGWEPITTITLSTRDGDGSHLPPRPRTPD
FT                   GSTGPGEAGDAPDGPQPPHADAADDARLFSGASADSAQRARDFSETTDHTNDPDLPGDD
FT                   PGPGRDADDR"
FT   gene            complement(433325..434332)
FT                   /locus_tag="FRAAL0367"
FT   CDS_pept        complement(433325..434332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0367"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59043.1"
FT                   /translation="MSDAGTGTGDGELALLVGEVRTALLRHSGAVSEPVAQEILDLVPA
FT                   AAVRSATRPSARAVSPDIVEGVHCRLPSGTGRRVEGVGTVVSRAVIAGGRIAQASSRAL
FT                   VVPAAGTRRRGWAAYLARRGVIERIGRGSADDLSAGFLGPRRPGTIDLDAVAGRLLDRV
FT                   QAAPALDGAVPLRAARTRFRFVIDLADRAETVTPAPPRFSLDDDNVRTLILDAPRGGPE
FT                   ALVTLCEDIACHDWLLTVVQGLVDTLDEAPGRVDRMARMARVSPAIEQLLHLWMPCAHL
FT                   EPDLRWVWSALEGRPGFSRQWASIVDRIRNEQMGSILRAVTGDGWRNGSGAAAD"
FT   gene            complement(434385..435404)
FT                   /locus_tag="FRAAL0368"
FT   CDS_pept        complement(434385..435404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0368"
FT                   /product="conserved hypothetical protein; putative N-6
FT                   Adenine-specific DNA methylase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59044.1"
FT                   /translation="MTIPVHRRQEARTEPMDAVYRESTAVAWTSEVPLAHVSVELGHLY
FT                   LEDLRSTDLDRFFDRIAPWTDRARMAAIAGNTAGRPRVSTCLLLDDYSGTADSTAELRP
FT                   GEAIPRLLDAAQRAGVPIDYLARESGLVEYRGGSLAELVEVALVADPPFGADGSRPPVT
FT                   ETGWLTNGQRSPVVGARQAMGGRAGWSPPIENARHLHSIFLDVELWSGPDGKRTWSCAY
FT                   LAAVWQLARLGVLRRHGRDVLRPEVAEVADLAALPDDWSQVPAVLQAGLNPAPFCAYRT
FT                   FSVLAGRFLPVENAVRTILSQVAVDPAALDQTVRRAAAERITLPLEIVDRMSYVLLGP"
FT   gene            complement(435404..436357)
FT                   /locus_tag="FRAAL0369"
FT   CDS_pept        complement(435404..436357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0369"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59045.1"
FT                   /translation="MRPLLQRISIALLTGAVSFGLTKLARGSLVSTLTLAVFVAGSVLV
FT                   VEFLRDVERSMTSTENMISHVNNATRLREAIEGSALDVLPTGSRPVQGLINNVVGFTPP
FT                   SPILGRLVVSEIRDLTELVQGLTTEIGRRSAYAASCEGEDRNWLLALTGAATGRILATS
FT                   TTAADGGQGKFEDGFWKTELGRAYLNAQRAAVDRGVEIRRVFILTDPEILASDDFIRTC
FT                   EKQLKAGIEVRTNEVLSNSPSTRNDWTATFKDFILFDDEVSYEVDLEGIPPTLSIARTN
FT                   LRYHPVTILDRRTRFEEIWEASTPFRLPQPSPPPDA"
FT   gene            complement(436429..437346)
FT                   /locus_tag="FRAAL0370"
FT   CDS_pept        complement(436429..437346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0370"
FT                   /product="putative Nucleotide-binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59046.1"
FT                   /translation="MIVLATSDKGGTGRSVTTTNVAYRRALQGDDVCYLDFDFGSPTAG
FT                   AVFDVEAASRGVKTGTGAHSYFQGDAAEPVRIDVWKQASWSRRRRPTGSGRLVLVPGDE
FT                   GGGEFPISVEMIGRCRRLLVRLAEEFSVILIDLSAGRSYAADLVQEATAAPDLGREDVR
FT                   WLVFHRWTRQHILAAHGLVFGERGIVSNGIRLGLSREEMESCVRFVRTAVQEPNSPLLS
FT                   PLRAQQASWLQRCHNELVDLAARRRLGRSMVIGAIPLDPVLQWREQIIRDLDISSTQIA
FT                   NRETGEAFEDLARKLTDPRSWQGT"
FT   gene            complement(437343..439211)
FT                   /locus_tag="FRAAL0371"
FT   CDS_pept        complement(437343..439211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0371"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59047.1"
FT                   /translation="MKIQPRQLLLDLWQAAAAYSYVKGEWVFGGRAEPNSTADAEQLLC
FT                   LMYPATTESPYFRLEQPDLTARDVAEALRPLGEAVDVPQVLLGAVSAFLRRYRDDDGIP
FT                   VFHGGSYLQAINQGDELPPDRQQVEIVDSMSMSITLCLAILGFFKEYRNTGIRRPQLLR
FT                   DIEWVEKAASERLTAAMVGLLRSFAVHAFSPTSAAGDTLLRTTDQDRLPREQLTAQLQR
FT                   SLNDIRADLQRATAGTAGLEVLENENHLFECGWSWGVVRAAPTVRTDEFPEAAQKPGRA
FT                   ISRPNLYFTLTALDGIADLFSERTRRLGLLTAAQQALSDNLQFRWDLVQRYWSTIAGFG
FT                   SQRTALEDIPWRPTVRADGEIPVNDHYYSLQVAGMMIEDLYRQKPSDNELSRVAKVLDE
FT                   LAIRSRVTRRATRQEAAIDMHVPGLRVRLVETDEREPELVWPVADFVTALLKRTVRLAT
FT                   LARGAELRQELLDLADRIWDHIEQRMIEEGPGEGLWDDPRRTFRDLSPVSTEPSWYFTE
FT                   RVMECLIAVVGAIEREPVTSGRAITEALELLAEAEHLFHKQLLGGGLDAGPAMRRELDG
FT                   IGVQIERGRAAAQRRPGTAKAILQEILLRLDQLDAARPQFYEAIQP"
FT   gene            complement(439255..439983)
FT                   /locus_tag="FRAAL0372"
FT   CDS_pept        complement(439255..439983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0372"
FT                   /product="putative N-methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTQ0"
FT                   /db_xref="InterPro:IPR000940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59048.1"
FT                   /translation="MAHNSDAPWDDFDPTAYFSHNYHTLRDDDRLILGLVRDFFVSVGP
FT                   SRPVRGIDVGTGPNLYPALSMLPWCQEITLVEHSTQNVAWLEKEVAHGYAPTWDPFWTV
FT                   LTSRAPYRSIGDPRGRLASAARVQKGNLFGLPAGEWEMGTMFFVACSISGHHGEFEEAV
FT                   NRFLGALRPGAPFAMAYMENSKGYEVSGLKFPAVEVGMPEVRRCLETRTTDLQISRVSS
FT                   ESLRPGYTGMMVALGRAAER"
FT   gene            complement(440294..440932)
FT                   /locus_tag="FRAAL0373"
FT   CDS_pept        complement(440294..440932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0373"
FT                   /product="Putative acetyltransferase (partial match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTP9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59049.1"
FT                   /translation="MRPRGADSGADSVVEAVPAVLEGFTVESRLEVRLVEREDLLPLHA
FT                   VDREVFGELAYPYFALRQLFDAHSGEILVARIDGRLCGYSLTMTSRTSDIGWFQGLGVV
FT                   PGLRGHRIGRRLACDALTLLFEHGIQHVRLAVREENIVATNLYESLGFHRTSKEVDYFG
FT                   SGENRVLMTCRLTQAIIRSWSAEVSSTPVRTVDVGAVAPDRADAPSTPR"
FT   gene            complement(441289..441810)
FT                   /locus_tag="FRAAL0374"
FT   CDS_pept        complement(441289..441810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0374"
FT                   /product="putative acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTP8"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59050.1"
FT                   /translation="MLPPPAEVLVMEEEVEADGAAQVAQVADRAPGATTVVATALLTPS
FT                   LPGLGNHVAQAMLLVDPKRIDQGGPRAGAGPYEDHGPYGGPASPTRGRAGGHWESVSRQ
FT                   AAEEMIDYATDLGYQAMQVHVVAANPKLVSLWRSLAFRQVGTLPAAYRHPWLGNVDLYV
FT                   MYRFLPPRER"
FT   gene            442118..442825
FT                   /locus_tag="FRAAL0375"
FT   CDS_pept        442118..442825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0375"
FT                   /product="Putative GntR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTP7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59051.1"
FT                   /translation="MRVPRPPTAWVATLSTSWSGSAREAILRELKRVILDGAAAPGLPI
FT                   PVDEVAARYQVSRIPVREALMSLVGEGLVEHRSRAGYTVATLTPGELREFYLVREALEA
FT                   AALGAAVRRATAADDALVSQAHAATSEAIRAGDSRGHHRESRRFHLALVNAGGMPRLAR
FT                   MFESAWNMTEPARPMDYASRDAVDLLNDDHERMLHAFRARDAAALLEVSRLHHGRLQNF
FT                   VLALPESGELGQG"
FT   gene            443257..444759
FT                   /locus_tag="FRAAL0376"
FT   CDS_pept        443257..444759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0376"
FT                   /product="Cytosine/purine/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RTP6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59052.1"
FT                   /translation="MEEGYDPRLHNADLAPLKEQGWSAYNIFAFWMSDVHSVGGYVTAG
FT                   SLFALGLTSWQVLVALLVGITIVYFFCNLVARPSQQGAVPYPVICRAPFGVLGANVPAV
FT                   IRGLIAVAWYGIQTYLASAALDVVLLKLFSGLTPYADVHQYGFLGLPLLGWCSFAVLWV
FT                   LQAAVFWTGMETIRRFIDFCGPAVYVVMFALTGYLIYRAGWGAMSLNIGSGDHHGSTIS
FT                   LMLGAIALVVSYFSGPMLNFGDFARYGKSFGAVRRGNLLGLPVNFLVFSLLVVLTSSLT
FT                   IPVFGELITDPVQTVARIDSTFAIVLGALTFTTATIGINIVANFISPAFDFSNVSPQRI
FT                   SWRAGGMIAAVGSVLITPWNLYNNPDVIRYTLETLGAFIGPLFGVLICDFYVIRRRVVV
FT                   VDDLFTMSEQGTYWYRKGVNPPAVIATAVGAVVAMVTVVVPSSAISWIGTAGQYSWFIG
FT                   MGLGLAVYYVLARRSPITATSLRPAPVPAPRAPQASQEPAAR"
FT   gene            444806..445534
FT                   /locus_tag="FRAAL0377"
FT   CDS_pept        444806..445534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0377"
FT                   /product="Hydantoin racemase"
FT                   /function="1.5.1 : Amino acids"
FT                   /EC_number="5.1.99.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="GOA:Q0RTP5"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59053.1"
FT                   /translation="MLIRVINPNTTVAMTTLIDKSAQLAARPGVLVEAVTSEMGPASIE
FT                   SHYDEALSVPGILAEIAAGEEDGAAGYVIACFGDPGVDAARELAAGPVLGIAEAAMRAA
FT                   SCLGRAFSVVTTLDRTRGRAAELVDRYGLRPVCRSVRACDLPVLALDSDPGAPARVLAE
FT                   CRAARDADGADVIVLGCAGMADLCAALSADLGIPVIDGVSVATAAVAGLAGLGLRSSGR
FT                   GEYAPPPRKPYTGLLHGFGS"
FT   gene            complement(445636..446754)
FT                   /locus_tag="FRAAL0378"
FT   CDS_pept        complement(445636..446754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0378"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTP4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59054.1"
FT                   /translation="MVAGLDPATATTAEFLGACYDAGLAWVHFPVGFGGLGLPAGLQAV
FT                   ADAILAAGGRPDPFLNNPIGVGMAGPTLHGHADSELRARLLRPLYTGEQMWAQLFSEPG
FT                   AGSDLAGLSTRAVRDGDDWVVDGQKVWTSLAHLASWALLLARTDPDLPKHRGLTYFIVD
FT                   MHAPGVEVRPLRQATGQAEFNEVYLTGVRVPDAHRLGDVGQGWNVAMTTLMNERSAIGD
FT                   SALGRGSGTIADALDLWRDRPDLHSPALRLRLADLWTQAEAYRLTGERARVARTAGPPG
FT                   PEASIGKLVGAELNQKIYDFCMEMLGPEGTLYDSYDDPSDSLQRRFLRARANTIEGGTS
FT                   QILRNVLGERVLRLPGDVRVDTGKPWRDVPRG"
FT   gene            complement(446917..448197)
FT                   /locus_tag="FRAAL0379"
FT   CDS_pept        complement(446917..448197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0379"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTP3"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59055.1"
FT                   /translation="MSSEFAWSAEQVELRRTVRAFAAEVSPQEEVRRLMASPLGHDPAV
FT                   WSRLGEELGVLGLATDEEYDGVGDGLVSQAVVIEELGRALVCGPLLGSIILGATALGGL
FT                   SDKAARAELLPGLVAGRTTAALAAPLHRGGFDPAAVTVTATARPGTAAPGGTPSSDGTP
FT                   SPGGAATAGYTLRGSVAHVLDGAAADLLLVAAAIGGTDGNGADGDGAAEGKDVDGDKDG
FT                   YGGAVGLFAVSAEAAGLVRQSTPTMDLTRRQATVSFNDVPARLLAAAPEAAAVLATTAE
FT                   TAAVLLAAEQVGAAQYLLDLSVEYARTRLQFGRPIGSFQAVKHLCADMLVLVEQARSVA
FT                   YHGAWALDEGTDDPRIAASLAQSVCSTAFTQVAAMAVQVHGGIGFTWEHPAHLYLKRAY
FT                   TDAALFGGAEAHQERLAQLVLDDTDGR"
FT   gene            448515..449921
FT                   /gene="gadB"
FT                   /locus_tag="FRAAL0380"
FT   CDS_pept        448515..449921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gadB"
FT                   /locus_tag="FRAAL0380"
FT                   /product="glutamate decarboxylase, PLP-dependent, isozyme
FT                   beta"
FT                   /function="1.1.3.4 : Glutamate degradation"
FT                   /function="1.7.13 : Amino acid conversion"
FT                   /function="5.5.4 : pH response"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.1.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="GOA:Q0RTP2"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59056.1"
FT                   /translation="MALHGKASGSQAEQTVDVRPQLVRPGEDVVVPRFRIPRESISPET
FT                   AYQIVHDELMLDGNARLNLATFVTTWMDPQADRLMAECASKNMIDKDEYPQTAELEKRC
FT                   VNILADLWHAPDSEHAVGCSTTGSSEACMLAGLALLRRWRARRRAAGAPADRPNLVMGV
FT                   NVQVCWDKFARYWDVEPRLVPMAPGRTHLTADEAAARCDENTIGVVAILGSTFDGSYEP
FT                   VAEIAAALDRLAAAGGPDVPVHVDGASGGFVAPFCDPELVWDFQLDRVVSINASGHKYG
FT                   LVYPGVGWVLWRDRAHLPDELVFEVDYLGGKMPTFSLNFSRPGAQVVTQYYTLLQLGFA
FT                   GYRRVAQACRDNARWLADEVARMGPFELVSDGSGIPAFAFRLRDEITDYTVFDISELLR
FT                   TRGWLVPAYRFPPDLTDLAVLRIVVRHEFSRDLAGLLVADLRRVVDRLSGAGRPLPPPP
FT                   PDGEAASFHH"
FT   gene            complement(450124..452085)
FT                   /gene="prpE"
FT                   /locus_tag="FRAAL0381"
FT   CDS_pept        complement(450124..452085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="FRAAL0381"
FT                   /product="acetyl-CoA synthetase of the propionate
FT                   catabolism operon with firefly luciferase-like ATPase
FT                   domain"
FT                   /function="1.1.2.3 : Propionate degradation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.2.1.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTP1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59057.1"
FT                   /translation="MCRSRRWATGWRECAPAVAGRGRMPVMGAYQREYDRAANDPEGFW
FT                   ADAAQALDWTRPPRRILDATRAPFTRWFPDAELNTCANALDRHVAAGRGDALALIYDSP
FT                   VTDTVRRFTFAELTDEVARAAGALAALGVGRGDRVIIYLPMIPAAVVSMLACARLGAVH
FT                   SVVFGGFAAAELAARMDDAQAKVVVSASCGIEPTRLVAYKPILDEAIALAAHAPAATLI
FT                   VQRDRQRCSMVAGRDHDWDAALAAAAPHPPVPVAATDPLYILYTSGTTGRPKGIVRDNG
FT                   GHGVALTWSMGTIYGVRAGDVMWAASDVGWAVGHSYAVYAPLLAGAATVLYEGKPVGTP
FT                   DAGAFWRVVAEHGVNVLFTAPTAIRAIKKEDPAGALVRGYDRSSLRALFLAGERLDPAT
FT                   YDWAVATLGIPVIDNYWQTETGWPICANPIGLEPLPTRAGSPTVPMPGYDVRVLDPAGQ
FT                   PVPAGTEGAICLRLPLPPGTLPTLWEDDDRYVASYLSAFDGYYLTGDGGYVDADGYLFV
FT                   LGRTDDVINVAGHRLSTGSMEAVLAAHPAVAECAVVGVADALKGQVPRGLVVVKTGVEI
FT                   GPDALAAELVARVRAEIGPVAAFQRVDVVAALPKTRSGKILRRTMREIADGRSPAVPPT
FT                   IEDATVLDALRPVLTAAP"
FT   gene            452146..453393
FT                   /locus_tag="FRAAL0382"
FT   CDS_pept        452146..453393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0382"
FT                   /product="putative Formyl-CoA transferase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="2.8.3.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTP0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59058.1"
FT                   /translation="MLRSAQKRIETGRAAMTRPLEGVRVLDFSEHGFVPSAAAALGDFG
FT                   ADVVKIERLAGDAMRRIIASGMVATKDGYDFQFELFNRNKRGIALDVEQPAGREIFEKL
FT                   VRWAEVYITNQLPRVRRKLRTEPADIFALNPTIVYARGHGQGQRGPDAEAGGFDGVSYW
FT                   ARGGVAHVLTDADATRPTKQRPALGDGPSGMFLAGGICAGLVHVGRTGKGIVVDTSLLG
FT                   SAAWTLGPDLAYTTLAGGQMPMAADEQISPLVRQYRTVDGRWVSLMMIDEARYWEQACR
FT                   ALGLDDLVPRFPDPASRRAGWPVIHERINAVITALDHVELEAKLRAQGCIFSFFATPME
FT                   VVADPAVVANGYLMQHPEHPDVRLAAAPVQFDDELPAARRAGPTLGQHSREVLTELGYG
FT                   ETEILRLLDDKVIAEP"
FT   gene            453612..454403
FT                   /locus_tag="FRAAL0383"
FT   CDS_pept        453612..454403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0383"
FT                   /product="Putative hydroxylase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59059.1"
FT                   /translation="MPTRDNIPAGAPCWVDLMTSDAAGAKAFYGELFGWAAEEPAPEFG
FT                   GYTNLTKDGVRIGGLMPKQPGMDAPDGWSVYLSTPDAEKTVAAATEHGGGVIVGPMAVA
FT                   DLGVMAVVTDPGGAAIGLWQPGTHSGFGVAAEPGAPGWFELLTRDYNAAVPFYRDVFGW
FT                   DVHVAADTPEFRYSTYGPGDAAHAGIMDASGFLPDGVPAHWSVYFATADTDATLERAAA
FT                   LGGSVVLPAEDTPYGRLAAAADPTGAVFKLLGPNVSTPAAS"
FT   gene            complement(454421..455440)
FT                   /gene="itaE"
FT                   /locus_tag="FRAAL0384"
FT   CDS_pept        complement(454421..455440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="itaE"
FT                   /locus_tag="FRAAL0384"
FT                   /product="L-allo-threonine aldolase, PLP-dependent"
FT                   /function="1.5.1.10 : Glycine"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.1.2.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9692922; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTN8"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59060.1"
FT                   /translation="MTRPTAAMRRAMAEAEVGDDHYGEDPSVRALEEYAADLLGHAAAV
FT                   FMPSGTMANFVALRASAQVGTEIIADTEAHIVTYEMGGLAALGGLQTRTLPGLVDTADL
FT                   ADVAATIRSHSVDGNYNMIRTSVLAVENTAARAGGRVWAPARLDQFRDLATAAGIALHC
FT                   DGARLWNAAVAGAVEPRRLAEPFTTLSVCLSKGLGAPVGSLVICDAGRVDEVRTWRRRL
FT                   GGAMRQSGVLAAAGLHALHHHLERLAEDHRRAGELAALLADAAPGRVDPKQVETNMVLV
FT                   EVADAARFARSAAEQGVLVGATGPSTLRIVTHLDVDDVGIRHAGSVLAGLLRAEPAAA"
FT   gene            complement(455612..456700)
FT                   /locus_tag="FRAAL0385"
FT   CDS_pept        complement(455612..456700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0385"
FT                   /product="putative luciferase-family oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTN7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59061.1"
FT                   /translation="MTTTATATRSSPAAEHERERLRALVDLATWAEGVGYDAFGVGERH
FT                   NPAFLSSAPAVLLGHIAARTSRIRLVTTVAVLSLADPVRAAEEYATLDQLSDGRLDLVI
FT                   GKGNDPVSPGMFGVDAAELWDRLAENYELFRRLWREENVTWTGRFRPPLHGATTRPRPL
FT                   QQPAPRVWHGSASSERSSDLAARWGDPLYSANGFRRTNHYLALVQRYRDRLVHHDHDPA
FT                   ATPLALGVHSPVITDRSQDALALARPAFAAFRDLPVARQNHFPFGSLEDFIDNGSALVG
FT                   TADQIIEKLLDLHRRFGNQVLGIGVEGFFLTDPATTRAHLERFFAEVAPTLRAEVPSAV
FT                   WTPEPPGPQDPGERRRLSAPPG"
FT   gene            457062..457508
FT                   /locus_tag="FRAAL0387"
FT   CDS_pept        457062..457508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59062.1"
FT                   /translation="MVGRKGGAVGQNGGGPVDTRAATVLAIRDDATCRVREILDRVGDK
FT                   WTLAVVSELGRGSHRFTELRRAVPGISQRMLTSTLRGLERDGLVRRTVHPVVPPRVDYE
FT                   LTELGRTLLDTAWALMSWALEHMDQIDDARQEYDGRREYDAGRE"
FT   gene            complement(457523..458416)
FT                   /locus_tag="FRAAL0388"
FT   CDS_pept        complement(457523..458416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0388"
FT                   /product="conserved hypothetical protein; putative
FT                   luciferase-like"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTN5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59063.1"
FT                   /translation="MVTETRRRLGRYGVWLAAATLLATPVAVQRRQFDRIERLGYGSLW
FT                   GAEPPAGAPTGGREAFTQHALMLAATERIVVGTGIANVTVREPATMHTGAATLAEAYPD
FT                   RFVLGLGGQQGSRPLTALGDYLRAVDDVAAWLLPAPRYPRVLAALGPRAHRLARDHADG
FT                   VHPFLQPVAHTAAARAAVGPDRLVIPHQAVTLEADPATARGRLRAVFNAGAGAAESPYT
FT                   SNYRRLGYGDADLSGARSDRLVDDILAWGDEAAVAARLGAHLTAGADHVLVHPFAADLP
FT                   AAVDQLERLAPLLTGN"
FT   gene            458643..459254
FT                   /locus_tag="FRAAL0389"
FT   CDS_pept        458643..459254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0389"
FT                   /product="Putative TetR-family transcriptional regulator
FT                   (partial match)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTN4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59064.1"
FT                   /translation="MRADARRNYERLLAEARVAFAEHGTGASLEDIARRAGVGTGTLYR
FT                   HFPAREALLEAVLREEFQRLTASAGVAAAARPAGPALLAWLRELVAFNGTYRGLTAVLM
FT                   QPLLDPASELHAACEAMRTAGGDLLRAAQQAGRIRPDVTVLELFTLVSGLSWAHEQTSA
FT                   ALPGSLAPDRLLHLTVEGLAPRPAQSGVMQSGVMQADAGR"
FT   gene            459485..461056
FT                   /locus_tag="FRAAL0390"
FT   CDS_pept        459485..461056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0390"
FT                   /product="Transmembrane efflux protein"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RTN3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59065.1"
FT                   /translation="MTSSTPAPPRTDGARTAGWLPLVVVLAGTFVTFLDFFIVNVALPS
FT                   IETDLAAGSATLSLVVAGYGLTFAVGMVTGGRLGDLHGRRRMFLVGLALFTLTSAACGL
FT                   APNAEVLVVARFLQGASGALLTPQVLAILGILYVGRRRGPAFAAYGFAMGIAGVLGQLI
FT                   GGALIEADLAGSGWRAVFLINVPVGLLAMPAARRVLPESRGPRARLDLAGAALVTAAAT
FT                   LLILPLVEGRERGWPGWVWCCLAAAPAVAAGFVVRQRRLAARGGAPLIDLGLFRHRAFA
FT                   VGTCVALGFALIPSSFFFVLALDLQQGRGYGALFSGIVFAAVGAGYMLAMFLAGPLGDR
FT                   LGHRVLAVGALGVAAGGALLVATASAASALALVPGLAVTGLGIGLVLVPLSSTVLAGVD
FT                   PRHAGAAAGVLAMAQQIGGALGVAVIGVVFFGAGTAEGAFTASLWVLVVVAVAVAGLTR
FT                   LLRPRATAGWSGRVRAAGAEPGPGSAPTPTGRVTGAGSAAEQAGRVHGPVVGRPGALDR
FT                   GDDRAR"
FT   gene            complement(460970..462055)
FT                   /locus_tag="FRAAL0391"
FT   CDS_pept        complement(460970..462055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0391"
FT                   /product="Putative lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59066.1"
FT                   /translation="MKVGFITAEGGSAISLPEVREGAQAAAAYANDYLGGIGGRPVQLV
FT                   VCKSQEDAASARTCANEMVEQKVTAVNIGTTAFADSMVPVITGARIPYTTGVAASGAEF
FT                   VTDGAFSWTGGFPATLGVMAQTAKDKGYKSVSLFVTDAPAVTAGANALGKPVFAKAGVG
FT                   LDIVPIPVGTPDATSQVTAAIGKKPGAVILVGEGTFCSTVLKSLVAVNATQPKFVIQPC
FT                   LSKTVEDAAPGALDGATLFTPGDTEGDNAESRLYRTVMGKYAPKTALDGYAVTGYQNLL
FT                   GLVRALKGLTGDVTPASVASTLKAAKDVVLPAGDGLTFTCDGTAIPNLKALCSTGSVVA
FT                   TVKGTRATDYRTVDSASLFGG"
FT   gene            complement(462052..462402)
FT                   /locus_tag="FRAAL0392"
FT   CDS_pept        complement(462052..462402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0392"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59067.1"
FT                   /translation="MSLRCLPPLPLDRIYYLDNIAHHVSWVTYPVLAAEPFRRAAWDEM
FT                   EGLWAARVCGGGVRAERGWERRSWPSAWACYRPRAAVTEAVQARAGAARAQPRRPARPR
FT                   RCRRARRRPARR"
FT   gene            complement(462399..462824)
FT                   /locus_tag="FRAAL0393"
FT   CDS_pept        complement(462399..462824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0393"
FT                   /product="MutT/nudix family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RTN0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59068.1"
FT                   /translation="MAAGCLLRDAAGRVLLVEPTYKPNWEVPGGIAEPGESPRQTAQRE
FT                   LGEELGLDLPVGRLICVDHLAATPRRADALRFLFAVDGPPIPVDALALQAEEIRSARYC
FT                   TAAEVAERAAARLARRIAACLAAPHLPVYLEDGDPAG"
FT   gene            complement(462866..464668)
FT                   /locus_tag="FRAAL0394"
FT   CDS_pept        complement(462866..464668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0394"
FT                   /product="Putative ABC transporter ATP-binding protein
FT                   (partial)"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59069.1"
FT                   /translation="MGMPARHAARDGSTVAGGGSTVAGGGSAATRRVVRRLRPLVRPER
FT                   GVLLGAAALLLAGTAAETVTVWLFGRLTDRALVQGSPREFCAPAAVWLAVAIAGGMCGY
FT                   AGHLLEARASGRLLGRLREAMLARLHVLSPTFFAQRPAGDLLTRFGSDVDAVDELVGTG
FT                   LVQAVTTGCGVVCFTTAAFVLCWELALLACAAAPLHWLLTRRLAGRVRAVSHAERAAEG
FT                   RIAAVAEENIAASALVQTHGMAAHELRRLRHHGAAWRDARFAAHRLAAANAVLASLLET
FT                   VFVLAVLGVGSWEIATGRLTVGGLLSFAGFLGYLYGPLQELGELVVAVGSAVAAGERIA
FT                   EVLDHPAEVADAPDARPLGRVRGHLRFEHVHLTYPDALGPALDGVSFALRPSELTVLTG
FT                   GSGAGKSTVTRLLTRLHDPSAGRILLDGHDLRRVTLASLRRAVTVVAQDSPLVDGTLWE
FT                   NIAWGEPDADPARVAAAARAAGVDGFAARLPDGYDTPLGQSGRRLSGGQRRRVTLARGL
FT                   LRDSPVLVLDEPTAGLDDTAAEPLLRTLRRLAADRTVLVITHDLRLAARADHLVVLDRG
FT                   RLARPASESLFGPDGLTITGNVRP"
FT   gene            complement(464951..465169)
FT                   /locus_tag="FRAAL0395"
FT   CDS_pept        complement(464951..465169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0395"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59070.1"
FT                   /translation="MVPPVRDALRQAYQHSTAAARDAEAPAGTPVADRPGRRPPGSSGG
FT                   QDRRAVGVVGRSGSSGGPGGDSRGHPM"
FT   gene            465247..466032
FT                   /locus_tag="FRAAL0396"
FT   CDS_pept        465247..466032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0396"
FT                   /product="putative acyl-CoA hydratase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTM7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59071.1"
FT                   /translation="MSPEFRTLKFERDGGVARITLNRPDAANGLNQEMSAELARAAAAC
FT                   DGDPSVRAVLLTATGRFFTAGGDVKEMADHGDRIGVEIKKLADDLHRAVSIFARMNAPL
FT                   IIAVNGVAAGAGVSIVAAGDLVLAADSATFTMAYTNVGLSPDGSSSYTLPRLMGLRRTQ
FT                   EFMFLNRRLSAAEALEWGLVTRVVPAEELAGEATALAQRIAAGPADSHGAIKRLLVQTF
FT                   ANGLETQMELEAREIARSAVGDGREGITAFVEKRAPKFT"
FT   gene            466338..467948
FT                   /locus_tag="FRAAL0397"
FT   CDS_pept        466338..467948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0397"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59072.1"
FT                   /translation="MAGLALGACSDGAGAGAGEAPDATGAAAGTGTGSGAADGSWRGAA
FT                   HVAGRWQSGMRAVESPLAADDSVVFHALTAAGVFEMVSLDPVSGRPRWTAPASPSRAAP
FT                   GAGLQTMTLSGGRVVVWMEPGQPVSPGGVTAGGVSVVAADARSGRRLWSYGDGRLELPS
FT                   VPDICGDGDVCVPAGNGSGPIILDGRTGTPRNSAAQPASLAGPGQIQRPLHHPVPATPT
FT                   TPSIVTPPIVTPPIVMPSIVTVSTVEVDTAPSPGYSRSIGAGLYDDGRDLIAYTDAGAE
FT                   RWRRPYATLFRGLDVSPDYGWKVGLSNDLYVVSLGYVPTPEQLAASRAGIPLTRDAARL
FT                   WATAAFDAQTGETLWVSPAATTYCGGLDTDIRNPVRCTYAGTVRYGAQDTSAQDVQVTV
FT                   EGFGAESGRTTWRWVAGAVPGLVLSAAAGSPDILRIDDTRYAVRTPQRTILLDVANGPL
FT                   NEPPPASGWCFTGAVAKPAFTVDGNGGDARYKDDRWYPCAEGRPVDVPSTTPRFAGALV
FT                   GNMYAWRDAYGQVRGGHVG"
FT   gene            468071..469108
FT                   /locus_tag="FRAAL0398"
FT   CDS_pept        468071..469108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0398"
FT                   /product="putative NADH pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTM5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59073.1"
FT                   /translation="MRLVLEDAAVTDFGLVRPPVLAGAALLRDEPLRQDTGRQKEGWAS
FT                   ARVVLVDEEGRSPVRWGPRVEGLGIGAVSGVDDADAGPRLWTRAATEIAGSPPPDALLL
FT                   GEADGVAYWAVRGGADQVAAGDDGVRWLTLFSVGAELGARDAALLAAAVALLNWHGRAL
FT                   FCARDGSPTRLANAGWARVCEAQHHEEYPRTDPAVICLVHDGADRMLLGRHRAWPAGRF
FT                   SVLAGFVEAGESLEACVAREIGEEVGLDVTDIRYLGSQAWPFPRSLMLGFHAVADPAQP
FT                   LRLDEAEISEAVWVTRDEVRQALARGDDWAVADDAPATDSPPPIRLPGRMSIARTMIDS
FT                   WSAAG"
FT   gene            complement(469182..470075)
FT                   /locus_tag="FRAAL0399"
FT   CDS_pept        complement(469182..470075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0399"
FT                   /product="conserved hypothetical protein; putative
FT                   methyltransferase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59074.1"
FT                   /translation="MVRNGPRRKGSVAMSEAEAGTTGTRWFTPVAAEVRPADLNTGVPH
FT                   PARMYDYYLGGKENFPADRETAEQAIAAFPNTRNAARQNRAFLVRVVRHLVGEVGIRQF
FT                   LDIGTGIPTSPNLHEVAQGIAPDTRVVYADNDPIVLAHARALLASTAQGRTAYLDADIR
FT                   DPERILASAELRDTLDLTKPVALSLIAIFHFIDDVDDPYGIVRRLVDALPSGSYLALTN
FT                   ATGDHDPTFEPAAETYRRRGVTMRLRNRAEVERFFDGLELSDPGVQVVHRWRPDTTTED
FT                   LTDAQVSVYGAIARKP"
FT   gene            470336..471010
FT                   /locus_tag="FRAAL0400"
FT   CDS_pept        470336..471010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59075.1"
FT                   /translation="MPTEPAVITGADLGAAEQAVRYELATLHFGLAEGGQAAAGVLPWV
FT                   EGEGARGRLLGCWQTEHGPLGRLFVLRSFDDDGELAAERTRARLSAAPFGAGPGSVVTD
FT                   LSLASFAPFPYVPPVRPGEFGRVYEIRDYHLRPSGLAPTIEAWRGALPARHVIDPLTVV
FT                   MYALDGPARIIHIWPFAGLDERVEIRRDLAARGIWPPAGAPEQILDAQSIMAWPTDFSP
FT                   LH"
FT   gene            complement(471032..471658)
FT                   /locus_tag="FRAAL0401"
FT   CDS_pept        complement(471032..471658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0401"
FT                   /product="Putative oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTM2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59076.1"
FT                   /translation="MEDFVDAETLLTTTRSVRRKLDLDRPVEPEVLTDCLRIAQQAPAA
FT                   GMLRSNLRWIVVRDQALREKIAAPVREVGRESQAKYGHLVDARTLASGKYLLDTLHRIP
FT                   VLVVPCMQGRPGGENGELSAFYGSVYPAIWSFQLALRARGLGSTMVGYHLIGREREVAD
FT                   ILGIPADVTQVSMLAVAYTTTNTFQPAAWPPVEDITYHDGWGRPA"
FT   gene            471755..472417
FT                   /locus_tag="FRAAL0402"
FT   CDS_pept        471755..472417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0402"
FT                   /product="putative regulatory protein"
FT                   /function="3.1.2.3 : Repressor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTM1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59077.1"
FT                   /translation="MPRQTLSRQTVLDAALRLADEGGLPGLTMRRLAAELGVEAMSLYN
FT                   HVANKRDLLDGIAARVYESIALPDPALAWDERLRLLGNGTFAAFAAHPVVARAVVAGQA
FT                   DPRSVRALRVFDAFFGALLDAGLDEPTAVRRYRSLAGQLFGAVLVQTASPAGAQADQAD
FT                   LLDDWSRTAARSEQLPHLRVILPVMAADECRPDFGPELDLFIDGLRPARRAPPTPAR"
FT   gene            472690..473547
FT                   /locus_tag="FRAAL0403"
FT   CDS_pept        472690..473547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59078.1"
FT                   /translation="MRRATVARTVAELAALLGSEGGTLALSAVDESAGTVALSFSLNDA
FT                   DCGDNCALPPDQLRRVVETRLRRALPGLTAVRIDDSRQPVSAGAGGLAGAGGVAPAGPA
FT                   PSSITVLDPTGGVVPGDADPGPDLGSLRGRRIGVRVDVLWQAWDQTVDEWIAELERAGA
FT                   VVTTWRRAQGLKGAEGERRQAEYDAFVGGVDAVISGLANCGSCTSWSVKDGLNALNRGL
FT                   PTVVAVTEHFVGLARTLAADNGRPGLRLVELPSSLNTLPEEQVRAHARSSFPALLDAIG
FT                   AVVR"
FT   gene            473598..474623
FT                   /locus_tag="FRAAL0404"
FT   CDS_pept        473598..474623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0404"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59079.1"
FT                   /translation="MVHEVPADQEAFDALARERGWSDGLPLVPPTPERVARYLAEWGTA
FT                   PDEVIGALPPSLAPVTAEKLAVNAVMAGAPAAALPLLRAAVEAVADPGYELHALNATTG
FT                   SVTTALIVNGAQRHALGIPFGAGCLGGADGRAASIGRALQLVMRNVAGQRVGVTSQSTF
FT                   GQPGRVNGIVFGEWEERSPWAPLAERRGVPGDAVTAFGTMGTANICEVVATDADVLLKF
FT                   VGRALAHPGANGYLVQLSFAEVVIALNPVWAALVGRAYPDVDDVRRILWENASIPLSEF
FT                   PRQHQRQYEDIGWVDARGRVPLTRRPEDVLVMVAGGLGGLHGAALHSWGTTITQTRPVR
FT                   P"
FT   gene            474725..475576
FT                   /locus_tag="FRAAL0405"
FT   CDS_pept        474725..475576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0405"
FT                   /product="Putative TetR-family transcriptional regulator"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59080.1"
FT                   /translation="MEPWTMSCVRESAEGTQPPTVGRRRRARGSLSSGEIVAAARDLAA
FT                   QDGLARLSMPALARRLGCGVMSVYRYFDTKDDLLAALADQVMSDLHRQLPPAGDGPWRD
FT                   ELITYFTAYRDLMESFPAYREVVLYAPTFVIRAALTPAQLRRLDTGIGLLLRAGLPLAD
FT                   AAAVYNVCFNYTRSFVAFEHAARAAATTATAATATTTTATTTTATTTTATTVAGGAIEA
FT                   GGVGAVAAAPASGRRLPADEYPQLSRLADIDGVLGVDERGFRLGLELLATGIAGRYGVA
FT                   ER"
FT   gene            475771..475986
FT                   /locus_tag="FRAAL0406"
FT   CDS_pept        475771..475986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RTL7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59081.1"
FT                   /translation="MGDEDVKQFNVYLPIGLIKRVKHRAIESELSLSALVADALRTYLD
FT                   VRDGLDARDDHDHLRDERGQASGKGI"
FT   gene            476018..476431
FT                   /locus_tag="FRAAL0407"
FT   CDS_pept        476018..476431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0407"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59082.1"
FT                   /translation="METHNWGRAARFFQALGFTLEFETDHGSGLLRAGDGPYVFLREVP
FT                   AGEVPRIQPVLTVADADALRLDPAVEVVTPFEETHYGTREMTVRDPDGRTWSLQAPTEP
FT                   TLMRLVDEGDGVVAAAAADLPVLTADQVRETQE"
FT   gene            476864..477250
FT                   /locus_tag="FRAAL0408"
FT   CDS_pept        476864..477250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0408"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59083.1"
FT                   /translation="MSAPFWAAARERRLELQRCQDCGLFIHLPRPVCRRCGSFRFAYEP
FT                   VSGRGSVYSFTETRRVFHPFFADRVPYLLASIELAEQAGLRMLSNLVGIAEPDVRFGMP
FT                   VEVTFEDLSPDLTIPVFAPAGSLA"
FT   gene            477250..478377
FT                   /locus_tag="FRAAL0409"
FT   CDS_pept        477250..478377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0409"
FT                   /product="putative lipid transfer protein"
FT                   /function="1.1.2.1 : Degradation of short-chain fatty
FT                   acids"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10217753; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTL4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59084.1"
FT                   /translation="MAGRRVAIVGVGYSDAGRRTGLSERHHAAQAARAALADAGLESAD
FT                   IDGLTTWGGNPIDFAHMLGFSPLRWHLDVGISPAFISPAIHAAHAVASGQADTVVAMRV
FT                   ILQQPSRANLWAGGTGMAFDAQFQHPFGDLMPAQWAGLLTNRYLHESDATEEDFANFAV
FT                   TQRAYAAKNPEALIREPLTVEDYLAAPYISKPLRLLDCDYPCDSGAAVIFTTEERARDL
FT                   RQKPVFVEATALSATHDMTFELLPDMVRTSPVHCLRELWSHTDLTAADLDCAQLYDGFS
FT                   VITLQWLEALGVCEPGQAGPFVSSGGTSLTGALPTNTDGGACNVGRRHGANFCIEATRQ
FT                   LRGGQSGERQVADAEVALWANAVGPFTGAMLLTGA"
FT   gene            complement(478568..480394)
FT                   /gene="deaD"
FT                   /locus_tag="FRAAL0410"
FT   CDS_pept        complement(478568..480394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="FRAAL0410"
FT                   /product="cold-shock DeaD box ATP-dependent RNA helicase"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism"
FT                   /db_xref="GOA:Q0RTL3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59085.1"
FT                   /translation="MSSTTDPEPDPAGDEAQAREVGPARGNPAGDVEPAGDVEPAGDMA
FT                   PAGDIDPAEDVAGFAELALRPELLRSLAALGYEEPTPIQREAVPPLVAGRDLLGQAATG
FT                   TGKTAAFALPLLHRLTDDRTGDHGPQALVLVPTRELAVQVSEAIHRYGRDLGARVLPVY
FT                   GGAPIGRQVRALVQGVDVVVATPGRALDHMGRGTLRLDGLHTVVLDEADEMLDMGFAED
FT                   IDAILEQAPQKRQTVLFSATLPPRMDQIARRHLRDPVRIQIGRAAPEPGAAPLVRQVSY
FT                   VVPRAYKTAALGRILDVESPRSAIVFCRTREEVDQLADSLNGRGYRAESLHGGMSQEQR
FT                   ERVMERLRTATADLLVATDVAARGLDFEQLTHVVNYSVPSAPDSYVHRIGRVGRAGREG
FT                   VAITLAEPREHRMLKTIERVTRQRIAVEKVPTVADLHARRLELTRAALQESLLEDDLER
FT                   FRVVVETLTDEFDPMEIALAAVKLAHDASFVPNDADDIPDLPPATDARGERTGRDGAGR
FT                   RERRPRPASGGMARLFVGAGRGAGVRPQDLVGAITGETRLSGRDIGAIEIAQRFSLVEV
FT                   PDGAADEVIASLRGSTIKGRRVAIRRERQDSR"
FT   gene            480677..480865
FT                   /locus_tag="FRAAL0411"
FT   CDS_pept        480677..480865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0411"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59086.1"
FT                   /translation="MLAHHRHPDPAQPAPDDTHVHTYGGLARKRQPGAGTRGGVPRCSS
FT                   AADTALVYDSVSYHRRG"
FT   gene            480869..482089
FT                   /locus_tag="FRAAL0412"
FT   CDS_pept        480869..482089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0412"
FT                   /product="acyl coenzyme A dehydrogenase (partial)"
FT                   /EC_number="1.3.99.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="GOA:Q0RTL1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59087.1"
FT                   /translation="MSLVPRGVGAGPRRAAPGTAGRSDVERTLYEDDHELFRESVRTFV
FT                   ERFVSPGYSQFIADRVIAREVWHEAGRAGFLGLGVDEEHGGSGIHDYRFNAVWVEELSK
FT                   VSAGVASSFSVHTDIVAPYVAGLTTQDQQKRWLPAFCSGEMVAAIGMTEPAAGSDLAAL
FT                   RTTAVPDGSDWIINGSKTFITNGYSADFVVLAARTDPGAKAARGITLFGVTADTPGFSR
FT                   GRKLHKVGQPESDTAELFFTDMRVPADAVIGEVDRGFPRMMERLPQERISVAVSSIAHA
FT                   TQILGETLAYVAERKAFGAAIGSFQHNKFLLAELVTKIDVTQAFVDSCVAAHSRGNLSA
FT                   VDAAKAKWWSSEVQNAVLDACVQLHGGYGYMTEYRAAQAWMDGRVTKIWAGTNEIMKEI
FT                   IGRSLGF"
FT   gene            complement(482174..482587)
FT                   /locus_tag="FRAAL0413"
FT   CDS_pept        complement(482174..482587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0413"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR023341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59088.1"
FT                   /translation="MSGVTNLTVLVDDEPTPDGWIKIGKDLNAGAGGAYLYFAYEKGSG
FT                   APITNIIFLLSKDESAPPSYHRIDVDLNKGAGGAYIYAAFTREAHLGSPIDDLDVILGD
FT                   NSGIQPQAPWRRIDVDLNKGAGGKYVYLVYRNA"
FT   gene            complement(482773..483600)
FT                   /locus_tag="FRAAL0414"
FT   CDS_pept        complement(482773..483600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59089.1"
FT                   /translation="MWTHKSWQGRFLAHPLPPHERLRHYAGWCNAVEGNTTFYATPTRD
FT                   TVASWAQQTDADFRFVLKLPKVITHERRLTDVDEALGAFLAAIEPLGPRAHAVWIQLPG
FT                   SFAPTDVPALARFLGRLPRSHRYAVEVRHRAFFDDHRAARTLEAALAVAAAEWIPFDTT
FT                   ALFRSAPTSDAERDAWAKKPRVPLRSVALTDRPIVRYLGRDDSARTIEGWQGWIDVVVD
FT                   WLREGRSPTVFLHTPDNADAPELARRFHDEVRARVPALAALPRPRPTEPATLF"
FT   gene            complement(483688..483921)
FT                   /locus_tag="FRAAL0415"
FT   CDS_pept        complement(483688..483921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0415"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59090.1"
FT                   /translation="MWTSSSSGVVRDPPTGPGVPVDVAAHVDLAVLHHPALSFRPWGPP
FT                   TVRHRCYGSVALVEHPRVDRSATSFGFDHPPG"
FT   gene            484058..485170
FT                   /gene="vanA"
FT                   /locus_tag="FRAAL0416"
FT   CDS_pept        484058..485170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanA"
FT                   /locus_tag="FRAAL0416"
FT                   /product="Vanillate O-demethylase oxygenase subunit"
FT                   /function="1.1.5 : Others"
FT                   /EC_number="1.14.13.82"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9098058; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTK7"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59091.1"
FT                   /translation="MVDTRAARATVPPDCSFDPDDWAILARHWYPVALSREVRDQPVAA
FT                   RLLDERLVVYRAGGEVVVARDLCPHRGVPLTMGTGDGETVACAYHGLRFGAAGACVAIP
FT                   AHPTVKIPARMALTAYPVTERYGLVWTCLRPDLDAGFAAGSSSGSGSPGPSSGSDRPPV
FT                   PPIPRMPHWDDPGFQRVTCPGFDVAAFAGRQVEGFLDVAHFAFVHTATFADPDNAEVPD
FT                   YTPAPTPHGFSADYWSTVGNYPHGARRGEPDFRWLRRFDAHLPFTATLVVHFPDGGRLA
FT                   IMNAASPVSARQTRMFAPIAKNFDTAQPDQEIYEFNLRIFEEDRVIVEAQRPENLPLDP
FT                   RLEVNIPADRSSVAYRRGLRAMGLSHFFTA"
FT   gene            485211..485852
FT                   /locus_tag="FRAAL0417"
FT   CDS_pept        485211..485852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0417"
FT                   /product="Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /function="1.2.2 : DNA"
FT                   /EC_number="3.5.4.5"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTK6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59092.1"
FT                   /translation="MDLSPTDPSPAVAVRPVAALGVSLPAWVDDEVHTAGTVLPDVEQR
FT                   MDLVHRLAARNHREGCGGPFAAVVANPDTGQIHAAGVNLVLATGLSAMHAEVVALSFAQ
FT                   ARLGRWDLSAVGSPVELVVNWRPCVMCYGAVMWSGVQFLTIAGEGDEVEQLTGFDEGPM
FT                   RDDWQEQFARRGITVRTDVLREQALTVFADYGSRDDVVVYNARRGAPTTT"
FT   gene            485938..486315
FT                   /locus_tag="FRAAL0418"
FT   CDS_pept        485938..486315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0418"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59093.1"
FT                   /translation="MEHQAGTRGQPRTVAGGVGPDRTRVTRVARVTQVSRVSGVTDVEV
FT                   PHAVAAFGQQGSEEAEILERDVPNGDRGARHDHSYRIPPWPAPDQRSLGRRPQHRAAHR
FT                   PGRRAPEGEKPLRLFGPPGRS"
FT   gene            complement(486345..486779)
FT                   /locus_tag="FRAAL0419"
FT   CDS_pept        complement(486345..486779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0419"
FT                   /product="Putative HTH-type transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTK4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59094.1"
FT                   /translation="MRRVSTALAQQVDRALREFSLTHTQLGALAQLGLVDPGALSGATL
FT                   GQRNGVTAQSMSTAIAGLLVRGLVDREPHPTHGRILQVRITPEGTDLLARAQAAVGRAE
FT                   DRTLAFLDPEQQRQLRSVLRTMMRAMDLYLYFPDADDDRA"
FT   gene            486923..487711
FT                   /locus_tag="FRAAL0420"
FT   CDS_pept        486923..487711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0420"
FT                   /product="putative Short-chain dehydrogenase/reductase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59095.1"
FT                   /translation="MARSGSRGVVMSAARTVVVTGASGGIGSEIVNRFLAHGDTVVAAD
FT                   VSQEALDTWRARWDSGAPGGRHPSLHAVATDIASEESVAALVQVVQQSLGTVDVLINNA
FT                   GRFPQTAFEEMSTDEWRQVIDVNLTGTFLMIRAFVPLLKASGRGRVVNIGSGSVFSGTP
FT                   MQSHYVASKGGVLGLTRVLARELGGYGITVNVITPGLTVTPAAAAVLPEALLAEQRDAR
FT                   ALHRDETPEDLVGPIFFLASDDAAFVTGQTLNVDGGRHLL"
FT   gene            complement(488020..488688)
FT                   /locus_tag="FRAAL0421"
FT   CDS_pept        complement(488020..488688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0421"
FT                   /product="putative regulatory protein"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59096.1"
FT                   /translation="MTEEAAVMAGRPVNHQRRAELLDAAVEYAAEYGFSELTWRPVAAA
FT                   LGVSPTTLVHHFGTKEQMLEAILGRLRERIFAATRDLAGEQPDLAAEARASWTRAFDPQ
FT                   HEAEFRLFFAVYGRALQAPQQFAAFLEHVVAYWMRALVAAQGPDTDPATATRTATLVIA
FT                   TIRGLLLDLLATGDRNRVQDAADCFLATLERPATVERPATVERPATVEHGPQPTVARPR
FT                   "
FT   gene            488819..489754
FT                   /locus_tag="FRAAL0422"
FT   CDS_pept        488819..489754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0422"
FT                   /product="putative oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59097.1"
FT                   /translation="MRVFVTGASGWVGRGLVPDLITAGHTVTGLARSDAATVALRAAGA
FT                   EVREGSLDDLDILREAAVAADGVIHLAFKHDIAFAGDFAGATDADRAAIEAFGEALAGT
FT                   DKPFVIASGILGVLGLPPGVVATEHDGRAAQDADREVPISGANGRIDNANYTLALAARG
FT                   VRSSVVRLPPATHGNGDNGFIPAAIGFAREKGAAAYVGDGTNRWPAVHRDDAARLFRLA
FT                   LEAAPPGSALHAVGDEGVPIREVAEVLAAHLDVPAVSVTPDQIGDYVGFLGGFWGFDGP
FT                   ASAQITRDLLGWQPTRPGLTADLKEGHYFA"
FT   gene            complement(489796..492066)
FT                   /locus_tag="FRAAL0423"
FT   CDS_pept        complement(489796..492066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0423"
FT                   /product="putative integral membrane export protein"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RTK0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59098.1"
FT                   /translation="MKRIAELAVRRRWLVVVGWVVFVIAAQGIAGAMGGASYKDTFSLP
FT                   HTETASVANLLEDAGLNNQNGALGTVVLKNRAGAFTTPPAQLKPALSKVCTSGNHVALI
FT                   VSPWESIDCSKSDAAAPGNPGLLNRAHGSTTALVTLTWENDHYDAELFKNVYDQLKTLR
FT                   SDALQVEFTGNAFAGIGQSSGSGSSVFIGFAAALIILALVFRTVAATVLPLASAVVALV
FT                   SGLGVIYILSHAINVSNITPYLAELMVIGVGVDYALFIVTRHRRNLRRGMPVAESIVNA
FT                   INTSGRAVLFAGTTVCIAILGLIALGVSFFNGMAVATALAVGFTMIASLTLLPALLSLF
FT                   GLKVLPRRQRAAVRAGEFIDDRPVGYWARWSQFVARRRVVVAIASGAVMVVIALPFFSL
FT                   ELGASDQGSDAKSFTTRAGYDLIAADFGVGYNSTLEAVVSGPGASDQAYLQRVTKSLAA
FT                   VPGVDPASLGTAPLAKDIAFVTFKTTTSPQSEKTYTLVRHLRSTTLPPLYDGTPNHIYT
FT                   FGDTAINVDFASVLARKMPLFIAVVVGLSFILLLIAFRSLVIPLTAAVMNLLAAGGSFG
FT                   LVVAIFQYGWLSDAMGAGPGGPIDAWIPVMLFAILFGLSMDYQVFLVSRMHEEWVHTRD
FT                   NTRSVTIGQGETGGIITAAAIIMIAVFLGFVVSPGRPIKIFGTGLAAAVFLDAFVLRTM
FT                   LVPSVMHIVGRSNWYLPRWLDRITPHVSVEPADEAVTHATGTGIGSFDDDRPEDERELA
FT                   HRS"
FT   gene            complement(492050..492253)
FT                   /locus_tag="FRAAL0424"
FT   CDS_pept        complement(492050..492253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0424"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59099.1"
FT                   /translation="MTVVSGDAAPVEHSFDPVEDVAALSSPGSPLSARKHAETEVDADA
FT                   VADAGAFASCQTSSRRTDEADR"
FT   gene            492640..492813
FT                   /locus_tag="FRAAL0425"
FT   CDS_pept        492640..492813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0425"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59100.1"
FT                   /translation="MTPFAREGRHIDFLADLRLRTDASEALRHRSRREDTTSTHHPIMT
FT                   DRRQPRWQTSPM"
FT   gene            complement(492830..495169)
FT                   /locus_tag="FRAAL0426"
FT   CDS_pept        complement(492830..495169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0426"
FT                   /product="Putative serine/threonine protein kinase"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="2.7.11.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTJ7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59101.1"
FT                   /translation="MVAVDRDRVRAALPGYTISGQLGTGSSGLVLAGHHRDLDRPVAIK
FT                   VLSTAATDPAAVDASRAEAQMLGRLDHPHIVRIHDFVVRDDLCLLVMELLPGGPVDRRR
FT                   LSPPAACAVGLAVAHALSQAHRFGIAHRDVKPANILFTGSGLPKLTDFGIAKILEGTAG
FT                   EASRLAGTPRYMAPEQIRRGRLSPATDVYGLGVVLHELLRGESMFPRGLPVSELFRWHL
FT                   EVEPPPLPAVPPALGEVVARALAKDPAARHPTGLDLARELAVAAGAAFGPRWLHGCGVT
FT                   VRVVDDLVEQPSPPAGRDRAGRDLAGPTSLPTPLPLPTPASTPRSDSTTASIPAAVPTS
FT                   ASDRSTLAGPSPGSVPLGVVRPGAFRPGGFRPGGADAAAPVTPPPAVRPVRRQRRRRLA
FT                   VTVAATAATMVLGLIACLVIPGGSASSPRSGATTTAAVGDAGVTPPGPDGVAAINEFKD
FT                   LTVDAAGNVYLADQADPRIRRIDRRGYVSTVAGSGETGTSGDGGPALQAAFQRLGSVAV
FT                   DAAGNIYISDESNRVRRVDTHGTVTTIVGTGDDADTGDGGPAIQAALDFATTEKISVDV
FT                   AGNLYICVLDGLRRVDRAGIITTLIKRGTGLSPSPPGDGGPASAGRLQATTAAVADRSG
FT                   DLYIADSEANRIRRIDSRGIVTTVAGTGAKGFSGDGGPATRAMLNNPTGVAVDRAGNLY
FT                   IADSANHRIRRVTPDGIITAFAGSGAAFVWGSPKSDETNGPATSVVLWNPEQVAVDGAG
FT                   NVYIGDSPRVLKVDPQGTSHLLANRP"
FT   gene            complement(495204..497381)
FT                   /locus_tag="FRAAL0427"
FT   CDS_pept        complement(495204..497381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0427"
FT                   /product="Putative serine/threonine protein kinase"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="2.7.11.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTJ6"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59102.1"
FT                   /translation="MPVIDRDRVVAALPGYTVGEELGSGGYGLVLAGRHLDLGRDVAIK
FT                   VLSTAAAGRPDVAAGFRTEARLLGRLEHPHIVQIYDYVDHGDLCLLVMEVLSGGTLTRQ
FT                   QLGQQSACAVALAVADGLAAAHEAGVLHRDVKPDNVLFTVAGQPKLTDFGIAKIFDGTA
FT                   STASRVVGTGRYMAPEQILGGRLSPATDLYSLGVLLYEQLTGGPMYGPGLSITDLFRHH
FT                   QEVMPAPPPGVPEPVARVVMRALAKQPQQRQPNARVFGHALALAARQAYGRDWTAGTGI
FT                   VLHLPDELREPTRHRPRRSRIPAAADGTGVDGWGSDGTGEHRRRPRRRVWLPAAIVVVL
FT                   AAAGGITFAATRGSGPEPLPAWVPRTLAVGQIGGAVGTGNDGFSGDGGRAAGAGLNKPD
FT                   AMAVDTAGNLYIVDKSNQRVRRVDRDGVVTTVAGNGIRGFTGDGGPAIRAELADPAGIA
FT                   VDAAGDIYISDQGNQRVRRVNPAGVITTFAGTGVFGFSGENGPKIGGFSGDGVLARQAM
FT                   LDEPSALWVDRAGNVYICDGSNDRIRKVDTAGVISTVVGSGGDGFGGDGGPATAARLQW
FT                   PESLAVDVAGTMYVTDQGNNRVRRIDTHGIITTAAGTGTMGFSGDGGPATRAAIHTVGA
FT                   GVTVDDAGNIYLADPQVNRIRRIDTHGIITTIAGTGVAGNAGNGQRALDAAISYPSSLL
FT                   FYRGYLLVSEVNGSRILAIALGPASQGAHRR"
FT   gene            complement(497389..499986)
FT                   /locus_tag="FRAAL0428"
FT   CDS_pept        complement(497389..499986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0428"
FT                   /product="Putative ascorbate-dependent monooxygenase"
FT                   /function="1.8 : Metabolism of other compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTJ5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59103.1"
FT                   /translation="MRRTWTTWCWGRGRGEDMPAVDRDSVIAALPDYTVGRELGMGGYG
FT                   RVLAGHHHPLNRDVAIKILSLRAVHGESATEDFRTEGRLLSRLDHPHIAQVYDFVSRGD
FT                   VRLLVMELLSGGSLTRQHLSGPDACAVGLAVADALVQAHGLGVLHRDIKPDNILFTTAG
FT                   QPKLTDFGIARMFDDPATVARGVIGTPRYMAPEQIREAALGPATDLYALGVTLYELMTG
FT                   GPLFPPELSVPELLRHHCEVPAPVPVTVPEPIGRVVLRALAKDPAARPPSARAFAADLA
FT                   AAARVVYGPNWLHRAGVVVRIIEDAGDPPTATATAAGPATTVAAGVTADADLTRRVGTP
FT                   PPMPMPAYGPDGSAAVPWYGAESGDGGGLGPAGVLASPPQPGGADPGSGGSGADGSGVD
FT                   GSGVDGSGVDGPESGGPASDGSGVDGSESGGPASDGSAGEVSRADPPTRVRRRWRRPAA
FT                   AATGVLALVAATSLYLTWGGSSSPVSRPAVSGTLPTPRSPQVTSDPGARILPVAGTGAR
FT                   GSPVDGALALRTSLADPFGLTADAFGNLYFADFGSNRVMRINAAGVITTIAGTGVAGFS
FT                   GDGGPAVAAQLDQPAGIALDNRGDLYIADRLNHRIRRVDPRGIITTVAGINDHFIVGDP
FT                   VGYSGAGAGDGGPALAAPLSFPTAVATDDAGDLFIADQGENRIRKVDARGIISTFAGSS
FT                   GRGSFGDGGPATDALLDVPFGVAADAAGDVYIADTDNSRIRKVDTHGVITTVAGNRLRG
FT                   FAGDGGPAVKASLQDPRGIAVDAVGNLYITDRGNSRIRKVDTHGIITTLAGSGRPGSAG
FT                   DGGLAGNAELGRPDGAVGVDHEGNVFFSDRASGRIRVVVPSHPLPSTPASTRG"
FT   gene            complement(500263..500577)
FT                   /locus_tag="FRAAL0429"
FT   CDS_pept        complement(500263..500577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0429"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59104.1"
FT                   /translation="MTTPATTTPSADATPAKLHHPGAWFDGYADTQPEPPTPELLELFI
FT                   RLADLHLDDHSIGSALEDMLITPLDQALSTHSPTRSGTLTTLTVTDVAREYGAWTVSLA
FT                   "
FT   gene            complement(500589..501122)
FT                   /locus_tag="FRAAL0430"
FT   CDS_pept        complement(500589..501122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0430"
FT                   /product="Putative TetR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59105.1"
FT                   /translation="MDMTPRRRVSRRGKPEFAGCGSGDGTGRGGRAGRPARCRRDARRA
FT                   GRPGQTAGAGADRRGAAGRDGERADGEAGVAVGVGPAAATPLGGWKDPRAGGDDDPPER
FT                   FGVRDASLYTHIRGLADLQERVAMLALGEWADTLGAAIAGRSGRTALSAFAERSGRPRG
FT                   PTARPRRHGSWPPP"
FT   gene            complement(501268..502257)
FT                   /locus_tag="FRAAL0431"
FT   CDS_pept        complement(501268..502257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0431"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59106.1"
FT                   /translation="MSTYRPRPDGRVDAERLLRGDPVNAGIGTDPLADLLAAASAPARD
FT                   GELDGEEAAVAAFREARLVHVPQPRRKSMLKLMLANALTAKIAAAAVGATVLSGAAVAA
FT                   STGVLPLTGGGGRTVSATGTPSATVTTPVVAVASPGAAVSASLLALCHTYTATAASGAS
FT                   TALDSPGMTALVTAAGGRDKVGPFCVRALQAQVDATVAPGAQADTRLDPGGVGAGAAVG
FT                   PNAAVGATAGPGSAGAGARVGAGTGVGAQAGQSGTGVGATAPGAGVGASAGPGGLGLGA
FT                   SAPGTGVGAQTGQSGVGLGATVPGAGVGASAGPNGLGLGASAAPTPRH"
FT   gene            complement(502340..503032)
FT                   /locus_tag="FRAAL0432"
FT   CDS_pept        complement(502340..503032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0432"
FT                   /product="putative RNA polymerase ECF-subfamily sigma
FT                   factor"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type f : factor"
FT                   /db_xref="GOA:Q0RTJ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59107.1"
FT                   /translation="MIPAPPTPIRRTFGGASTPFRDGPDTDPPPTTEPDLSSAVSGAQR
FT                   GDEASFRLIYRTVQPGLLRYLRVLVGDDAEDVASEAWLQIARDLPTFRGDADGFRGWAA
FT                   TIARHRALDHLRRRGRRQREDVPVELVTAQLAGPDDTAGEALEAMSTEAALRLIAGLPL
FT                   DQAEAVLLRVVMGLDAKTAGRVLGKRAGAVRTAAHRGLRRLAEQLGAVEHLGARGDQQD
FT                   RSARSRRT"
FT   gene            complement(503231..503449)
FT                   /locus_tag="FRAAL0433"
FT   CDS_pept        complement(503231..503449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0433"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59108.1"
FT                   /translation="MALAAEHLGTMAWDDRGGTAASRATGRSGLVTVPVGHSDTLRELA
FT                   IDEVKASDLTRSAVLQPFQNVSGGSSP"
FT   gene            complement(503619..504449)
FT                   /locus_tag="FRAAL0434"
FT   CDS_pept        complement(503619..504449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0434"
FT                   /product="Putative HTH-type transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTI9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59109.1"
FT                   /translation="MSSEFGLLLRGWRDRTSPAFVGAIETNRRSPGLRREELAALAGLS
FT                   VDYLVQLEQGRAARPSPQVVAALCRALRLAEDDAALLHQAAGLAIPKGAVSTEIPSGIE
FT                   RLLQRLDDWPVAVYSVDWWLLRWNRLWAALLGDPGALLGRSRNLIWHEFTDTPSRVALA
FT                   PPERDAFRDALVADLRVASIEYPHDPGVRQLVNELRTRSTDFVSRWIAGRPVRHQTARK
FT                   RIEQPHVGHLTLDSDVLQTPGSALRIIVYSAEPGSQDASRLDLLRVLGTEAFAH"
FT   gene            504403..505251
FT                   /locus_tag="FRAAL0435"
FT   CDS_pept        504403..505251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0435"
FT                   /product="Putative short chain oxidoreductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTI8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59110.1"
FT                   /translation="MRSRHPRSSNPNSLDTEPVWRYGGPADWCCQSHPRAVPSSGAVDP
FT                   DRLTGMDTITLITGANKGLGYESARRLREAGHTVLLAARDPERGQAAAGELAVPFVHLD
FT                   VTDEDSVALAASWVRDQYGRLDVLVNNAGINGPSIPIDQATAADVAGVFNTNLLGVVRV
FT                   TTAFLPLLRASDNPRIVNVSSGTGSFALTEKNSWWDPEYVPPIYAATKTALTKLTVFYA
FT                   HALPDMRVNAADPGWTATDLNNFRGIQTVQEGTDAIVELATLPADGPTGAYVNRDGVVP
FT                   W"
FT   gene            complement(505223..505531)
FT                   /locus_tag="FRAAL0436"
FT   CDS_pept        complement(505223..505531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0436"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59111.1"
FT                   /translation="MFRYKVPRRSAAVAFRITNMAHIIAPADLGNHGASPDAEPTRAAQ
FT                   CTISPSDNIPRCGGCLPISPRNPSRNDSNSASRNSWSTVDACRVHGLVVTRGRRRLG"
FT   gene            505593..505808
FT                   /locus_tag="FRAAL0437"
FT   CDS_pept        505593..505808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0437"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59112.1"
FT                   /translation="MDQAARRGAGWVRRDCLWPGLAAYYQQQGFTLVREVEHGKYRHHM
FT                   LARRAERIDLSTWFSTGTPSLPGGGR"
FT   gene            506181..506726
FT                   /locus_tag="FRAAL0438"
FT   CDS_pept        506181..506726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0438"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59113.1"
FT                   /translation="MLSPRRALAGAFTVAAVAADLWFAPVAASAALARVTCTGQEAVSY
FT                   SPGLTLTPHDTTVTINSLLGSAGNPGLCVAPGKGITSATYTEVFDRPGASCVQALFNGP
FT                   GSRVIVWSDGRSSTFTFTAQIQTLPGASLVTLTGTITSGEFAGRRAVETIQIPQLDLVQ
FT                   CLTTGIDNSIALATLVIL"
FT   gene            506669..507055
FT                   /locus_tag="FRAAL0439"
FT   CDS_pept        506669..507055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0439"
FT                   /product="Putative oxidoreductase; short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTI4"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59114.1"
FT                   /translation="MLDDRHRQQHRTGDTGHPVATEPRPFPQAVAAGLRRPTPCDGWDL
FT                   AALLAHVIGQGGRYAGPGGFLQGRGAPKLVGRSRAARDGALARRLWTVSEELTGVTFPL
FT                   AATKATKNERQSLPVSPAPAPQDW"
FT   gene            507117..509264
FT                   /locus_tag="FRAAL0440"
FT   CDS_pept        507117..509264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0440"
FT                   /product="putative dehydrogenase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTI3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59115.1"
FT                   /translation="MRSSSGDGRAAARRSPPTQAPEESLRMGTPVREVRTYCRICIAQC
FT                   GTLVTVDGDPASPVVRQVRGDAEHPVSKGYTCAKGRALPALHHHPLRLEQPLLRDADGT
FT                   QRPVDWDTLLTDLGGRLAGIVAEHGPDAVAVFYATGAAFDAAGRRTAERFFDRLGTRQK
FT                   YSSLTIDSPAKPLTAEMVGGWPWLNLVDDDQECRLSLLVGINPIVSHGHTTSMSNPRAR
FT                   LRAQRERGELWVLDPRRTETARMATRHLQTRPGSDPFVLGFLVRELLADGADEAYLRAH
FT                   ASGVDDLARAVSPLDAQRAAAVSGVSVDQLHELLAAIRRAGRISVVTGTGATMAASANV
FT                   TEWLRLALLTVTGSLDRPGGMWFHPGFLRPVDGLDLPVSPPEGRVEPGPRSRPELTRRF
FT                   GEYPCAALVPEIEAGNVRALVVVGGNVASSFPASGGIRAALRSLEVCAVADVVETETTR
FT                   LATHVLPSVGQLERADVPVLLDAFTDRVMSQRTAAVVPPVAERRPVWWSFARLAEQLGL
FT                   DVLPRGLTWETADDDAIIDPIVARSRDPEALAQAPAVVLSSVERFGWVTGHVLPGGRWR
FT                   LAPPPLLAQLAELLTSEPGVDVAPDGLLLVPRRLPRAMNSQLHDVRQAGATPQAELLVH
FT                   PADAATAGITDGVMVRVLGAHGATRAQARVTDEIRAGTVSLPHGWTEPDVNRLTSIVDE
FT                   TDALTGMVRMSGIPVRLEPEV"
FT   gene            509638..510516
FT                   /locus_tag="FRAAL0441"
FT   CDS_pept        509638..510516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0441"
FT                   /product="hypothetical protein; putative membrane protein;
FT                   putative Zinc transporter"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTI2"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59116.1"
FT                   /translation="MSETRTLILGFIAGATILIGLPVGRLRRPMPGVRQFLNATAIGIL
FT                   IFLVWDVLAHAWEPLDAALSKVHDHSGGLGPVFGYGTLFLGGLSIGLLSLLGYERVLIR
FT                   RPTPPQPEPGAGARFGPGAMAADELATLQPPATTGLSAARRLALTIAVGIGLHNFGEGL
FT                   AIGGSAGRGEITLATLLVIGFALHNATEGFGIVAPLAADADRPSWGFLLLTGLIGGGPT
FT                   LIGTAIGRQFTSDPLSVIFLSLAAGSILYVVIQLIGIASRAGRRELLYLGVLAGLAAGF
FT                   ITDAIVTAGGA"
FT   gene            complement(511192..511335)
FT                   /locus_tag="FRAAL0442"
FT   CDS_pept        complement(511192..511335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0442"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59117.1"
FT                   /translation="MQWRVDKIDKSWWRFLGIAMIIGLAVALLSGAADHCQFLKDLTLW
FT                   TS"
FT   gene            complement(511550..511744)
FT                   /locus_tag="FRAAL0443"
FT   CDS_pept        complement(511550..511744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0443"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59118.1"
FT                   /translation="MKWRAGCIIGSQDDGLGRVEGSFDICAAAVAVPTRLRLLSMIYFR
FT                   GGAAYACELTEPLGLRAGP"
FT   gene            511857..512345
FT                   /locus_tag="FRAAL0444"
FT   CDS_pept        511857..512345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0444"
FT                   /product="putative Site-specific recombinase, phage
FT                   integrase family"
FT                   /function="2.1.3 : DNA recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTH9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59119.1"
FT                   /translation="MGLCCQLVRSAERGAKTPTVGKRYRAPEGIWTVYRDRVPCGQVEV
FT                   IGCTRRRGSSAVLHLAEALPFDLEAGVELGEDLLSLKRLHDLRHSSASIHLSEGGDLTL
FT                   LSKRLGHSSPAITARLYAHLLRSTGQAAAETVANAVPRRVRRPSHPQSTHSDQRTRNE"
FT   gene            complement(512493..512735)
FT                   /locus_tag="FRAAL0445"
FT   CDS_pept        complement(512493..512735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0445"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59120.1"
FT                   /translation="MALKSRRTWPVGVRPGIVVLREILSCRRLGVPGDRPKRAAARPPQ
FT                   TGTGPYQNMIVVAEMWARTARSGAYFPDTLRHHTA"
FT   gene            514600..515286
FT                   /locus_tag="FRAAL0446"
FT   CDS_pept        514600..515286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0446"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59121.1"
FT                   /translation="MHARAEVTIRSSPPARGSSGRVRGSDPRRRVVPARAGIFLIAAPI
FT                   VVTLDRRPRPRGDLPRTISDAIGAVLSSPPARGSSPALGAAPDAVPVVPARAGIFPSCP
FT                   SPPTRRSGRPRPRGDLPQAARKKTRRRQSSPPARGSSSRGGGPANDFRVVPARAGIFLP
FT                   ELRTGGGVRGRPRPRGDLPARPGLRGWFALSSPPARGSSPTLGRPDGLELVVPARAGIF
FT                   PDSVYH"
FT   gene            516374..516622
FT                   /locus_tag="FRAAL0447"
FT   CDS_pept        516374..516622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0447"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59122.1"
FT                   /translation="MAWDLFGHVVPARAGIFLRIPASDIRDGGRPRPRGDLPPLTIGAG
FT                   SYFSSSPPARGSSFDRLGDERHLLVVPARAGIFRQTT"
FT   gene            517241..517537
FT                   /locus_tag="FRAAL0448"
FT   CDS_pept        517241..517537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0448"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59123.1"
FT                   /translation="MLPTSSPPARGSSPLCVTQETDRDVVPARAGIFWSDGRADTSRNG
FT                   RPRPRGDLPKKAATPATPTASSPPARGSSSAGKGRRSGAAVVPARAGIFPRGI"
FT   gene            517795..517971
FT                   /locus_tag="FRAAL0449"
FT   CDS_pept        517795..517971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0449"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59124.1"
FT                   /translation="MTSRPRPRGDLPELAIMSFSRIASSPPARGSSAEREVMKADLLVV
FT                   PARAGIFPRGGGR"
FT   gene            517968..518273
FT                   /locus_tag="FRAAL0450"
FT   CDS_pept        517968..518273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0450"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59125.1"
FT                   /translation="MSRTHRSSPPARGSSALGSALPSGAAVVPARAGIFPHPVNLHPPA
FT                   EVVPARAGIFLGIDLTGPERDGRPRPRGDLPPRGADAFARAWSSPPARGSSSVESP"
FT   gene            complement(518564..518998)
FT                   /locus_tag="FRAAL0451"
FT   CDS_pept        complement(518564..518998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0451"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59126.1"
FT                   /translation="MRFAAHHQHPATNQVPCLPEANPHFWVPTDPTPEPRSSLTRLACT
FT                   KARTDGRAIPRSPTTADRARRKIPARAGTTRPSCAGRRTGEEDSRAGGDDRPHPMIILA
FT                   GRKIPARTGTTSPTTRRPPPPSEDPRAGGDDFVGVWFSAK"
FT   gene            519064..521865
FT                   /locus_tag="FRAAL0452"
FT   CDS_pept        519064..521865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0452"
FT                   /product="hypothetical protein; putative DEAD/DEAH box
FT                   helicase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="InterPro:IPR041372"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59127.1"
FT                   /translation="MWGKSKAPESMHLLLGHLLDTAAVAELVWDNFLSPAVQRFLDDCS
FT                   RGRGRSLFALLCGLHDVGKATPAFQMKDAALADRVRAAGLDWGDLTVDQGRRWHHARAG
FT                   AVIVKRRLREAGWRPSACAWAWPLIAGHHGLVPGADRLKPSTPNAQGRGVWAQAQTVFV
FT                   DRVAAELGIDVVSLAEVRTPRRGSQLTLSGLIIMADWIASDEKHFQGQAELSEVSLECS
FT                   RERAGKAWDRLGLRGGWRVERLASGVDGEPDLIRRRFGQSARAVQGSAVRLAEEMPTPG
FT                   LMIIEAPMGEGKTEAAFGAAEVLARRFGADGVFVGMPTQATSDPMFGRVRTWSLSIDPE
FT                   VPLGLLHGRARFNKEWAALRSQVTFTGIDDELDEYGLPDEFGVGAATTTGPRHTIDGVA
FT                   AAEWFLGPKRGLLAPVTVGTIDQLLHAATRTKHVMLRHAGLAGRVVILDEVHAYDVYMA
FT                   QFLFEALRWLADTGVPVILLSATLPPAQRAELVRAYLQGALQKRDIDVSALPAPRGYPR
FT                   VTTAWAYEGAPDFGRATDPAWMTLPPIEVEVLAENADFSVDAVADRVIREVGGGGCALV
FT                   VCNTVARAQDVYAAIRPEFGQDVVLLHARLVAGERAARTETVVDLLGPPGRGTARPGRL
FT                   VVVATQVAEQSFDVDVDLLVSDLAPIDLLLQRAGRLFRHRRPDRGREPKVIVCGLRVDA
FT                   EGLPRWPGGSRAVYGDHLLLRSAALVLEAAAGAGWSVPAQVPELVTAGYGDEPLGPDAW
FT                   SQSATRYRQEWADREADRTVRAADFLLSGPDKLGVKTLEGLHERATAVLTTEERVAAVV
FT                   RDGDESVEVVLVRGDPAGGYRSLAGRSLGRHGEAAISDDTLLEQVFADTVRLPANKALT
FT                   AVAIKELAPLPGWQGDPWLRRARALVLDDDLSTTLGGHRLSYSHETGLSHERLGHPWTH
FT                   GHR"
FT   gene            522726..524198
FT                   /locus_tag="FRAAL0453"
FT   CDS_pept        522726..524198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0453"
FT                   /product="hypothetical protein; putative IMP
FT                   dehydrogenase/GMP reductase domains"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59128.1"
FT                   /translation="MLIDACGAPRDREEWSSWWEDGEFCDERLKQLGKYFKHHAVDCFD
FT                   LFHPERPFAQVAGLRTAKGETKPVSLLIPRLAAGNNVPLFSARAESDPPALTPARAARA
FT                   LLSVHCWDTAAIKSGAVDDPAVKAGKTTGNPTGPVGQLGVIVPFGATLFHTLLLNLPIL
FT                   PQGVNPGDRPQWRAEAAAGPGWSSRGARGLLDLLTWQARRVRLVAELEDAAPGGVVVRQ
FT                   VVLAAGDRLRGSAHEVEPHTAWRQVDKPKSDEPPQRPVRHQPGRSAWRGLEALLATSSP
FT                   TSDRVSSSALLTQLAALRLDEYVAEDLPLRVLTVGVRYGNQSAVIEDVMSDEIPLPVTA
FT                   LTENTEVRDVVLTVARQAEDLRIAANRLGDDLRAAVGADKLPWDRGQRLGDVLVHLLTP
FT                   TVRRLLAGLALHPGDADGAEQAWRIVARRLAWEVADPVLSAAEPATFLGREPEQRFGPR
FT                   LANAEASFRRSLNNILGRPVTTQGRPNGEAAA"
FT   gene            524354..524830
FT                   /locus_tag="FRAAL0454"
FT   CDS_pept        524354..524830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0454"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59129.1"
FT                   /translation="MRRGVGREPGSVPQMWRYYTTLQADGHLTTRLRAEHAALTLFAIH
FT                   QQSLPRSAHELGSGLGTAVKELRASGKFSPDAVDRRFGTAATATSLSEASYHLRGLVRQ
FT                   LRQIQRPLDYTALFWDLVTWQNPARLGQVRRRWAAQYFLNRDSEGAASASASRR"
FT   gene            524900..526042
FT                   /locus_tag="FRAAL0455"
FT   CDS_pept        524900..526042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0455"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59130.1"
FT                   /translation="MRCYIDVHILQTVPPSNINRDDAGTPKQAVYGGVKRARVSSQAWK
FT                   RATRTAFADQIDQAQLGSRTKKISALLAERLTARGKLDPEASTRVATSLLADLGIKPGK
FT                   KAAETAYLLFFGRPQLERLIDRIEPDLPRLIGLDDTELTAALKNVSVKEVLGAGHPIDV
FT                   ALFGRMVADLPALNVDAATQVAHALSTHAAEVEFDYYTAVDDENPKEDTGAGMIGTVEF
FT                   QSATLYRFATVGLHQLVENLGGDTEAAVEALRVFLTAFTTSMPTGHENSFAHRTTPNLL
FT                   TVAVRGDQPVNLVSAFEQPVRAQQKGVLDGSIDQFAKELTTAADLWGLRPELIASTYRT
FT                   PGDAERGKVLTSALGPSAPLTKVIETVADAARARLASAAR"
FT   gene            526039..526866
FT                   /locus_tag="FRAAL0456"
FT   CDS_pept        526039..526866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0456"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTG7"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59131.1"
FT                   /translation="MTGADSRCLVLRLAGPVQSWGGGSMFNRRETLTEPTKSGLIGLLA
FT                   AAEGRRRADPIEDLLALTFGVRTDQPGTLLRDYHTVSDYRGRPLPSAAVTAKGLQKLTS
FT                   PAKYTHVTERFYLQDAVFVVAVAAPEPVLTTLVDAIRAPAFPLALGRRSCPPTQPLLLT
FT                   PDDESGRPLWPGDVVDVLTAVPWAAGAAQIDRLAALRRQPRTVDLPVTVDDPHGEDVRM
FT                   DLPTTFDPRTRAFSSRRVHQTWVHLPPPYDLVDLDDDAGGTGSSHDPFALLGW"
FT   gene            526796..527632
FT                   /locus_tag="FRAAL0457"
FT   CDS_pept        526796..527632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0457"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59132.1"
FT                   /translation="MLTSTTTPAAPDLPMIRSLCWDGEPPMTYLSRVWLNPLRTGAQSL
FT                   LRNPERMHAAVLGGLTRQPVTERVLWRLETGRPHRAEVLILTESRPSWEHLIEQAGWPN
FT                   AEDPQALVRDYQPLLDRIQAGREFAFRLRANPVAATRQPTSPSVAQKERLAGPRPRGVR
FT                   VAHRTAGQQLAWFTDRVDRWGFTPLTTETGPAVQLNARERLTFRKRPPDGGNGGKNKGH
FT                   QVVLSTATFDGALRVVDPDLARRALLSGVGAAKAYGCGLLTLAPLAPVTTPPSEGG"
FT   gene            527634..528626
FT                   /locus_tag="FRAAL0458"
FT   CDS_pept        527634..528626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0458"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTG5"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59133.1"
FT                   /translation="MWWSSDPLDLHRIEDRVSSLYVEKCHIDRDDNAVVLINRERTVRV
FT                   PAAFVATLLIGPGTRVTHAAVRLLADSGTAVCWVGDRGVRMYAGGLGPSRGSGLLMRQA
FT                   YLVTRTQHRLAVARRMYGMRFPDDDVSTATMQQLRGREGARIKKVYRAHAERTGVSWNR
FT                   RVYTHGDPFADGDDINRLLSAGHSCLYGICHAAIIGIGASPALGFVHTGSAISFVLDIA
FT                   DLYKAEYTIPLAFDLAAAGTVEERDIRTAFRDKVADGHLMGRIVRDLKDLLLDGEQAET
FT                   GDQDALHLWDELDGQVPGGVNWAADYANGWDDAISLGIVGPDVDGQTDP"
FT   gene            528638..528904
FT                   /locus_tag="FRAAL0459"
FT   CDS_pept        528638..528904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0459"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR010152"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59134.1"
FT                   /translation="MLIAASEGLRGHLTRWMIEIAAGVFVGNPSARVRDRVWTLLAQRI
FT                   GEGQAVMIEPADNEQGWAVRTAGRDRGYPIDYDGLILFARPHR"
FT   gene            complement(529566..529808)
FT                   /locus_tag="FRAAL0460"
FT   CDS_pept        complement(529566..529808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0460"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59135.1"
FT                   /translation="MRTIPARAGTTNEHPTADSRVQDDPRAGGDDASVSFVSAFKIGRS
FT                   PRGRGRPDGPRHGHVGRGTIPARAGTTGRRRCRVK"
FT   gene            complement(530571..531980)
FT                   /locus_tag="FRAAL0462"
FT   CDS_pept        complement(530571..531980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0462"
FT                   /product="Putative transposase"
FT                   /function="2.1.3 : DNA recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59137.1"
FT                   /translation="MEIDLLVRRFRCLTADCGRVTFTEQVVGLTSPRARFTPLADRMIE
FT                   AIGLALAGRAGARLADRMGLPAGRNTLLRRVRALSDPQIGVVTVLGVDDFALRRGRVYG
FT                   TVLIDLDRHRPVDLLPDREAGTFAGWLGEHPGTQVICRDRAGAYADGARTGAPDAVQVA
FT                   DRFHLWSNLAGYVETTVARHRSCLAQPPATEGEIADEPQADLDSAVAAARDAQFEQRAF
FT                   VRHARERYTAIQELKAAGVGIKPIAARLGLARGTVRKYYRATSVEDVLAKTRDGRGSIL
FT                   RPWELYLTERVNAGITNGSQLFREIRGQGYSGSKAVVLAYLRPLRASGANAAPAARPAP
FT                   KVRTVTRWILTHPEHLNEQETLALKTILTRCQDLQKTAGHVTAFAQMLTGRHGDRLNDW
FT                   IAAVDADDLPELHRFTRGLLRDHDAVLNGLTLPHSSGQVEGAVNRIKMIERQMYGRANF
FT                   DLLRKRVLLAT"
FT   gene            complement(531941..532189)
FT                   /locus_tag="FRAAL0463"
FT   CDS_pept        complement(531941..532189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0463"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59138.1"
FT                   /translation="MSGASLTLGFSFRIWRVSLSIGWTGLVIGCGCGLVFEELLVGALG
FT                   VGWSRSGSTGGIAAGWSMQRSRVLRWRSICWFDGSAA"
FT   gene            532269..532565
FT                   /locus_tag="FRAAL0464"
FT   CDS_pept        532269..532565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0464"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59139.1"
FT                   /translation="MTELDRQSCPDCRRIVYERGPARMIEAAQVPDQVPPVEEFFRALE
FT                   KKPAGRLQLADIAVRLEEYARRGSLPVPRELNDLADGLREIKVGKFATREDFL"
FT   gene            complement(532579..532899)
FT                   /locus_tag="FRAAL0465"
FT   CDS_pept        complement(532579..532899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0465"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59140.1"
FT                   /translation="MGVIRGARIAGASWPRFPVLDCGASMLSVFVQLDAELEAQSVKIL
FT                   GYGRYPHVAVAFEDLVDGGPADPETSSEVRLVNSGGSQSSMKATQYLMSYASIGQVAGP
FT                   VR"
FT   gene            533079..533552
FT                   /locus_tag="FRAAL0466"
FT   CDS_pept        533079..533552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0466"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59141.1"
FT                   /translation="MNADTIVDTTPHRAQILQSAELYDISTQSCHATRHTEAPPALIDI
FT                   ELNTNASLEAAGLDVTVTCQCAIRGDDQSSVADIGLTILVRYAFPADFNRAAFSIDQEG
FT                   ELHVLRASFPYLREGIQSLAARLGIPGIALGPIAVDIPSQSGDIDLDVDVPEE"
FT   gene            533596..533802
FT                   /locus_tag="FRAAL0467"
FT   CDS_pept        533596..533802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0467"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59142.1"
FT                   /translation="MARPSPPRQLRQRQRRATRGREATPVLLHRFIKDALPGADRCLAP
FT                   AGRLQTGVSWPGRSAARRRRDVL"
FT   gene            533799..536327
FT                   /locus_tag="FRAAL0468"
FT   CDS_pept        533799..536327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0468"
FT                   /product="putative ATP/GTP binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RTF6"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59143.1"
FT                   /translation="MTVVAGCSSMGTGDPVAGDTAGSPAAVDFFVSYTGVDQGWAEWVA
FT                   WQLEAAGYTVRIQAWDFGAGAHFVTEMHQAAQTAARTVAVLSAAYVSSAFAEAEWQAAW
FT                   ATDPSGRDRKLLVFRVEDCDRPGLLAQTVSVDLFGVDRTAAASRLVAAVRGERGKPTAE
FT                   PLFPGGPVRPARSASGVEPVFPGRLPAAWNVPGRNRLFTGRAAQLEQVRTGLGGGPVAV
FT                   SALYGMGGVGKTQLAVEYAWRHAADYSLVWWVDAEQTTLLAEKIAALARPLGLPTGGPV
FT                   PEVAAAVLAALGRRAGWLLVFDNADNPAALRRWLPAGPGHILITSRHPGWDPLAATVDV
FT                   DLFPRGESVALLTRRLPDLNPTIADQLAEELGDLPLALAQAAAYLTHTRLDPAVYLHRF
FT                   RARRQTFLGKGDDLLYAGRVDTCWSISLDRLRDETPAAVALLELCALLAPEPIPLTLLT
FT                   DHAHLLDPPLAAVTAGADPTVDLDDTLAAAGDYSLARRLGDTLVVHRLVQTVIAGQLTA
FT                   DRHQTLTDTTGRLLDATLDPLSAEDPGSWPVWAALGPHLLHAHARLTGPTDPHQLRHHA
FT                   DGFCFHLYAHGDYPAAHTLATRLHQDTRDQCGPDHPATLTTAYTLAITLGALGDHEGAR
FT                   VLDEDTLARRRRILGDDHPNTLISAGNLAIRLADLGDVRGARVLDEDPLTRRRRVLGDD
FT                   HPDTLTSAGNLAATLAALGDVRGARVLDEDPLTRRRRVLGDDHPHTLTSAHSLAVRLAD
FT                   TGELPAACDLGRVVVEGRRRMLGVDHPDTLDSAHNLAVYLADAGRVGQARVLLVDTAAR
FT                   LGRVLGEGHPSTQLTARVLAELPADPPVEG"
FT   gene            complement(536571..536816)
FT                   /locus_tag="FRAAL0469"
FT   CDS_pept        complement(536571..536816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59144.1"
FT                   /translation="MDHPHPRRETLEKADATSRLAALTLILHAHPTTGTGQLPDLDEQT
FT                   LTTLTPTWISLLDDGSYQLTEAAADHLPIYQPTPPA"
FT   gene            complement(536741..537205)
FT                   /locus_tag="FRAAL0470"
FT   CDS_pept        complement(536741..537205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0470"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59145.1"
FT                   /translation="MPVTTTTAPEPAAKAPGRPRLTAPQAAAARQLVDFATALPVSPDA
FT                   RLLALTLAVRAVRDGQANLTSMDLRRYPDPHGVLGELATGGWIVGDDLGRIVDADPAEA
FT                   FRLQAAGFAGLVDPPMGTLMRSRVSGWITRTLAAKPLKKPTPPAGSPPSP"
FT   gene            537378..537872
FT                   /locus_tag="FRAAL0471"
FT   CDS_pept        537378..537872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0471"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59146.1"
FT                   /translation="MEDDAQRACAGAHGAGLGGAWMTGIEIAVGVLAAWALRKARRVGD
FT                   RVDGGIDTETDRLVDAGMDRVHDLVSGVLGENDPVLARVEEETQDTGEVSVRTRQRLAL
FT                   ALEDATDHDPAFAAALAQAVEQVRAATTSGGGHSLVGNLFTGPTAIQQGDHNRQTNTFT
FT                   G"
FT   gene            537878..541516
FT                   /locus_tag="FRAAL0472"
FT   CDS_pept        537878..541516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0472"
FT                   /product="Putative ATP/GTP binding protein (partial match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RTF2"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59147.1"
FT                   /translation="MTGLPAPDPDPDPDPDQFGQSGSLPDWPEKNNVVVGPAAIQQGDR
FT                   NVQHNYFPGRRVVAWPALVGQPPTLASAFQPRQGLQDQIVAAHRRGEDVVLAQGGRGRG
FT                   AGTRVLAGGGGVGKSQLAAWFAHQAVERGTELVVWVAAGSAEQVITTYARAAVRVGVPG
FT                   AVGADPTADAQALLEWLHTTDRSWLVVLDDITDPAGLTGWWPPHRPSGWTVATTRLRDV
FT                   TLASAGRRTVEVDVYTPAESAAYLTGRLTGEGKAHLLDAGVAGLGVAVGHLPLALSHAA
FT                   AYMIAQEEGCAAYLARYTAGEERLDEVMPASADPDGYGRPVAVTLLLALDAADAADPPG
FT                   LARPALAVASVCDPDGHPDTLWATPAVLGYLTAHRTATAGRSVTADRPVTADQARKTLR
FT                   LLHRYGLLTHTSTDDVRAVRVHALTARAARETTIAPAAPVRAAADGLLALWPDGDHTTP
FT                   DLAAALRANTTTLAAVAGDLLWQPDGHRLLFRAGDSLVNAGLYAPAVAYRQQIADQAAR
FT                   LLGDEHPTTLTARVNLAFSYGQGGRTVEAISLGERVVADCVRLLGGEHPDTLAARGNLA
FT                   FFCGQGGRIVEAISLGERVVADYVRLLGDEHPATLAARGNLALSYRQAGRIVEAISIEE
FT                   RLVADRERLLSGEHPDTLRARGNLAFSYGQVGRIVEAISLGERVVADAERLLGDEHPNT
FT                   LTARANLAVSYLQAGRTAEAISIFERVVADCVRLLGDEHPDTLTARVNLAFSYGQGGRT
FT                   DEAISIEERVVADCVRLLGDEHPSTLTARVTLAGSYRQGGWTAEGINIFERLVADCVRL
FT                   LGGEHPTTLTARATLAFSYGQVGWIVEAISLGERVVADAERLLGDEHPNTLTARANLAA
FT                   SYRQAGRTDEAINIKERVVADSERLLGDEHPDTLTARVTLAVSYGQAGRTAEAINIFER
FT                   LVADCARLLGAEHPDTLRARATLAVSYGQVGRTVEAISIEERVIADSARLFGDEHPATL
FT                   TARATLAASYRQAGRTVEAISLGERVVADCARLFGAEHPTTLRARADLAASYRLAGRTV
FT                   EAISIEERVIADRERLLGDEHPATLTARANLAASYGQAGRTAEAISLGERVAADAARLL
FT                   GAEHPTTLTARNNLAASYRLAGRIAEAISIFERVVADCARLLGDEHPDTLTARANLAAS
FT                   YGQAGRTAEAISILERVVADREQLLGDEHPDTVAAADALRAWQADA"
FT   gene            541543..542073
FT                   /locus_tag="FRAAL0473"
FT   CDS_pept        541543..542073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0473"
FT                   /product="Putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTF1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59148.1"
FT                   /translation="MSVWGTTLRTKDEAAAKRITEAFAPEAIDTLLKDAKATGTPIDGV
FT                   DGLLNQMTKAVLERALQVEMTDHLGYEVGDPAGQGTGNSRNGRSTKTVSTRNGPVEIEV
FT                   PRDRNGSFEPTIVPKRARRIGNLDDTILSLYSRGMTTRDIEAHLREVYGVLWGARTRPP
FT                   VVAWGFRRLVRIR"
FT   gene            complement(542048..542707)
FT                   /locus_tag="FRAAL0474"
FT   CDS_pept        complement(542048..542707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0474"
FT                   /product="putative Transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTF0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59149.1"
FT                   /translation="MSASTIRRVLKSLGLPPAPRRQTDTTWRQFLRTQASTMLAVDFFH
FT                   VDCAVTLRRLYCFIVLEVGTRTVHIVGVTVHPDGPWTTQQIRNLLMDLGDRAADFQFLV
FT                   RDRAGQFTASFDAVLTDAGITAVKIPPRTPRANAYAERFVRTVRNEATDRILIFGERHL
FT                   RTVLAEYAAHYNGRRPHRGRDLQPPRPDHPIADLTQERIKRRPVLGGLINEYERAA"
FT   gene            complement(542753..543079)
FT                   /locus_tag="FRAAL0475"
FT   CDS_pept        complement(542753..543079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0475"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59150.1"
FT                   /translation="MCGWLVLLGRSSASKDIELLVLRHEVAVLRRTQPKPRWDWADRAV
FT                   LAALVRLLPTTLRAHRLITPGTILRWHRRLITRKWTHPQRMGRPPVSAEIAALIEQFAT
FT                   ENAT"
FT   gene            complement(543271..543822)
FT                   /locus_tag="FRAAL0476"
FT   CDS_pept        complement(543271..543822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0476"
FT                   /product="Putative acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTE8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59151.1"
FT                   /translation="MSQLHFGEPTAIVVPTVITERLLLRCWQARDVEPYAAVAADPEMG
FT                   RYTGSPRSEAAVWDMEAALTGHWHLRGFGMWALEDRTTGEFIGRAGLYEEPGWPGIEAA
FT                   WTIRHDRWGQGLATEAGRAVLIFAFTHVKADQIISLINPQNAASIRVATKLGFHDAGTQ
FT                   FRDDAIYTITHTTWANHLSR"
FT   gene            complement(543819..544784)
FT                   /locus_tag="FRAAL0477"
FT   CDS_pept        complement(543819..544784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0477"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59152.1"
FT                   /translation="MAAAGTSAAVLYRRLAVAHPDQLTVEEMEADLDGIAATYMATPHS
FT                   VMFPRILAGWRQAEEFLEGRGGLKVRRQVTSFAGRYGFYLARLALNTGDDETARRFGML
FT                   AFQHGDDADDALLTGTVAGLRSSLAYFAGTFQTAAEIAAAARPTADPYARARLAAFEAR
FT                   AWAALGDETRTRHALDAMADDLFTVPQFGEPPFDDEAVAGFTAVALSRLGEGTEAEPHA
FT                   RRSITILEEQGIRRPEDYGGSLAALATALLNRPKPDPEEAARIMGRTLDLLASYPTRTV
FT                   LHRAHEVAAQLDPYATLPVVADVRERLHHVRPLLALPAAR"
FT   gene            complement(544841..545014)
FT                   /locus_tag="FRAAL0478"
FT   CDS_pept        complement(544841..545014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0478"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59153.1"
FT                   /translation="MPTDEGGGNFVSATDLENLHGEFPGFREPVALGAAAWSRRPPPQC
FT                   SFREVDDLPLWG"
FT   gene            complement(545181..545402)
FT                   /locus_tag="FRAAL0479"
FT   CDS_pept        complement(545181..545402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0479"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59154.1"
FT                   /translation="MIFSLELRAAFPKLLAVRITAAAPPLRFNFHFLRKALRFQFLSLT
FT                   IDLASTERTRNPWHHTANKTSPKYPESP"
FT   gene            545580..546002
FT                   /pseudo
FT                   /locus_tag="FRAAL0480"
FT   CDS_pept        545580..546002
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0480"
FT                   /product="putative phage integrase (fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAJ59155.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            545885..546862
FT                   /pseudo
FT                   /locus_tag="FRAAL0481"
FT   CDS_pept        545885..546862
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0481"
FT                   /product="putative integrase XerD family protein
FT                   (fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAJ59156.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(546902..546977)
FT                   /locus_tag="FRAALtRNA46"
FT   tRNA            complement(546902..546977)
FT                   /locus_tag="FRAALtRNA46"
FT                   /product="tRNA-Lys"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            547196..548044
FT                   /locus_tag="FRAAL0482"
FT   CDS_pept        547196..548044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0482"
FT                   /product="hypothetical protein; putative
FT                   Arylesterase-related"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59157.1"
FT                   /translation="MSEISPAAESEPSAVSAGHTIVFIHGLWLSSASWQPWIDRFAALG
FT                   HTGLAPEWPGMDRDLEALRGEPTADNHIGVTEVTDSYAKIVAALPEAPILVGHSFGGLI
FT                   VQLLLDRGLGAAGVAISPAPVKGVLRLPLATLRSSAPVLTKPATRGRLVGLTADQWFYA
FT                   FANTVSRAESDELYARLQVPTPGRPLWQAAFANVNPKAVSKVDFTKADRAPLLVLGNGA
FT                   DHTVPASVSRETYTRQRRSGAITAYHEFPGRPHLTASVPGWEEVADLALAWALAPRSGE
FT                   V"
FT   gene            complement(548111..549397)
FT                   /locus_tag="FRAAL0483"
FT   CDS_pept        complement(548111..549397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0483"
FT                   /product="putative cytochrome P450"
FT                   /EC_number="1.14.15.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTE3"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59158.1"
FT                   /translation="MTPPSHDRVDTWAPAPAAPELAAPAPGFPDHPGAVRLYGPRFQHN
FT                   PAQMYREMRRVHGPVAPILLDGDIPAWLVLGYRELHYVTSNPELYGRDPRRWNAWDRVP
FT                   PDWPLLPVVGYQPYTMHLEGAEFERRSAIMNDVLGDVDLFELRALCERTCDELIDGFAG
FT                   RGEADLITEYAQSMPMLLIGRMIGIPEAGLPELLASMNAATDGSGPEAVAGHSRFVAII
FT                   NALLADRRARPRPDLPSAMLGHPGKLTDEEASWDLLLIVGIGQQPITDWIGNTLRLMLT
FT                   DSRFAVTLSGGRRSVGQALNEVLWEDTPLQNMSGRWAVRSTQLAGQHIQAGDMLVLSCA
FT                   AANGDPQVRPDSFEGPGGNHAHMSFGHGEHRCPYPAQEIAETIVRGAVEVLLDRLPDAV
FT                   LAVSPDALVWRPSPWMRGLSALPVHFSPS"
FT   gene            complement(549394..549930)
FT                   /locus_tag="FRAAL0484"
FT   CDS_pept        complement(549394..549930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0484"
FT                   /product="Putative ATP/GTP-binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59159.1"
FT                   /translation="MIVGGFGVGKTTMVRAVSEIRPLSTEETMTGAGIGIDDTGGVREK
FT                   TTTTVAFDFGRISLNERMVLYLFGAPGQERFWFLWDRLFAGTLGAVVLVDTRRVADSWY
FT                   AIDRLEHHGMPFIVARNNFGEPAHTLPQLREALSLSDDVPLVDCDARHRASSKSVLIAL
FT                   VNHLYALSTAQEISP"
FT   gene            complement(550001..550360)
FT                   /locus_tag="FRAAL0485"
FT   CDS_pept        complement(550001..550360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59160.1"
FT                   /translation="MIREAIDGENPDRLYTVTGGRSRADENAFDLVTLIVSESDPAPGM
FT                   QSEHAAILRMCRSPVAVVELAAELKLPVSVVKILLCDLLDTGRIAARHPSASVVRTPLP
FT                   HPEILKQVLVGLKKL"
FT   gene            complement(550357..550776)
FT                   /locus_tag="FRAAL0486"
FT   CDS_pept        complement(550357..550776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59161.1"
FT                   /translation="MNTRTRDLDWLLENLLERTPGTRHALVLSKDGLKLCRSSGLSVDS
FT                   ADQLAAIASGIQSLSHGASIEFGDGSGGVRQSMTEFHGGLLFIIEAGQGAHLAVVATDD
FT                   ADAGVIGHNMNELVEQIGDYLSAPPREAAPGFAAS"
FT   gene            complement(550805..553048)
FT                   /locus_tag="FRAAL0487"
FT   CDS_pept        complement(550805..553048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0487"
FT                   /product="putative sensor-like histidine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTD9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59162.1"
FT                   /translation="MPTHASPTRRGPRTPTDQTPVVLLIAVLAVVGAAAWANAATAGPD
FT                   RPPVIVSAVVATAVVLLTVALALGRGRAVRRLRSQVTDLENRLAGAQSQVQTQNVRAAQ
FT                   LADQILPAVVKRLRDGASPEAALAEIVEIGEIGAAGTAYPGLARGTDPAVGTVIGQEAG
FT                   VIGRGDAAASPEIGDGDREARETHRRILRTLATEIGRGERMRAAAMSACANAAGRVQAL
FT                   ATSMLADLREMEERHDEEVFGDLLRLDHATAQAGRLADSIAVLTGARTGRRWTKPIVME
FT                   SILRGAVGRISAYQRVRLHSTSTVAVAGYAAEGVMHALAELMDNATSFSPPSEEVHVYV
FT                   EEVQAGIVVTIEDGGLVMGPAALRRAEAAVSAEPLDLTTLSGTRLGLAVVGVLARKHGL
FT                   MVSFRPSSRGGTGVVVMIPRRLITQPRPNPTAAGLPVGEIVGAAAAAPGAAARADAAGA
FT                   APRGTSSRLERPTSVEPSLDGASFDGASFDGTSFNGTRSTGTGSTGTGLAGTGLAGSGL
FT                   AGSGLADGAAAGRPAAPGTPVLGSPTGPVARADVPGEPAAPVPPAPREVLPKRRRGETM
FT                   ANAVGRVPVPPAPTRASPPADAGARFGAFRRATRGERTDAVASNTSSAPDRPGVGRPPS
FT                   PPPPLPPSRTGPTALPGPTVPPGPTVPPRPTVPPRPTVPPGPTVPPRPVEPHPASGGSA
FT                   GGPDESTWFQTRGGTDADGPTPGGSTFDGLTPDGTRFDGPTPGGLPTWRNGNS"
FT   gene            complement(553062..553265)
FT                   /locus_tag="FRAAL0488"
FT   CDS_pept        complement(553062..553265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0488"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59163.1"
FT                   /translation="MTGRIGNVLPAGSRDRRDRRHRRDRGVETVAVTNLGLRTSHQAER
FT                   AHGRRRALGGHPDRPRVLATSR"
FT   gene            553408..553551
FT                   /locus_tag="FRAAL0489"
FT   CDS_pept        553408..553551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0489"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59164.2"
FT                   /translation="MSPNGPRGCPEPSGDKGTVPQEAAVPPMRERPRFPSAVLNAPFAR
FT                   PP"
FT   gene            complement(553736..553990)
FT                   /gene="rpsR"
FT                   /locus_tag="FRAAL0490"
FT   CDS_pept        complement(553736..553990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="FRAAL0490"
FT                   /product="30S ribosomal protein S18-2"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structural protein"
FT                   /db_xref="GOA:Q0RTD6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RTD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59165.1"
FT                   /translation="MPTRRTPKPGQRKKPNILRERGITYVDYKDVALLRQFISDRGKIR
FT                   ARRITGLTPRQHREVTRAIKNAREMALLPYPGPAAARGR"
FT   gene            554366..555190
FT                   /locus_tag="FRAAL0491"
FT   CDS_pept        554366..555190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0491"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59166.1"
FT                   /translation="MAVSKRPALFERPARFDDLRAVGLGLTTTGVLVRFDVDSPSRLVR
FT                   IGQVSGLVGGDTSLIGIDYRVQNGRLYGVGNLGGIYVINTSTAVATRVSHLTVALSGTA
FT                   FDVDFDPAANRLRIISNTGQSLRHNIDDRAGVPPIGTTVVDTPLNYPPTAIVATGLTGA
FT                   AYTNNDLDPATSTTLFGVDTTLGQVVVGSPSHSGQLVATGQFGLPLGGDAGFDIFTRRS
FT                   GGRAVGNRAFATLLVGSTYRLAEIDPLTGRIRVHGSFPSNAQVADIAIPPNQ"
FT   gene            complement(555426..558113)
FT                   /locus_tag="FRAAL0492"
FT   CDS_pept        complement(555426..558113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0492"
FT                   /product="Putative transcriptional accessory protein"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTD4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59167.1"
FT                   /translation="MTTTSVPQRSIHQRIAEELGVRQGQVTAAVDLLDGGATVPFIARY
FT                   RKEATGTLDDTQLRTLEERLRYLRELEERRTAVLESIRAQGKLDDALEAQILAADSKAR
FT                   LEDIYLPYKPKRRTKAQIAREAGLEPLADALLGDPTRDPHGTASGYVDPDKGVADAGAA
FT                   LEGARAILVERFGEDADLIGALREQMWSRGVLVSRVREGKEEAGAKFADYFDFSEPFTS
FT                   LPSHRILAAFRGEKEEILDLTLEPDTPTEPGTPPAPGPTSYEVRIAETFGISDAGRAAD
FT                   RWLLDTVRWAWRTRILVHLGVDLRMRLWTAAEDTAVRVFAANLRDLLLAAPAGSRATMG
FT                   LDPGYRTGVKVAVVDATGKVVATDTIHPHVPARRWDESIATLARLAAEHHVDLISIGNG
FT                   TASRETDKLADDLIRRHPELSLTKVTVSEAGASVYSASAYAAAELPGMDVSLRGAVSIA
FT                   RRLQDPLAELVKIDPKSIGVGQYQHDLAEARLSSSLDAVVEDCVNAVGVDVNTASAPLL
FT                   TRVSGIGAGLAENLVRHRDANGPFRTREALRDVPRLGPKAFEQCAGFLRIRGGDDPLDG
FT                   SSVHPESYPVVRRILAATGGELSTLIGNGAVLRSLKPTEFVDDTVGLPTVTDILAELEK
FT                   PGRDPRPAFRTAAFTEGIETLADLVPGMTLEGTVTNVAAFGAFVDVGVHQDGLVHVSAM
FT                   SKNFVSDPREVAKPGDIVTVKVLDVDIPRKRISLTLRLDDEVGAPAGGAGRGSGRRGGD
FT                   GGGTGSSGGNAGSSSSGGGERRAPGGGAGTGREGARRGEAGGERRDGAGGRGRGGGRDG
FT                   SAGRAPGTRGGGRGGAGGPGGVGSGGGAGANRGGGGAGANRGGGGGRGGRGGAPDGAIA
FT                   DALRRAGIVTGDRITLDGSDRKRS"
FT   gene            complement(558457..558621)
FT                   /locus_tag="FRAAL0493"
FT   CDS_pept        complement(558457..558621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0493"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59168.1"
FT                   /translation="MANAADVGRAQGRTADWTESTLPSHSAALRCNPAADDPGMDEPYP
FT                   AGPRLECEK"
FT   gene            558547..559659
FT                   /locus_tag="FRAAL0494"
FT   CDS_pept        558547..559659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0494"
FT                   /product="Putative anti-sigma factor kinase"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTD2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR025847"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59169.1"
FT                   /translation="MTRESTLGPVRGPALSPTNVGGIRHEAFLFRGDVGFLSATRDFIL
FT                   AGLAADEDVLVAVTPARMALLRAALDRAARRVTFLDLTEVGRNPARIIPAWQEFLDLGI
FT                   ERGRTVRGIGEPLWSGRPVPEQRECMLHEALLNEAFTAPPAWRLRCPYEVTALDAVTAD
FT                   EVWQTHPVVVDGGLGRVSARYRPPAPAVSAVPAVSAVPAASAVPAASAVPAVSAVPAVS
FT                   AAAVADAAAATRPDPLAEPLPDLGRPRAEVAFGPDDLGLVRAAATRAALADGLGEDRAG
FT                   DLELAVHEVATNSVRHGGGRGIVRFWTADGCLVCEVTDSGRLADRLAGRRRPDLDLSGG
FT                   RGLWLVNQLCDLVQLRSGSVGTTVRMFMYV"
FT   gene            559706..560494
FT                   /locus_tag="FRAAL0495"
FT   CDS_pept        559706..560494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0495"
FT                   /product="conserved hypothetical protein; putative
FT                   Peptidoglycan binding domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59170.1"
FT                   /translation="MTSTERTRVGRGAWPTDGRGGTVAPAGGTTAAGPGRCYGVGAGEA
FT                   PPAGSTDADILAVRAGITAISRALNWHGGPGTPVPTDGRFTAATKAAVIAFQDKLQPVI
FT                   NRDMYLPAVEHSPAGFVNKETSYALFMPIADRYALKYTVPRGLLRGIATIESNWDPGAV
FT                   GYWTNSDFGLCQWNTTLPDITTARALDPFWALDSTAKAMRERFDSDRWGHNWLYVIAAH
FT                   NVPTWAAQWAQGELSATDPADKPKLDRMNGYVSNVLARVW"
FT   gene            complement(560543..560968)
FT                   /locus_tag="FRAAL0496"
FT   CDS_pept        complement(560543..560968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59171.1"
FT                   /translation="MVQRAVPGTPEQVVAKLADYQGARARSWPENVSEYRVLAGGTGAG
FT                   SRIAYRLQATRKRVRQVDATVSAPDATTLVEADQNSSLQTRWQVAPGAGEQQSTVTATT
FT                   TWDGAGGVGGFFERTFAPIGIRRLNTAVLEKVTAPAD"
FT   gene            560943..561302
FT                   /locus_tag="FRAAL0497"
FT   CDS_pept        560943..561302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0497"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59172.1"
FT                   /translation="MPGTARWTTTLICPTAVPPSLPGVRTGQIRTPAADAAPGPPEHRS
FT                   RMAGSITQSYIAGTLAAALEPAAATGAPDEGVGRFLAHGQVIRVPSGTSSSSARARTAA
FT                   RWLRRTAPVSSPPVH"
FT   gene            561257..562450
FT                   /locus_tag="FRAAL0498"
FT   CDS_pept        561257..562450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0498"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTC8"
FT                   /db_xref="InterPro:IPR025519"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59173.1"
FT                   /translation="MAPQDRPRFVTAGALMLLTAGLATYAGATVAAMGLHRSTLGAVPF
FT                   GLFYATVIFFIDRSVLLSTRPYRYGPGGTVRVGRAGPSTAMRIFIAVCAALLVGETLLL
FT                   RIFAPSIAPRVTQIRQEDLGRVLRGWDANQLGEQRVLRDDLAARQRALDSAHALVTGKT
FT                   AEVNCQLTGGDGCLSGEGAVYRIKLGELGAATAAVTTATGQRDAAQARLDVFDQSRDAR
FT                   RAHFRDQQTATVDAADDLLIREKAFWRLTAADHSVLLWRTVLTLLLLGIDLGPLMFKRT
FT                   LEQTELRRRERLVQWQGETTDEVDAQQIGQTARRRGELAEALAEGAAARYGQYVRRRDE
FT                   IGTSLRVAADLADADVGREQIRIDRDSRIRDLRVRYRVPDPAPAPDPADRAHRATPS"
FT   gene            complement(562607..563152)
FT                   /locus_tag="FRAAL0499"
FT   CDS_pept        complement(562607..563152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0499"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59174.1"
FT                   /translation="MTSTSPDEIRSDIEATRARLGDDLDELSDRVSPQKVAGRTAQDLR
FT                   RRVSSATESVRPKVAATTGTATEKARHTADQAKATVRRQLDAHPQVAATAQRARDTAGS
FT                   AAGSASQTVHRQLDSHPQVAAKVSQVRDTAGGAVSAGRQKAAANPRATGTAAAAAAALL
FT                   ALLLVVLRHRRQDTDTLD"
FT   gene            complement(563232..563798)
FT                   /locus_tag="FRAAL0500"
FT   CDS_pept        complement(563232..563798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0500"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTC6"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59175.1"
FT                   /translation="MTSTYRQQPDVAADPYPNDVTAYRGGVDVDAPDESTQVLRAPTAA
FT                   TSTAPPSSARHDGEGHSAGRGSTGQLVSEVVTDISTLFRQEVALAKAEVREEAKKAGKG
FT                   AGMFAGAGGAGYFALLFALLAVMFGLGEVMALGWAALIITVVLGAVAAVLALKGRSTVR
FT                   KVHPAPTQTVETLREDVQWAQSRRR"
FT   gene            complement(563891..565030)
FT                   /locus_tag="FRAAL0501"
FT   CDS_pept        complement(563891..565030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0501"
FT                   /product="putative tRNA processing ribonuclease"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTC5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59176.1"
FT                   /translation="MEIAMNPSVLLGHRHDDRGHRTSRPVREVDPPEHGPTSVPARGWL
FT                   AVAKRVKSQLAILSIPLIASGVAFWAILSIFPAAIAVLTVYGLVASPQTVSNQIADLSD
FT                   SLSPSTSAVLRDWLNGIVSTNHSGLGLGLLLSLAGVLWAVSSGTQNLIKAVTVAFEQEE
FT                   TRGPVRLRGLAVAMSLGGVVVAVLIVGGITAGGSLLSHHVADGTVRVVLTVVQWLVLAM
FT                   IVMAAVATLYRFGPAHTPANWRWASVGAVVATVALIVASVAFSFYVRAFGHYNKTYGAL
FT                   GGVVILMLWLYYAVTVVLIGALLNAEAAREATGATAPETYPEASPVGVRRPWDRPEADD
FT                   EAETEAETDRDGETATDRPAGAAERIRTGIRFRRRERRG"
FT   gene            complement(565135..566019)
FT                   /locus_tag="FRAAL0502"
FT   CDS_pept        complement(565135..566019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0502"
FT                   /product="putative Epoxide hydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTC4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59177.1"
FT                   /translation="MEDEAPAWFEAALDSRPQRHETEVAGATISYRCWGTAGRPAIVLV
FT                   HGGAAHAGWWDHIAPLIPSEYRVVALDLSGHGDSDRREDYTLSTWAAEVIAVIDHAGIT
FT                   SPPIIIGHSMGGWVTITTAAEYPDRVAGIVVVDSPVQEFTPEERAARDRTAFGPLRVYP
FT                   TATDALARFRTVPDQPSSLPFIIDHIARGSIGSVQGGWTWKFDPKVFGNRTPSPEVLRK
FT                   VHCRVALFRAEYGLLTPDIGVQMYNLLGRVAPVIEIPLAGHHVMLDRPLLLVTGIRTIL
FT                   ADWEHSSPQERTD"
FT   gene            complement(566288..567886)
FT                   /locus_tag="FRAAL0503"
FT   CDS_pept        complement(566288..567886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0503"
FT                   /product="hypothetical protein; putative Thiamine-phosphate
FT                   kinase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023911"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59178.1"
FT                   /translation="MTVDGAPAAPPRRARVARPVLDALLSAGAAPPVTAEPVDTLAIWG
FT                   DRRTLERLPPYRIEQAGDAATLAAHRELASPAIHTGYEGSGGDDARTDDSRADGPWTDD
FT                   SRADEPPADDPWTDESREGDPRTVVLIARAVGAGGDGAVLGGIRLGPLWPGPDLGAWYC
FT                   DRLAVSARARHEFPGVAAALVRAAAARAEDCGVLRLEAVVRPELERFFGRLGWSTAGPA
FT                   ALARGPGVLMRWPIDRIAALVASCKAPLGAVLAGLRPGGPGFVGDDGAPLPGSDIVAAC
FT                   DAIMPTMVERDPHWAGWCGALVSINDLAAMGATPIGLLDAVAGTTASHVARVLGGLRAA
FT                   ADAYGVQILGGHSQFGVRAALAVTALGRAAHPVPAGGGLPGHAVSLTVDLGGGWRPGYT
FT                   GRQWDSAASRRTAELQAMVRMPGRHRPSAAKDVSMAGIAGTLGMLAEASGCAAEVDVAA
FT                   VPRPAGVTMGDWLTCFPGYGMITADRADRPVPPTGPAASARCGILLPGAGVTLRWPDGV
FT                   RTPVLAGHITGLGHA"
FT   gene            complement(568043..568711)
FT                   /locus_tag="FRAAL0504"
FT   CDS_pept        complement(568043..568711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0504"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR023847"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59179.1"
FT                   /translation="MLDCNACNKGISAARADRRYRPRFVVDDDRRRPGETGDRRSVQSR
FT                   PGPDRGAFMELTENDRQSLNEVPHPALPPGSNLYGSTKIFPDYQARDGECYLTLVHGIA
FT                   HESSVSFVAILQATRALRKGFESVLYFYGPGAMNTMATRGFPHTGDSAFPGEHNINHQI
FT                   ETFIKEGGKVYVCRFGLSLHGLREEDVIDGVIPAHPLDIQDCVIEYTRRGAIINSTFMF
FT                   "
FT   gene            569014..569907
FT                   /locus_tag="FRAAL0505"
FT   CDS_pept        569014..569907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0505"
FT                   /product="hypothetical protein; putative
FT                   Metallo-phosphoesterase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59180.1"
FT                   /translation="MRYAVLADLHGRPGALRRILAAAAAAGADEIVCLGDYLEAKVPRR
FT                   LHDPSRFWPLERVVDPDPALWARLAGIRRVLGNQELRIRELLRPEQVPADLAVLLDAPE
FT                   RDRLHGLVGLHGHQIRWSTGRAEPVGGPGEPGEPGEPVGTAADGSADGRALLVPVAADV
FT                   PRVPVVVVGHTHQEAMFEIVWSDTALGGDAADGPAVGLVRPAGMPGPAGMPDPAGVVRT
FT                   LPPVEPGRPVAVRLDAGPSGGGPSGGGPFDTGRTDTGRFGAATLVVNVGPARGKPSHWL
FT                   LYDTDRGEISFQRAVR"
FT   gene            complement(570507..570662)
FT                   /locus_tag="FRAAL0506"
FT   CDS_pept        complement(570507..570662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0506"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59181.1"
FT                   /translation="MPKTGYRPRSTAQLRPTLVIYETSHIYPNVAEPVGKATLTVGSFI
FT                   RITVDT"
FT   gene            570944..572074
FT                   /locus_tag="FRAAL0507"
FT   CDS_pept        570944..572074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0507"
FT                   /product="putative aminotransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTB9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59182.1"
FT                   /translation="MHVPAARIVFSPEDRAEIASATIEILSTGAMTLGAHTNEFESAFA
FT                   AAHRAPFAVAVSSGTAALEIILRSLDVQGADVVVPTNTFAATAFAVIRAGATPVFADVS
FT                   PDTFALTARDVAAAVTPNTRAVVLVHIGGLIASDVAELAAFCADRGLALVEDAAHAHGC
FT                   RHGEGYAGSFGVAGAFSFYPTKLITSGEGGMIVTADPAIHEAALVYRDQGKAGFLGNTH
FT                   IKQGYAWRLSEMHAVTGKVHLRHLDEFLTTRAAVAARYDAALDALDGATRLRVPAGDVC
FT                   NYYKYIVLPRPGVDRARLKKELKERYGVSLSGEVYEAPLHQQPVFSDYAGRSLPVAEDL
FT                   CARHVCLPIHSDMTDAEADHVVTSFAAALASLDLDG"
FT   gene            572131..573060
FT                   /locus_tag="FRAAL0508"
FT   CDS_pept        572131..573060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0508"
FT                   /product="putative UDP-glucose 4-epimerase"
FT                   /function="1.1.1.23 : Galactose degradation"
FT                   /EC_number="5.1.3.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8611559; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTB8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59183.1"
FT                   /translation="MDRLLDAGHDVLSLDVDSRPSDPRATSRQVDVLDLPGLTAALAGV
FT                   EAVFHVAGMSNVDFAYADPARTVRLNVEGTGNVCEAARQAGVARVLFASTVWVYGAVGE
FT                   RADPAPLTEDAEITLGRAGHVYTSTKLAAELLLHSYQQTYGLPFTILRYGIPYGPGMRD
FT                   ELVLARFVRKALDGESLTVAGDGQQFRNYVFVRDLADAHVLALRPEAENATIALEGAEA
FT                   VSVLEMAQAVCSHFPGTAIEHVPARPGDFRGREVSAQRALDLLGWQPTTPFTDGVRQYI
FT                   EWYLANRRPPAQAVQPVDDLDVSAASSE"
FT   gene            573123..574406
FT                   /locus_tag="FRAAL0509"
FT   CDS_pept        573123..574406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0509"
FT                   /product="Putative glycosyl transferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RTB7"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59184.1"
FT                   /translation="MAAPATRPSAEGRPAGVVSAVERLGDGGAPDRGGPVIDGVAVEEA
FT                   ATAALLAGAASRQPATRRGSALLLSGSLGMGHDVMAEACGASLTRRGFTARTADSLRML
FT                   GGRNGSRGEKVFRGMIAVPGLYDAVHFSQMRTGGRLALAIERASSRYVVPALRQELTEQ
FT                   PTDLVISIFATGAAATSRVKPEFPGLVTAVFSTDCCVHRLWVHDNTDLYLVTSQTAARY
FT                   VRRFAPNALVSVVPTPVREPFYDPPTQEEARAALGIPADAPCVLLMSGSWGLGPLVEGA
FT                   AAMAAAGIYVLAVAGRNKPLAARLTALAERQHKVIPFGFTDRIPALMAASDLVVTSSGD
FT                   TCSEARVIGRDLLLIDVVPGHGRDNLQKELERGHAEVTNTDPVSLTRSALACLDRVKPP
FT                   SDRVAIGPQAWEQAFGSALAQIGFGAHW"
FT   gene            574646..575905
FT                   /locus_tag="FRAAL0510"
FT   CDS_pept        574646..575905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0510"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTB6"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59185.1"
FT                   /translation="MSKALALGLPTAMVSAALYGVAPLVQARAARREEESSGLGLGLLA
FT                   RLVLRPLWLLGLAVEATSFLLEVYALSVAPVAMVAPVMALDMIIFTLLAQRVLGERISL
FT                   TGWLGVGSMVAGVGLLAYAFASRAEVGSAASTDVLLAFLVLGLVFALVCAFLANVAAAR
FT                   SMIAGAAFGFGAAAGVCYAIATLATRQIGLAVNDRREGQSALADLLTTPTPYVLVLFSV
FT                   LALGLQQRGLQGRAAVIAFPVTSGVSAFLPVTLGLTLFGEPAPDGAQRVAFVVAMVMVA
FT                   AGIAALGRDRMAANRSVDELEGAAARPADGPGSGRPDPDRPGSGRPDVDRPDAGRPDVG
FT                   RPDSRRADSDGLDPAERLDPERLDSEPLDSGRMDLERVDLGRSERVDSDLGRRTRHGDD
FT                   PWNPPGRGDGGPGAALREFG"
FT   gene            complement(576109..576960)
FT                   /locus_tag="FRAAL0511"
FT   CDS_pept        complement(576109..576960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0511"
FT                   /product="putative DNA hydrolase"
FT                   /function="1.2.2 : DNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RTB5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59186.1"
FT                   /translation="MTSRVPRMPSPPESSAATTAHDHPDPGPDTDAHADTHADADTHAG
FT                   GGAGGLPAEVVPVALSVDLVLLTVREEQLQVLLVRRGIEPYRDRWALPGGFVRPGEDLA
FT                   AAAVRELAEETGLRHPPAHLEQLATYGAPDRDPRGRVVTVAFLALAPQSRTPIAGTDAA
FT                   ASRWEPVSTQGCGSRLAFDHAAILADGLERARAKIEYSAAAAAFCEDEFTVAELRRIYE
FT                   LVWNSRLDPRNFHRKVTGTAGFLVPTGRFTSRDGGRPAELYRRGDATVLHPAMLRPVPR
FT                   LP"
FT   gene            577021..578061
FT                   /locus_tag="FRAAL0512"
FT   CDS_pept        577021..578061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59187.1"
FT                   /translation="MADISRAPFLCHLRGTPTAYIRHQRGTAVAHEGVGLVFWYRPRTA
FT                   VISEVPVDDRELAVLFHARTADFQDVAVQATVTYRIADPVLAATRLDFGIDPELGTWRE
FT                   KPLDQLAGMINESAQEYASDLLARTSLTTALAEGVPVIRERVTTGLRGDARLVQTGVSV
FT                   VGVRVVAVRPAPEVEKALRTPTREQIQTEADRATYGRRALAVEQERRIAENELQSKIEL
FT                   AVRAERLVTQEGANEQRRMTEQAAAARIAAAAEAERAQTAARSQAERVRVEAAAQAEAL
FT                   RLVGQAEADAEAARVAAVTGLDSSAVVALAVRDLADHLPAIGALTITPDVVTEAVARFV
FT                   RAGTPR"
FT   gene            578058..578981
FT                   /locus_tag="FRAAL0513"
FT   CDS_pept        578058..578981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59188.1"
FT                   /translation="MSLAPRAVLVHRRTEYAELMDRHGTRGQAAFFLATRGRELAEVQA
FT                   AHDGAEAARRVVAAAIPPHWRRGEVERTDLDRFLFAPDDVVVCVGQDGLVANVAKYLDG
FT                   QLVLGINAEPARTPGVLVRHTPGEAAALLRTVEGSPTDPARGLGRLLRELTMVEARSDD
FT                   GQRLVALNEIYVGHPGHQTARYRLRVPGEGVPVTERQASSGLLVGTGTGATGWCRSVWA
FT                   QRRSELPLPAPTAGALAWFVREAWPSPATGTACTEGRLTGPARLEVLVEADRMVVFGDG
FT                   IEADTIELSWGQQLTVGVADRRLRLA"
FT   gene            complement(579248..579415)
FT                   /locus_tag="FRAAL0514"
FT   CDS_pept        complement(579248..579415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0514"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59189.1"
FT                   /translation="MIAVATATTNLLNTPMKDQRVERVRRAALSAYVDGKITFAQANLR
FT                   VSKALERFGV"
FT   gene            complement(579412..579657)
FT                   /locus_tag="FRAAL0515"
FT   CDS_pept        complement(579412..579657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0515"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59190.1"
FT                   /translation="MLSPAGRRASGRLGGRRCRHPVAVLAENGAPARAPGTPAPSITVG
FT                   PPLDPPGIDVPDGSPATGTTPRSTRVAPSCSPATGR"
FT   gene            complement(579582..579788)
FT                   /locus_tag="FRAAL0516"
FT   CDS_pept        complement(579582..579788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0516"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59191.1"
FT                   /translation="MIIFDGAATRVRRRNATVRVTVLPAALDPGGHQAAPTASVRITAC
FT                   CRPPAGGPRAGSVAGGAAIPSPS"
FT   gene            complement(580361..580603)
FT                   /locus_tag="FRAAL0517"
FT   CDS_pept        complement(580361..580603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59192.1"
FT                   /translation="MTRFAKPDLGGPAELAWRKSSYSNGAGGMCVEVAPLGEGIVVRDS
FT                   KNPSGPVLAFSAAEWDAFLAGARDGEFDRTRVGQA"
FT   gene            complement(580600..581592)
FT                   /locus_tag="FRAAL0518"
FT   CDS_pept        complement(580600..581592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0518"
FT                   /product="putative DNA-binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RTA8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59193.1"
FT                   /translation="MAPASTACKSFCNSFATQSCALCMRSGDPVAGCTHHSQQTEGLAM
FT                   ATSGGPTVRRRRLGAELRRLREAADVSVDEVCQLLRCSVSKVSRMENGRVPVRTRDVSD
FT                   LLNLYGVTEGERRDALMALARESRRHGWWHSYHDVVPAWFEIYIGLEGDAASIQVYEPQ
FT                   LVHGLLQTGDYARQVIRADDPEADDEEVERKIALRMDRQRRLTAPDHPRLWVVLDEAVL
FT                   RREIGGRAVMRDQLDFLAKRSELPNVTIQVLPFAVGAHAGLGSAFSILGFPDSEDHEVV
FT                   YIEEAAGSLYIERAAEVRRYKLKMNHLLAAALRPEESTQMILSVVKELR"
FT   gene            complement(581662..581889)
FT                   /locus_tag="FRAAL0519"
FT   CDS_pept        complement(581662..581889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0519"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59194.1"
FT                   /translation="MAAALTMAAHAVVVVVAIRTSGTDGKDRTAGADRGAEVARVSGAC
FT                   GRTDAAQPVVPARLPDRRLGPHTIAIDYSP"
FT   gene            582116..582394
FT                   /locus_tag="FRAAL0520"
FT   CDS_pept        582116..582394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0520"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59195.1"
FT                   /translation="MATRRFQVYDGDGELVATFLEWEAAHSWAHRRAGEAGTRNPVQVE
FT                   DRVERRTWTIDADQCRLTVWRRRVEYGYCGRPEARPVGAGRKHVYVS"
FT   gene            complement(582382..583542)
FT                   /locus_tag="FRAAL0521"
FT   CDS_pept        complement(582382..583542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0521"
FT                   /product="Putative membrane protein (partial); putative
FT                   signaling pathway G-protein coupled receptor protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59196.1"
FT                   /translation="MFGYRVPAPDQAMLISGGKNRGGMPFKVITGHGGFILPFFRKVRF
FT                   LTLAMCEAEVTETCVTHQGISLNVRAVIAFKVGNDSESIVNAGQRFLSDQGQMAVLTGR
FT                   IFSGHLRSIIGSMTVEEIIRDRQKLATEVLDGSKAEMARIGLTVDALQIQSIDDGRLGY
FT                   IAAIAAPHNAAIQRQAQIAQAEANQAAAEAEQRSQRAQAEYARQTSIVQAQYRAEIDRA
FT                   QAEAAQAGPLAQAQAEVAVTAARTELAEREAQLRQQQLVTEVVKPAEAEAERVRVLALA
FT                   EAEKMRIQAEAAASHNRVALDRMLIDQLPEIVRQAASGLAGANVTVLNGAEGIGEIASG
FT                   LVGQGVAIFEALRAGVRQPAYAADGQDTGASTGHPGIATARPVQET"
FT   gene            complement(583558..583713)
FT                   /locus_tag="FRAAL0522"
FT   CDS_pept        complement(583558..583713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0522"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59197.1"
FT                   /translation="MRVRGGIETFLALSDTPLPKGASVLVIGTRGPRTVEVVPWLDPAA
FT                   VFGGDL"
FT   gene            complement(583973..584233)
FT                   /locus_tag="FRAAL0523"
FT   CDS_pept        complement(583973..584233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0523"
FT                   /product="Putative araC-family transcriptional regulator
FT                   (partial)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTA3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59198.1"
FT                   /translation="MRPIQMGACPVVASTWLTAERVTLACRLLERGEQRLDLVARASGL
FT                   GTAAGLRVALRRRTGLTPTAYRRRFEPGRRAPEPAGPAVSG"
FT   gene            complement(584230..584865)
FT                   /locus_tag="FRAAL0524"
FT   CDS_pept        complement(584230..584865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0524"
FT                   /product="putative Protein-glutamate methylesterase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 3280143; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTA2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59199.1"
FT                   /translation="MLVDSAPDLAVIAEAGTGAQAVRLARHLRPDVVLMDIRMPIMDGL
FT                   EAMRIIAADPGTAATRVLVVTTFDQDEHVFAALRGGASGFVLKDTRPEDLLAAIRIVAA
FT                   GDALLTPSVTRRLIAEFAQRPQRPVRGEELTRLTEREREVLVQVAAGLSNSEIARRLFV
FT                   GVTTVKTHVSRLLTKLGARDRAQLVVAAYESGVAVPGAGPLAPGSDHS"
FT   gene            complement(585024..586778)
FT                   /locus_tag="FRAAL0525"
FT   CDS_pept        complement(585024..586778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0525"
FT                   /product="putative two-component system sensor kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RTA1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59200.1"
FT                   /translation="MDAASCPSTSRSWAGLSSIAGTILGSFEGWTRRGSSDRRRMARVI
FT                   LWRDAGSRPRRLPSHSMALITPAPSGPTHRPARMQEFAGSAKVGRSAGPGAVDVAVALA
FT                   SFALFSLPAALTPTVSPGADAYGSTSHILLFGVLCAAPLIAARRWPLPVLASVTAVLCA
FT                   AAFAGVRFTPLVSNAGPALGVAVLTVADHHPRRTSLAASTAAVASIAVSTAVAMRLYPD
FT                   QEQDLVQALIAAAAWLVGDAFRTRRRYRCRLALEARREAAERERRIRAEERLRVARDVH
FT                   DVVSHTLSLIAVRSGVARLLEDPREAREALSVIETTSRSALDEVRRVLRSTRQEIEEPS
FT                   GRSDATLTARPEREPTGVSSRADQTVPSSGQPERAESVQADERFSADAPARITEPKLAD
FT                   LDHLVAGLQRHGFRTSYRRTGTERCYLPVLETSVYRIVQEALTNVVRHADATEAQVSVH
FT                   DGPRELVVRIVDDGRTSPGSPEHHHSEATPADRRIDQARCGLADAPTGSASGRPEPDTA
FT                   SGPGLGLVGMRERAELFAGTLSAGPHEGGGFAVVARFPLPPAIVMADRSCERPPTSVQP
FT                   CPAGQDAV"
FT   gene            586985..587431
FT                   /locus_tag="FRAAL0526"
FT   CDS_pept        586985..587431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0526"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RTA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RTA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59201.1"
FT                   /translation="MRAEHSAGTAAWGPHLAVLILAGVLATGSWLRRRRPSTEWRARGA
FT                   LPAPLGRPAARRITLTALAVRRRPAELWRLAVLAASAVVLLYLCWRAGLQVLGGLDPNF
FT                   TANAWGGPSYAGAMACHYLDLAVIGAVVAGLLDRALLPVPAGRG"
FT   gene            complement(587613..587993)
FT                   /locus_tag="FRAAL0527"
FT   CDS_pept        complement(587613..587993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0527"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59202.1"
FT                   /translation="MHLSSGQSREQCGSHCTGSTAQVDHDLAGPANGLAEGLSDEELGT
FT                   APGHEHTGLYRDPQAAELDPAEKVFQGLAGDPAVNHRGQLGGCPGSAHKQPGLVLGEDA
FT                   ACGTQPMNDVGQRERRRKGRRQ"
FT   gene            588018..588440
FT                   /locus_tag="FRAAL0528"
FT   CDS_pept        588018..588440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0528"
FT                   /product="Putative adenine-specific methylase (partial)"
FT                   /function="2.1.2 : DNA restriction/modification"
FT                   /EC_number="2.1.1.72"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT98"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59203.1"
FT                   /translation="MRCARRNVAGGGLVHEGDLFAALPRTLRGRVDLLVVNAPYVPTDA
FT                   IGLMPPEAREHEPRLALDGGTDGLDVLRRVVVDAPSWLAPGGSLLFETSAQQSPALADA
FT                   VTQTGLIVRIVQSEESAATVVVAVSRAADAATSDRR"
FT   gene            complement(588567..589907)
FT                   /locus_tag="FRAAL0529"
FT   CDS_pept        complement(588567..589907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0529"
FT                   /product="Putative oxidoreductase (partial match)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT97"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59204.1"
FT                   /translation="MTAFESWSTFITPRIQFLTRFETWSYADGPIGLDPTCGGRMGNRT
FT                   VLVSGAGIAGTTLAYWLSWHGFRPTVVERGLWQRTSGSPVDVRGPALRVAERMGVLARL
FT                   RAAATNVTGMRFVDAAGRSVGRVNLRALARATGGGDVELPRGALATILQAASAEHAEFV
FT                   FGDSIAGLAQDDHGVDVTFDHGRSRRFDLVIGADGLHSAVRRLAFGPDANFVRHLGLYI
FT                   ATVPFNGPIEHRREVVMHNTPGRAVALHPSASGPIAFFAFRRPDLADFNHRDIDQHRTL
FT                   LAGAYAAGSWRTPELLARAQASEDLYFDAVSRVDVPAWSTGRITLVGDAASCVSLFGDG
FT                   SSLAMAGAFALAEELAATPDDHRSALRRYEARHRHLVEPRQRGVDQAAHLLIPTTWTGI
FT                   HARNAATRLWPAAAAAGWLGSRLTTAGRGPRPPRRTPARPAGATSPG"
FT   gene            590006..590707
FT                   /locus_tag="FRAAL0530"
FT   CDS_pept        590006..590707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0530"
FT                   /product="Putative HTH-type transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT96"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59205.1"
FT                   /translation="MRHGARRVTVEDVALGANIGKGTVYLHWETREKLFAAVFDRAVAR
FT                   AISELLVAMRTQPSTCLPHQFAHDYFLAVMHRPLLRGLLLSDPELLGRLARQHDPAWDE
FT                   RHHLVSERYFRLLAEYGVLRAELGADEVAYAFQATFEGFVRAEDELAGGENAAPRAAAQ
FT                   PAVATLERRADLLARTVELAFENSRPVTADELRSLAADVVDLFTDLVDRRGFTDLVDLV
FT                   DHAELGAPAVS"
FT   gene            complement(590777..591787)
FT                   /locus_tag="FRAAL0531"
FT   CDS_pept        complement(590777..591787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0531"
FT                   /product="putative Tyrosinase (Monophenol monooxygenase)"
FT                   /function="1.1.3.15 : Phenylalanine, tyrosine degradation"
FT                   /EC_number="1.14.18.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT95"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59206.1"
FT                   /translation="MAAIRRDILRDDKARADYIRGVKLLKHEPTTLTTDRFGIPDRARP
FT                   VYTYDLFVIWHVLAMNTAVPPGGDAGTRNAAHRGPVFLPWHRVMLRWLEAHLQRVLGDP
FT                   DFGLPYWDWALDGTPPAPGGVANPAASVLWRDTPDGFGGQGSPVRGGAFAFDRADPTSF
FT                   RVRIATGSSGALRQVTERGLARSFGQNAPFGSPRLPRTGDVRAAYDTRADPSLADYDRP
FT                   PFDVSSRGFRNRLEGFTGPGLHNQVHLWVGGDMAPASSPNDPVFFVHHCNVDRLWEGWM
FT                   SRNGRRYQPDMTAPPTLLGHRIDDPLVSPFTPASKPDTPGGVLDVSAIYTYDVLP"
FT   gene            complement(591789..592196)
FT                   /locus_tag="FRAAL0532"
FT   CDS_pept        complement(591789..592196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0532"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59207.1"
FT                   /translation="MPSDTADPIQPAFLATYLAGLPQPEHDHTGPARSVREDDFDGHHV
FT                   VVTTTYEITVDGRPLDVHIGLSNDGSAHCHGLPAYQLPSLVDLVRVLIRTFPEEFSPQP
FT                   SPAEGHEGHDHEGHDHGGSGHMHGDETPGGR"
FT   gene            592585..592902
FT                   /locus_tag="FRAAL0533"
FT   CDS_pept        592585..592902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59208.1"
FT                   /translation="MVVRIDGRVVADSHDSRTLREASYPPVQYIPIADVDQSVLRRSDT
FT                   TSYCPYKGDASYYSVETSDGTTLRDVIWTYETPYPAVADIAGRIAFYADRVEITLPDAA
FT                   A"
FT   gene            592984..593478
FT                   /gene="adk"
FT                   /locus_tag="FRAAL0534"
FT   CDS_pept        592984..593478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="FRAAL0534"
FT                   /product="Adenylate kinase (ATP-AMP transphosphorylase)"
FT                   /EC_number="2.7.4.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT92"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59209.1"
FT                   /translation="MRRIVILGRGGAGKSTLARRLGEITGIPVIELDQLFWRPGPRPSL
FT                   PQEWTRTEREAVRADAWIMDGDLGPYEVSLDRFAAADTIVVLDFSLPRCAWRALRRSRE
FT                   NLEFWRWTIGYRRRSLPQVMARISARRAAAKLHVVRNPRELERFVALVAATAGRGTTSA
FT                   S"
FT   gene            complement(593543..594496)
FT                   /gene="pip"
FT                   /locus_tag="FRAAL0535"
FT   CDS_pept        complement(593543..594496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="FRAAL0535"
FT                   /product="proline iminopeptidase (PIP) (Prolyl
FT                   aminopeptidase) (PAP)"
FT                   /function="1.1.3.6 : Proline utilization"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.11.5"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11298241; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT91"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59210.1"
FT                   /translation="MGSQYPPIEPYDTGMLDVGDGNLVYWEVCGNPAGRPALVVHGGPG
FT                   SGCSPQARRWFDPDRYRIVLFDQRGCGRSTPHAGDHDTDLRHNTTGHLLADMELLREHL
FT                   GIDRWLLYGASWGSTLTLAYAERHPSRVSEIVLVAVTMTRRRDVDWLYRGVARYFPAEW
FT                   ERFRDALPPADRDGDLVAGYARLLADPDPAVRQRAADDWCAWEDAVISLESNGQPGAYG
FT                   SRPQRARLALARICSHYFAHGAWLDEGVLLRDAGRLAGIPGVLIHGRHDLGGPFRVAWE
FT                   LARAWPDADLVPITDSGHTGSETLGRYLRDALDRLA"
FT   gene            complement(594511..595386)
FT                   /locus_tag="FRAAL0536"
FT   CDS_pept        complement(594511..595386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0536"
FT                   /product="Putative acetyltransferase, GnaT family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT90"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59211.1"
FT                   /translation="MSRTRQAGGGRMTGTGHGTGQPAGTSTATTLPGQETLLASWAALA
FT                   RTSPGAGLVHPPGAVAAVFPDWAPLNNAILLDDVATASTVAGRLGRLYAAAGVDTWALW
FT                   IPSRATDLDTPDEPRTVDGPCTVDGPCTVDGLTRDTTTLVMRAVLQPGPTRTDGVVRTS
FT                   IDAAIRAADGPLDAAELGLPEAVPGLAAWALLRDGAAVAGAWSFRHGADCGIYTVGTAP
FT                   AWRRRGLATALLRHVLAVAEQDGARTATLQSTPMARGLYAALGFLPVGRYEEWVHTIGI
FT                   PTTAGTHRDQ"
FT   gene            595550..596077
FT                   /locus_tag="FRAAL0537"
FT   CDS_pept        595550..596077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0537"
FT                   /product="putative marR-family transcriptional regulator"
FT                   /function="3.1.2.3 : Repressor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT89"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59212.1"
FT                   /translation="MAPGGPALFRLVRFWSRRWTATAAAGEDVDRTGHVLVLTAIDAAS
FT                   RDGRAQIVDVAAELGLDRSNASRMLAAAVSAGLVTKSVSPADARRAELAVTPAGAELLA
FT                   AARAWQERMFAGLVADWPADDARRFAAYLARLAAETTPATTTTPTATTTPTATTTPTAA
FT                   MPATRTALEVRP"
FT   gene            596074..596439
FT                   /locus_tag="FRAAL0538"
FT   CDS_pept        596074..596439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0538"
FT                   /product="conserved hypothetical protein; putative
FT                   Extradiol ring-cleavage dioxygenase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59213.1"
FT                   /translation="MTVVLNHTIVPVADKERSARLLAALLGVEAGEPAGPFVPVRVNDE
FT                   LTLDFDDRLGARPGHYAFLVDDVTFDVALDQARRSGLAWGSAPRTVDRQINHLGGGRGV
FT                   YIRDPDGIAYEFFTTVP"
FT   gene            596499..597506
FT                   /locus_tag="FRAAL0539"
FT   CDS_pept        596499..597506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0539"
FT                   /product="conserved hypothetical protein, putative
FT                   esterase/lipase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RT87"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59214.1"
FT                   /translation="MTEFAIAPPSAVRNDSLVTTGLDCLAETEAFNAAFEAKAGSVPDR
FT                   SRGVDAATLATLRRNRVGGEAPPVRLAEAHDRQVEVDGVRVGLRVFVPPVVEGAYLHIH
FT                   GGAWMFGSADGQDEQLWDLARTARLAVLSVDYRLAPEHPYPAALDDCERAALWLVRNAA
FT                   VEFGTDRLLIGGESAGAHLSLTSLLRLRDRHAITGAFRAAHLTFGPYDLSMTPSQRLFG
FT                   SRRLVSNTDSLRGTYDAFVPGRTPEQRRDPDVSPLYADLAGMPAARFVVGTDDPLRDDS
FT                   LFMAARWRAAGLPVELEVVAGAMHGFTLFPLTITERELRRQTEFLSGAGRSLRP"
FT   gene            597503..598213
FT                   /locus_tag="FRAAL0540"
FT   CDS_pept        597503..598213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0540"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59215.1"
FT                   /translation="MTRTDRLYALMEELRAVAPRPVTVPVLARRLEVSERTVQRDLKAL
FT                   AETGAPVYSATGRGGGWSVDPAMTLPPIGFTPGEALAVAAALAAAEGSAPFADGIRGAM
FT                   RKIAASLSGQALVEAHELAAQIVALPSRLDPTVRGAVEWALTRREVLSLSYLDAGGRTS
FT                   EREVEPAGLLAAEGRWYLVAWCRLRRAPRGFRLDRIRAAAPTGQAAPRRELADLLGSAA
FT                   TGAVTPAVLDSLAP"
FT   gene            complement(598330..599031)
FT                   /locus_tag="FRAAL0541"
FT   CDS_pept        complement(598330..599031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0541"
FT                   /product="putative dehydrogenase/oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT85"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59216.1"
FT                   /translation="MATHLARAGVGVIGTYNSRKDEADRLVAELEGQGVPAAALQLDVG
FT                   NSGDFARFAADVRTTLAGLGAERLDYLVNNAGVGLYAPFTETTEDQFDELFRIHVKAPF
FT                   FLTQTLLPLLADGGRILNVSSGLARFTHPGTSAYAAAKGAIEVLTRYQAKELGERGIRV
FT                   NVLVPGAIATDFGGGRLRDNAQLNEAVASAIPLGRVGEAEDIGAAVPLILADGFGWANG
FT                   TRIELSGGQNL"
FT   gene            599293..600150
FT                   /locus_tag="FRAAL0542"
FT   CDS_pept        599293..600150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0542"
FT                   /product="putative DNA-binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RT84"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59217.1"
FT                   /translation="MQRQELGAFLRHRRELLRPSDVGLVAGGRRRAPGLRRDEVAVLAD
FT                   MSTDYYERIEQGRGPRPSPSMLGAIARALRLTLDERDHVYLLAGHEAPPRHCSLGYADA
FT                   GLMCVLDALAPTVPALISDDLANVVAQNPLNIALLGPIARAPGRAHNFLWRWFTDGELR
FT                   ARYLADQHDTLGREHVADLRVTLGRRHEDEAVRSLVAELSAASAEFREVWARQEVAVRR
FT                   TTRKVLLHPEVGRLDLECDAVVSPPSGQRLVLFRPQPGSGAGERLEMLAVLGTQTFLAP
FT                   GRSR"
FT   gene            complement(600165..601421)
FT                   /locus_tag="FRAAL0543"
FT   CDS_pept        complement(600165..601421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59218.1"
FT                   /translation="MPDPTITDVDGPPPARSAHGETDKTEVTEEERLRRWRLVLGAPAA
FT                   PAFGPARALSKRDADIDAALGALYDADGESGGGRGRERSAGLGGSAPAVTRWLGDIRDY
FT                   FPSSVVQVLQHDAVQRLGLAQLLMEPELLAAAEPDVHLVGTLLSLRSALPERTRETARR
FT                   VVRMVVEDIERRLAQSLRSAVFGALNRGERARTPRLPDVDWNRTILANLRNYQPEQRTV
FT                   IVDRLVGYQRARRVAALRDVILLIDQSGSMASSVVYAGVLGASLASIRSLSTRLVVFDT
FT                   SVVDLTDSLDDPVDVLFGVQLGGGTDIDRAVGYGASLVRRPADTVLILISDLIEGADQS
FT                   SLIARLRALVDAGVTVIVLLALSDDGAPAYDHQLAATCAQLGAPAFACTPDRFPELLAT
FT                   ALRREEVGRWAALHGLVPA"
FT   gene            complement(601414..603888)
FT                   /locus_tag="FRAAL0544"
FT   CDS_pept        complement(601414..603888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59219.1"
FT                   /translation="MTVTVLGVRHHGPGSARAVRAALAELDPDLVLVEGPPEGDSALVH
FT                   VGALTPPVALTAYAVDEPRDAAFWPLAEFSPEWQALLHGRAAGVPTRFIDLPFGHDLAL
FT                   RRRDAETDSDEDTGEADEDTAEADEDTGEADEDTVPELVADPLGWLAFAAGHDDPERFW
FT                   EDLVEHRRPASTPTAGAGGRSPGLELFAAVAEAMAALRDPDHQPGPAASRGAHARREDL
FT                   REAHMRLAIRAASTGADAAARVAVLCGAWHVPALTGRTGRTTVAADRELLRGIRPVRTT
FT                   TTWVPWTHALLSADSGYGAGVTSPGWYHHLWTAPDQVGARWVARVAALLRAADLPASTA
FT                   SVVETVRLAEALAAVRERAVPGLTELTDAVLAGLCAGDPVPLAVVREQLVIGDVVGAVG
FT                   PDVPTVPLAADVARTQKRLRLAPTPVEKPLRLDLRRELDRERSALLHRLRLLDVDWGIP
FT                   TATSSTGTFAEGWTLAWQPTFALALVVAARHGATVEDAAGDVVAERTRAAPDLAAITGL
FT                   FEQVVLADLPAALEAVRAGLEQRAATTGDVAHLMLALAPLARVHRYGDVRGTDTGLVVG
FT                   LTTSLMTRICAGLPAACASLDDDAADAMVAAVDTADTAFGLVADPEHVARWHAAVGVAA
FT                   TTAGGNPLVAGRCTRILSDAGRLTPAAVATRLARALSAAGGAPADAAHWLAGFLGRSGA
FT                   VLARDPAMLSLVDTWLAGLDGDAFTVVLAPLRRTFAAFAGPERRLIGERVRSGLPRPTA
FT                   EPPGGAVTDPADTTSPGGSPATARPPTGAIPPGDGPAWDPARVAIVLPTLAALLGPDSA
FT                   APARAEKEHTDA"
FT   gene            complement(603888..605054)
FT                   /locus_tag="FRAAL0545"
FT   CDS_pept        complement(603888..605054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RT81"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59220.1"
FT                   /translation="MTLAPPSTSTATPDAGPTADSAPLLRPHAEQAYAGELAALTAADT
FT                   RARPPSWRLSPWAVVTYLLGGVLDDGTVISPKYIGSRRLVEVAVATLATDRALLLLGSP
FT                   GTAKSWLSEHLAAAVSGDSTLVVQGTAGTSEDAVRYGWNYARLIAEGPSPDALVPSPVM
FT                   RAMTRGSIARVEELTRMGAEVQDALITVLSEKTLPVPELASEVQAVAGFAVIATANDRD
FT                   RGVNEMSSALRRRFNTVVLPLPASEDAEVEIVTRRVADLGRTLALPDEPPAASEVRRVV
FT                   QIFRELRAGVTRDGRTTLKSPTATLSTAEAISVITGGITLATHFGDGRLRAEDVAAGLV
FT                   DAVIKDPATDPVAWREYLEGVVRDRKGWSDLYRACRDLDDDARVPGDA"
FT   gene            complement(605051..608347)
FT                   /locus_tag="FRAAL0546"
FT   CDS_pept        complement(605051..608347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0546"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RT80"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59221.1"
FT                   /translation="MRRAKVSEVGARLPGMSLTPVSAMSREAVLTLAPDSASARAGERL
FT                   GSTGSWSGLGMSNQALWGACRGSGATPYRVVVLAGAEFASSCTCPSRKFPCKHALGLLF
FT                   LACATPAALATGDDPPDWAADWLARRAARAARAASPEAAPGEAAGTGKAGTGGKAGASR
FT                   ATSAARTQARRDARVDAGVAELSRWLVDLAHGGLGAAQVQPASWWEATAARMVDAQAPG
FT                   LAEVVRDMARIAAAGGPDWPARLTDRLGRLYLLCEGWSRRGEVEPALVDVVRDRIGFSR
FT                   SASDVLAGERLAGPIDVLGERRFTTGKLQGRRQWLRVAGIERLALLVSYGSAKEVPPPT
FT                   LPVLTRFQGEVAAYPGRRPTRVALAETTTAPQPLAELAATDAGDTAGTWQEALAALTPA
FT                   LAADPWADPVAFIVRQLTVLPPIVDAHDKAPTGAVARKGRQGGGPSGVGARWLLRDRAG
FT                   QALALTADAGARWGWHLLALGGGHPLDLGVEWDGFELVPLAAMASRPQPGTGLPARTGA
FT                   ADPGAEPPVPPGQPACPRPTPGWSSLVDAAVVGSARAAVPVLPDLGDAAGSGGGGGGSG
FT                   GGGGAAGDGPSRATALLRTAALASCARRAGLFAADARALPAPAPAPPERAPTLAPHAAR
FT                   IVEGALDGSEPAGTRQYLELMAEGGWRVPDLLLAGLLSRGLRDVAMRAPIARVLGERGR
FT                   WLAGLHPDGRWVSRTRLADWPTASALERRTLVQELRQRDPAAAVTLLRGPADDPPFAAF
FT                   DAAGAAERLAFCEALRVGLGPWDVDLLDHALDDRREDIRRAAVEIALLLPGSGLQARAE
FT                   ARTEGMITSRRGRLGGRHHLEITLPAECSDEMRRDGISDTDPASLILGRATAGEVMFVA
FT                   ELARVDPTVWTRRTGLTPKEFLDAGADLPGARHPVSQLLSIGLLPAVLRHGDPGWVAAL
FT                   LPHVGRTYQGRLLACLAEPARTQALTDTLRGLRLDSYHPDGSAARDQDGRWPDTPVERI
FT                   TTLLTAVPGPWSEPFSRAVWTALTALSARHYSDDYLLRELIGPMAWALHPDTDLGDPNP
FT                   DRPRYLDLDGRTRLTTILGARRRLRAALTDPPPADTAPTRPVHLPQEGPS"
FT   gene            complement(608608..609342)
FT                   /locus_tag="FRAAL0547"
FT   CDS_pept        complement(608608..609342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0547"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RT79"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59222.1"
FT                   /translation="MPRKSDEVTPAEATRLKAYWYAVRKPRVVHEAGVVSLVLPGYFGD
FT                   RPWSIPVDRVAVRDLSSAPLPEDIPEPEPVLARQVTIPYLFTTGPLTLPNLLLMFTEPQ
FT                   RVPPLRLGPAMAPNSDLPFGYFSTRAERGAYVDGVKLRAENPSGLERLLLAAGATRFED
FT                   PVRWLHRHRQVITDAADQERITRRRVVGHRIQLAAAFVWVPAVIGEEALIGEDGPLWAI
FT                   LLLLAVIVGTLGLSVVGGRRAR"
FT   gene            609550..611100
FT                   /locus_tag="FRAAL0548"
FT   CDS_pept        609550..611100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0548"
FT                   /product="putative oxidoreductase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT78"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59223.1"
FT                   /translation="MVDTRRAETGVGSPVDPQVLFRFNSDRGQPLFSLFAQRCHMTWMP
FT                   PPAPEPHARLGLKPRRPRVTAWSRDLLSEDRLPDLAVRLGLTAVGVAVIALWWVDTPSS
FT                   RVQTAAATMTALGRVAGLLAAYLVLVELMLMARVPALERAIGFDRLASWHRGLGTNIVL
FT                   LIGGHVLLTVWGYGLSAHEQPLSELVTVITRYPDEWEATIGALLFVAVGISSAWSLRAR
FT                   ISYEAWYAVHLTVYAAVALTFFHQIASGEDFVDHPRNRLLWTALYLAVAACLVVWRIVL
FT                   PARADLRHRMTVDRVVVEAAGVVSVWIRGRRLDQLGALPGQFLLWRFLARGQWASAHAY
FT                   SLSMPPHPDLLRITVKDLGDQSRDLARLRPGTRVLAEGPFGHFTHAHAHAPARKALLIG
FT                   GGSGIGPVRAVAEDLVNRGWDVIVLQRASRPDDLPLGGELSLLAAHGRLVFHQVVGSRR
FT                   ELGYDPLASDIIAVSVPDVAQRDVFVCGPPGMTAVVARGLRDLGVPTGQIHTEEYSLR"
FT   gene            complement(611120..611401)
FT                   /locus_tag="FRAAL0549"
FT   CDS_pept        complement(611120..611401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0549"
FT                   /product="hypothetical protein; putative Merozoite surface
FT                   antigen domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59224.1"
FT                   /translation="MSIASPRTVCRALEPPEPAALPEPDETDGSGAADASDGSESGEAE
FT                   GAASAAVARSGGADASAELGADPSPEIVLTPTTRTTALARAAKPSGPR"
FT   gene            611379..611645
FT                   /locus_tag="FRAAL0550"
FT   CDS_pept        611379..611645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RT76"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59225.1"
FT                   /translation="MRGDAIDTRFGPVQVDVVLAGSTIVDVVPVVVPDQDPRDRQINEY
FT                   AVPLLRQEVLDAQSAKIDSVSGASFTSYGYAWSVQSVLDKLGA"
FT   gene            611704..612510
FT                   /locus_tag="FRAAL0551"
FT   CDS_pept        611704..612510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0551"
FT                   /product="putative thiamine biosynthesis lipoprotein"
FT                   /function="1.5.3.8 : Thiamine (Vitamin B1)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT75"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59226.1"
FT                   /translation="MGTVVSIDVRTPLPPPALDAAIETAVAVLHQADEDFSTFRPESWV
FT                   SRLRRGEVDLADCPEHVREVYRLAGRCRDATGGWFDPAWRRDGTLDPTGLVKGWAADAA
FT                   SAALIEAGAPDHCVNAAGDLRIRGAAGPSAEGSSAEGSGSGKPWRIGIVDPFDRGGLVA
FT                   VVEGTDLAVATSGIAERGSHVVDPSTGVPASGLASVTVVGSDLTVADAYATAALAAGSD
FT                   TGDLLAEFTRAGWAWLTVTTTGRIRAGKAFPGQLAAGRQQLGMPAL"
FT   gene            complement(612913..613329)
FT                   /locus_tag="FRAAL0552"
FT   CDS_pept        complement(612913..613329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0552"
FT                   /product="hypothetical protein; putative PilT domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RT74"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59227.1"
FT                   /translation="MPTRIYLDTSALAKMFIAEKESDDLRQWLVEQVQPLRLVSSALLA
FT                   VELTRLLGLINPAILGLAESFLSSDVDLVQITPPLLADASRVPPARLRTLDAIHLATAL
FT                   DLRDSLDIVLSYDKLLIEAVSASGLVPASPGAEA"
FT   gene            complement(613329..613592)
FT                   /locus_tag="FRAAL0553"
FT   CDS_pept        complement(613329..613592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59228.1"
FT                   /translation="MGMRELSQRTAKVLALVRAGATVEVTDRGRIVARIVPAEDDRYEQ
FT                   LVAAGLIRQATGPFNPAHLPEPAANPTGRSTDEWLADLRGEG"
FT   gene            complement(613691..614164)
FT                   /locus_tag="FRAAL0554"
FT   CDS_pept        complement(613691..614164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0554"
FT                   /product="putative MarR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT72"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59229.1"
FT                   /translation="MPERGRHGSIDPTAVPARLRSLATRLLGRGAVHADRISHARLAAV
FT                   GATRWQYATLVTLRDAGPASQAALSERTGIHRSDMVAVLGGLTEAAYVERTPDPADQRR
FT                   NIVTLTPAGRSRLRTLDRLVDQTQDELLAPLTPTERAELIRLLQRIDDHHSTR"
FT   gene            614240..615328
FT                   /locus_tag="FRAAL0555"
FT   CDS_pept        614240..615328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0555"
FT                   /product="Epoxide hydrolase"
FT                   /EC_number="3.3.2.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10682287; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT71"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59230.1"
FT                   /translation="MRIQSFRVDVPQADLDDLQARLDRTRWPDELPGVGDEFGVPLARV
FT                   RDLADHWRRRYDWRAAEAELNSHPQFVTEIDGQRIHFLHVRCPRPEALPLVLTHGWPGS
FT                   IVEFLDVIGPLSAEFHLVVPSIPGWGFSGPTRERGWDVDRVARAWAELMCGLGYRRYGA
FT                   HGGDWGASVSRALSQHDADHVVGIHLNYLPTPPLPGDPDRARLTPGDQERLVQTEAYLR
FT                   NQPAVRTINGTRPQTPAYALNDSPVGLLAWLLDPMTMWAAADFSISPDRLLTNATLYWL
FT                   TGTAGSAPRLHRETGGPPSWRTVQPVGVLVLPEDITRPIRPYAERRMPIARWTEADRGG
FT                   HFPGLEVPELLAADIRAFFQRL"
FT   gene            615325..617130
FT                   /locus_tag="FRAAL0556"
FT   CDS_pept        615325..617130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0556"
FT                   /product="Putative carboxylesterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT70"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59231.1"
FT                   /translation="MRPAASPVLSRLGQALAALVCLDAPVSFNPWHALVAVLWWSRRQG
FT                   TVNGWRAFPVLRDDSAVRVRVRDRDRGRVRSVRVGGAMTTVGAVPASAGSRPGARVAGG
FT                   ALCGSRESGVAVFRGIPYAAPPVGGLRFAAPRPAASWDGVRSALSYGPPPPQSDVLGRG
FT                   PSAEGTPGDDWLTVNVWSPEPDPAAKLPVMVWIYGGAYAIGASSRPEYDGAHLARDGGV
FT                   VVVTFDYRLGMEGFAQITGAPPNRGLLDQVAALEWVRDNIAAFGGDPDEVTVFGESAGG
FT                   GSVAALLAMPRAAGLFRRAIAQSVPGTFLSPQLAADIAADCADELGLRPTVADLATVDP
FT                   ALLTVAADTVATDTVAATMATRARRWGQAALRSILFAPVVDGEVLPATPWQALAAGAGR
FT                   DVDLLAGHTRDEQRLFTALTGLLGQVTPDQAATALQDFAPGRDGARRYRDAYPDAGPEQ
FT                   LYELVHSDWLFRMPTLHLAQAQVAGGGRVHLYELTWPAPGMGGALGACHGLDVPLVFGN
FT                   LTSGQPALLIGDSPTPEATALSARMRSAWTTFATRSDPGWPAYDCDHRLTQIFDTSPVV
FT                   TAYPEERSRLIWQDHSFPPLLLHAP"
FT   gene            617192..617935
FT                   /locus_tag="FRAAL0557"
FT   CDS_pept        617192..617935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0557"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59232.1"
FT                   /translation="MSQSDEPDELLTNDPLALPIGMVLDKHLGQTGNRTGPPTDSCSGI
FT                   AEWRPRRREHSEPPEVPPLTFPVRACRIPCAAGPGRRRSQQPGPDAVRTARPPGRVKLA
FT                   DHHDADDGAADRDDVGVLRRASGPFRHGHGELVRGGGEVIQMRRADLGIGLRSNAVVVA
FT                   QVWRDHAGRQAALARLLRAVEVCTVDERTGRDAGVLLGRAGTSDVVDATVVLLARPGDR
FT                   ILTSDPKDITRLVQAGGVPAVVVRC"
FT   gene            617982..618569
FT                   /locus_tag="FRAAL0558"
FT   CDS_pept        617982..618569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0558"
FT                   /product="conserved hypothetical protein; putative
FT                   DNA-glycosylase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RT68"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR017658"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59233.1"
FT                   /translation="MVGYGDAVGLHLSQINEADELLTNDPLALLIGMVLDQQIPLERAF
FT                   AAPYELVARLGRPLDPAELAAFDPDELGAIFSRQPALHRFPGSMAKRVQSLCRLLLDSY
FT                   DGDAAAVWTTAADGRQLLKQVAALPGFGEQKARIFVALLGKQLGVTPPGWREACAPFGE
FT                   DGSHRSVADITSPESRSKVRDYKKAMKAAAKA"
FT   gene            618643..619059
FT                   /locus_tag="FRAAL0559"
FT   CDS_pept        618643..619059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0559"
FT                   /product="Putative transposase"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59234.1"
FT                   /translation="MEKVRDVVGVSLDPPGPRGEVVALSHLRFHLRFTPTSSSWMNLVE
FT                   RWFVELSRRKLCRSTHRSVVELEAGIRKWISAWNKGPEAVRLDEDRRPESRNPRCLPRT
FT                   NQRRRILGGDLDHRPPKIIRYVDIVKTWYIQCRR"
FT   gene            619035..620294
FT                   /locus_tag="FRAAL0560"
FT   CDS_pept        619035..620294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0560"
FT                   /product="Putative multidrug resistance protein"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59235.1"
FT                   /translation="MVHTMPKVSDATGVGTDANVHQEVPLRRNEGFRMLWTGQLLSDTG
FT                   SGIGLLAYPLLILALTHSAVLAGVVGTSRAMTLLCLQLPAGALADRFDRRLTMIICDTM
FT                   RAALLALLGILIATDLASWPVVLVVCLIEGGAGAIFNPAAAAVLPGIVPDGQLEQASAA
FT                   TETRTYAAALAGPALGGALFGLGQAVPFLANAVSYVVSFGTVNRIRGRFRPENVAERKA
FT                   LWREVADGLQFVWQVPILRAVAITAPLMNFAFTGVIFTVTLALRHHGTSTAVLGLVQAT
FT                   IAAGGLLGAVVAPRLQGRMRLGALATTITLAGALLFGAAAPLLPSPLVAAPIALALLLA
FT                   PAVNAALFAVTLRSAPAEMRGRVINTVVMATTALAALAPLTAGLLVQHVSGAWTVGAFA
FT                   ATAATAAVLCLILPGLRNAA"
FT   gene            621194..621616
FT                   /locus_tag="FRAAL0562"
FT   CDS_pept        621194..621616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0562"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59237.1"
FT                   /translation="MADKQELFDAVVEILRRRYQISGLDSTAGTFDLRDEDRAVRVTLE
FT                   PNLLKEYFSRLDEENSVLGLAEAQGDERDRVRLQYIIMLIQEYFESDTFLSLVEIRLDR
FT                   SADGRVSLVRRRGTERRSFSLADMEGGFWWSDRPGT"
FT   gene            complement(621916..622140)
FT                   /locus_tag="FRAAL0563"
FT   CDS_pept        complement(621916..622140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0563"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59238.1"
FT                   /translation="MLVATDVLPIPGELAVSVISIAELQFGVLVARTPEARANRLADRT
FT                   QHDLLDLVLGHHGRVAALHRARQDAPNQG"
FT   gene            complement(622164..622292)
FT                   /locus_tag="FRAAL0564"
FT   CDS_pept        complement(622164..622292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0564"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59239.1"
FT                   /translation="MTPRAWRPWDDLAEVFALPSDADWPGDRDLVDNTLTDPWEDR"
FT   gene            complement(622408..623847)
FT                   /locus_tag="FRAAL0565"
FT   CDS_pept        complement(622408..623847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0565"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RT62"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59240.1"
FT                   /translation="MAEQQWDFFVSYAAVDRAWAAWIAWELENAGYSVLFPEWDFVPGS
FT                   HWTSQLRAGIERSTRMLAVLSEQYLSSVYGTAEWQTVYRADPQGFRRRLVPVRIENCRR
FT                   PDVLGGIVSFDLFGCSRKEAGDRLRTQITAVVGGRAKPLTQPAFPNDGTLEPGIPGSAA
FT                   DGAIAPSDGPIPPMTQPSTEPPGFPWTPAAPASADTGGRAAPNHGRTPQLPGPSPLRSS
FT                   APSGLQIVSREPAVSVGRRVDVAADHPAHGPSHRGEKRSGRDPRRSRRMPLIIGAMITA
FT                   VTAVTLVMYFPRSPSGPPTTRPDPPTTPVPTRSPATTASTPTPIPPDGRDEGSVDKPRE
FT                   SATPRPAGGAGGATGTPSSTPSNTPSEIPGITQRLHGSWNCIYQEYPQGTAGGECQARV
FT                   NFSAQETFILHYDDDHPETSGEYQVLGRDKAAGQGNEAEYLMQISAPGEQRFLRFWFDN
FT                   DQLYLLDNKDNKEVLYHLQHA"
FT   gene            624133..625059
FT                   /locus_tag="FRAAL0566"
FT   CDS_pept        624133..625059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0566"
FT                   /product="putative oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT61"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59241.1"
FT                   /translation="MIPIGLALVPPGPEASNAIDVLVGQAKAAAAAGLGSVWLGQQYDL
FT                   DALTALAALAVHVPGVGLGTAVTVTHSRHPITMSSQAQTVQAASGGRLTLGLGVLHRRP
FT                   VARRFGIDLDGPATYMREYLCALQPLLRDGTVVFEGDMITADTSGFSGHVAGSTPPVVL
FT                   VAALGTAMLRVAGELADGTVTWMAGPRTIGSHIVPAITAAGGGAAAPQVAVSLPVCVTD
FT                   HPEEARRRAAAHLACYADLPSYQAMFDQEGAANPAEVAIIGDERHLETQLHRLTDAGAT
FT                   RFIAKPTGITTAAERDRTLQALGGLAG"
FT   gene            complement(625168..625779)
FT                   /locus_tag="FRAAL0567"
FT   CDS_pept        complement(625168..625779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0567"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT60"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59242.1"
FT                   /translation="MTQDLPPRTSGTRAAGRRLRSDAARNVESLVTAARALFDERGTEV
FT                   PLDEIARRAGVGNATLYRNFPTRGDLLVAVYSEEVDALCGHGAALLETTPPGDALFAWL
FT                   DLFVVHAATRRALALAALSQGPDERRGKLAEGWHASMRSTLAALLAPAQEAGAVRPDLT
FT                   AADLLALTNATALASTDPADAVRLMHVLRGGVEPRPDLPP"
FT   gene            625915..626319
FT                   /locus_tag="FRAAL0568"
FT   CDS_pept        625915..626319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0568"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59243.1"
FT                   /translation="MTVDDRIAVNDLIHEYGHLVDAGELDRLAELFTADVTHDLIDFGQ
FT                   GTLTGVAAIRSAALALGEANPVGHHVTNIVLTEQADGRVRARSKGIGIMADGTTGSVLY
FT                   DDLIVRRDGTWRISHRKIVARRAPLGGVPR"
FT   gene            626535..627248
FT                   /locus_tag="FRAAL0569"
FT   CDS_pept        626535..627248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0569"
FT                   /product="Putative short-chain type dehydrogenase/reductase
FT                   (partial)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT58"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59244.1"
FT                   /translation="MFAARGFGVVAVDLDEAGLSALIGRSASEQVVPLVGDVSREETGT
FT                   AMARLALDRFGRLDVAVLNAGIGGTLPWEDADAIDRLDRIFAVNVRGVAIGIRSVVPAM
FT                   RAAGGGAIVVTASSAGLQGEPGNWAYNASKAAVINMVRAAALDHAAQRIRINAVAPGLS
FT                   ETPLTARHRAEPESAAAVGRRIPMQRWGQAREHAAAIWFLASPEASYITGTTLVADGGL
FT                   TAHHGAAPLPSHSQP"
FT   gene            complement(627504..628058)
FT                   /locus_tag="FRAAL0570"
FT   CDS_pept        complement(627504..628058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0570"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT57"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59245.1"
FT                   /translation="MQACRELIRSGAEVTMPQVAQVALVSEATAYRYFPDLVSLIQEAL
FT                   VGLWPQPAQALAPIAGSTDPGERVAFACEHLLRQVLAYQGAVRATISHTITAPLRARDR
FT                   PGLRFGLIDHALAPFQDPAGPAYLGPAALDRLKLDLAITVSAEALFVLTDLCRLPPEEA
FT                   IASAVRTATTLTRAAFTDPPG"
FT   gene            628242..628706
FT                   /locus_tag="FRAAL0571"
FT   CDS_pept        628242..628706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59246.1"
FT                   /translation="MGTKASIVGPEGGEAVHLGPATMRILEDGSTTGHRIGIGEITLAP
FT                   HTDGPPQHRHGRHDEGFYVVSGTARFTVGTTIYDAPAGTLAMIPPGAPHTFANPGDEPL
FT                   VLLNTFTPDLYVQYFRDLRDMIAQTGPATPEATAQVMSRYATEVATDYAD"
FT   gene            628875..629660
FT                   /locus_tag="FRAAL0572"
FT   CDS_pept        628875..629660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0572"
FT                   /product="putative hydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT55"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59247.1"
FT                   /translation="MPTSSGPVPVTVTERGQGRVVLLLHGGAGPDSVAGFADLLAAHGP
FT                   ARVLTPKHPGFGGTPRPDGIDSVRRLAEVYRGLLDLLDVTDVTVVGNSIGGWIAAELAL
FT                   AAPRRVGRLVLLNAIGPTSAEHPVADFFALTLDAVVNLSYADPDRFRINLAALTDAQKS
FT                   VTAGNRAALQAYGGPTMADPSLAGRLGGLAVPTLVVWGEADRMAVPAYGRQYAAAIPGA
FT                   AFHLLPAAGHLPHLEAPDALLTLLVQFVQFVDGTPTDGE"
FT   gene            629704..631236
FT                   /locus_tag="FRAAL0574"
FT   CDS_pept        629704..631236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0574"
FT                   /product="Putative transmembrane transport protein"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RT54"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59248.1"
FT                   /translation="MSMPMSTQPPAIARPAPSAATSSTTSSKAAILTLACVAQFMVILD
FT                   VSIVNVALPAMRHGLGLSAAGQQWIVTAYTLGFAGLLLLGGRVADLVGVRRAFLAGLAG
FT                   FTLASLAGGLATSGAVLIAARAGQGVCAAFLAPATLTLITTTFTEPTARTRAVGAWSTV
FT                   TTTGGAAGAVLGGVLTQYLGWRWVLFVNVPAGAAVLAVAGGRIPAADGRAADALRRLDL
FT                   PGAAAVFAALTALVYGVVNTETHGLADPRVAVPLAAAVLLLAGFVAIEFTAAQPLVPLA
FT                   MLRRRTLAGGNLIMIFIGGALFPMWFLLSLYLQQVLHLHAVRTGWCLLPGALSIIVGAR
FT                   ISVRLLGTLGPRRLLVIGMALSTAGFAWLSRVGVDGDYHTDVLAPFLLTALGLGLAITP
FT                   TTVTATQGIDRAHSGLAAGLVNTSRQVGGALGLAALATLAAHTTAAAHAVAVPTTAARL
FT                   QTHSVAAALADGYAHALLGAAVVTATAAVASLLLPGRPAASRRSDHRAVRGR"
FT   gene            complement(631207..631884)
FT                   /locus_tag="FRAAL0575"
FT   CDS_pept        complement(631207..631884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0575"
FT                   /product="putative transmembrane oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT53"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59249.1"
FT                   /translation="MRIGILGTGALAEALGTGWARAGHELVVGGRSRAKAQALAGRLGA
FT                   GARAADPREVVAGRDAVLLAVLWSGVADVLRDVDAAAGALAGTTLIDPTNAVEHGVGVL
FT                   LTGAGTSAAGQIAAWAPGALVVKAFHLFPAEQWTAPPPGDAAGTAPATVVICGDDAGAL
FT                   RITGELIRDVGGTPAVLGPLARARQLEEAAGLVIGLAFAGFDPSSAIPRVPTQSPSPDG
FT                   SVV"
FT   gene            complement(632442..634676)
FT                   /locus_tag="FRAAL0576"
FT   CDS_pept        complement(632442..634676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0576"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RT52"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59250.1"
FT                   /translation="MNAPTTGAAVTTGAAGATGAGGARAAGTPRRVAARVGLGVVIGTY
FT                   LGDALSAFFPGTPGYPVVAAGSLLGLLLGLLTAHRRELASASLGLAAGAVTGLVANPVA
FT                   PVAIARTYRNAGTADYGYQPVVTLVFLAALGAALGQVVERRPRFTKPVSGLALGALGGH
FT                   FAGLAAKTGAGRFVADSAGPRLDHLDGAGHADTLVSGYGYAHGYASAVFVAGGAVLGLL
FT                   VGLVADRRRGLARPTLGLALGALLGGLGVAASRSMYAAFTSPTLIDGLGSDPVGRFAGV
FT                   GYLGDLDPGHGLALVAGGAALGLLLGLLAERWHRIATPLLGAAVGGVVGHVAGGGLRLV
FT                   DSTSFDWPDSLTWSGGSEPAGPAQSLVVGHGNGQVVALLIGAVLGGVAGPLAGPLAGRR
FT                   RRLLTPLAGLVLAVSAVSAVSVGYDNFVLLASAPSPPSNDALGVRIAVLALACLVAGLG
FT                   AGVIAGRCPRLVRPTLGLVFGAIVGQTAADVAADAYLFAVDYTYNHPSDTRWAGVVGLL
FT                   AGAAAGLVLGAIANRRPRLAGPSLGLALGALAGSAAGSAYASSLFEENRHPPDALSVYV
FT                   CTAMVAGAVFGLLAGLTTRWPRRRRRVLGALAGVFSGAPLSALVFEISPAVLLVLSGAV
FT                   GAVVAAGGLGASSAPSAGSTPFRSSSLPTRRVVRLLRPGMFAHGLVGLAAAIAASDGQQ
FT                   ERYAEEFEATLVDVDGRLRRTRRLWCALTILAGAALLRAELARKEAERRS"
FT   gene            complement(634673..634954)
FT                   /locus_tag="FRAAL0577"
FT   CDS_pept        complement(634673..634954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0577"
FT                   /product="Putative PadR family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59251.1"
FT                   /translation="MLLDDDVEPYGLAIARKAGLATGSVFPILARLERLGWASSSWEES
FT                   DRPGPRRRLYRFTPEGMAGARALLAERRPRRGHGHGRHGTFTTPEGAW"
FT   gene            complement(635152..637131)
FT                   /locus_tag="FRAAL0578"
FT   CDS_pept        complement(635152..637131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0578"
FT                   /product="putative serine/threonine protein kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT50"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59252.1"
FT                   /translation="MRVEPGSGRATAVLPLRPDDPALIGDYRLLQRLGAGGMGRVYLGR
FT                   SPGGRTVAIKVIRSEFADDPQFRQRFRREVDAARRVGGAWTAPVLDADPDAEQPWLVTA
FT                   FVPGPSLHEAVRTHGLLPARTVRALGAGLAEALIAVHGAGLVHRDLKPSNVLLSLDGPR
FT                   VIDFGISQAVDATTLTHTGAAIGSPAFMAPEQIGTGDVGPASDVFALGAVLVHAATGTS
FT                   PFQAATVPAMMYAVLSREPDLAAVPDDLRDLIGACLRKDPGERPAPTAVLAALAPAGGA
FT                   ATLIAAGWLPATLVTALSRRAVALLDLDAPTRPPPPRDLSGTSPPHSTGIPNHPEPPAA
FT                   ITGPDASHGPRPDRGRTRNVPSDPRGYPPPGTTPPPDAYRPPGATPSPDAYRPPGATPR
FT                   PDAFPPPGALPPPGATPRPGTGSAPGPLPGQDPLWPPAAPRQPATRRRRSRVLAVLAGA
FT                   GAVGLALVALAVVLIVDRGSGGGSDGGTATAGGARSGATSGATAGAASGSGSGAVGGER
FT                   LAGANPSTSPAVTAGAAVPAGYVGTWRGEITTPSGLAQNAVVTVHPGLTGQAVAHSEIT
FT                   VDGLTQADGQPIRCTADLRLVSISGGLSLQDIPGTGSDPKILGISACSHGGRISLLLQA
FT                   DGTVRFAADAPGTGNPTGTLIRDR"
FT   gene            complement(637222..637536)
FT                   /locus_tag="FRAAL0580"
FT   CDS_pept        complement(637222..637536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0580"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59254.1"
FT                   /translation="MLSRDTGRRTAAQINRPADDWAPRNERVPRNHRTPWNNGAPRDHR
FT                   TPRTTISRETARGRRGIARDRRGARMAGRSPVTRDGARGSHGILHARRRTDARQDCGPG
FT                   "
FT   gene            637574..638353
FT                   /locus_tag="FRAAL0581"
FT   CDS_pept        637574..638353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0581"
FT                   /product="putative methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT48"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59255.1"
FT                   /translation="MSSHISSDHISSSWYADFFTDLPNEFWRRAATPEWTEADVDFVEA
FT                   RLGLPHGSRILDVPCGSGRHSLALAARGHRVTGVDLSTEAIAHARRAARVAGQAVAFEH
FT                   GDMRDLGRFGVFDAAVCLGNSFGYLDLAGTRAFTAALGRAVRPGGGLVVDFGATAESIL
FT                   PGFAGTPRTMRTGDITVETTTEYDVAASCLISRYRFSQGARRLAATALHHVYTSAHLGD
FT                   LLTDAGFTDIRRYAGPDGTPYTLGAGRLLLTARRETG"
FT   gene            638654..640453
FT                   /locus_tag="FRAAL0582"
FT   CDS_pept        638654..640453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0582"
FT                   /product="Putative efflux membrane protein (partial match)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RT47"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59256.1"
FT                   /translation="MSDLTRGRRLLVLAICCMSLFIVGLDNTIVNVALPSLRRDLHASA
FT                   SGLQWTIDAYTLVLASLLMLGGSTGDRLGRRRVFQTGLVLFTLGSLLCSLAPSLTWLIV
FT                   FRMVQAVGGSMLNPVAMSIISNTFTDSRERARAIGVWGAVIGVSMALGPVLGGTLVESV
FT                   SWRAIFWVNVPVGVAALVLAGLFVPESRAARARRFDPVGQALVIVILASLTYGIIEAPS
FT                   AGWLAARTLALFAVSALAAAVLVRYEGRRAQPLLDVRFFRAAPFAGATGIAVFAFAALA
FT                   GFLFLNTLYLQEVRGYSPLLAGITTLPMAGMTVVSAPIAGRLVASRGARTPLLIAGVTM
FT                   TAGSVMLTALGVSTSILWLVSAYVLVGLGFGMVNAPITNTAVTGMPQSQAGVAAGIAST
FT                   SRQVGQSLGVAVIGSLAAAHVAGRGGVVDPTSAVGWWTIVLCGAGVLLLGAASTGTWAR
FT                   GTAQRTAARLAADAAPGATAVASGIAATAATAGRATATADADADRTPEARDAASAGRLE
FT                   DGRPAAGGARLGGGEGGGRHRRPVRPVAAGMVAGDDDRASRPVWRQSAFRRRSRAGRVG
FT                   VAARSRSHGSSGQDGHDEFAPTR"
FT   gene            640839..641222
FT                   /locus_tag="FRAAL0583"
FT   CDS_pept        640839..641222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0583"
FT                   /product="Putative MarR-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT46"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59257.1"
FT                   /translation="MVDRNERRREVCEALDLSFIRVKALLALQAGPLTLGELAAALSID
FT                   RPYTTLTVHELERRGLAERTVHPDDRRSKLVELTASGRTAARLADDMLNRPPAALVALD
FT                   AADLATLDRITAHLAGEDPAATA"
FT   gene            complement(641380..641820)
FT                   /locus_tag="FRAAL0584"
FT   CDS_pept        complement(641380..641820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0584"
FT                   /product="Putative transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT45"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59258.1"
FT                   /translation="MTAGPEITAGPAAAVDLATTGAVGPTAASTVPQPKRAAGDLERAV
FT                   LTLLWSADEPLMPFQVQQRLGAGLAQSTIATTLLRLVNKGMVQRAPRGRGFAYRPLRRA
FT                   ADHAAGQMLDFLRRGENPDSVLRCFARRLSTDQRDVLLRALT"
FT   gene            complement(642040..642864)
FT                   /locus_tag="FRAAL0585"
FT   CDS_pept        complement(642040..642864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0585"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RT44"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59259.1"
FT                   /translation="MRRIIAVPPLEFDAVMGQGGPRGTGGAAPAIPPPEDPTTGSGTGT
FT                   GAGGARRWTAGWAATRTGRIARATVAALLTVGLAVAAHVLACGRAPAVAVVLVGIVLVL
FT                   RVCWGVSERRVSMSRLVGLVLAVQGCLHVAFGLSAPAGHAGHAGIGGGADHAGLAAASP
FT                   ADLVPGGAAMLGLHLAAALLLAGWLALGERLLWQAARGAVRVARRAVGRLHRPRPAGGV
FT                   PATVASQRILAISRPPDAACSLWLRHVVVRRGPPRLAARQTAARRGAQASVS"
FT   gene            complement(643037..643738)
FT                   /gene="ssuB"
FT                   /locus_tag="FRAAL0586"
FT   CDS_pept        complement(643037..643738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="FRAAL0586"
FT                   /product="alkanesulfonate transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /function="1.8.2 : Sulfur metabolism"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.6.3.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RT43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RT43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59260.1"
FT                   /translation="MRVRGLRRVFGEQVVLDGLDLTITPGEFVALLGRSGSGKSTLIRI
FT                   LGGFDDGVEGEVLAARRRSVVFQEARLLPWKRVLPNVTLGLAGRDVAERGRVALAEVGL
FT                   AGRERSWPATLSGGEAQRVALARALVREPDLLMLDEPFGALDALTRIRMHALLQHLCRR
FT                   HQPAVLFVTHDVDEAILLADRVVVLTEGRFSLDVPVAVASPRRRADPAFDRLRATLLAE
FT                   LGVDDLAAATH"
FT   gene            complement(643813..644616)
FT                   /gene="ssuC"
FT                   /locus_tag="FRAAL0587"
FT   CDS_pept        complement(643813..644616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="FRAAL0587"
FT                   /product="alkanesulfonate transport protein (ABC
FT                   superfamily, membrane)"
FT                   /function="1.8.2 : Sulfur metabolism"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="4.S.5 : alkanesulfonate"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:Q0RT42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59261.1"
FT                   /translation="MDLAAGRRRTTRRRRVPTEVRRFLGPALLFALWWAVTGLDLVSDR
FT                   ALASPAAVLDAARELWRNGDLVDSLGASLYRVGAGVLFGVGIGLALAVVAGFFRTASDV
FT                   VDSAMNFLRTIPVIALLPLIIVWIGIGESAKIFLITVGVAFPIYMNTYAAIRGVDARLV
FT                   EAGQTFGLGRFGLVRSVIVPAAAPGFLVGLRWALGVAWLLLVFAEQVNTDSGLGYLLNS
FT                   AQSWNRTDIIVLCLVVYGILGLVSDGLVRLLERMLLSWRRGFDGT"
FT   gene            complement(644817..644888)
FT                   /locus_tag="FRAAL0588"
FT   CDS_pept        complement(644817..644888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0588"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59262.1"
FT                   /translation="MRLRATACAAVEQSRYRDGFISS"
FT   gene            complement(644899..645867)
FT                   /locus_tag="FRAAL0589"
FT   CDS_pept        complement(644899..645867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0589"
FT                   /product="putative alkanesulfonate transport protein (ABC
FT                   superfamily)"
FT                   /function="4.3.A.1 : The ATP-binding Cassette (ABC)
FT                   Superfamily + ABC-type Uptake Permeases"
FT                   /function="4.S.6 : alkanesulphonate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59263.1"
FT                   /translation="MILAACGSGGGDGARAAAGDQRVTLRIGDQSKTLELPLTLSGAAR
FT                   GAPYGLAYSTFADGPHMNAAFSAGRLDVGYMGDTPVLFANAANAGVVAISVAENPVNSQ
FT                   TIIARAGSGIRTPADLRGRRVAFTLGTSLHGYLLNQLDGAGLNQDDISPVNVPVTSLTS
FT                   TLASGKVDAIVYTRQYRSAVARQAPGSYEIQTRPLPQYSVLLASKSALKNPAKRAAIRD
FT                   FVLRLARAWSWPKANAALWVQKYYVDQLKQDPVASRKYFDSLPEARYRPVSPAFVASQR
FT                   VQARLLGSVGELPKSLDVDDELDPAFNGELTAAFAKAFPAT"
FT   gene            complement(646191..647117)
FT                   /locus_tag="FRAAL0590"
FT   CDS_pept        complement(646191..647117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0590"
FT                   /product="putative taurine dioxygenase"
FT                   /function="1.1.4 : Amines"
FT                   /function="1.8.2 : Sulfur metabolism"
FT                   /EC_number="1.14.11.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT39"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59264.1"
FT                   /translation="MTSITPTALGIDVRPLSGHTGAEIHGIDLREELDDATVAEIRSAL
FT                   HQWKVVFFRDQHIDHAQQVAFGRRFGRLTPAHPHEEAPPVGFPEILPIDSRRYAKVFGK
FT                   RKATYDNGWHTDVTALVNPPTASILRGDVIPPYGGDTAWTNLVAAYEGLPEPLRNLADG
FT                   LRARHSFGNFPSDSEYGRRVAANPLVAIHPVVRVHPETGERALFVSPSFTAKDGEIIGF
FT                   SPKQSRQILDVFYDQISRSEFTVRFKWNQGDVAFWDNRATAHLGPSDLGHLDFDRVLYR
FT                   VTIEGDIPVGVDGRESELVAGEPFLGT"
FT   gene            647278..647526
FT                   /locus_tag="FRAAL0591"
FT   CDS_pept        647278..647526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0591"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59265.1"
FT                   /translation="MAGGAAGNAGEDSSGGILDASLPGYPLGRVEDIRRQHRRQRGPGG
FT                   GEIPPPLRPMLFTDQSSVMNDGAVNILRSAEINCRGG"
FT   gene            complement(647507..648631)
FT                   /locus_tag="FRAAL0592"
FT   CDS_pept        complement(647507..648631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0592"
FT                   /product="putative ROK-family transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59266.1"
FT                   /translation="MSRQTAGLISLGLLRELPASSLSPRVGRPHVPLDVDTRRHLACGV
FT                   HIAVPFVTFSVVDLRGQVVAREQRPREGDAMTVLQMIIRHLPGFLARHATGSRVLGLGV
FT                   VTGGRVDPELGLVVEHEPLDWRDVPVRAVLAAATGLPVHVDGHARALAQAEILFGDPRA
FT                   RRSLLHLFVGNVADAAFATDGSVHIGPNSAAGGIAHLRLADSDAHCRCGRSGCVQATLS
FT                   ERTLLRHAVGEGIISRPDLQDLLAAALGGDRRAVALFRDRLRVVGRLIALLVDMMDPEI
FT                   VVLTEAATLFLPALRADLFAEISAYSRVCAEPERMVLPSSFGPDVLAVAAGAAVLDAVH
FT                   RSPHSLLAGLTTPRPAAGAASPRRPATPLTRHGN"
FT   gene            648972..649172
FT                   /locus_tag="FRAAL0593"
FT   CDS_pept        648972..649172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0593"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59267.1"
FT                   /translation="MRTDTLRWTDTGNLLASQPGHVRLFRGAGVRRAEARTVAASRVDD
FT                   RGGVPPATRGCHARTRCDRGA"
FT   gene            complement(649602..652538)
FT                   /gene="argE"
FT                   /locus_tag="FRAAL0594"
FT   CDS_pept        complement(649602..652538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="FRAAL0594"
FT                   /product="Phosphoenolpyruvate carboxylase (PEPCase) (PEPC)"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /EC_number="4.1.1.31"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1551850; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT35"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59268.1"
FT                   /translation="MSGISANPGRPIRAKAEPGRPRRTADPGEPRRTTGGGVTTERSAS
FT                   TTLDELAPDPGAFAGGVSSDARHAAVRAGVRRLGDLLGQALTRHEGAATLALVEQVRAL
FT                   ARRPDNGAELGRLLATVDDRTAIVLARAFTAYFQLANITEQLHRSRELSDRAKGPLTET
FT                   FDRMAAALDAGTLDRSLAESIARRLELRPVFTAHPTEASRRSVLDTLRRIADLLDADSP
FT                   DGAVPAADRDRTQRRLAEMVDVLWQTDELRVERPKPADEARSAAYYLELIATEVLPDLL
FT                   EELDLALARVGLTLPAGAHPVRFGSWAGGDRDGNPNVTPAVTLEVLTLQHEFGIRLLTA
FT                   SVERLIQELTASTRVVGVGDELLSSLAADREALPEVHDRYIRLNAEEPYRLKCSYILAR
FT                   LAGTRERLAAGAPHVPGRDYGGVAEILDDLEVMRASLNAGDGSLVADGPLLRVIRTARA
FT                   MGLSLATLDIREHADKHHAALAAVYDQVGELDVPYAQLDRPARRTLLSAELARRRPLLG
FT                   AVPPPLPPAVLGTLELMRTVREALDRFGGDVIESYIVSMTRDVDDILAVVVLAREAGLV
FT                   GLGFADRPAWARIGFVPLFETVAELRAAGSLLDGMLSDPSYRSLVRARADVQEVMLGYS
FT                   DSSKDAGITASQWEIHKAQRELRDVARRHGVVLRLFHGRGGSVGRGGGPSGEAIMAQPF
FT                   GTLDGSIKVTEQGEVISDKYTLPQLARHNLEITLAAVVEASILHRSSRLSPTVLAGWNE
FT                   TMQAVADSARVTYQAFVGDPALVPFFLAATPVEELGNLNIGSRPSRRPGGTGGLADLRA
FT                   IPWVFGWTQSRIILPGWFGVGTGLAAARAAGAGDTLAEMYRSWHFFRTFLGNVQMTLAK
FT                   SDLTIAQRYVSTLVGDDGGTIFETIRAEHARTVAEVLTVTGQAELLENAPTLRHTLEVR
FT                   DAYLAPLHALQVSLLARARAAGEGADPLLRRALLLTINGIAAGLRNTG"
FT   gene            complement(652723..654009)
FT                   /locus_tag="FRAAL0595"
FT   CDS_pept        complement(652723..654009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0595"
FT                   /product="hypothetical protein; putative membrane protein;
FT                   putative peptidase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RT34"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59269.1"
FT                   /translation="MTTAALLALFAGVLAWPVPRLLAAARWPHRCPRAAIVLWQAIGLA
FT                   GGVSALLAAIAFTVSPLSGSTPTAITDHLGNIAAGSPLTGLRWVNLVGLATATALACRL
FT                   FGVLCASTAATLRERHRHRHLVDLAGRRHRGHGAWESADHTHLHPPTTATATAGGAGGG
FT                   DADRGDATNPGDGPGAGGDGSGSGADSTTCCLCEHRDRAGILLRILDHPIAVAYCVPGV
FT                   RHARVVVSRGLLNTLDAAELDAVLAHEAAHVAGRHDLVIQPFVAWERTFPFLRPAREAT
FT                   AAVSLLVEMLADDAAARETNRRSLARALARLGVARAPVPAGALSITGHPAAVLPALGAE
FT                   DPLPATAARAATRFGAGSAGGPRSAPGAGSAAAVAPDAPGLRLGTVNPVISRIARLLDP
FT                   PGVRWWLPAGAYLAAAAVLAAPPMIVLIG"
FT   gene            complement(654023..654466)
FT                   /locus_tag="FRAAL0596"
FT   CDS_pept        complement(654023..654466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0596"
FT                   /product="Putative regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT33"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59270.1"
FT                   /translation="MWSSEGWLTAREVAARLDHERDLAYTTVLTVLERLERKGFVRRQR
FT                   AARAHRYAASDSREAVVAEAMMEALGTADDRGSALVRFVGSVSAEEAEILRRALEPLGG
FT                   EPAAEVPDPAVPPPPGAAPGGPDGPAAVTTDSDRTVQIPPDGR"
FT   gene            654921..655262
FT                   /locus_tag="FRAAL0597"
FT   CDS_pept        654921..655262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0597"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59271.1"
FT                   /translation="MAGYPLGGVDVLSESYFFGRADRPAPGVNLFRPAMAGCGECAGRA
FT                   LWCRGERGKCQGPRLPGTSHGVCGGGSGRKTAYAGEGDARCTAPPAGVAHVVDLTEARP
FT                   PTGSPRYVP"
FT   gene            655333..657705
FT                   /gene="cydA"
FT                   /locus_tag="FRAAL0598"
FT   CDS_pept        655333..657705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="FRAAL0598"
FT                   /product="Cytochrome d (bd-I) terminal oxidase subunit I"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.4.2 : Electron acceptor"
FT                   /EC_number="1.9.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT31"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59272.1"
FT                   /translation="MRMVLAADAVDLARAQTAFSLAFHICFAVFGVGLPWLLIYTERRW
FT                   LKTGDPVWLALTKKWSRAFAVLFAVGAVSGTVLSFEFGLLWPAFMSKYGGALGLSFTME
FT                   GFAFFTEAIFVGMYLYGWKRLSPRAHWLTLWPIAISGTLSTLFIITVNAWMNVPRGIVE
FT                   QNGKLLEAKPYAPFISPGTPPQLVHMLLAALMCAGGVVAAIYAVGMLRGRRDTYHQRGL
FT                   KIGLAVVLACAPLQLIVGDWAARVAGANQPFKLAAMEGLYHTGSHAPFALGGIYDNKTG
FT                   EIRYGLEIPGGLSLLEGFSTGHVIKGLDGAPPDERPNGTLVHGAFTTMVGAGSALIGLS
FT                   LITGFVVLRRRRRGERPLLPTSRPWLIAAACTGPAAMLAMLTGWEVTEGGRQPWIVGDH
FT                   MRVVEGVTGGDAVAPMFAGTLVLYLGLAGALLLILRKMATGGPSGEQLRPGQPAGPSAP
FT                   TAPRPRDGGSGSGSGGSGPAGSGPEQGSGGDESGSKESVPAARYIPAARGVPAATGAPA
FT                   ASGVPAATGVPAARSLPAARSLPAAESFPAAESVPAVRYVPAARSFPAAESVPAVRYVP
FT                   AATFAPAARHVPAAAYDPAAEPVAWYTTRTDLLSERDQTGLPVAVLLPGRLPVTPAGAP
FT                   APAGGSMVTGIGNPSEGSDPAKGPDPSRGTEPSTGSEPPTETEPATEADPLAGADPGMD
FT                   PSRNPAPTISPRPDGAEPSATPTTPAPTSPTIPRPRPEPHPTGSFGGGRPAASNRRGAP
FT                   GWHGLLGRRSAGGRHATTRRPDTGTRTAGRTDRGETR"
FT   gene            657702..658694
FT                   /gene="cydB"
FT                   /locus_tag="FRAAL0599"
FT   CDS_pept        657702..658694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="FRAAL0599"
FT                   /product="cytochrome D ubiquinol oxidase subunit II"
FT                   /function="1.4.2 : Electron acceptor"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT30"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59273.1"
FT                   /translation="MTSADLLLVVMVIGLTAYALLGGADFGGGVWDLLARGRDARAQRK
FT                   LISNAIGPVWEANHVWLVFIVVALFSGFPPAYGVVGSSLEVPLSAALIGIVLRGAAYVY
FT                   RAYGAGAAGPDHWWGHVFAVSSTITPFALGVAGAALATGDMSADDPFAPVRSSFGLVCG
FT                   LFAVAATAFLAAVYLCKDAAASPATEHLVADFRRRAVGGAVVCGILALVLLPLFWDQAP
FT                   VVAHRFRDRSMLLVVLSAVGGIGSLVALARNQFVAARLAAGLAVAAMLWGWAVAQYPDL
FT                   IVGQVTVDDAAAPATNIHAMLYTVGGGLLLITPPLVVLYRLFTRPEPVD"
FT   gene            658756..659592
FT                   /locus_tag="FRAAL0600"
FT   CDS_pept        658756..659592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0600"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RT29"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59274.1"
FT                   /translation="MVGPPIAVGYGRPVTDAPPAAPVTAEPLTRRVLAAEVWLVLGVSF
FT                   AASALYALIRYVGVLTRPGPVRSQVARLNTSAAPGRPWLDLALQLADVATGVVPVLLAV
FT                   HLLARHGGGRRVIGLDGRRPGPDLAQGALLAAGIGGLGLGFYLLAWHSGANLTVAPSSL
FT                   PDVWWRVPVLVLSACQNGLAEEVIVTGYLLVRLRELGVTPGRALATSALLRGSYHLYQG
FT                   LGGFAGNLAMGLLFARLFQRNGRVLPLVIAHSLIDTVAFVGYVLLVGKVSWIPAPR"
FT   gene            659784..661352
FT                   /locus_tag="FRAAL0601"
FT   CDS_pept        659784..661352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0601"
FT                   /product="conserved hypothetical protein; putative
FT                   Adenylate cyclase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59275.1"
FT                   /translation="MATGAREIERKYAVEPTFVLPKLGGLPGVATARTRRAVSLEAVYF
FT                   DTDDLRLARNRITLRRRTGGSDAGWHLKLPVRVGERDELRLPLDAADGVVDVAAGARHT
FT                   PPAEFVDLVTVHLRGGELRPVARLRTLRTARRLRDAAGVDLAEVVDDQVSAQTLGEATV
FT                   VSTWREIEVELVDGKRGLLDDVGELLLSAGAVAATDSSKLGRLLGPALAAGPGPDVPPL
FT                   PRRPRRRAPAGDVVRAYLIEQVRALLAADPRVRLDEPEAVHRMRVACRRARSTLRTFAP
FT                   LFPADTVTLLDGELRDLAGALSGARDAEVQIAYFDGRLAELPADLVAGPVHETVSAHLS
FT                   TGMAAARDEALAMLRSDRYFALVASLLTLVRAPLTGAARRPAGKVLPDLVRRADRRLAK
FT                   KVTAAAGLPVGHDRDELLHSARKQAKRLRYAVEAVTPLYGQDATALVGQAERAQELLGT
FT                   HQDATVARDLLRGWGAAAQAQGESTAFTLGVLLGLEECRGRLAERDFFDAWPRISAAKY
FT                   RRWLA"
FT   gene            661542..662522
FT                   /locus_tag="FRAAL0602"
FT   CDS_pept        661542..662522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0602"
FT                   /product="putative aldo/keto reductase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT27"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59276.1"
FT                   /translation="MEITRVGFGAWAIGGAGWAFGWGAQDDAEAVAAIRHAVAAGINWI
FT                   DTAAVYGLGHSEELVARALADLPAAERPYVFTKCGLVWDDADRSVPPARVGAPASIRTE
FT                   VDASLRRLGVDRIDLYQLHWPPQDGTPIADAVGTLHELRAAGKIRSVGVSNFSVDQLEQ
FT                   AAAAGGVDVLQPPFSLIDRAVAGEILPYAAAHGIGTIVYSPMQSGLLSGRWSATRTAEL
FT                   PADDWRRGAPEFNPPALARNLALVEVLAEVARRHATTVAAVAVAWTLASPGVSGAIVGA
FT                   RRPDQLDGWLPAGSLTLTGADLAEIAAAAERLSAGRGPLHPAGDA"
FT   gene            662941..663144
FT                   /gene="cspD"
FT                   /locus_tag="FRAAL0603"
FT   CDS_pept        662941..663144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="FRAAL0603"
FT                   /product="Cold-shock protein; nucleic acid-binding domain"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structural protein"
FT                   /db_xref="GOA:Q0RT26"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59277.1"
FT                   /translation="MAQGTVKWFNSEKGFGFISVDGGGSDVFVHYSAIQMDGYKALEEG
FT                   QRVEFQVTQGQKGPQADAVRVV"
FT   gene            complement(663725..664783)
FT                   /gene="asd"
FT                   /locus_tag="FRAAL0604"
FT   CDS_pept        complement(663725..664783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="FRAAL0604"
FT                   /product="Aspartate-semialdehyde dehydrogenase (ASA
FT                   dehydrogenase) (ASADH)"
FT                   /function="1.5.1.7 : Lysine, diaminopimelate"
FT                   /function="1.5.1.9 : Methionine"
FT                   /function="1.5.1.8 : Threonine"
FT                   /function="1.5.1.18 : Isoleucine/valine"
FT                   /EC_number="1.2.1.11"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT25"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59278.1"
FT                   /translation="MVGATGAVGTVMLSMLAERPDIWGEIRPVASARSAGRTVRVRGAD
FT                   VAVQVLSPEVFDGVDVAVFDVPDEVSAQWAPVAAARGAVAVDNSGAFRMDDDVPLVVPE
FT                   VNADQLAARPRGIIANPNCTTLSMIVALGALHRAFGLESMFAASYQAASGAGQAGIDTL
FT                   YNQLATVGGTRELGQTAGDVRKAIGEDGLGPFPAPLALNVVPWAGSLRDGGWSSEEFKV
FT                   RNESRKILGLPDLRVSATCVRVPVITTHAVAVHARFARPVTGDEARAVLLAAPGVAVVD
FT                   DPSAGEFPTPSDVVGTDPTWVGRIRQSPDDPHEIALFLCGDNLRKGAALNTLQIAELLV
FT                   AGPPAAQAAAAG"
FT   gene            complement(664899..666167)
FT                   /gene="ask"
FT                   /locus_tag="FRAAL0605"
FT   CDS_pept        complement(664899..666167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ask"
FT                   /locus_tag="FRAAL0605"
FT                   /product="Aspartokinase (Aspartate kinase) [Contains:
FT                   Aspartokinase alpha subunit (ASK-alpha); Aspartokinase beta
FT                   subunit (ASK-beta)]"
FT                   /function="1.5.1.8 : Threonine"
FT                   /function="1.5.1.21 : Homoserine"
FT                   /function="1.5.1.9 : Methionine"
FT                   /function="1.5.1.7 : Lysine, diaminopimelate"
FT                   /function="1.5.1.18 : Isoleucine/valine"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT24"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59279.1"
FT                   /translation="MALLVAKFGGSSVADADRIKRVAERVVEARRDGNDVVVVVSAMGD
FT                   TTDELLDLAEQVSPLPPARELDMLLTAGERISMALLAMAITTLGAEARSFTGSQAGVIT
FT                   DSVHGKARIIDVTPGRIRAALDEGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAA
FT                   ALHADACEIYTDVDGVFSADPRIVPDARRIDTISYEEMLEMAACGAKVLMLRCVEYARR
FT                   YSVPVHVRSSFNAKPGTWVTEIPEAQLVEQAIIRGVAHDVSEAKVTVVGCPDKPGVAAA
FT                   VFRAVADADVNLDMIVQVGSVAGSGRTDISFTLPKTDGRTALTALAKVQGEIGFERTLY
FT                   DDHIGKLSLIGAGMKSHPGVSARFFGALADAGVNVEIISTSEIRISVVVRDTDLPGAVR
FT                   AVHGAFELGDPDGGAVVYAGTGR"
FT   gene            666418..667002
FT                   /locus_tag="FRAAL0606"
FT   CDS_pept        666418..667002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0606"
FT                   /product="putative tellurium resistance protein"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type s : structural protein"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59280.1"
FT                   /translation="MAVSLAKGGNVSLTKQAAEAGTAQLTALNVGLGWDARTTTGTDFD
FT                   LDASAIGLRADGKAFNDSYFIFYNNLASPEGAITLTGDNKTGQGEGDDESIIINLPSVP
FT                   AEIERIVVPVSIYDAVNRSQNFGQVRNAYIRVVDQGGNELVRYDLSEDYSTETVVIFGE
FT                   VYRNGADWKFRAVGQGHNDLGGLARDHGVSV"
FT   gene            667023..668045
FT                   /locus_tag="FRAAL0607"
FT   CDS_pept        667023..668045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0607"
FT                   /product="putative alcohol dehydrogenase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="1.1.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT22"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59281.1"
FT                   /translation="MRAWQVVAPGPMGTRPLRAAELPVPEPGPGQVRLRVDACGVCRTD
FT                   LHLAEGDLVPHRPRTVPGHEVVGRVDALGPGVPAAVDAGPPGVRLGDRLGVAWLASTDG
FT                   TCAYCARGAENLCPASTYTGWDVDGGYAEYVCVRADYAYRLPAGYSDAELAPLLCAGIV
FT                   GYRALRRAALPPGGRLGIYGFGASAHLAAQVAIAQGARVHVLTRSARAQALALELGAAS
FT                   AAGAYDAPPEPLDAAVLFAPVGELVPVALAALDRGGTLSVAGIHLSDIPPLVYADHLFQ
FT                   ERDLRSTTANTRADGAEFLAIAAEHRLAVTVSPYPLDAADQALDDLAADRVTGAAVLLP
FT                   "
FT   gene            complement(668198..668650)
FT                   /locus_tag="FRAAL0608"
FT   CDS_pept        complement(668198..668650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0608"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59282.1"
FT                   /translation="MIISSHVPAGAFVGMAIRHPVPALAAGFLSHLAMDALPHWGTGPN
FT                   TESEWLPIARRDGVAGLAAMALLTASAPAGRRLAVLAGMTGACLPDTDKVGRYFVGSSP
FT                   WPSRFDRFHEKIQNEARHRLPREVATAAALTLAGTVLLRRLPARAS"
FT   gene            669205..669813
FT                   /locus_tag="FRAAL0609"
FT   CDS_pept        669205..669813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0609"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59283.1"
FT                   /translation="MDRWIRGVRTCPLRDACDLGAALPPGVVISVAWRLDGAGRIIGGM
FT                   LPRGHPQGGPQGKRVLHGEGVWAAEMFPRDREITTELDLVEPGSAARPARLVVHGPERD
FT                   IVGYVDQPWLPADRLARLTTGMRRDARQIRIRAAGRIWWIRATKVFGVRVSRDHGVDVY
FT                   RTRGLHAVFSAEADHLDVSVVLLTLASIPSSTYAPILGF"
FT   gene            complement(669856..670455)
FT                   /gene="recR"
FT                   /locus_tag="FRAAL0610"
FT   CDS_pept        complement(669856..670455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="FRAAL0610"
FT                   /product="recombination and repair protein"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT19"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RT19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59284.1"
FT                   /translation="MYEGIVQDLIDELGRLPGIGPKSAQRIAFHLLAADPVDVRRLATA
FT                   LTEVKDKVRFCRSCFNVAQSELCRICADPRRDQALICVVEEPKDVVAIERTREFRGRYH
FT                   VLGGAINPIGGVGPDDLHIRELVARLADGTVTELILATDPNTEGEVTASYLARQIGPMG
FT                   LRVTRLASGLPMGGDLEWADEVTLGRAFEGRRVVNA"
FT   gene            complement(670471..670980)
FT                   /locus_tag="FRAAL0611"
FT   CDS_pept        complement(670471..670980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RT18"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59285.1"
FT                   /translation="MSNSQTSAGDGTPAGGGLPAGGGAHLGQILQQAQKMQAALLSAQE
FT                   ELASARVDGTAGGGLVRATVNGGGELVDLTISPEAVDPEDTETLADLILAAVRDATTNA
FT                   HRLAAERMGSLTGGLGAGGLAGGGLGGATAAGGAGGALGGLGDLGGLLAGGGAAGPRGP
FT                   GRPGLG"
FT   gene            complement(671002..674052)
FT                   /locus_tag="FRAAL0612"
FT   CDS_pept        complement(671002..674052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0612"
FT                   /product="DNA polymerase III subunit gamma (partial match)"
FT                   /function="2.1.1 : DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT17"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59286.1"
FT                   /translation="MSTALYNRYRPATFAQVVGQEHVTDALRKALRTGRLHHAYLFSGP
FT                   RGCGKTSSARILAASLNCEQGPTPEPCGVCDECVGIRTGASMDVTEIDAASHGLVDDAR
FT                   DLRERAFFAPASARFKVFVVDEAHMVTAAAFNALLKVVEEPPPYLKFVFATTEPDKVIP
FT                   TIRSRTHHYAFRLVPPGVLRTHLASICEQEGVTVDPTVLPLVVRAGAGSVRDSLSVLDQ
FT                   LLAGADDDGLHYDRAVALLGMTDGVLLDETVDALARHDGAALFTVVDKVVSAGHDPRRF
FT                   ATDLLDRLRDLIIMAAVPDADARGLLESFSPDQIDRMRAQAAAVGPAELSRTADVLHGG
FT                   LVEMRGTTSPRLMLELILARALLPAASADPAALLTRLERLERRSVLAAPDSAAAHPASA
FT                   PGFGPDPAAGSSPFGGVNGPDGPRGMPGPPGPDEAAAPARTASPARPAPAHSARAAAAP
FT                   ASQGPASGSWDAAPVGSGAGPGAPTGGAGYGGPPPAGAGFGPQPGAGGGPGARQGAGTG
FT                   QGAGAGQGPGTGQGAGARHGLGAGQSAGAGQGAAAGQGGGVGPGGGRIDAAGLRMLWDE
FT                   VLQLASRRSRKTHAILKDHATVADVRGDEVVLAFASPTMGRMFGQGNNAEVFCTALAEK
FT                   IGGTWRVSVGPAGGSGPGRGGGRPVGGPPPGGGFGGQPGSGPAWAGPDQRFGGGGPAPA
FT                   AGGRAGGPAPGQPGPGQPVSGHWQGPGGGSHPDQQDHSGHARPGEGPGGVDAGGRPPAP
FT                   TGWAPGPGGGVPRADDGDAGRATGAHGPVGGPGEGGPGQGGPGQGVADDGWRGRGGESG
FT                   GDHHLGRRSDNTRFPEPTPPTHEHLEDGGSGTYYGDRGQGSGDAHGIVEQRGAGAHAAG
FT                   QNSTGRNGAGPNNAGPNSLGRNGVAQNSTDWNGARHHVGVHRAADQGAAAQGAAGQGAG
FT                   GGGAAARGGAGWAGGGEGGAGPIGVGGHGSAGGGGTRAAPPVNDEPSLDDDDAPGQVGG
FT                   ARGGAEAAMSLLRTGLGATVIEQIPTS"
FT   gene            complement(674114..674389)
FT                   /locus_tag="FRAAL0613"
FT   CDS_pept        complement(674114..674389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0613"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59287.1"
FT                   /translation="MPDVRPALARPALGRFLVYPEGFVSDLSLWIGKERARDGGGRAGV
FT                   AAGSGEVEDLQIHDRPGRARLRSRPLVRRYPREPPQGRKAARVSGL"
FT   gene            674539..674623
FT                   /locus_tag="FRAALtRNA6"
FT   tRNA            674539..674623
FT                   /locus_tag="FRAALtRNA6"
FT                   /product="tRNA-Ser"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(674614..675138)
FT                   /locus_tag="FRAAL0614"
FT   CDS_pept        complement(674614..675138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0614"
FT                   /product="putative integrase (Site-specific recombinase,
FT                   phage integrase family)"
FT                   /function="2.1.3 : DNA recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT15"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59288.1"
FT                   /translation="MPAAAGATEIVVGMRYREPVGTWTLYVDREPVGEVTVVSAVPMSG
FT                   TRARLTLAAPLPVDIGVDAELGWSMLSRRRLHDLRHSSASIQLAEGMDLALVSKRMRHS
FT                   STSITGNLYVHLLRSSGQEAAEAVAAAVPRSARRGRTRWAPNPRRGSFRLTRARFPLVA
FT                   EESARSDHCGG"
FT   gene            complement(675676..675885)
FT                   /locus_tag="FRAAL0615"
FT   CDS_pept        complement(675676..675885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0615"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59289.1"
FT                   /translation="MTQVLGAAEAAEAASIVATRQMNDAVARRIDSRMIVLSCSPALVD
FT                   IGRRGVNFAARGRPVGDAHGWWRR"
FT   gene            675839..676225
FT                   /locus_tag="FRAAL0616"
FT   CDS_pept        675839..676225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0616"
FT                   /product="putative Xylanase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT13"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59290.1"
FT                   /translation="MLAASAASAAPRTWVNTATSKCLDSNGKGAVYALGCNGGPYQSWV
FT                   SSQLNFGDQIQDVRTGRCLDSNGAKRVYTLPCNGGSYQQWQVTDQGPFGYQIQNVATGF
FT                   CLDSNGGGSVYTHVCNGGNYQRWH"
FT   gene            complement(676844..677689)
FT                   /locus_tag="FRAAL0617"
FT   CDS_pept        complement(676844..677689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59291.1"
FT                   /translation="MCKGAGAMADPGADTDRVGATLRTDRPHAARMYDYYLGGKDNFPA
FT                   DREAAEQAIAAFPNARVTARVNRAFMTRATRHLAADAGIRQFLDIGTGIPTSPNLHEVA
FT                   QAVAPDTRVVYADNDPIVLTHARALLTSTPQGRTAYVDADLRDPAAILDSPELQKTLDL
FT                   SRPLALSLVAIFHFLPDEDDPYGIVRRLVDALPSGSYLVLTHGTADFDPGAEEFAAAYR
FT                   QRGVPFQLRSRAEVERLFDGLELVDPGLLVAHRWRPDDDDSMSLLDAQVGLYGGVARKP
FT                   "
FT   gene            677794..678012
FT                   /locus_tag="FRAAL0618"
FT   CDS_pept        677794..678012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0618"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR025680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59292.1"
FT                   /translation="MKSDNDLIRPFTSNSQIWWSRGEPRDEVDYWLGSQPSYCPPWALI
FT                   PMATAQQVVRANFTTGERPDTVEWAQP"
FT   gene            complement(678686..680227)
FT                   /locus_tag="FRAAL0619"
FT   CDS_pept        complement(678686..680227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0619"
FT                   /product="putative antibiotic antiporter"
FT                   /function="4.S.15 : antibiotic"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RT10"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59293.1"
FT                   /translation="MDSQSAPALRLPPPAVAEWAEETAGRDDAFVWTNRHTVALLVLCL
FT                   AQLLEALDMTVVNVALPAVRDDLGFSAGNLAWVVNAYTVLFGGFLLLGGRAGDLLGRRR
FT                   VFLTGMLAFTVASLGAGLSQGETSLISARAVQGLAAGFVSPMTLAMIASIFPQGPPRNR
FT                   ALGVWGTTSALSASLGLILGGVLVDGPGWRWIFFINLPVAAVLLVSALRVLPPDRPTHR
FT                   HQRFDAVGAVASTIGASLLAYTVIQTDAHGWGSARTISLFALTVVVIAYFIVHETKISK
FT                   EPLVPFSLFRIRSLSAANTVQALTSAAMFALFFFTSLYMQNVLHYSSLKTGLAYLPLTA
FT                   TLVIFAGIVPPLIPKLGVRWVLVAGATVSAVGLALFSRITPERGLVSGIILPSLVVSFG
FT                   FSLMWIPMTIAAVSGVPGHQNGIAAAMLNVSRTLGGALGLAFISTFATRHTASLLARHD
FT                   PPRLEHALSDGYRLGFLISAALMVATAVTALTLFRNEGRGEKVDTAQLAAVGIEE"
FT   gene            680579..681412
FT                   /locus_tag="FRAAL0620"
FT   CDS_pept        680579..681412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0620"
FT                   /product="Putative cytochrome P450"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT09"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59294.1"
FT                   /translation="MEAPLMTLSVESHLPSCPMERSSPFEPPPGYARARSEAPITKVRL
FT                   VDGSTGWFVTGHALVRRLLNDPKVSKNGLRPGYPPLVPDQEALVRGQKGFLVWMDPPDH
FT                   TMYRRMLAGEFSVNTLERLRPHVEHIVNECIDQLLDAGPPADLVQVLSLPVPTMTICEL
FT                   LGVPYTDRQLFQESTAATVNLRTTQEERNRTVAELRQCATRAGDRLPHALPAAPGPARR
FT                   AADALGADRLRAGRGRTGEDGLVVLLTEDPPEERRQEVIDAAGSCPAQAILVDGE"
FT   gene            complement(681519..682148)
FT                   /locus_tag="FRAAL0621"
FT   CDS_pept        complement(681519..682148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0621"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RT08"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59295.1"
FT                   /translation="MALPPASSTPPASSTSPASSTSPASSTRAERRRQTESRILHAARE
FT                   LFAEHGYDRTTIRAVATRASTDPGLVMRYFGSKAELFSHAACLQEEAAAPDSPEELTEY
FT                   LLDTLTDRLTQEPTAALAMLRSMLTHPEAADAVRTSLGGQLKGVQEVISADDAAVRSGL
FT                   VSTILLGVVIGRVLLELDELTAADPAQIRQLLRPCVRLLVNDLPTG"
FT   gene            complement(682806..683828)
FT                   /locus_tag="FRAAL0622"
FT   CDS_pept        complement(682806..683828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0622"
FT                   /product="Putative hydrolase (partial)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT07"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59296.1"
FT                   /translation="MAEAHATRETTVTASDGVRLHVTEAGPPDAALTLVFVHGFCMTAD
FT                   AWHFQRRDLADLGRTVCYDQRAHGRSGPSDVEHCTIAQLADDLHRVLDDRVPTGPVVLI
FT                   GHSMGGMTVLGLAETHPELFGDRIIAVALLSTSAGELARLAFGLPATVTAAARRVLPGV
FT                   AVGLQHAPSLLERLRWRGSSASRALTRRLGFGVTRVPEPVVDSLEEMIANTPIPVVGAF
FT                   LPTLLDHDRLAAAGVLRDVPTLLLVGDADVMTPLEHSRTLAEALPRAELSVEKGAGHAV
FT                   ILERPHEVSARIRELVARARPARRTSRHRTTLTLRTPRAGRPGKRAQAHRLPDRLPDQR
FT                   "
FT   gene            complement(684144..684575)
FT                   /locus_tag="FRAAL0623"
FT   CDS_pept        complement(684144..684575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0623"
FT                   /product="Putative transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59297.1"
FT                   /translation="MREPLRADMFDELCPSALNPVRFGDKWAALIIRCLEDGPRRFSEL
FT                   RVPLGRITPKVLTHSLRSLERDGLLTRTVLNGTTTVRVEYELTALGRSMLEPMAIACAW
FT                   VAEHWEQLLDAREAYDRAIRFDRAAAALPAGRRAAAPIG"
FT   gene            684823..685302
FT                   /locus_tag="FRAAL0624"
FT   CDS_pept        684823..685302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0624"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59298.1"
FT                   /translation="MGDVTDAVDVQHAAAGQDAAISAAVDLAVPAHDFFTSSSRALATG
FT                   LAKAGVRRLVVVGVSSILPGASGAPLMDEPGFPDEYRSFCLGHAAGLDVLRACELDWVY
FT                   VAPAGDFDHDGARTGRYRIAEHGDSASRIGYADFAIALLDEIEEPRRHHCTVSVE"
FT   gene            complement(685328..687001)
FT                   /locus_tag="FRAAL0625"
FT   CDS_pept        complement(685328..687001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0625"
FT                   /product="Trehalose synthase (Maltose
FT                   alpha-D-glucosyltransferase)"
FT                   /function="1.6.9 : Polysaccharides, cytoplasmic"
FT                   /EC_number="5.4.99.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT04"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59299.1"
FT                   /translation="MRLSRTADLWWKNAVIYCLDVETFADGNGDGCGDFRGLTQRVDYL
FT                   HELGVTCIWLMPFYPTPDRDDGYDITDFYGVDPRLGTHGDLVEFLLVARDRGIRVIADL
FT                   VVNHTSDQHPWFVSARSSRDSPYRGYYVWRDEPPADGPSDVVFPDQEDSVWQYDDAAGQ
FT                   YYLHRFYKHQPDLDVANPAVRDEIARIMGFWIALGLSGFRVDAVPFLLETDGAADAADL
FT                   PDPHEYLRDLRAFVSRRDGEVVLLGEVNLPYDDTRRFFGDEDGDELTMCFDFPGMQRLY
FT                   LALARRDATPLLEALRDRPAAPKDCHWATFVRNHDELTLDKLDDGERQEVFAAFGPREE
FT                   MQLYGRGLRRRLPPMLDGDPARIRMVYSLLFALPGTPTLFYGEEIGMGENLDIPGREAV
FT                   RVPMQWSDGPNGGFSTVDPDAEADRLPAPVVQGEYGPAKVNVAAQRHDPTSLFSWVAAL
FT                   VRRYRQCPELAWGAGVTVDHDTASVLAHWTEHDGRAVLTLHNFAAASASVTLRLPEVGA
FT                   GARFVELLGEQAGAVRTVDEDGSLRLDVDAYAAHWLRTES"
FT   gene            687231..688355
FT                   /locus_tag="FRAAL0626"
FT   CDS_pept        687231..688355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0626"
FT                   /product="putative Short-chain dehydrogenase/reductase"
FT                   /function="1.7.9 : Misc. glucose metabolism"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RT03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59300.1"
FT                   /translation="MVGASSGIGRATALAFAQRGARVVCAARGEEALHALVGEISGEVG
FT                   AGRAFAVPTDVADPAAVRELAASAERRLGRIDTWVNAAAVSVLGRVEDVTDAEFDRVLR
FT                   INLLGQVHGAKAALPALRRAGGGVLIGVSSVEGIRAMPLHSAYAASKWGLRGFYDSLRV
FT                   ELAQEGVPIAVTTVLPPSVDTPFFAHARSRIGGRPKPPPPVYAADVVAAAIVRAAVRPS
FT                   REVLVGGTAVAAAIAARVSPALVDALLSLRRAGIETLREDRPGEPGDIVDAPEAGPGRV
FT                   DGDYPGRVLRHSPLTSLLGVGRRPVELLTAAVGRLHRSTPPGTAHLAARGAAGGPPPPS
FT                   PSGMTMPADTPLRRWRGTGSVMRSPGRTTGVAGG"
FT   gene            688547..689722
FT                   /locus_tag="FRAAL0627"
FT   CDS_pept        688547..689722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0627"
FT                   /product="putative Penicillin-binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59301.1"
FT                   /translation="MTRNEGGAAAATAAGAGFERVWRVPEGQVASGRIPGYVGALRIGG
FT                   RVEVRAGGRMALGPASAPMTADTRFRLASLTKLTAGVLVLGLEHDGLLGLDDPVARWLP
FT                   EAAAPRVLVAPDAPLDRTVEARRPITVRHLLTLTCGWGAVLEQTPLQAEMLRRGVFPGP
FT                   LTPRMSADEFVARVAGLPLAFQPGEGWLYDTGIDLLGVLLARCAGRPLSELVAERITGP
FT                   LAMASTGFWEPDPSRLATAYQPGPDGLAVLDAPDGAFARPPAFEELSSGLVSTAPDVLR
FT                   LLCALADGGDPVLPVGAVARMTADALTDAQRDQARPIVGPGGSWGLGTGVDVEPAEPWM
FT                   TPGRWGWDGGTGTTGHVDPTRGAVGVLLTQRAMTGPLDGFGEFWTAVAATR"
FT   gene            690281..691606
FT                   /locus_tag="FRAAL0628"
FT   CDS_pept        690281..691606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0628"
FT                   /product="putative DNA binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RT01"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59302.1"
FT                   /translation="MRAYRLAYGWTQEELVRRIRQYETEAGRGDPPLGHQRISRWERGE
FT                   RPSPRYLDALCAVLRTRPDRLGFGLDGSAQDVAPVLAETGWTDSIVPVQVRSGHPAGPT
FT                   APPPAAAVLARAGELRDVLDRSLWVEVPAEQVDRLDEVVRDQGFRYRTQPVIGMIGDLS
FT                   VDLAEVGRLLGRRQPLYQQRRLRGVAAKVAGITALSFSDLGHRVEMRGWFETAYRNASE
FT                   HGAAELLAWVVAKRAKAELENGASAQLVLTIAARAEALAGRSPSAGKLIAVTMQARALG
FT                   VQKKLPEVLRRARQALDLFDRLDPESTSSSVLAMSEQQLHLYIADALLAAGDWRRSLPH
FT                   FDRAVRLFPPGEPRDPVLTRINQAGALILGQQVDTGCEQIIRELTGIAEHWRSPLVLRW
FT                   AADGLRRVPERHRGQSAVRELRDLIATLTSIGSAGSVATIGW"
FT   gene            complement(691635..692267)
FT                   /locus_tag="FRAAL0629"
FT   CDS_pept        complement(691635..692267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0629"
FT                   /product="Putative acetyltranferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RT00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59303.1"
FT                   /translation="MTLTYGLPTRIEIPTVITSRLILRGWRPEDLHPYAAMNADPETMR
FT                   YLDGPFGLAGTERLVTHLLGMWMIHGHGMWAVEERGSGEFLGRAGVYFADGWPGIEVAV
FT                   SIRRDHWGQGLGTEAVRASLEFGFERLTVDELITSTHRDNAGMNAIAHRLGMTFRGIAD
FT                   VGPWLASNVYVMSRQQWYARTATADRALPRERDSPAARSSDSARPVG"
FT   gene            complement(692452..695520)
FT                   /locus_tag="FRAAL0630"
FT   CDS_pept        complement(692452..695520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0630"
FT                   /product="putative WD-repeat protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RSZ9"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59304.1"
FT                   /translation="MTVARVFVSHASSDVELADRIYRTLADLGHRAFLARDIRTGIRPG
FT                   EVWKERLHQELRAADAVICVVTEAYNTSPWCAYEIGIAHEVGSLLLPLRAQAGVASPLL
FT                   DDRQHVAVVDNGGWIGDLDGPLRRVDAAGGLGWAWDRSPFPGLRPFTRDMARVFYGRAD
FT                   ELRRLAHRLRALSDRRLLLVVGGSGCGKSSLVTAGLTARLGAEPGWEIADPFLPGRDPT
FT                   RKLALALAQTAIRVGLRWEPGEIHQRLVADDRALVGLAEELLSAGYGQPRDRLLLVVDQ
FT                   GEELFTRADAAERARFAGVLSRGLDGPIRVVIAVRSEFQDQLFALPELHGAHLHTFPLR
FT                   PLARDMLSVVITEPARVAGLSVEPELVSQMVADTDGGEALPLLAFTLHELARNQTRGGR
FT                   LSAQRYEELGGVRGALARRADAVLDEAVAAARLPRAEILAGMAELATLDEGGRRTRRRI
FT                   EVAELPSEAMRTAFGVFVEQRLLSTASDSLGGAGVGVVHEALLSVWPPLDAAIREREAA
FT                   LLSEGQVERAAAAWAHGGPLWDVDRLTAATTILWGSYDRFRAGGRAVVNLNNAGQRFLA
FT                   ECHCRVEAARHRERRRRRRTIAVLAALLAVTLAGAATAGWQGVSARQAQHSAERAQRAV
FT                   IAQALLTRADDVSATDRIRALRLSLAAWAVHPDAASQERLQTLASSRTALANGSPVTAV
FT                   AFSRDGKLLATGGADASVLLWSVAAGPDQPRRVGLPLTGLRSQVTAVTFSADGRQLVAT
FT                   GFDRTRMAWDIGDSARPRPVDPVAPALGPVDTCVDRSPAAPVEAVGEELGGVSLWSAGG
FT                   GAGNRRLLGWLPAGPGEARAVRFSPDGSILAVGSGRGVRLWDARTAARLPPATADAADL
FT                   IGRPALDACASETEKDEVRRDREGRESREGRSGPAGDGADTSARDARDARDAQDSRNAR
FT                   DSLDPPAPSLRPIGQPLTGHTHAVFSLAFSQDGSVLASGGNDGMLRLWRVSTVNASRRQ
FT                   VVAAACAEAGGGLDASSWQFYLPGVPYRPTCER"
FT   gene            696520..697980
FT                   /locus_tag="FRAAL0631"
FT   CDS_pept        696520..697980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0631"
FT                   /product="putative Pyridoxal-dependent decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RSZ8"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59305.1"
FT                   /translation="MAWDGPYVHQFDAETADLLRAIFDFTGVRLGFDPVPLDGPATPAE
FT                   LSARAGRTITEDGIGGLRALATFDEVLSRACISADHPRNLAFIPAAPTRLSVLFDVVVG
FT                   ASSIYAGSWMEGAGAVHAENETLRWLADLAGLPATAGGVFVPGGTVGNLSALVAARQAA
FT                   RARLAAEGRPMPARWRFVCGAEAHSSLYQAAMVLDADIVAVPTGEEGRLTGPLLAAALD
FT                   DLAGRSDLAGRGDLVGHRDSATPSDGPVHDGVFAVVATAGTTQFGIVDDLRGVVDVCRD
FT                   RGLWVHADGAYGLAALAAPSARPLFDGIADVDSFIVDPHKWLFAPFDACALIYRDPALA
FT                   RAAHGPQRAGYLDVLDSAVNWNPSDYAIGLSRRARGLPLWFSLAAHGTRAYAEAIETTL
FT                   ATTRAAAAQIAARPELELVRPAELSVVVFRRLGWQDADYHRWSENLLREGFAFVPPTRH
FT                   DGETVARFAVVNPRTTPADIEAILNTMV"
FT   gene            complement(697964..698155)
FT                   /locus_tag="FRAAL0632"
FT   CDS_pept        complement(697964..698155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0632"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59306.1"
FT                   /translation="MPGGEGDGRPPVAAPGRRGSKGLAPPDFLEEARAPGDLESTGHGA
FT                   RAAVYGAEHREHEIRPSC"
FT   gene            complement(698244..698885)
FT                   /locus_tag="FRAAL0633"
FT   CDS_pept        complement(698244..698885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0633"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59307.1"
FT                   /translation="MARIVIFGAGGQIGRRITDEAIRRGHEVTAVEVDAARVKKLPRKA
FT                   NAVEGDVTSRDSVQRLAQEADAVVVAVGGVDRPVHANAARTLVDVLPRIGDQAPAVLHV
FT                   SSGGTLEDDNGQRLVDSPDFPAAERKDALDQVDALDVYRGARNVRWAAIAPPPRNMGQG
FT                   QRRGAYRTGNDRPVVDAQGEIGISHEDFAIAVVDEVEKPRNRNRRFTVGN"
FT   gene            699438..699662
FT                   /locus_tag="FRAAL0634"
FT   CDS_pept        699438..699662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0634"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59308.1"
FT                   /translation="MEAVRGRVMLPGVLEVLVLPVAVNLASSALFELVRSWVAQARGPA
FT                   AQDAEFEVVETTDDQGNRVVVVRPRRTVR"
FT   gene            complement(699770..699859)
FT                   /locus_tag="FRAALtRNA45"
FT   tRNA            complement(699770..699859)
FT                   /locus_tag="FRAALtRNA45"
FT                   /product="tRNA-Ser"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(700088..700579)
FT                   /gene="tadA"
FT                   /locus_tag="FRAAL0635"
FT   CDS_pept        complement(700088..700579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="FRAAL0635"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="3.5.4.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RSZ4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59309.1"
FT                   /translation="MSGRGPAGGSDHEAAMGLALAQARLAPEHGDVPVGAVVVGPEGTV
FT                   LGAGRNTRERDGDPTAHAEVLALRAAAARVGSWRLSGATLVVTLEPCTMCAGALVLARV
FT                   DRLVYGAVDDKAGAVGSLWDVVRDRRLNHRPEVISGVRAAECATLLADFFTARRRPPTG
FT                   "
FT   gene            complement(700668..701162)
FT                   /locus_tag="FRAAL0636"
FT   CDS_pept        complement(700668..701162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0636"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59310.1"
FT                   /translation="MTTKAIAIARDHGRWSVHELDPVGAEDLDALTDTMRDFGDDTIVA
FT                   FLEEDDEYLAIVRVGADEPDPKVFLSDRRVLITSELAERLFADALPSMAGLATEDDEDD
FT                   DTSVLTQASPVGDLDLLVDLGTSEEALLELIGEEGMLPADLISALSERAGAGEILDDVR
FT                   G"
FT   gene            701602..702852
FT                   /gene="murD"
FT                   /locus_tag="FRAAL0637"
FT   CDS_pept        701602..702852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="FRAAL0637"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase
FT                   (UDP-N-acetylmuramoyl-L-alanine synthetase)"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /EC_number="6.3.2.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2129548; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RSZ2"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59311.1"
FT                   /translation="MTTSFPRRFTARTQAALAVERLAAEASRRLGRGSGEMIGGKLALR
FT                   VSPGALAEVGSHRRTACVSGTNGKTTTTRLLARALGTGGPVKSNSGGANMAPGVLAALS
FT                   RPPFDAAAALEVDEIWLPKVAREILPRVVLLLNISRDQLDRSNETRRIASMWRELGAEL
FT                   PDATVVANVDDPLVAWAAAGWRRQVWVSAGQNWTADAMVCPQCARLLHRNEAGWWSECG
FT                   LARPEPIVAVTGPRELLWYGRTISAHLDLPGRVNLGNAAMAAAAARELGVEVEAALGAM
FT                   AGLGDVQGRYQEVVLGEQGRRGRLLLAKNPAGWVEMMELLADAPPRPVVIDFNSQTADG
FT                   RDPSWIWDVPFERLAGRQVLVTGGRKEDMSVRLAYAEVPHSVHASAEDAALAANEKVVD
FT                   VVANYTAFRDLLVRSSR"
FT   gene            702849..703652
FT                   /gene="cobQ"
FT                   /locus_tag="FRAAL0638"
FT   CDS_pept        702849..703652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ"
FT                   /locus_tag="FRAAL0638"
FT                   /product="cobyric acid synthase"
FT                   /function="1.5.3.13 : Cobalamin (Vitamin B12)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:Q0RSZ1"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59312.1"
FT                   /translation="MRRTSATRIALIYPELLGTYGDGGNAIVLEQRLRWRGLPVEVVNV
FT                   PAGSPVPDSCDIYLLGGGEDAPQVLAADGIRQNRAIVRAVGSGAAVLAVCAGYQVIGAT
FT                   FPSGGEIHEGLNLVDIETRRSFAPPGTPPPGRAVGDIVVEPDPRLGLPTLYGYENHAGR
FT                   TRRLPGAGGFPLGVVRRGIGDGDGGTDGGGGTGGGGGTSGDGGGTDGIVDGRVVGTYLH
FT                   GPVLAQNPALADLLLTWIHGELPPLDAPREAQVLREARRRALATS"
FT   gene            703758..704426
FT                   /locus_tag="FRAAL0639"
FT   CDS_pept        703758..704426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0639"
FT                   /product="hypothetical protein; putative
FT                   Esterase/lipase/thioesterase domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RSZ0"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59313.1"
FT                   /translation="MWFGWIVASNPLAGWWGKNKRTVLIVGAVIVVLWVFIERGNGPKT
FT                   KRVSMPKDYGSADRELLVHAPSDPKDPIPLVLILHDDNVDAKTLDHDSAAGSVANARNF
FT                   AVAYPEAVGGTWRIDSPDGADAKYLRDVVSYVSAKKTKVDPNRIYVWGVGEGARLALTV
FT                   VCGGAKPIFAAVGVVGQFTQEPQSACPGRAPEARVAETKWNKKVSETLWTASAKHHLGA
FT                   "
FT   gene            complement(705290..706249)
FT                   /locus_tag="FRAAL0640"
FT   CDS_pept        complement(705290..706249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0640"
FT                   /product="Putative peptidase"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59314.1"
FT                   /translation="MALAGCATDVHADTALEESPNTAPITLAAQIGSRAALGGSIAAAA
FT                   VSEHSSSGLTLGAANGLDAPPLAGKVQVGLRVTNPDVTVNADEPVDIGFSLYNEATHEP
FT                   LANQLVKVQVKLPTGWATFKHLQTNAQGYASYTARVLTTTNVTAIFDGTDALQSAHSVN
FT                   DATLNVRPQRAPLAGVSARLGSLSGGVSVGSPQVSVPVPSSSIGAKAVYLASLQAGKPY
FT                   VYGADGPSSFDCSGLVQYVFKQLGKSLPRTTDAQFAATTRVSQYNKQPGDLIFLGSPGD
FT                   IYHVGIYAGDGKMWVAPHTGSVVKLQSIYTTSYYVGRV"
FT   gene            complement(706405..706576)
FT                   /locus_tag="FRAALmisc_RNA_5"
FT   misc_RNA        complement(706405..706576)
FT                   /locus_tag="FRAALmisc_RNA_5"
FT                   /product="ydaO-yuaA"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type n : RNA"
FT                   /inference="profile:Rfam:7.0"
FT   gene            complement(706939..707322)
FT                   /locus_tag="FRAAL0642"
FT   CDS_pept        complement(706939..707322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0642"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59316.1"
FT                   /translation="MPSSDPQRRETAILPERGDLIAELAGRLEALDALLNRLEDAERQA
FT                   ADASEHLIRTRRWQEDTVRTIQEERARMRQRQHALDELADHARAAVAALAHHRSLPREV
FT                   HELAVELQVLDAAGFLTRRGRAR"
FT   gene            complement(707262..707675)
FT                   /locus_tag="FRAAL0643"
FT   CDS_pept        complement(707262..707675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0643"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59317.1"
FT                   /translation="MRGRPAPGRPSRPGRQDDPNGAAGHSYPDDADPLGDRGPRIGRKS
FT                   PQTTQGVLCTRKPGKGSRSIAHFRYQLTAVTYPYDGLHPALPVGYRYQPCRSNRVSCPP
FT                   LGAVPRSPTRQGSTCPRLTPSGERPPSCPSGAT"
FT   gene            complement(707739..708911)
FT                   /locus_tag="FRAAL0644"
FT   CDS_pept        complement(707739..708911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0644"
FT                   /product="putative metal-transport protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RSY6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59318.1"
FT                   /translation="MPGQAGGEHPVLDALEDALGQASANAHRLAGALSRPVSLVRVGRK
FT                   RRRARRVELPATPDGRVMACGVYSHGRCVTMEVDHSDALRVARTERDGFAWLGLFEPSY
FT                   DQLAAVAQEYGLDKLAVEDAVTGGQRPKLEQYENHLFVVLKTASYVAHTEVTGTSEVVT
FT                   TGEIMIFLGEDFVVTVRHGQHGEMTRLRRRLEATPEMLRHGPTSVLHAICDSVVDNYVD
FT                   TVEKIQVDVDQIEAGVFRRDQTPSTESAYQMKRELLELKHAVQPLAGPLRTLTAEGPRL
FT                   VDAAMRRYFRDVADHLEQVSERIEHFDELLSSVLQATLTQVTIAQNEDMRRISAWVAIA
FT                   AVPTALAGIYGMNFEHMPELRQTWGYPTVLAVMATACLFLYRAFKRNGWL"
FT   gene            708885..709283
FT                   /locus_tag="FRAAL0645"
FT   CDS_pept        708885..709283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0645"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59319.1"
FT                   /translation="MLAARLAGHARATVRFRVPRFRVPRFRAPRFRAPRFRAPRFRAPR
FT                   FRAPRFRAPRFRAPRPRVPRLRACRVVSHHRLFPVAHVARRPRCQSPRFPSCRGAQLPK
FT                   RPSFPSGTASAERPRFRVPSFAAGSPPW"
FT   gene            709493..711340
FT                   /locus_tag="FRAAL0646"
FT   CDS_pept        709493..711340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0646"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR011935"
FT                   /db_xref="InterPro:IPR025554"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59320.1"
FT                   /translation="MVTEDLPQLVRLDAPIAAVVIHPRGARITRRGRVRLPVSAGYGSV
FT                   GTGLRVELDGLPWELAPDSVRVGGRGPGRVLGVDVVARTHPEPADTAGADLAARRLALA
FT                   AELTAIADEDDAEQARRGFLDVAARTGAAALARSWASTPGAAEGLAAAEDLLATRIGEV
FT                   HARRRALAGRRDDLERRIAALDRTIEARHAPRVPDTRTVVVDLDLDAPADLDAPADLDA
FT                   PADADAPADLDAPADRDAPADADAPADLDARADADAITDADVGADVEPDAGVEAGRQSA
FT                   EEGAEVELEVSYLVSTAGWRAGYDARLDGERVTLTWFALIAQRSGEDWPATADLVLSTA
FT                   RPAAHADLPELTPQFVDLSQPSPLPPPAVARTAAVPAAGGTPPGQSRGRSKAKQTKVLR
FT                   PAVADEPEIDFAGSATYRPPRRVAIPADGGRHRLTVAVIEFGASLDHLTVPRISPDAYL
FT                   RATITNTSPHTLLPGKVSIFHGTDFAGSGTIGTVPSGAEVELHLGVDDRVRVERELVHR
FT                   ATGRRVVGGNRRIEAGYRIEVTNHTPRPVRAVVRDQIPVSRHESVAVRDFQARPEPDER
FT                   TDVGLLSWTLALGPGATGRVEFSFRLEHPRGMELTGWRD"
FT   gene            complement(711352..711708)
FT                   /locus_tag="FRAAL0647"
FT   CDS_pept        complement(711352..711708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0647"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59321.1"
FT                   /translation="MARDQAVFAARSRLVDVRRRFLGRDLPPLGTLIVRHQVAVPDGAE
FT                   WPWALVSSWQHATLLGGRSLNDGAHPSVAHIRMGRPLRIRSADVVDWAIIDARGEIVEG
FT                   AWTRRLRAPADTTA"
FT   gene            complement(711716..711787)
FT                   /locus_tag="FRAAL0648"
FT   CDS_pept        complement(711716..711787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0648"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59322.1"
FT                   /translation="MPVAHTDAYRKEGFHYYCGHGWQ"
FT   gene            711906..712712
FT                   /locus_tag="FRAAL0649"
FT   CDS_pept        711906..712712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0649"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59323.1"
FT                   /translation="MIMAETLTTLVDAAHEDAVHLLELSRDGRDATGAPDATPTDPRQA
FT                   LHASDAAVAAVSAHLSAMEAVVYPEMARRVPGGRARVAELGRLARRCSSVMRGIEQYVQ
FT                   GDLNRPAGSVASLRRDLAALLAEHARAEDGLLRELTERLSDADRQHLVDRFADAMRHAP
FT                   TRPHPHLGHGGIFGGSLAIRLLGSFDHLLDVMDSREVAGAPVRAPAPAGLWGWYLLGRP
FT                   TSPAPEWPAADQPAPPADRAQPEAEIASGPEIGSGRSAARGTGPRR"
FT   gene            712823..713032
FT                   /locus_tag="FRAAL0650"
FT   CDS_pept        712823..713032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0650"
FT                   /product="Hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59324.1"
FT                   /translation="MAAVAYSAIGVPLRAIARGHAMLRVQDGPKWPACRALPRRCVRNR
FT                   EHRGPGARNGTGGCGLADTPRRGR"
FT   gene            712974..714140
FT                   /locus_tag="FRAAL0651"
FT   CDS_pept        712974..714140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0651"
FT                   /product="putative Sensory transduction histidine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RSX9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59325.1"
FT                   /translation="MPGTEPADVVWPILLVEDDDADAYLVSELLDEVAAPVELTRVRTV
FT                   AEAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGLVDEYRGAQAVAAG
FT                   AQDYLVKGQVDGRDLVRAVRYAIERKRADTAAQALRESELRADERARLERGLLPRPLYD
FT                   DRQLLHAARYRPGRQQSLLGGDFYDMVSTPDGTIHVLLGDVCGHGPDEAALGVSLRIAW
FT                   RTLVLAGVAEADRLGYLQRVLVSERERDEIFATVCALSIAPDRASLRMRLAGHPPPALL
FT                   HPRLAALPGDVVGPALGILDEDLTEEVLVELGPRWVLLLATDGLLEGREGPGGEPLGWE
FT                   GVLPEIAQLWPPDGPDGLLDSLIDRVEARNGGPLTDDVALLLLMWGAD"
FT   gene            714278..715960
FT                   /locus_tag="FRAAL0652"
FT   CDS_pept        714278..715960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0652"
FT                   /product="putative two-component sensor protein"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RSX8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59326.1"
FT                   /translation="MRRRLGVTYAVAAVALLIIVGLVVSSLVRLDNAIHTRSDIMAPAL
FT                   LGSAQLVSSLVDQETGMRGYLLQGHEEFLEPYNSGRRDESAQLADLQRRLAERPDLLGK
FT                   LRTLRERILAWHRDYADPSITAVRDRGPKAATALSPEVGKRRFDAVRAASDDLESALRT
FT                   KAIKARNNVGAALHFLVLALAIGALVLIVLLAAIARALRVWVTRPIEQVAADARTVASG
FT                   RLDHVVEPAGPPDMIALAGDVESMRQQLLSELGVARAARIAVETQAEVLQRSNRDLEQF
FT                   AYVASHDLQEPLRKVASFCQLLERRYGDKLDERGTQYIAFAVDGAKRMQQLINDLLAFS
FT                   RVGRSTDGFVEIALGDVLGRATTTLSLSIESLQAEVTADELPVVRGDPVLLTQLLTNLI
FT                   GNALKFRGDEIPRVHVSAVERAEDWEFACADNGIGIDPEYAEKIFVIFQRLHGRDVYEG
FT                   TGIGLALCRKIVEFHGGRIWLDATVEHGTTFRFTLPKQALLAPMSEPAALVGAVEAAGL
FT                   PSVSAPASAASSAAAPSTAEPPAPVPSNPAPAPNSARSSGGSS"
FT   gene            715957..716397
FT                   /locus_tag="FRAAL0653"
FT   CDS_pept        715957..716397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0653"
FT                   /product="Transcriptional regulatory protein"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type r : regulator"
FT                   /db_xref="GOA:Q0RSX7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59327.1"
FT                   /translation="MSEPLVPVEVLLVEDDPGDVLMTREAFEDHKLRNHLNVVSDGVEA
FT                   LAYLRGEGEYAGSPRPDLILLDLNLPRRDGREVLREVKADERLRRIPVVVLTTSEAEED
FT                   VLRSYDLHANAYITKPVDFERFVAVVRHIDDFFVTVARLPGQ"
FT   gene            716631..717290
FT                   /locus_tag="FRAAL0654"
FT   CDS_pept        716631..717290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RSX6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017519"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59328.1"
FT                   /translation="MATGPEPAQRRARAQRQALADLLTDLGPGHPTLCTGWTNHDLAAH
FT                   LVTRERVPWAAPGLVISSLHGITERAERATMRAHPYPELVETFRAGPPWWQPTRLGLID
FT                   DAANFVEFFVHAEDVRRADAGWEPRTLDDTSRDAMWAALRLIGFAGFRRAGVGVVAERT
FT                   DRPGRRILHAGEPTVEIMGPPEELVLYAFGRIEAARVELRGADDDVELLRATPVGL"
FT   gene            717563..718009
FT                   /locus_tag="FRAAL0655"
FT   CDS_pept        717563..718009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0655"
FT                   /product="Putative MutT/nudix-family hydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="GOA:Q0RSX5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59329.1"
FT                   /translation="MLVDPADAVLLLRSHDPTLDDAPQWWHVPGGGLDAGESAEQAAVR
FT                   EVFEEVGYRLLDPGPAVATRRASFTYLGREYAQFDTFFVARVPHRLELDSSSWTETERG
FT                   SILGWAWWTVPQLRATKQTVYPTRLVGLVEGWLRSGPPAAPIRL"
FT   gene            complement(718027..719370)
FT                   /locus_tag="FRAAL0656"
FT   CDS_pept        complement(718027..719370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0656"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RSX4"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59330.1"
FT                   /translation="MKHRSEGNPSPPRARAGSRRRRRRPHHPAWIASLGVLALLAAAIG
FT                   WSIAPAHDSAGDDGSTVEAAAVHVNARHHGGDPKATPSASARPSGTGRGHVPAASPSPS
FT                   RAGAGAPAATTTATTAKPVVPALTKPAVPTIRPTAKPPAAPVPIVPAGGGGGSVPGGMS
FT                   GVSAGSMTQVRAWESFRGSPVNAVLTFADRSSWQTITNPWLGSGPEKFSTFNGTWIISQ
FT                   PFFPTGGGDMNSCASGAYSGHWADFGRWLVSKGRPASIIRLAWEFNGNWFPWSVSKTNA
FT                   TTWVNCFRQVVGAIRSTDPQARIDWALNAHSGGAWSVYPGDQYVDIIGIDSYDQWPAST
FT                   TDAAFAKQCADPTGLCSVIAFARTHGKQFSVPEWGLVSKSDTGAGRAGQAGGDNPVYVR
FT                   NMYQTFAANRDVLAYETYFNNSEAGNVHSSLVGPNENPTAAATYASLW"
FT   gene            719477..719818
FT                   /locus_tag="FRAAL0657"
FT   CDS_pept        719477..719818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0657"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59331.1"
FT                   /translation="MEWPPGYPLGAPDGCLVRYDETLHGGNLARCPSSDAMHDSSVLVG
FT                   LEPCVRLVGAVGLMGPAAVRGPLVTRCSGGPLGGSLRPRRVVWNVWQAEVPVVSQCARG
FT                   PGRRGGSQR"
FT   gene            719961..720728
FT                   /locus_tag="FRAAL0658"
FT   CDS_pept        719961..720728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GOA:Q0RSX2"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59332.1"
FT                   /translation="MSQPPEYPPGGYPQGGHDQGGQGQGGYGPGQDQGQGGYGQGQGGY
FT                   EQGQGGYGQGQGGYEQGQGGYGPGPGQSQGGYGQGGYGPGQDQGQGGYGQGGYGQGQGG
FT                   YEQGGYGAPVPGYGPPPGGYGAPQGFGSPEGYGAPPGYGAPGGYGAPGGFGPPPPYGRP
FT                   ISNYLWQSIVVTVLCCLPAGVVAIVYATKVDGRRQMGDLNGALDASKKARMWCIISAIA
FT                   GVASFVIFLVVALVGGFDSSSSTSYSTLGPAAV"
FT   gene            720741..721175
FT                   /locus_tag="FRAAL0659"
FT   CDS_pept        720741..721175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0659"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RSX1"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59333.1"
FT                   /translation="MSSPPGGERPDPAGQLGGFDQSGGFDQSGGFGQPGGWPQGEPGGW
FT                   PPPEAGGAVATPAEDRPIRTYLWQSLVATLLCCLPTGIVAIVYATQTQTRLQAGNLAGA
FT                   REASGRARRWCVISLIAFVVVLLVYVVAIVITVAIVSRND"
FT   gene            complement(721144..721938)
FT                   /locus_tag="FRAAL0660"
FT   CDS_pept        complement(721144..721938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0660"
FT                   /product="putative Formate dehydrogenase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RSX0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59334.1"
FT                   /translation="MKPSDPPPSPADLPAPGSGRIATPSGLVRRFGRVPRWVHWLTAAL
FT                   MGCCLLTGATLYLPPLARLVGRRQLVETVHLYAGLALPVPMLVAAVSAGYRRDLRALNR
FT                   FTAADRAWLRASLRFGSWRRAAARARIVAGVGKFNAGQKLFAAFVAGGALVMLGTGMIM
FT                   QWGAGPLGPIPIGYRTGATFVHDLLAYGLFFGVVGHLWMAAHDPVARVGIRTGTVPVWW
FT                   AAREHPAWAPAPAVPSRPAPGETVGRDGDSGGISRCATRSPQ"
FT   gene            complement(721925..722584)
FT                   /locus_tag="FRAAL0661"
FT   CDS_pept        complement(721925..722584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0661"
FT                   /product="putative reductase with Sulfite oxidase, middle
FT                   catalytic domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="GOA:Q0RSW9"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59335.1"
FT                   /translation="MVALGAAGVAFGAPVERAVERVVTPIREKDPTGLSDLVPVGGFRY
FT                   YTVTSSVPRLGPDDYRLRVHGLVDRPMTLTLADLARMRQTTLVRDFQCVTGWRVGAVHW
FT                   SGVLLRDLLAAAGVQPAATALTFRSFDGVYTESLTLAQATRPDVLVALTMLGAPVTHDH
FT                   GGPVRLYVAPMYGYKSIKWLGEIEVVDTVTPGYWERQGYDVDGWVGRSNGRADEAV"
FT   gene            complement(722763..723911)
FT                   /locus_tag="FRAAL0662"
FT   CDS_pept        complement(722763..723911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0662"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GOA:Q0RSW8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59336.1"
FT                   /translation="MSPFDRLVRELDGTDAYAVLGVSRSADRAEIRRAYRARVRVHHPD
FT                   NPASRHPGSVRAMQLIVASHELLEKWRDDYDARTGRLSRPHRDTRATPPAASTPPATPT
FT                   APAAPTSPAAPTSPTASTSPTAPASPAADVRARRSAHRAAGAGETTGHHFFSSGHHYST
FT                   GYPTSRSQGPGTHPHRRAAWPAYPPMRPAGAAATARAAGSATRTDSTTRTDPDLRTDPD
FT                   IRAGSDVQAGFEVQAGFDIRTGFGIRTGSSSRGENGVQAAGEPWSVPDPRLDPHDPRAW
FT                   LPIRTRADGEDRLPQRRAPSHRAVRVRSHLGLSIVATILCAPVGAFGLVYSMRTSERLA
FT                   RGDVAGARLASRRCRAWCLAATAAGVVLLGVLAAVGGRNGPG"
FT   gene            complement(724055..724876)
FT                   /locus_tag="FRAAL0663"
FT   CDS_pept        complement(724055..724876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0663"
FT                   /product="Putative ABC transporter integral membrane
FT                   protein"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="GOA:Q0RSW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RSW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAJ59337.1"
FT                   /translation="MNLVLAARRSLRAELIKLWRPSTAVAMAILAVLSVLSTALLFGLA
FT                   DAGGPGAAGAGGSGGFGVTTGQVSAADGMALGFISGSTFTGLLIFLVFAITITLEYSQG
FT                   TLRTLFLREPRRLGWLAGRMSVMLALTAAALIGAVVLSVGVGYVTATLRGIDTSAWWSG
FT                   DGVRHLASGYLNALVAAAFFGVAGTVLGLVLRSTALTLAVGVAWTFPIEHIIQESWGAS
FT                   NRVLPGLVFDAIGQGGVSDAGYGTALLVGTAYAMGAALLGAITLARRDVTA"
FT   gene            complement(724873..725865)
FT                   /locus_tag="FRAAL0664"
FT   CDS_pept        complement(724873..725865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FRAAL0664