(data stored in ACNUC22857 zone)

EMBL: CT841508

ID   CT841508; SV 1; linear; mRNA; STD; HUM; 2933 BP.
XX
AC   CT841508;
XX
DT   23-MAR-2006 (Rel. 87, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens AP1B1 full length open reading frame (ORF) cDNA clone (cDNA
DE   clone C22ORF:pGEM.AP1B1.V3)
XX
KW   CDNA; chromosome 22; ORF.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2933
RX   DOI; 10.1186/gb-2004-5-10-r84.
RX   PUBMED; 15461802.
RA   Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
RA   Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J.,
RA   Beare D.M., Dunham I.;
RT   "A genome annotation-driven approach to cloning the human ORFeome";
RL   Genome Biol. 5(10):R84-R84(2004).
XX
RN   [2]
RP   1-2933
RA   Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
RA   Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J.,
RA   Beare D.M., Dunham I.;
RT   ;
RL   Submitted (23-MAR-2006) to the INSDC.
RL   Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK. E-mail enquiries:
RL   c22g@sanger.ac.uk
XX
DR   MD5; f358d8b58f5e3015cbb2c79c3ac2f953.
XX
CC   Sanger Institute name : pGEM.AP1B1.V3
CC   Homo sapiens cDNA sequence. This sequence was generated as part of
CC   The Wellcome Trust Sanger Institute program to isolate cDNA clones
CC   representing the full length open reading frame of well annotated
CC   protein coding genes on human chromosome 22.  For more information
CC   see http://www.sanger.ac.uk/HGP/Chr22/ORFcloning
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2933
FT                   /organism="Homo sapiens"
FT                   /chromosome="22"
FT                   /lab_host="Mach1"
FT                   /mol_type="mRNA"
FT                   /clone="pGEM.AP1B1.V3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        31..2850
FT                   /gene="AP1B1"
FT                   /db_xref="GOA:Q10567"
FT                   /db_xref="H-InvDB:HIT000340862.10"
FT                   /db_xref="HGNC:HGNC:554"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="PDB:4HMY"
FT                   /db_xref="PDB:4P6Z"
FT                   /db_xref="PDB:6CM9"
FT                   /db_xref="PDB:6CRI"
FT                   /db_xref="PDB:6D83"
FT                   /db_xref="PDB:6D84"
FT                   /db_xref="PDB:6DFF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10567"
FT                   /protein_id="CAJ86438.1"
FT                   /translation="MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGK
FT                   DVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLD
FT                   TLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFI
FT                   LDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLL
FT                   KKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHK
FT                   PPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNL
FT                   DLGPPVSGPPLATSSVQMGAVDLLGGGLDSLIGGTNFVAPPTAAVPANLGAPIGSGLSD
FT                   LFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMT
FT                   DFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNN
FT                   IDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQ
FT                   SSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVY
FT                   QAYETILKN"
XX
SQ   Sequence 2933 BP; 674 A; 898 C; 824 G; 537 T; 0 other;
     cggaagcctg gctacagata agggaccaaa atgactgact caaaatattt caccacgacc        60
     aagaaagggg agatcttcga gctgaaggca gagctcaaca gtgacaagaa ggagaagaag       120
     aaggaggcag tgaagaaagt gattgcatcg atgaccgtgg gcaaagatgt cagtgccctc       180
     ttccccgatg tggtcaactg catgcagacg gacaacctgg agctgaagaa gctagtatac       240
     ctctacttga tgaattacgc caagagtcag cctgacatgg ccattatggc cgtcaacacc       300
     tttgtgaagg actgtgagga ccccaacccc ctcatccgag ccctggcagt gcggaccatg       360
     ggctgcatcc gcgttgacaa gatcacagag tacctgtgcg agccactccg gaagtgcctg       420
     aaggacgagg atccatatgt gcgcaagaca gcagctgtgt gcgtggccaa gctccacgac       480
     atcaacgccc agctggtgga ggaccagggc ttcctggaca cccttaaaga cctcatctcc       540
     gactctaacc ccatggtggt ggccaatgca gtggcagcgc tctcagaaat tgccgagtct       600
     caccccagca gcaacctgct cgatctgaac ccacagtcca tcaacaagct gctgacagcc       660
     ctcaatgagt gcaccgagtg gggccagatc ttcatcctgg actgcctcgc caactatatg       720
     cccaaggacg accgcgaggc ccagagcatc tgtgagcggg tcacccccag gctctcccat       780
     gccaactccg ctgtggtgct ctctgctgtg aaggtgctga tgaagttcat ggagatgttg       840
     tctaaggact tggactacta cggcacactg ctcaagaagc tggccccacc cctggtcaca       900
     ctgctgtcag ccgagccaga gctgcagtat gtggccctgc gcaacatcaa tctcatcgtg       960
     cagaaaaggc ctgagatcct gaagcatgag atgaaggtgt tcttcgtgaa gtacaacgac      1020
     cctatctacg tgaagctgga gaagctggac atcatgatcc gcctggcctc tcaggccaac      1080
     atcgcccagg tgttggcaga gctgaaagag tacgcaacag aagtggatgt ggactttgta      1140
     cggaaggctg tgcgtgctat tggccgctgc gccatcaagg tggagcaatc tgcggagcgc      1200
     tgtgtgagca cgctgctcga cctcatccag accaaggtca actatgtggt ccaggaggcc      1260
     atcgtggtca tcaaggacat cttccgcaag taccccaaca agtatgagag tgtgattgcc      1320
     acactgtgtg agaatctgga ctccctggat gagcctgagg cccgggctgc catgatctgg      1380
     attgtgggcg agtacgcgga acggatcgac aacgcagatg agctgctgga gagcttcctc      1440
     gagggcttcc atgacgagag cacacaggtc cagctgcagc tgctgacagc cattgtgaaa      1500
     ctctttctaa agaagccaac agagacccag gagctggtgc agcaggtcct cagtttggcc      1560
     actcaggact cagataaccc agacctgcgg gaccgtggct acatctactg gcgcctgctg      1620
     tccacggacc cggtggcagc caaggaggtg gtgttggctg agaagccact catctctgaa      1680
     gagacggacc tcatcgagcc cacactgtta gacgagctta tctgctacat cggcacgctg      1740
     gcttccgtct accataagcc tcccagtgcc tttgtggagg ggggccgggg cgtcgtgcac      1800
     aagagcctgc cacctcgcac ggcctcgagt gagagcgcag agagccctga gacagcccct      1860
     actggagcac ctcctgggga gcagccagat gtcatccccg cccagggcga cctgctgggt      1920
     gacctcctca acctggacct cggcccccca gtgagcggcc cacccctggc cacctcctcg      1980
     gtgcagatgg gagctgtgga ccttcttggc ggtggccttg acagcctgat tgggggcacc      2040
     aacttcgtgg cacctccaac agcagcagta ccagccaatc ttggagcacc catcggcagt      2100
     ggcctgagtg acctctttga cctgaccagt ggcgtgggca ccctgtcagg atcatatgtg      2160
     gcccccaaag cagtctggct cccagccatg aaggctaagg ggctggagat ctcaggcacc      2220
     ttcacccgcc aggtgggctc catctccatg gacctgcagc tgaccaacaa ggccttgcag      2280
     gtcatgaccg actttgccat ccagttcaac cgcaacagct ttggcctggc ccccgccgcc      2340
     cccctccagg tccacgcgcc actcagcccc aaccagacag tggagatctc cctgcctctc      2400
     agcacggtgg gctcggtcat gaagatggag cctctgaaca acctccaggt ggccgtgaag      2460
     aacaacatcg atgtcttcta cttcagcacc ttgtacccac tgcacatcct ctttgtggag      2520
     gacgggaaga tggaccggca gatgttcctg gccacatgga aggatattcc caatgagaat      2580
     gaggcccagt tccagatcag agactgcccc ctcaatgcag aggctgcgag cagcaagctg      2640
     cagagcagca acatcttcac tgtcgccaag aggaacgtgg agggccagga catgctctac      2700
     cagtccctga agctgaccaa cggcatctgg gtgctggcgg agctgcggat ccagccgggc      2760
     aaccccagct gcacgctgtc cctgaagtgt cgagcaccag aggtgtccca gcacgtgtac      2820
     caggcctacg agaccatcct caagaactga gaccccggcc agcgcccacc ccagccttct      2880
     gcccgcccca tcgaggaggc ccctcggggg cagcacatct tcctcctcgc agg             2933
//

If you have problems or comments...

PBIL Back to PBIL home page