(data stored in ACNUC29543 zone)

EMBL: CT978603

ID   CT978603; SV 1; circular; genomic DNA; STD; PRO; 2224914 BP.
XX
AC   CT978603;
XX
PR   Project:PRJNA13654;
XX
DT   19-MAY-2007 (Rel. 91, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Synechococcus sp. RCC307 genomic DNA sequence.
XX
KW   .
XX
OS   Synechococcus sp. RCC307
OC   Bacteria; Cyanobacteria; Synechococcales; Synechococcaceae; Synechococcus.
XX
RN   [1]
RP   1-2224914
RA   Genoscope;
RT   ;
RL   Submitted (19-MAY-2006) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
DR   MD5; b35e319e7f0d9237fd6dca0f330fc715.
DR   BioSample; SAMEA3138265.
DR   EnsemblGenomes-Gn; EBG00000307196.
DR   EnsemblGenomes-Gn; EBG00000307197.
DR   EnsemblGenomes-Gn; EBG00000307199.
DR   EnsemblGenomes-Gn; EBG00000307200.
DR   EnsemblGenomes-Gn; EBG00000307201.
DR   EnsemblGenomes-Gn; EBG00000307203.
DR   EnsemblGenomes-Gn; EBG00000307204.
DR   EnsemblGenomes-Gn; EBG00000307205.
DR   EnsemblGenomes-Gn; EBG00000307206.
DR   EnsemblGenomes-Gn; EBG00000307207.
DR   EnsemblGenomes-Gn; EBG00000307209.
DR   EnsemblGenomes-Gn; EBG00000307210.
DR   EnsemblGenomes-Gn; EBG00000307211.
DR   EnsemblGenomes-Gn; EBG00000307212.
DR   EnsemblGenomes-Gn; EBG00000307213.
DR   EnsemblGenomes-Gn; EBG00000307214.
DR   EnsemblGenomes-Gn; EBG00000307215.
DR   EnsemblGenomes-Gn; EBG00000307216.
DR   EnsemblGenomes-Gn; EBG00000307219.
DR   EnsemblGenomes-Gn; EBG00000307220.
DR   EnsemblGenomes-Gn; EBG00000307222.
DR   EnsemblGenomes-Gn; EBG00000307223.
DR   EnsemblGenomes-Gn; EBG00000307225.
DR   EnsemblGenomes-Gn; EBG00000307226.
DR   EnsemblGenomes-Gn; EBG00000307227.
DR   EnsemblGenomes-Gn; EBG00000307228.
DR   EnsemblGenomes-Gn; EBG00000307229.
DR   EnsemblGenomes-Gn; EBG00000307230.
DR   EnsemblGenomes-Gn; EBG00000307231.
DR   EnsemblGenomes-Gn; EBG00000307232.
DR   EnsemblGenomes-Gn; EBG00000307233.
DR   EnsemblGenomes-Gn; EBG00000307234.
DR   EnsemblGenomes-Gn; EBG00000307235.
DR   EnsemblGenomes-Gn; EBG00000307236.
DR   EnsemblGenomes-Gn; EBG00000307237.
DR   EnsemblGenomes-Gn; EBG00000307238.
DR   EnsemblGenomes-Gn; EBG00000307239.
DR   EnsemblGenomes-Gn; EBG00001465253.
DR   EnsemblGenomes-Gn; EBG00001465254.
DR   EnsemblGenomes-Gn; EBG00001465255.
DR   EnsemblGenomes-Gn; EBG00001465256.
DR   EnsemblGenomes-Gn; EBG00001465258.
DR   EnsemblGenomes-Gn; EBG00001465261.
DR   EnsemblGenomes-Gn; EBG00001465263.
DR   EnsemblGenomes-Gn; EBG00001465264.
DR   EnsemblGenomes-Gn; EBG00001465265.
DR   EnsemblGenomes-Gn; EBG00001465266.
DR   EnsemblGenomes-Gn; EBG00001465268.
DR   EnsemblGenomes-Gn; EBG00001465270.
DR   EnsemblGenomes-Gn; EBG00001465271.
DR   EnsemblGenomes-Gn; EBG00001465272.
DR   EnsemblGenomes-Gn; EBG00001465273.
DR   EnsemblGenomes-Gn; EBG00001465274.
DR   EnsemblGenomes-Gn; EBG00001465275.
DR   EnsemblGenomes-Gn; EBG00001465276.
DR   EnsemblGenomes-Gn; EBG00001465277.
DR   EnsemblGenomes-Gn; EBG00001465278.
DR   EnsemblGenomes-Gn; EBG00001465279.
DR   EnsemblGenomes-Gn; EBG00001465280.
DR   EnsemblGenomes-Gn; EBG00001465281.
DR   EnsemblGenomes-Gn; EBG00001465282.
DR   EnsemblGenomes-Gn; EBG00001465283.
DR   EnsemblGenomes-Gn; EBG00001465284.
DR   EnsemblGenomes-Gn; EBG00001465285.
DR   EnsemblGenomes-Gn; EBG00001465286.
DR   EnsemblGenomes-Gn; EBG00001465287.
DR   EnsemblGenomes-Gn; EBG00001465288.
DR   EnsemblGenomes-Gn; EBG00001465289.
DR   EnsemblGenomes-Gn; EBG00001465290.
DR   EnsemblGenomes-Gn; EBG00001465291.
DR   EnsemblGenomes-Gn; EBG00001465292.
DR   EnsemblGenomes-Gn; EBG00001465293.
DR   EnsemblGenomes-Gn; EBG00001465295.
DR   EnsemblGenomes-Gn; EBG00001465296.
DR   EnsemblGenomes-Gn; EBG00001465298.
DR   EnsemblGenomes-Gn; EBG00001465299.
DR   EnsemblGenomes-Gn; EBG00001465301.
DR   EnsemblGenomes-Gn; EBG00001465302.
DR   EnsemblGenomes-Gn; EBG00001465303.
DR   EnsemblGenomes-Gn; EBG00001465305.
DR   EnsemblGenomes-Gn; EBG00001465306.
DR   EnsemblGenomes-Tr; EBT00000257243.
DR   EnsemblGenomes-Tr; EBT00000257245.
DR   EnsemblGenomes-Tr; EBT00000257246.
DR   EnsemblGenomes-Tr; EBT00000257247.
DR   EnsemblGenomes-Tr; EBT00000257248.
DR   EnsemblGenomes-Tr; EBT00000257249.
DR   EnsemblGenomes-Tr; EBT00000257250.
DR   EnsemblGenomes-Tr; EBT00000257251.
DR   EnsemblGenomes-Tr; EBT00000257252.
DR   EnsemblGenomes-Tr; EBT00000257254.
DR   EnsemblGenomes-Tr; EBT00000257255.
DR   EnsemblGenomes-Tr; EBT00000257256.
DR   EnsemblGenomes-Tr; EBT00000257258.
DR   EnsemblGenomes-Tr; EBT00000257259.
DR   EnsemblGenomes-Tr; EBT00000257260.
DR   EnsemblGenomes-Tr; EBT00000257261.
DR   EnsemblGenomes-Tr; EBT00000257262.
DR   EnsemblGenomes-Tr; EBT00000257263.
DR   EnsemblGenomes-Tr; EBT00000257264.
DR   EnsemblGenomes-Tr; EBT00000257265.
DR   EnsemblGenomes-Tr; EBT00000257267.
DR   EnsemblGenomes-Tr; EBT00000257269.
DR   EnsemblGenomes-Tr; EBT00000257270.
DR   EnsemblGenomes-Tr; EBT00000257271.
DR   EnsemblGenomes-Tr; EBT00000257272.
DR   EnsemblGenomes-Tr; EBT00000257275.
DR   EnsemblGenomes-Tr; EBT00000257278.
DR   EnsemblGenomes-Tr; EBT00000257279.
DR   EnsemblGenomes-Tr; EBT00000257280.
DR   EnsemblGenomes-Tr; EBT00000257281.
DR   EnsemblGenomes-Tr; EBT00000257284.
DR   EnsemblGenomes-Tr; EBT00000257285.
DR   EnsemblGenomes-Tr; EBT00000257286.
DR   EnsemblGenomes-Tr; EBT00000257287.
DR   EnsemblGenomes-Tr; EBT00001619050.
DR   EnsemblGenomes-Tr; EBT00001619052.
DR   EnsemblGenomes-Tr; EBT00001619053.
DR   EnsemblGenomes-Tr; EBT00001619054.
DR   EnsemblGenomes-Tr; EBT00001619055.
DR   EnsemblGenomes-Tr; EBT00001619056.
DR   EnsemblGenomes-Tr; EBT00001619057.
DR   EnsemblGenomes-Tr; EBT00001619058.
DR   EnsemblGenomes-Tr; EBT00001619059.
DR   EnsemblGenomes-Tr; EBT00001619060.
DR   EnsemblGenomes-Tr; EBT00001619061.
DR   EnsemblGenomes-Tr; EBT00001619063.
DR   EnsemblGenomes-Tr; EBT00001619065.
DR   EnsemblGenomes-Tr; EBT00001619066.
DR   EnsemblGenomes-Tr; EBT00001619067.
DR   EnsemblGenomes-Tr; EBT00001619068.
DR   EnsemblGenomes-Tr; EBT00001619070.
DR   EnsemblGenomes-Tr; EBT00001619071.
DR   EnsemblGenomes-Tr; EBT00001619072.
DR   EnsemblGenomes-Tr; EBT00001619074.
DR   EnsemblGenomes-Tr; EBT00001619075.
DR   EnsemblGenomes-Tr; EBT00001619076.
DR   EnsemblGenomes-Tr; EBT00001619077.
DR   EnsemblGenomes-Tr; EBT00001619079.
DR   EnsemblGenomes-Tr; EBT00001619080.
DR   EnsemblGenomes-Tr; EBT00001619081.
DR   EnsemblGenomes-Tr; EBT00001619082.
DR   EnsemblGenomes-Tr; EBT00001619083.
DR   EnsemblGenomes-Tr; EBT00001619084.
DR   EnsemblGenomes-Tr; EBT00001619085.
DR   EnsemblGenomes-Tr; EBT00001619086.
DR   EnsemblGenomes-Tr; EBT00001619087.
DR   EnsemblGenomes-Tr; EBT00001619088.
DR   EnsemblGenomes-Tr; EBT00001619089.
DR   EnsemblGenomes-Tr; EBT00001619090.
DR   EnsemblGenomes-Tr; EBT00001619091.
DR   EnsemblGenomes-Tr; EBT00001619094.
DR   EnsemblGenomes-Tr; EBT00001619095.
DR   EnsemblGenomes-Tr; EBT00001619096.
DR   EnsemblGenomes-Tr; EBT00001619097.
DR   EnsemblGenomes-Tr; EBT00001619098.
DR   EnsemblGenomes-Tr; EBT00001619099.
DR   EnsemblGenomes-Tr; EBT00001619100.
DR   EnsemblGenomes-Tr; EBT00001619101.
DR   EnsemblGenomes-Tr; EBT00001619102.
DR   EnsemblGenomes-Tr; EBT00001619103.
DR   EnsemblGenomes-Tr; EBT00001619104.
DR   EuropePMC; PMC2442094; 18534010.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01739; glnA.
DR   RFAM; RF01752; psaA.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CT978603.
DR   SILVA-SSU; CT978603.
DR   StrainInfo; 827612; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2224914
FT                   /organism="Synechococcus sp. RCC307"
FT                   /mol_type="genomic DNA"
FT                   /note="Genoscope sequence ID : Syn_RCC307"
FT                   /db_xref="taxon:316278"
FT   CDS_pept        174..1313
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SynRCC307_0001"
FT                   /product="DNA polymerase III beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26904"
FT                   /db_xref="GOA:A5GPU5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU5"
FT                   /protein_id="CAK26904.1"
FT                   /translation="MKLVCSQAELNGSLQLVSRAIAGRPTHPVLANVLVTADAAAGRIS
FT                   LTGFDLSLGIQTSFAAVVESSGAITLPAKLFTDIVSRLPADGPLTLACPEGEEQTELSA
FT                   LTGSYQMRGLSAEDFPDLPLAQNGQPLLLSGEAFAEGLRSTLFASSGDESKQILTGIHL
FT                   KVEDGGLEFAATDGHRLAVRRNGAGGQEGAESFAVTVPARSLRELERLLSARPSEESIS
FT                   LFCDRGQVVFLWADQVLTSRTLEGTYPNYGQLIPESFARTISLERKPFIAALERIAVLA
FT                   DQHNNVVKLTADPASGQLQLSADALDVGSGSESLAAQINGEEIAMAFNVRYLLEGLKAM
FT                   ADATVRLNLNSPTSPAVLSADEDGEAGFTYLVMPVQIRS"
FT   CDS_pept        1314..2042
FT                   /transl_table=11
FT                   /gene="SynRCC307_0002"
FT                   /locus_tag="SynRCC307_0002"
FT                   /product="RNA metabolism-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26905"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU6"
FT                   /protein_id="CAK26905.1"
FT                   /translation="MPLPRQILISELLRSRLRDELGQDLGVGHQVWMHPPCHRLLGWSS
FT                   RPSAFGPRRSVWRLDQLVDWLEGQVEVEGEPADTEQPTLDLLPTLMEATLLGQQQQPLG
FT                   RLVDAVVDVQSGRINHYLVARSDPRLPGSSRWRLEPDRLIDQQPGQVQAALQELDDLPL
FT                   DRASIRQQMLRRSRQIRDQVPDSFDDFEGRLRSFGQRLWDGGEDLIERWRDEEPPVDER
FT                   RSRPRSRDWDDPDDGEDPWI"
FT   CDS_pept        2082..4454
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="SynRCC307_0003"
FT                   /product="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain"
FT                   /EC_number="6.3.5.3"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26906"
FT                   /db_xref="GOA:A5GPU7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU7"
FT                   /protein_id="CAK26906.1"
FT                   /translation="MASTPASGAPAFDQAPPAIAAQVKQEGLTPEDYNEIVRRLGRHPN
FT                   RAELGMFGVMWSEHCCYRNSRPLLGQFPTEGPRILVGPGENAGVVDLGEGHRLAFKIES
FT                   HNHPSAVEPFQGAATGVGGILRDIFTMGARPMALLNALRFGPLEESRNAGLMEGVVAGI
FT                   AHYGNCVGVPTVAGEVAFDPSYSGNPLVNAMALGLMETETIVRSGASGVGNPVVYVGST
FT                   TGRDGMGGASFASAELSEDSLDDRPAVQVGDPFLEKGLIEACLEAFQSGDVVAAQDMGA
FT                   AGLTCSCAEMAAKGDLGIELDLDRVPARETGMTAYEFLLSESQERMLFVVQAGREEPLM
FT                   QRFRRWGLQAAVVGRVLEEPVVRVLQNGAVAAEVPSRALAEDTPINRRELLSEPPAVVQ
FT                   QHWQWQESSLPALAAEAVEPTLLQLLDDPTIASKRWVWRQYDHQVQANTVVRPGGADAA
FT                   VLRLRSQQEDDPQSSNQRGVAATVDCPNRWVALDPERGGMAAVAEAARNLSCVGAEPIA
FT                   VTDNLNFPSPETPTGYWQLAMACRGLSEACRVLQTPVTGGNVSLYNDTRLPDGSIQPIQ
FT                   PTPVVGMVGLVDNINTLVGLAWPQPAPGVAGDYLVLLGLPLDTAQDDERLGLAGSSFLQ
FT                   VCHGLCTGRPPHTDLALEQQVQKAVRSGIRAGQITAAHDVSDGGLLVAVAEMAIAAGCG
FT                   VQLSVPSAGRLERLLFAEGGARVVVSVPEDSWPALQAALQQAGCPLQALGRVQADPQLQ
FT                   LRVGDRDLLDVAIDALAHAHQQGLPRRLEQPALGHNG"
FT   CDS_pept        4461..5960
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SynRCC307_0004"
FT                   /product="Glutamine phosphoribosyl pyrophosphate
FT                   amidotransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26907"
FT                   /db_xref="GOA:A5GPU8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU8"
FT                   /protein_id="CAK26907.1"
FT                   /translation="MKASAAVTIQWPEQSGGAPDRMEEACGVFGVLASGQQVSSLCYFG
FT                   LYALQHRGQEAAGIAVFEGDRVRLHKDMGLVSQVFDQDVLERMPGDLAVGHTRYSTTGS
FT                   SRVCNAQPLVLMTRLGPFALAHNGNLVNAMQLRDQLQQQGCQATGTTDSELIAFAVQAQ
FT                   VEAGLDWDEAIKAAARQCQGAFSLVIGTPDALYGLRDGHGLRPLVFGSLPEAEVASWVL
FT                   SSESCGLDIVGARFHDDVAAGELVRFHSGEAQPFRSRWIEETPKLCVFELIYFARPDSR
FT                   FFGESLYSYRKRIGQRLAQESPVEADLVIGVPDSGIPAAIGYSQASGIPFGDGLIKNRY
FT                   VGRTFIQPTKAMREAGIRVKLNPLPDVLEGQRIVVIDDSIVRGTTSRKLVQAFRDAGAS
FT                   EVHMRISSPPVTHPCFYGIDTDTQDQLIAARLKLEEIEAHLGVDSLAYLSREGMLHCAQ
FT                   EQSENFCSACFDGNYPIPVEDGMRKSKLMLEPAGVAAGLKS"
FT   CDS_pept        complement(5970..8432)
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="SynRCC307_0005"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26908"
FT                   /db_xref="GOA:A5GPU9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU9"
FT                   /protein_id="CAK26908.1"
FT                   /translation="MADERIVSISLHQEMQRSYLEYAMSVIVGRALPDVRDGLKPVQRR
FT                   ILFAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFGCRNPLLDGH
FT                   GNFGSVDDDPPAAMRYTETRLAPVSHQALLEEIGSDTVDFAPNFDGSQQEPTVLPAQLP
FT                   FLLLNGCTGIAVGMATSIPPHNLGEVVDALVALIRNPNLSDEKLLQLVPGPDFPTGGVV
FT                   LTGSGLRDTYLHGRGSIPMRGVAHIEEVQPGKGRHKRNAVVITELPYQLSKAGWIEKLA
FT                   EQVNDGKVAGIADIRDESDRDGMRVVVELRRDANPEQVLAQLHKRTALQNNFGAILLAL
FT                   VNGQPIQLSLRQMLQQFLEYRELTMMRRTRYALRRCEERLEVVEGLIKALDDLAKVIQM
FT                   IQDARDAASAKASLQVHLDISERQADAVLSMPLRRLTGLEQESLRQELEELRQEQSRLR
FT                   HLLDDRKSLLDTLVSELKHLRKRYATPRRTALQEGGDELVAQRTAAQRPNTEMLRKQAL
FT                   ANVSSDQQLLWQSDGILRLVTPQVLGRLHLLDDLDFGDHGCSAKLLLPVQPEPQLLAFT
FT                   SGGRVAALRWEFAAQQPGPLERFLPDSVDGQAEQVVDVLVVPPADQDFSVGLLSSDGRF
FT                   KRLAGQDLRELSGRATTVLKLKDGVQLQRVVMCRPGDDLAVASSTGRMLRLPVDDSTIP
FT                   VMGRTAQGPVLMRLLPGESIVGAAAVAAGGDVLLISQLGQLKRLGIDHLRRCQRGAIGE
FT                   IGLRFEQRNDALTDLRSTTARLSVETQAGSLRLASDSLPVQDGRGTGQQLKLPKGQTVQ
FT                   RLLPLIDG"
FT   CDS_pept        complement(8482..9366)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0006"
FT                   /locus_tag="SynRCC307_0006"
FT                   /product="Secreted Tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26909"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV0"
FT                   /protein_id="CAK26909.1"
FT                   /translation="MRRWLPALCAAALLSPVLPARALVPYVYVPTSEELNDAGVNIAGA
FT                   AAGLLRIGQIAEARRLGRLAVQLLPDDPRAWLVLAEAELRSSDGNNRGEQTAKAEAALA
FT                   RAKELDPKNAGVWFAEGSLNLRNDRPAAAEQLLKEGLRLDPKNPGAYFDLGNAQIKQGN
FT                   LGAALKSFEKASGLRQNFWEAVNNQGIVLFEEDRRDDAINRWRQAVEMSDGEAEPMLAL
FT                   AAALYANGDDSADTLGLAVQALIKQPDYVLAAFQEDQLWGTKLVAATQELFENEQVKGA
FT                   VQRAKGLATFQSN"
FT   CDS_pept        complement(9387..10346)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0007"
FT                   /locus_tag="SynRCC307_0007"
FT                   /product="Uncharacterized Fe-S protein"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26910"
FT                   /db_xref="GOA:A5GPV1"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GPV1"
FT                   /protein_id="CAK26910.1"
FT                   /translation="MVSSDTGECFSGATVRVPADLADALKQQALEQGFALAGIAAVPSG
FT                   ERIAMRTAALQRWLAAGHQADMAWMQDPRRQAIELLLPGVQSVLAVALNYYVDQQQTPA
FT                   SPKIARYGWGRDYHRVMDQRLRRLGRWLEEQQPSCRWRACVDSAPLMDKAWAEEAGLGW
FT                   IGKNGNLISPSHGSWLLLGHLLTTASLPADQPARSLCGHCQRCLPACPTAAITEPFVVD
FT                   SRRCIAFHTIENRDEQVPLPLHGWVAGCDVCQEVCPWNQHHAQSSADPAVQPREWILSS
FT                   TVNEMASWSDDTWSERLQASALRRIKPWMWRRNLADLG"
FT   CDS_pept        10330..10980
FT                   /transl_table=11
FT                   /gene="SynRCC307_0008"
FT                   /locus_tag="SynRCC307_0008"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26911"
FT                   /db_xref="GOA:A5GPV2"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV2"
FT                   /protein_id="CAK26911.1"
FT                   /translation="MSELTTSRLSGLLRWIGGVLVILLGFELLAVLMANAWGEEAFHQL
FT                   LVDTLLAHAPMALVGLLLMLVGSRLDFPAQGRSPLRWTVLVVGALMSLALFVAIPVQVG
FT                   GNQLIQLEANRSVDQKRSEFEQAQQESQDPKLMEMLQAQLEQAGQVSAEAKPEDKKAQV
FT                   QALIDQRLDQLKQQQVQAERTRDLTLGQRRWGGTAVALLLALASLAVALAAVL"
FT   CDS_pept        11034..11777
FT                   /transl_table=11
FT                   /gene="SynRCC307_0009"
FT                   /locus_tag="SynRCC307_0009"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26912"
FT                   /db_xref="GOA:A5GPV3"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV3"
FT                   /protein_id="CAK26912.1"
FT                   /translation="MVQSRSRSEPPVNVRLQQDLKNDLIAGLLVVIPLATTIWLATLVT
FT                   RFVVSFLTSVPKQFNPFNTLNPLLQELINLSVGLLVPLLGILLIGLMARNIVGRWLLDF
FT                   GEGTLARIPLAGSVYKTLKQILETVLRDNSTRFRRVVLIEYPRDGIYALGFVTGMLSAG
FT                   MQAGFPQPMISVFIPTAPNPTTGWYSIVPEASVKDLDMSVEEAFRTIISAGIVNPDEQP
FT                   SPSNRSFSSLLAQLRPTPLSAPPKA"
FT   CDS_pept        11781..12392
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SynRCC307_0010"
FT                   /product="Transcription termination factor, NusB"
FT                   /note="Transcription termination factor, NusB"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26913"
FT                   /db_xref="GOA:A5GPV4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV4"
FT                   /protein_id="CAK26913.1"
FT                   /translation="MQNRTIARELALLILGQLQDRHAPEATTTEQLLAQAMASLNSHLR
FT                   ESLDQAAEELQQAQQALLDSELAEGQLPQVREHLRQGLERSEQVLNRLSSSLEYPRLLQ
FT                   LADQQDLRHWALLRAKAVAEAQPQLDQGIDAVMEGWRLTRLPRIDQDILRLAVVEIDEF
FT                   QTPAAVACNEAVELAHRYSDEAGRRMINGVLRRYTTAAAR"
FT   CDS_pept        12396..13868
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="SynRCC307_0011"
FT                   /product="Signal recognition particle GTPase, FtsY"
FT                   /note="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26914"
FT                   /db_xref="GOA:A5GPV5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV5"
FT                   /protein_id="CAK26914.1"
FT                   /translation="MAEFDWFQRQDASESSDAQQPDDALDWAKQAYARLKAQQEAEKTA
FT                   AAAHPAEPAPEPVPVSEPEAAPEQPAAAAEVLDSSVAAEPEPEPVSAVPEPAPQPEPEP
FT                   AVPSAPSWLEAAAARRQERLEQLVEEEPSAEPEPELVQVSEPEAEPKLGQLDEDFLWSA
FT                   EVLAAQGRQADQISLEEIDWLGRLRRGMEKTRQNFVTTLLENLGDDPLSEASLDDIETL
FT                   LLQADVGVEATDQVLDLLRRRMNEAVVDGSEAINLLKDQLRNLLDAPIKSMGANPLLAP
FT                   QKGRLNIWLMVGVNGVGKTTTLGKLANLAVRSGYSCLVAAGDTFRAAAVQQLQVWADRS
FT                   GVPLVANPSANADPAAVVFDAIGAAQSKDIELLLVDTAGRLQTKNNLMEELAKVRRIVD
FT                   RLAPDAAVESLLVLDASQGQNGLRQAMAFAKAAGLTGVVLTKLDGTARGGVAFAVASES
FT                   NLPIRFIGAGEGLRDLRPFNSFEFVEALLARA"
FT   CDS_pept        13911..15284
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="SynRCC307_0012"
FT                   /product="Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /note="Signal transduction mechanisms / Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26915"
FT                   /db_xref="GOA:A5GPV6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV6"
FT                   /protein_id="CAK26915.1"
FT                   /translation="MGGTPPAHRSPAAITPAASLRQLIDSLNREQRRNQELLASLGFAL
FT                   RSFTNLSRFLELVPLLTARLVEAEGAVLLTFRSDGGLWREQLHCSSQSRCGELLRQLAG
FT                   LQDSDLDRDAGDEAMATRLDQLVRRQLGDVQLFGTSVVAKNRQRGRLYVFSGDPQFSWS
FT                   EVRRRHVQLVADQTAVAIENELLLEEMRRHERLDQQLSIGGEIQSQLLPSRCPVIEGVE
FT                   LAARCRPAFQVGGDYFDFIPTRPQLLGKRREQGRWALVMGDVMGKGIPAGLLMTLLRGM
FT                   LRAEVLTGLPPDRILHDLNELAQEDLAQSNRFVTLFYSELDPVTRVLRFSNAAHNPPLI
FT                   WRRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDGVTEASGVGGERFDE
FT                   ERLMRALLAICKTVPDAQGILDQLFARLDRFVGPGRQLEDDASMVVLKVRDEVVLPTL"
FT   CDS_pept        15288..16700
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SynRCC307_0013"
FT                   /product="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26916"
FT                   /db_xref="GOA:A5GPV7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV7"
FT                   /protein_id="CAK26916.1"
FT                   /translation="MPMTVSDGVTGGSGSGWSDRFEEGLHPSIERFNASIGFDITLLQQ
FT                   DLDGSVAHARMLGRCDLISAQESEQLIEGLETIRQEAAAGDFNPGLEAEDVHFAVERRL
FT                   IELLGPLGKKLHTGRSRNDQVGTDLRLWLRQQIDAIDGALLRFQRALFRHAEEHLHTLI
FT                   PGYTHLQRAQPLSLAHHLLAYVEMAGRDRQRLQDVRRRVNCCPLGAAALAGTPLPINRQ
FT                   QTADDLGFEGLYANSLDAVSDRDFAVEFSAAASLVMVHLSRLSEEVIFWASEEFAFVRL
FT                   TDRCATGSSLMPQKKNPDVPELVRGKTGRVFGHLQGLLTMIKGLPLAYNKDFQEDKEAL
FT                   FDVVRTSLDCLEAMAILLEEGIRFRPERLEQAVASDFSNATDVADYLVAREVPFREAYQ
FT                   LVGRLVKLCLEEGILLRDLPLNRWQQLHPGFEQDIYDAIAPRQVVAARLSEGGTGFAQV
FT                   EKQLQRWRPVLA"
FT   CDS_pept        16813..17427
FT                   /transl_table=11
FT                   /gene="SynRCC307_0014"
FT                   /locus_tag="SynRCC307_0014"
FT                   /product="RNA-binding protein, RRM domain"
FT                   /note="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26917"
FT                   /db_xref="GOA:A5GPV8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV8"
FT                   /protein_id="CAK26917.1"
FT                   /translation="MSIFVGNLPFRAEQEDIIELFASFGEVANCSLPLERDTGRKRGFA
FT                   FVEMADEATEERAIEGLQGTELMGRPLRINKAEPRGSRGGGGGGGYGGGGGGRGGYGGG
FT                   GGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGGERASGARGWEDRSYGGG
FT                   GGGGEPSRDSFDEGRSRRRRGGGGGGESSGGDWGDYGGAEG"
FT   CDS_pept        complement(17431..18438)
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="SynRCC307_0015"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26918"
FT                   /db_xref="GOA:A5GPV9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV9"
FT                   /protein_id="CAK26918.1"
FT                   /translation="MSSTSASPQPHPAYRFSVAPMMDYTDRHFRVVMRQVSRHALLYTE
FT                   MVVAQALHHGRQDTLLGFDPLEKPIALQLGGDDPALLAEAAELAERWGYDEINLNVGCP
FT                   SPKVKKGRFGACLMAEPQQVARCVEAMGAACRLPVTVKHRIGIDERDSYDELLDFVDTV
FT                   AAAGCQRFAVHARKAWLEGLDPKQNRTVPPLRYDLVHALKRDRPALIVELNGGLESLSA
FT                   CQEQLHAVDGVMVGRAAYAHPLQWNRVDQEIFGDSNATPIKASEVLQGVLPHAEHWCSS
FT                   GGRLWPIARHLVHLVEGVSGARYWRRQLSVEASDRSARPDVLERAMRQLQERGL"
FT   CDS_pept        18406..18960
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="SynRCC307_0016"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.6"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26919"
FT                   /db_xref="GOA:A5GPW0"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW0"
FT                   /protein_id="CAK26919.1"
FT                   /translation="MRLGAGAGAAHSPMLQSDLPRPMAQWPRRSLLQAAAAVFGSLFRP
FT                   KAALAASAADPAWQLSDQQWRERLSPEAFRVLRQEGTEPPFSSPLNNEKRPGTFVCAGC
FT                   QQPLFASSTKFDSGTGWPSFWQPLPDAIDTQVDFRLIIPRTEYHCRRCGGHQGHVFNDG
FT                   PRPTGQRYCNNGVALAFVPDA"
FT   CDS_pept        18887..20209
FT                   /transl_table=11
FT                   /gene="SynRCC307_0017"
FT                   /locus_tag="SynRCC307_0017"
FT                   /product="Predicted flavoprotein"
FT                   /note="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26920"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW1"
FT                   /protein_id="CAK26920.1"
FT                   /translation="MTDRAPPGSATATTGWPWRLCRMPEAGSPVPLVVAGGGAAGFMAA
FT                   ITAAEAGVPQVQLWEATAEPLSKVRISGGGRCNVTHACWDPRELVGHYPRGSRPLRGPF
FT                   SRFAAGDAVAWFADRGVELVEEADGRMFPASNRSSSVIEALRQAARSAGVQLLPKRALQ
FT                   GVRPIEGGGFALQARGDSTSVVAQRLLLATGGHPSGRQLAQALGHQVVAPVPSLFTLRV
FT                   QAPWLNALAGLSQSPVAMELSVGEERFRQQGIVLLTHWGLSGPGVLRLTAFAARALQQQ
FT                   RYLAELRLNWCGGMNESVVRDELSQARQGLAKKQLANGRPELLMLLRRRLWLALLQQAG
FT                   LDPALSWAELPRRGEQALLELLLRCRLPVTGRGPFGEEFVTAGGVELGEVNLSSMESRL
FT                   VGGLYFAGELLDIDGVTGGFNFQHCWSSGWIAGQAIAMGLT"
FT   CDS_pept        complement(20202..21434)
FT                   /transl_table=11
FT                   /gene="pilC,pulF"
FT                   /locus_tag="SynRCC307_0018"
FT                   /product="Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26921"
FT                   /db_xref="GOA:A5GPW2"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW2"
FT                   /protein_id="CAK26921.1"
FT                   /translation="MMATQAFIATYKDRRGKEKSLKLKAADLASAKRNLRKRGILALSL
FT                   KADSGSSEKVQRGLSLSLEKAPGVKEKAVFASQMAALVSAGVPIVRSLEILAEQQKLPM
FT                   FKRALQRLSLDVNQGSSLGSALRRWPQVFDALSVAMVEAGEAGGVLEEVLKRLAKLLED
FT                   NAKLQNQIRGALGYPVTVLVIAIAVFLGMTIFLIPTFAGIFEDLGAELPAFTQLMVNLS
FT                   ALLRSSFSLYLAGGLLLLLFVMKRAYGTKLGRRRMDGLMLRVPLFGDLIRKTATAQFCR
FT                   TFSSLTRAGVPILMALDIVRDTVGNRVLAEAIESAKVEVQEGGTLSLALARRKVFPSMA
FT                   MSMLLIGEESGEVDAMLSKVADFYEDEIAATVKAMTAMLEPAMIVVVGGIVGSILLAMY
FT                   LPMFSVFENIK"
FT   CDS_pept        complement(21431..22576)
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="SynRCC307_0019"
FT                   /product="Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26922"
FT                   /db_xref="GOA:A5GPW3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW3"
FT                   /protein_id="CAK26922.1"
FT                   /translation="MAGLPLLPNSQGHTAEIGAPERAMELQIETLMEQLVEKGGSDLHL
FT                   SAGLPPYGRFSGALKPMHEAPLAEESCNRLIFSLLNNNQRKQLEQNWELDCSYGLKGVA
FT                   RFRVNVYREKGCYAACLRALGSSIPSLQQLGLPDVVREISERPRGLVLVTGPTGSGKTT
FT                   TLAALLNHINQQRAEHILTVEDPIEFVYKSERSVIHQRELGEDTRSFANALKAALREDP
FT                   DVILVGELRDLETIQLAITAAETGHLVFGTLHTSSAAQTVDRMVDVFPPEQQTQIRVQL
FT                   SGSLVAVFAQTLCRRLNPPPGAFGRVMAQEIMVNTPALANLIREGKTAQIYSQLQTGGQ
FT                   YGMQTLERALANLVDGGQVERGEALSKASKPDELMRLLGEA"
FT   CDS_pept        complement(22525..24018)
FT                   /transl_table=11
FT                   /gene="pilB, gspE"
FT                   /locus_tag="SynRCC307_0020"
FT                   /product="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26923"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW4"
FT                   /protein_id="CAK26923.1"
FT                   /translation="MQSCHVAGTPTPGSRSENPAILKAETVRGAALERFELDESFESFA
FT                   PPPPPDGPDLVESANDRDASPVIQLADRILVQALSRQASDIHIEPQEDGLHVRLRLDGV
FT                   LQNAFETLPAKVIPALTSRFKIMADLDIAERRQPQDGRIRRRYQGNTVDFRVSVLPSRF
FT                   GEKIVLRLLDSSATELGLDLLITDSQALAEVRDMGSKPYGILLVTGPTGSGKSTTLYSL
FT                   LAERNDPGLNISTVEDPIEYTLAGITQTQVNREKGVDFAKALRAFMRQDPDVLLVGETR
FT                   DLETAKTALEAALTGHLVLTTLHCNDAPSAVARLEEMGVETYLLSASLIGVLSQRLLRK
FT                   LCTHCRQPYQPKEATLARFGLEASQNSSISFFQPPANNTCSHCHGLGYKGRIGVYEVMR
FT                   VNEVMAEAIGQGAGTDQLRHLALSNGMKTLLGYGLELARQGHTSLEEVERVLLTDSGLE
FT                   QEIRARNLSTATCVGCGAGLRDEWLDCPYCLTPRGTLQR"
FT   CDS_pept        23976..24716
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SynRCC307_0021"
FT                   /product="Molecular chaperone GrpE, heat shock protein"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26924"
FT                   /db_xref="GOA:A5GPW5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW5"
FT                   /protein_id="CAK26924.1"
FT                   /translation="MIQGSASQQHGRTARVAPMTAEPPTSPSPSEAEVSVEDQQQPMAE
FT                   AQVEQPAADAAAAEPETTAEAPEATAESGDGAAALEAELTALRQEHETVRSQYMRIAAD
FT                   FDNFRKRQQRDAEDLKLQLTCSTLGEILPVVDNFERARQQLNPEGEEAQALHRSYQGLY
FT                   KQLVDVLKQLGVSPMRVEGEPFDPTLHEAVLREPSDAHSEDVVMEELQRGYHLDGRVLR
FT                   HAMVKVSMGPGPAAAPESAPAEGN"
FT   CDS_pept        24716..25825
FT                   /transl_table=11
FT                   /gene="SynRCC307_0022"
FT                   /locus_tag="SynRCC307_0022"
FT                   /product="DnaJ-class molecular chaperone"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26925"
FT                   /db_xref="GOA:A5GPW6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW6"
FT                   /protein_id="CAK26925.1"
FT                   /translation="MADYYQLLGVDRDADADTLKRAYRRMARQYHPDVNKDPGAEEKFK
FT                   EIGRAYEVLGDPQTRARYDQFGEAGVSGAAGGMPDMGDMGGFADLFETFFSGFGGSAGG
FT                   PQRQRGPRQGDDLRFDLNISFRDAVFGGEKEIQIRHLETCGTCNGSGAKKGSGPVTCST
FT                   CGGAGQVRRATRTPFGTFTQVAPCPACEGTGQVIADPCPDCSGQGVQQVRKRLRVNIPA
FT                   GVDSGTRLRVSGEGNAGQRGAQAGDLYVVLYVQSDSKLRRDGINIHSELKISYLQGILG
FT                   DKVQVDTVDGPVELPIPAGTQPGAVLTLKDHGVPRLGNPVARGNHLFTINVQLPGKLEP
FT                   RERELLQELASISTSHPKGKGGLFGGLFS"
FT   CDS_pept        25826..26053
FT                   /transl_table=11
FT                   /gene="SynRCC307_0023"
FT                   /locus_tag="SynRCC307_0023"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26926"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW7"
FT                   /protein_id="CAK26926.1"
FT                   /translation="MDLRGTPCPLNFIRTQLALEKLASGEQLEVLLDAGEPDALVSAAL
FT                   QGDGAAAALVQEMQRQQQSDGSVRLLIIRA"
FT   CDS_pept        26046..26912
FT                   /transl_table=11
FT                   /gene="engC"
FT                   /locus_tag="SynRCC307_0024"
FT                   /product="Probable GTPase engC"
FT                   /note="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26927"
FT                   /db_xref="GOA:A5GPW8"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW8"
FT                   /protein_id="CAK26927.1"
FT                   /translation="MLEPFAAQVMALEANYLRVRLDHPGPDGRRLLLCTRRARLAHGGL
FT                   KVMVGDRVGVEGCDWIEGRAAVGSLEPRRNQLQRPALANVDQVLVVMALAQPAIDPESL
FT                   SRFLLSAETAGAEVIPVLSKADLVSDQQQQQWLDRLVGWGYQALAISRHDPAGLAALED
FT                   RLSRGVAVLCGPSGVGKSSLLNALVPELQLRTAAVSGKLQRGRHTTRHVELHDLPAGGL
FT                   LADTPGFNRPELPADPELVAQLFPEIRQQLEAGVRCRFRNCRHLQEPGCGLQRQWERYP
FT                   SYVELMG"
FT   CDS_pept        complement(26914..27249)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0025"
FT                   /locus_tag="SynRCC307_0025"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26928"
FT                   /db_xref="GOA:A5GPW9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GPW9"
FT                   /protein_id="CAK26928.1"
FT                   /translation="MAGFGLPNFGQLTEAFKKAQQIQQDAQKLQEELDAMEIEGSSVDG
FT                   KASIWLSGNQQPLRVRLAPELLASGQEATEAATLEALQNAYAQSTATMKERMEELTGGL
FT                   NLPGLGG"
FT   CDS_pept        complement(27274..28191)
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="SynRCC307_0026"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26929"
FT                   /db_xref="GOA:A5GPX0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GPX0"
FT                   /protein_id="CAK26929.1"
FT                   /translation="MEIPADLNLRKDVPLGDFTTWKVGGAADFFAEPDSSDHLEALVHW
FT                   GRGQQLPMRFIGAGSNLLISDEGLAGLVICSRRLQGSQLDPTTGIIEAQAGEPLPTLAR
FT                   RAAKAGLSGLEWSVGIPGTVGGAVVMNAGAQGGCIAESLIDATVLDPSSGQTRRMSCNE
FT                   LDYDYRHSALQSEALVVLSARFRLQAGVDPSELSARTSSNLHKRTSTQPYQLPSCGSVF
FT                   RNPEPQKAGRLIEGLGLKGHRIGGAEVSTLHANFIVNTGNAQAADMDALIRHVQAVVKQ
FT                   AHGLQLHPEVMRLGCFANSQAAAA"
FT   CDS_pept        complement(28195..29634)
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SynRCC307_0027"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26930"
FT                   /db_xref="GOA:A5GPX1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GPX1"
FT                   /protein_id="CAK26930.1"
FT                   /translation="MSQPLSLTAEQPVHFIGVGGIGMSAIAGILAERSYNVTGSDPKQS
FT                   AQSQLLRQQGARVFQQQNAATIDAICSGVDRAPLVVVSSAIPETNPELEAARGAGLRVV
FT                   HRSELLAWLINAQHSIAVAGSHGKTTTSSLIASLLHSAGLDPTAIIGGVVPAFGSNARN
FT                   GAGEWLVAEADESDGSLVRFHPQLGLITNLELDHTDHYPNLDALVATMRRFSGNCSSVL
FT                   ANRDCPVLSAELSADHWWSLQENSSAHFRAVPLSLDGAGCRADYLEDGRRLGELALPMA
FT                   GIHNLSNALAAVAACRLAGASFADLQAALTELVPPGRRFDLRGEWQGRLIVDDYAHHPS
FT                   EVDATLTMAQLMVSSGKSTLPWVPKRVVAVFQPHRYSRTAQFMERFAEALGCADEVLVA
FT                   PLYSAGESAIEGVSSATLAEKVQQAGHSARALADMDSLVDAVQQCSSAGDLVLVMGAGD
FT                   VNQLWSRLQSSADQQGLATAA"
FT   CDS_pept        29778..30803
FT                   /transl_table=11
FT                   /gene="gap1"
FT                   /locus_tag="SynRCC307_0028"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.59"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26931"
FT                   /db_xref="GOA:A5GPX2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX2"
FT                   /protein_id="CAK26931.1"
FT                   /translation="MTLRVAINGFGRIGRNFMRCWLSRGANTGIEVVGLNDTSDPATNS
FT                   HLLTYDTMLGRIRDAEISHTENTIIANGHEIKCFSDRNPLNLPWKEWGIDLVIESTGVF
FT                   NTDEKASMHIQAGAKKVILTAPGKGDGVGTFVVGVNADQYRHEDFDILSNASCTTNCMA
FT                   PIVKVIDQEFGIVKGSMTTVHSYTGDQRILDASHRDLRRARAAAMNIVPTTTGAAKAVA
FT                   LVYPEVKGKLDGLALRVPTPNVSLVDMVFNVSKDTSREEVNAVLKAASEGAYKGIIKYS
FT                   TLPLVSSDLAGTDDSTIVDAELTKVMGGDQVKILSWYDNEWGYSQRVVDLAEIVAQRWA
FT                   A"
FT   CDS_pept        complement(30819..31796)
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SynRCC307_0029"
FT                   /product="Thiamine monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26932"
FT                   /db_xref="GOA:A5GPX3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX3"
FT                   /protein_id="CAK26932.1"
FT                   /translation="MPEGLTLSQIGEQELIRRLAAFARADQWNDDAALLPEISPERWVI
FT                   SSDTLVEGVHFSAKTTPASAAGWRAAAANLSDLAAMGCRRCEGITVALSAPGDTQVHWL
FT                   EQAYGGMQELLLRHKGHLLGGDCSSGEQLVLAITALGPVHPDQLIQRGAGKPGDWLVST
FT                   GAHGRSALGLQLLLGQAAWAESLPSEQRQTAIRCHQRPQPRFDAVAALHASRPDGQPWR
FT                   VGGTDSSDGLRRSLELLGGASGCQPELNRHALPEPSDPFWSLCLDGGEDFELVLALEPS
FT                   WAQALLRQLPGSQHLGQLGEAAGHPCWADNKNPLPEGRGFEHFN"
FT   CDS_pept        complement(31789..32958)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0030"
FT                   /locus_tag="SynRCC307_0030"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26933"
FT                   /db_xref="GOA:A5GPX4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX4"
FT                   /protein_id="CAK26933.1"
FT                   /translation="MVPVRKSLLEIIPGEWIEADCTVVAATERAAVARALIPQLLALIL
FT                   SFGLALLSPATALAALPPGNAVTDPAAILRDSLPVDQADLRDLQHRLEGTSDDLRARRW
FT                   NSIKTSCERTQRQFSLKRGAILEAVPSELQPQAEQLLSQLDTNLEELCASSELQERDGF
FT                   LEQRRLTLADIGALEELFIGDFPYAIPSEFDDLPRLLGRATVEIRTSQGDLTAVIDGYS
FT                   APLTGGAFVDLVQRGFYDGLPFSRAEDFYVLQSGNPKGDAEGFIDPKTKQERHVPLEIL
FT                   VPGDASPIYNMTFEDLGLFKATPVLPFATLGTLGWAHSDKALDDGSSQFFFFLYEAELT
FT                   PAGLNLVDGRNAAFGYVVEGSEVLKEMTMDDTIISAKVISGADNLKSHA"
FT   CDS_pept        32924..33484
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SynRCC307_0031"
FT                   /product="Translation elongation factor P"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26934"
FT                   /db_xref="GOA:A5GPX5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GPX5"
FT                   /protein_id="CAK26934.1"
FT                   /translation="MISSNDFRTGTTIELDGQVWRVVEFLHVKPGKGSAFVRTKLKSAQ
FT                   SGNVVEKTFRAGEMVASALLEKSTLQHTYMEGEDFVFMDMASYEETRLTAKQIGEGRKY
FT                   LKEGMEVNVVSWKDNPIEVELPNSVVLEVTETDPGVKGDTATGGTKPAIVETGAQVMVP
FT                   LFISIGEKIKIDTRSDSYLGRES"
FT   CDS_pept        33490..33963
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SynRCC307_0032"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26935"
FT                   /db_xref="GOA:A5GPX6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX6"
FT                   /protein_id="CAK26935.1"
FT                   /translation="MQMDQQALRELLEFLSSSDIQELKLEGDDFRLEVRRNMPAPQAVM
FT                   LPAPAAPMVAEVAAAAPAAAASPPPAAAASRGDLVEVKAPMVGTFYRSPAPGEAPFVEV
FT                   GSKISNGQAVCILEAMKLMNELEAEISGEVVEILVENGTPVEYNQVLMLVRPS"
FT   CDS_pept        complement(33960..34946)
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="SynRCC307_0033"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26936"
FT                   /db_xref="GOA:A5GPX7"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GPX7"
FT                   /protein_id="CAK26936.1"
FT                   /translation="MTRLAIALGDPAGIGAEVVLKALAHRPSLNPLLVGCRQWLQASYE
FT                   QLLPCCHEPLADPSQLEILDEPLTEAITPGSISAAAGAASFGWLTRATEAVLDGRAQAL
FT                   VTAPIAKTAWHQAGHHYPGQTERLAELCGCDDAAMLFTARSPQSGWRFNTLLATTHIPL
FT                   SSVPAALTPERLERRLGQLEDFCRRFRQRPRLRVAGLNPHAGEAGQLGTEEQRWITACL
FT                   QAYQQRHNNLQLEGPVPPDTCWLGAAQAWNDSQHVEEGCDGYLALYHDQGLIPVKVLAF
FT                   DQAVNTTLGLPFLRTSPDHGTGFDRAGQGSARGASMLAAIDTAVELG"
FT   CDS_pept        complement(34950..35315)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0034"
FT                   /locus_tag="SynRCC307_0034"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26937"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX8"
FT                   /protein_id="CAK26937.1"
FT                   /translation="MNFRKLVESMARFECFSRTQRPDMDLLPIATEALQSQGFKVRSAI
FT                   GESISLVDSQPVKRLRDRAVVLLDQHTNPDGRRELQCVISNDSISSSPDCRCHGVFRQL
FT                   LGQFESMPDVVVEAAAA"
FT   CDS_pept        complement(35499..36410)
FT                   /transl_table=11
FT                   /gene="wcaG"
FT                   /locus_tag="SynRCC307_0035"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26938"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR039648"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX9"
FT                   /protein_id="CAK26938.1"
FT                   /translation="MSDTGVLTSLGAVNPLDPGQRLLVVGGGYTGQRFAERLRQLGADV
FT                   VVTHRRAPAAAGELPFDSSTGLLPSASELQGISHLLVTAPPDRQGQDPCLSSLKPLLDG
FT                   LPLQWTGYLSTTGVYGNQRGEWVDESTPPAADLLPRSQARLQCEQAWLNSGWPVQVFRL
FT                   PGIYGPRRNNLLALQRGDARHVHKPGQVFCRVHVDDIVGALLHCLRLPATQRPSILNVC
FT                   DNRPAPSSELLGYSAHLLGCPLPELQWFEAVEGNMSPMALSFWRDNRRVSNRKLTQALG
FT                   YALTYPSYREGLQACLKAEAPD"
FT   CDS_pept        36426..36596
FT                   /transl_table=11
FT                   /gene="SynRCC307_0036"
FT                   /locus_tag="SynRCC307_0036"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26939"
FT                   /db_xref="GOA:A5GPY0"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY0"
FT                   /protein_id="CAK26939.1"
FT                   /translation="MTCSTIIPAAQPRRAWLSPVVLAAAIAAAGLLLPEEPQLQAELCQ
FT                   RTSSVKACQVW"
FT   CDS_pept        complement(36602..37075)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0037"
FT                   /locus_tag="SynRCC307_0037"
FT                   /product="McrA/HNH family nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26940"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY1"
FT                   /protein_id="CAK26940.1"
FT                   /translation="MTAEQSSADLGQIREIRMHQSDAVFLEELCPKLRVRRWRQSLHEY
FT                   TGHTCIYCGKPSESIDHVWPRSRGGLSVTENCVPSCLSCNGHKSDSDAFQWYRRQRFYD
FT                   PRRAMAIRAWLDGDLRLAVRLLQWATPSESSNTQETSGNGVVPLQTPTNYQAA"
FT   CDS_pept        37149..38747
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="SynRCC307_0038"
FT                   /product="Superfamily II DNA/RNA helicases, SNF2 family"
FT                   /note="Transcription / DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26941"
FT                   /db_xref="GOA:A5GPY2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY2"
FT                   /protein_id="CAK26941.1"
FT                   /translation="MAKQIVSIGLSLTAAGDVLFRCPPDPVSQAQIRRIRPRGRWQQRQ
FT                   GGWVFPFEAAWQLTHHFGERFPIDPALQQWLDQVRCPLPPLPAHRELIAAADLQQPLSD
FT                   GRQLLAHQRAGVRWLLARRGAVLADEMGLGKTLTALAAARALLRCSATRLLVVAPVGLH
FT                   DHWRREALALQLSPELLSWARLPQEPPDGGCVLVVDEAHFAQNSQAKRTQALLRLARHP
FT                   RIRAVWLLTGTPLKNGRPVQLLPLLMAIGHPLARDRLAYETLFCNGHWRQSGPRMVWDC
FT                   QGASRLDELQRLLRPQLLHRRKRDCLDLPPKLRRFHGVVLKPEAQHQFDWALQQRLDAY
FT                   RKRAAAGLVRSDAERLALLTALRQLSSFHKLAALQQLLDQLQVSGDPVVVFSGFRGPLL
FT                   QLHRLRGGELLTGLVDPAERLERLQRFQQGDSNLLLATYGVAGLGLGLQRASQVILLER
FT                   PWTPGDAEQAEDRCHRFGTRRTVECHWLQLGGADALVDGLILSKSERIEVVLGRQRRQL
FT                   RRQGLARMLDELLQS"
FT   CDS_pept        complement(38744..39082)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0039"
FT                   /locus_tag="SynRCC307_0039"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26942"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY3"
FT                   /protein_id="CAK26942.1"
FT                   /translation="MGKGQLTKAIGVGMGLVILSACRSSHLEADSCLADVEANALDRAL
FT                   QRCNRVVKAHPQDPRPRNDRFLLHTLLQNKQAACQDIAQAAALLQASGAKSHNDLRAEI
FT                   LVRADSCR"
FT   CDS_pept        complement(39089..39469)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0040"
FT                   /locus_tag="SynRCC307_0040"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26943"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY4"
FT                   /protein_id="CAK26943.1"
FT                   /translation="MAAKRYQLMALALGLSCMGSLPAEANEAGDKGAEIYCFMRKTGNS
FT                   HNVSWKAAYERIKRQSTGLFKTSPKHAAVMVTESVVTKQDKYQDCGKYLGALFAGGETT
FT                   GKDFDAGLSNESSTTDDDRYSY"
FT   CDS_pept        39601..39840
FT                   /transl_table=11
FT                   /gene="SynRCC307_0041"
FT                   /locus_tag="SynRCC307_0041"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26944"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY5"
FT                   /protein_id="CAK26944.1"
FT                   /translation="MEPLSFRITRSTEGLAETLATLSHRLIKLEQRLAAMELQLQNQMA
FT                   PHPQELEALQSVDSLLADCRELLATSAPEMDQAA"
FT   CDS_pept        39865..40230
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="SynRCC307_0042"
FT                   /product="Bacterial UmuD protein homolog (SOS-regulated
FT                   protein)"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26945"
FT                   /db_xref="GOA:A5GPY6"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY6"
FT                   /protein_id="CAK26945.1"
FT                   /translation="MAVVAAGFPSPADDYLEAGVDLNRQLIARPLSTFLLQVSGDSMLA
FT                   DGIHHGDLLLVDRSLQPQPGRVVVAVLDGAFTLKRLECHGGRLRLQAAHPGYPPLELDA
FT                   CIAVQIWGVATHVIHPL"
FT   CDS_pept        40237..41517
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="SynRCC307_0043"
FT                   /product="Bacterial UmuC protein homolog (SOS-regulated
FT                   protein)"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26946"
FT                   /db_xref="GOA:A5GPY7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY7"
FT                   /protein_id="CAK26946.1"
FT                   /translation="MAAALALIDCNNFYASCEQLFDPALQGRPVVVLSNNDGCIVARSR
FT                   EARQLGIAMGTPYFQVADRLRDQQVVVRSSNYALYGDMSQRVMALLKQRVPELEVYSID
FT                   EAFARLPALPAHELSSWAAELRVLVRQQLGLPIALGMAPSKVLAKLANRLAKRDPARTG
FT                   VCNLLLEPQLPDRLAEVAVEDLWGVGRRLARWCRLRGLATALDLAQADSALIRQGWGVV
FT                   GLRLQQELRGISCLALESEPAAKQETCVSRSFGTAVLDRLSLREAVAAHVVRGAEKLRR
FT                   QGQRASRLTVFVRTSPFAAGFYANSISVSLPLATADTAVLLQRALPLVDQLFRHGYAFQ
FT                   KAGVLLGQLQPQEHLQHHLLVPCSPQQLRRRSRLLQAVDGLNQRFGTGTVQWAAVGVEP
FT                   DWCMRRQHLSAHFTTSKADLPMVSAHE"
FT   CDS_pept        41510..41815
FT                   /transl_table=11
FT                   /gene="SynRCC307_0044"
FT                   /locus_tag="SynRCC307_0044"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26947"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY8"
FT                   /protein_id="CAK26947.1"
FT                   /translation="MNKCEKILKSTRSGACGVPWPLARGGRIKRKRTMASLASVHPQSC
FT                   PYTPLSNRRGFVDSGHQIEKLEFALAVAVGRGDQQRIHELRQRIADLGDNREEPGT"
FT   CDS_pept        41919..42158
FT                   /transl_table=11
FT                   /gene="SynRCC307_0045"
FT                   /locus_tag="SynRCC307_0045"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26948"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY9"
FT                   /protein_id="CAK26948.1"
FT                   /translation="MLTQIRSSDVRETSQGNGSIDQERDQLKLQAQGFYDAAKVKAEAG
FT                   EVSEAGLLILKGLDCERRAKAKGPQVLGLIRKRG"
FT   tRNA            42175..42246
FT                   /locus_tag="RNA_1"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGG"
FT   CDS_pept        complement(42331..42774)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0046"
FT                   /locus_tag="SynRCC307_0046"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26949"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ0"
FT                   /protein_id="CAK26949.1"
FT                   /translation="MRRPALLLGSALVALALAACQSKPTPQQSEQKAESAVCANLAAVG
FT                   KALEAVGELGPTSTVGDAEQARNNLAQAVAKLQDSEAALEKLRIQDLQKQVMAFNKEAK
FT                   KITANKSTTLEEAANELQGKLEPVLAARQAAVADVNCDAGGAS"
FT   CDS_pept        complement(42834..44024)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0047"
FT                   /locus_tag="SynRCC307_0047"
FT                   /product="DHSS soluble hydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26950"
FT                   /db_xref="GOA:A5GPZ1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ1"
FT                   /protein_id="CAK26950.1"
FT                   /translation="MIHQPDSGPPPSGMKDKLQLMIPGPTPVPERVLLAMARHPIGHRS
FT                   GEFQQIVARTTEQLQWLHQTKGDVLVLAGSGTAAMEAGIINVLSRGDKVICGDNGKFGE
FT                   RWVKVAKAYGLEVEVIKAEWGQPLDPEAFRNALEADTAKAIKAVILTHSETSTGVINDL
FT                   ETINRHVKAHGEALIVVDAVTSLGACSVPVDAWGLDVVCSGSQKGYMIPPGLGFVAMGE
FT                   RAWAAQKQSDLPKFYLDLERYRKAAAGNSNPFTPPVNLYFALEAALDLMQDEGLEAIFA
FT                   RHDRHRRASQAAMRALGLPLFAADGYGSPAITAVAPAGLDAEALRKAVKGRYDILLAGG
FT                   QDHLKGKVFRIGHLGFVCDRDVLTAVAAIEGALADLGVASAQPGAGVAAAAAVLQG"
FT   CDS_pept        43913..45175
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="SynRCC307_0048"
FT                   /product="Cobalamin biosynthesis protein CbiD"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26951"
FT                   /db_xref="GOA:A5GPZ2"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ2"
FT                   /protein_id="CAK26951.1"
FT                   /translation="MPSPGAPVPAPEWGQGSSVEACPSCRWVGGRNPAGGSFTLKSSRL
FT                   SPLSASSALDSGYTLPVWVAVAAVAALRQLRGDPSAERIGLELLQPAGQRELPIEAVAP
FT                   FADGSALAISRCDPGPGMDLTRGLAVWVRARWAEPLEGACFQLQAGVGVGRLVEGGEVC
FT                   LSGFARDLLQHNLAALVPADRSVALEVVLPQGRERALRTSNAAFGVVEGLALIGTQAEV
FT                   QRSAAPDQLQGALDELRQRAERPQGCPELVLVVGENGLDLAPRLGLPVEVLLKSGNWIG
FT                   PLLAAAAEQGVQRLLLFGYHGKLLKLAGGIFHTHHHLADGRAEVLTALAALEGVQGELL
FT                   RELHSSATTEAALQLLRQREPELEQRLRQRITAAIEKRAAASIQATTGLTLEPGVALFD
FT                   RSRQLWAVGPRGQSWFAEAAF"
FT   CDS_pept        45105..46796
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="SynRCC307_0049"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26952"
FT                   /db_xref="GOA:A5GPZ3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ3"
FT                   /protein_id="CAK26952.1"
FT                   /translation="MIAPVSCGRLDRGVSPGSLRLRFRLFRLPYVPMSAALAGLEGADG
FT                   RRPAIVILDFGSQYSELIARRVRETEVYSLVVSHTTTLEQLKALGPRGIILSGGPSSVY
FT                   AAGAPLCDPGIWDLGIPVLGVCYGMQLMVQQLGGSVEASERGEYGKAPLFVDDPTDLLT
FT                   NVDDGSTMWMSHGDSVQALPDGFTRLAHTDNTPEAAIAHHGRKLYGVQFHPEVVHSTCG
FT                   MALIRNFIYHVCGCEPDWTTEAFIDEAIADVRARVGSKRVLLALSGGVDSSTLAFLLHK
FT                   AIGDQLTCMFIDQGFMRKGEPEFLVEFFDKRFHINVEYINARERFINKLAGITDPEEKR
FT                   RIIGTEFIRVFEEESKRLGPFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNV
FT                   GGLPKDLQFKLVEPLRRLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVSEEK
FT                   LDILRDADLIVREEVRDAGLYHDIWQAFAVLLPVRSVGVMGDKRTYAYPIVLRCVGSED
FT                   GMTADWSRLPYDLMERISNRIVNEVNGVNRVVYDITSKPPGTIEWE"
FT   CDS_pept        46803..47570
FT                   /transl_table=11
FT                   /gene="SynRCC307_0050"
FT                   /locus_tag="SynRCC307_0050"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26953"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ4"
FT                   /protein_id="CAK26953.1"
FT                   /translation="MIECVPGGRDHRDLAVARGATAWVAHLESAALVKPGNALPAPIPS
FT                   GTDRRVVASSAPLQQNPQLQRRLQQDSIELAGKTIYLNPFLYWRRFDANTDRWLREPGQ
FT                   LNEDQISTNRVRFYPEVVWDSLSDEERAIKDGSVEMFLKSLELISTFNPELTAGQLLEL
FT                   ERKMAVTKKKAFEHWVGKSLRRRSQEEKAEKRRFSRQRWVREWREWLADPTTGRALLPL
FT                   TGLILTAGFLGWHLGSQQFCRELILQPGVQRSR"
FT   CDS_pept        47613..47825
FT                   /transl_table=11
FT                   /gene="SynRCC307_0051"
FT                   /locus_tag="SynRCC307_0051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26954"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ5"
FT                   /protein_id="CAK26954.1"
FT                   /translation="MAEPSTNPWLSLGMQLMDVARQKLATPAEPVVPVEVTVEDPDEPA
FT                   SVEALQERLTAIAARLQQLEAKLLP"
FT   CDS_pept        47822..49621
FT                   /transl_table=11
FT                   /gene="SynRCC307_0052"
FT                   /locus_tag="SynRCC307_0052"
FT                   /product="Cell division protein FtsI / penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26955"
FT                   /db_xref="GOA:A5GPZ6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ6"
FT                   /protein_id="CAK26955.1"
FT                   /translation="MSLGFSRRDARFCGMGQQPGVILLVLLMFFSAIGMRLVWMQLLHG
FT                   AENRVAADENRIRLMPRSPIRGRLLDRKGRVLASSKLTYTLFIEPRLVTDEQWPALRDR
FT                   LAALLQLDPKGLDQARERGTGKDGYRIPLVNGLQPEQVLRFQEQNLDLPGASVDMDILR
FT                   YYPHGMLASHTLGYTQPITEDEYDVLIDKGYKIRDRIGRIGVEAAYESHLRGKWGGQML
FT                   EVNANGEVQRYLGDRPSKAGKDLILTIDLDLQRAAEKALADKRGGAIVAMNPTTGAILA
FT                   MASKPNFDPNFFSKLITTQQEYDALFKSPNKPLFSRAMNAYNPGSTWKVVTGMAGMESG
FT                   KFPAGTKLQTMGCITYGGHCFPDHNGAGFGTIGYEDALRFSSNTFFYQVGVGVGSRELY
FT                   KSAKLLGFDAPSGIEIGYEESPGLVGNEDWANEGRGWAEPGTTPWIPEDMASASIGQSI
FT                   VEITPLQLARAYSVFANGGYLVTPHLADQGQDWTAPPLRTKVDMKPSTLETIRAGLRKV
FT                   VADGTGYGLNDPALPPGAGKTGTAEDSQRGGPDHAWFGCFSPYDNPEIVVAAFAQNTPG
FT                   GGSVHALPMAKKVLLAWHAQKAD"
FT   CDS_pept        complement(49632..50777)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0053"
FT                   /locus_tag="SynRCC307_0053"
FT                   /product="Glycosyltransferase of family GT4; possible
FT                   alpha-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26956"
FT                   /db_xref="GOA:A5GPZ7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ7"
FT                   /protein_id="CAK26956.1"
FT                   /translation="MKIAFFTETFLPKVDGIVTRLTKTVRHLVEAGDEVVVFCPEGAPS
FT                   HYMGAKVVGVPAMPLPLYPELKLALPRPAVSEAIDAFQPDLVHVVNPAVLGLGGIWLAK
FT                   SKGIPLIASYHTHLPKYLEHYGMGMLEPLLWELLKAAHNQAVLNLCTSTAMVQELSDKG
FT                   IQHTALWQRGVDTDLFRPELRNDAMRKRLLGEHDDRGALLVYVGRLSAEKQIERIKPVL
FT                   NALPDARLALVGDGPHRQQLEKHFEGTATTFVGYLAGEELASAYASGDAFLFPSSTETL
FT                   GLVLLEAMAAGCPVVGANRGGIPDIISDGTNGCLYEPDGADGGAASLIEATRKLLGNDI
FT                   ERQGLRNAARSEAERWGWAGATEQLRGYYRQVLETNLTTAA"
FT   CDS_pept        complement(50784..52016)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0054"
FT                   /locus_tag="SynRCC307_0054"
FT                   /product="Sulfolipid biosynthesis protein
FT                   (UDP-sulfoquinovose synthase)"
FT                   /EC_number="3.13.1.1"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26957"
FT                   /db_xref="GOA:A5GPZ8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ8"
FT                   /protein_id="CAK26957.1"
FT                   /translation="MPRWELGSVRQETVVKVLVLGGDGFCGWPCAVNLADQGHDVLIVD
FT                   NLSRRKIDIDLEVESLTPITNIGERLKAWSEIGGKPMRFVHMDIAHEYQRLLDLLLEEK
FT                   PDSVVHFAEQRAAPYSMKSSATKRYTVDNNVNGTHNLLAAIVESGLDIHVVHLGTMGVY
FT                   GYGSHRGATIPEGYLKVEVPQPDGSRFEEEILHPASPGSVYHMTKTLDQLLFLYYNKND
FT                   QVRITDLHQGIVWGTNTEATDRDPRLTNRFDYDGDYGTVLNRFLMQAAIGYPLTVHGTG
FT                   GQTRAFIHIRDSVRCVQLALDNPPVKGERVKIFNQMTESHQVGELAKKVAALTGAQVNN
FT                   LPNPRNEAVENDLIVDNRCFIELGLNPTTLDDGLLKEVVEIATRYADRCDRNRILCTSA
FT                   WTKTQEQAIAR"
FT   CDS_pept        complement(52039..52209)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0055"
FT                   /locus_tag="SynRCC307_0055"
FT                   /product="HLIP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26958"
FT                   /db_xref="GOA:A5GPZ9"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ9"
FT                   /protein_id="CAK26958.1"
FT                   /translation="MAVTEEDGGRLNLFASEPRMTYAEPATAGSNSKRLMMIGMGGAVV
FT                   LAMMAVAVRIS"
FT   CDS_pept        complement(52279..53121)
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="SynRCC307_0056"
FT                   /product="Thiazole biosynthesis protein ThiG"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26959"
FT                   /db_xref="GOA:A5GQ00"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ00"
FT                   /protein_id="CAK26959.1"
FT                   /translation="MRKAGATPHDQIMATTTQDTPLQIGSRCFNSRLMTGTGKYPDIPS
FT                   LQQSIEASGCEIVTVAVRRVQSGAPGHGGLMEAIDWTKIWMLPNTAGCTTAEDAVRVAR
FT                   LGRELAALAGQSDNTFVKLEVIPEGSYLLPDPIGTLEAAEQLVAEGFTVLPYINADPLL
FT                   ARRLEAVGCATVMPLASPIGSGQGLANLANIKLIIEAASVPVVVDAGIGVPSDAALAME
FT                   IGADALLINSAIALSGHPPTTARAMALAAEAGRLSHLSGAMPKRAHASASSPQQGRIT"
FT   CDS_pept        53250..53759
FT                   /transl_table=11
FT                   /gene="SynRCC307_0057"
FT                   /locus_tag="SynRCC307_0057"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26960"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ01"
FT                   /protein_id="CAK26960.1"
FT                   /translation="MTEPAFLDFDLPPAAEVSPLDVEPIEPLEADRIEVQTFDPIKRAR
FT                   QLADTLPRQWQGTLRVAGSSERIPADLELDRLVPLEAMVDVFGQLTIAGQTVPVQGNLN
FT                   AATEQLNLLLLGDDLPADLEPGGNFLGLQMFNISMWVGPRLTSRAALLRLAPVAQYLEP
FT                   PVRGLW"
FT   CDS_pept        complement(53763..54281)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0058"
FT                   /locus_tag="SynRCC307_0058"
FT                   /product="Tetratricopeptide repeat domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26961"
FT                   /db_xref="GOA:A5GQ02"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ02"
FT                   /protein_id="CAK26961.1"
FT                   /translation="MDFALPQAYLLGLIVLLGVVAVVVGRQVLRVRKQEGQLASLESRC
FT                   QDSKADAASLYELGSVQLDKRLFAQAASSLKRAAKLSASEPAEARALIQNALGFALAAQ
FT                   QNHKDAVRHYRLALKARGDYPVALNNLAYSLEKQQKGDEAVELYQRSLELEPGNRTATK
FT                   RLKLLRPNG"
FT   CDS_pept        complement(54293..54640)
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="SynRCC307_0059"
FT                   /product="50S ribosomal protein L20"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26962"
FT                   /db_xref="GOA:A5GQ03"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ03"
FT                   /protein_id="CAK26962.1"
FT                   /translation="MARVKRGNVARNRRNKILRLARGFQGSNGTLFRTANQRVMKALCN
FT                   AYRDRRRRKRDFRRLWIARINAAARMNGVSYSRLIGGLKKADVRINRKMLAQLAVLDPS
FT                   GFETVVAAAKS"
FT   CDS_pept        complement(54683..54883)
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="SynRCC307_0060"
FT                   /product="50S ribosomal protein L35"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26963"
FT                   /db_xref="GOA:A5GQ04"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ04"
FT                   /protein_id="CAK26963.1"
FT                   /translation="MPKLKTRRAAAKRFRVTGSGKFMRRRAFHNHLLDHKSPKRKRYLG
FT                   TMAVVDERDHDRVSHMLPYAG"
FT   CDS_pept        54795..56480
FT                   /transl_table=11
FT                   /gene="SynRCC307_0061"
FT                   /locus_tag="SynRCC307_0061"
FT                   /product="SpoIID sporulation protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26964"
FT                   /db_xref="GOA:A5GQ05"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ05"
FT                   /protein_id="CAK26964.1"
FT                   /translation="MWNARRRMNLPLPVTRKRLAAARRVLSFGMSDALRTNNQVTGRTS
FT                   LSPSFSFIPWIGLTLPLVLVAGCRSAPRATEVPPKPVVPLHWPTQPAPPLQGDNPELWV
FT                   SLAPHLPQFRGGVPTDLLLRAAAGTLLLTTADGERWQGSAFPVRWSQVPLAQPLTIQRQ
FT                   VLGPFASHESALQQAEAWQQQGAEAVVAHPADWEVWAPLGSPDPGQPSRLVSETQTESW
FT                   QPVLDRQGTPTVIQGPLQIDAPEGLRWGGAVYRGRFRLQRDAYGSWTLLQQVPMESYLL
FT                   GVVPHEIGAGSPLEALKAQTVLARTWAMANRGRFAVDGYHLCSDTQCQVYSDPSAAGGA
FT                   VRQALASTAGQVLTWDGKALHGVYSASNGGVSSGLEEVWQASAQPYLKPAVDGPAPLPQ
FT                   QFPLPIQGDGSVRSLLGNRNFYGAGHPRFRWTRRYSATRLEQLAAAAGSPIGGAEAVSV
FT                   GGRGPSGRVLQLTVVGTDGRWVLERDQIRRQLRALPSTLFVVEQESPAAWLFDGGGFGH
FT                   GAGLSQAGAIDLASRGWSSERILRHYFPGAELQPVKNLSSQVSP"
FT   CDS_pept        56504..57865
FT                   /transl_table=11
FT                   /gene="SynRCC307_0062"
FT                   /locus_tag="SynRCC307_0062"
FT                   /product="Glycosyltransferase of family GT2; possible
FT                   processive Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26965"
FT                   /db_xref="GOA:A5GQ06"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ06"
FT                   /protein_id="CAK26965.1"
FT                   /translation="MPNGGSPASESPVMASVIDDLAWSDGRRRKALIVVLACLWAGAAP
FT                   HWLGPVRGLLPAFGLTLMLGGYGFSTLRRGRSSAAAVSSAPPAGAVVPAIDVLVAARDE
FT                   EQVIARLVQAIAGLEYPADRLKLWVMDDGSNDRTPEILNQLSATHSFLQVRRRPRNAGG
FT                   GKSGALNALLPQLQGDWLLVLDADAALTPDVLLRLQPQLHDSALGAVQLRKAVVGAESN
FT                   WLTRSQALEMAFDAEMQLGRIAQGGIGELRGNGQLIRRQVLLDCGGFNEDTVTDDLDLS
FT                   FRLLLAGQQVSVLWNPVVDEEPVMRWGALWRQRQRWAEGGLQRFLDYWPALFSDRLSGR
FT                   QQLDLIVFFLLQYGLPLATVGDVFGMIWWRQWPLLWPLSVSTLSLSALALWRSGRRHSE
FT                   GPELPEATGWNLLVANTYLIHWFLVIPWVAVRMALRPKRLVWAKTVHAGLSVSS"
FT   CDS_pept        complement(57862..59676)
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SynRCC307_0063"
FT                   /product="DNA polymerase III gamma/tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26966"
FT                   /db_xref="GOA:A5GQ07"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ07"
FT                   /protein_id="CAK26966.1"
FT                   /translation="MAYEPLHHKYRPQRFDQLVGQEAIAATLSQALQRGRIAPAYLFSG
FT                   PRGTGKTSSARILARSLNCLSSDGPTAEPCGTCELCTAIAAGGALDVIEIDAASNTGVD
FT                   NIRDLIERSRFAPVQARWKVYVVDECHMLSTAAFNALLKTLEEPPPRVVFVLATTDPQR
FT                   VLPTILSRCQRFDFRRIPLQALEQHLLWIAEQEAINITPEAVHLVAQLAQGGLRDAESL
FT                   LDQLSLLPPPVEPEAVWELLGAVPEQELLQLAAALQASDPLDLLQSCRQLLDRGREPAA
FT                   VLQGLAGLLRDLVLALAAPQHLELTSFSPANREALPALAQQLGRARLLRWQEGLRGSEV
FT                   QLRQSAQPRLWLEVLLLGLLAEPQAAAIAAAPAPIAQAATPAPAPPAAAAVPVPAPVAE
FT                   PAAAPAPAASTTPAAEPTSAPAPAAANLDLNSLWQQILASLELPSTRMLLTQQGELVRL
FT                   DNQRAVVRVAPNWAGMVQSRLPLLEQAAAKVLGQPRQVVLETGEPSQQKQPPQPAAPAP
FT                   VASPEAPPANPKPAAVAPTPPPEAPATTPAAPPTAAATPTPAAEPPAAPPKEVPAPPLP
FT                   ASSGQLEQQAKRFADFFDGAVVSDDTAA"
FT   CDS_pept        complement(59686..60402)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0064"
FT                   /locus_tag="SynRCC307_0064"
FT                   /product="Conserved hypothetical protein with NC domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26967"
FT                   /db_xref="GOA:A5GQ08"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ08"
FT                   /protein_id="CAK26967.1"
FT                   /translation="MSATATRCCLTPAAWSSRAPNAVAAADHLEVPRRHGLFMHHGIDL
FT                   GDGSVAHYLEGEKILRSTLQEFCLGETPRVISYDEADPSGQTLRRAMSRIGEQRYNLLF
FT                   NNCEHFAVWCKTGQHRSGQVERALGSGALGALAMGQMLPAALMAAVRLLLQRGLSMEQG
FT                   AGVARRALAELTSLRERLQARLERELQQMEQWWQRETNSDALPRLQAQSLADQLAAVDE
FT                   LEGQLKRLLGESDKAE"
FT   CDS_pept        complement(60341..61690)
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="SynRCC307_0065"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit,
FT                   ClpX"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26968"
FT                   /db_xref="GOA:A5GQ09"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ09"
FT                   /protein_id="CAK26968.1"
FT                   /translation="MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDE
FT                   ELVDGQAGARQGQGDASRKQAAPRKPSKPAPTLATIPKPQEIKAHLDEQVVGQNDAKKV
FT                   LSVAVYNHYKRLAWQGDGSTEPESSATRLHKSNILLIGPTGCGKTLLAQTLAEMMEVPF
FT                   AVADATTLTEAGYVGEDVENILLRLLQKADGDVEQAQRGIIYIDEIDKIARKSENPSIT
FT                   RDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDVI
FT                   QRRMGRNAIGFVPGETRNGRSRQKDQEASQVLRNLEPDDLVKYGLIPEFIGRIPVSAVL
FT                   EPLDEQALEAILTEPRDALVKQFQTLLSMDSVRLEFQPEAVRAIAREAHRRKTGARALR
FT                   GIIEDLMLDLMYDLPSQNEVQKFVITEELVDECHGNKVLPHPSSLEQQSA"
FT   CDS_pept        complement(61775..62398)
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SynRCC307_0066"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26969"
FT                   /db_xref="GOA:A5GQ10"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ10"
FT                   /protein_id="CAK26969.1"
FT                   /translation="MIEAISHHPIHSSWQNTLVPTVVEQSGRGERAFDIYSRLLRERII
FT                   FLGTGIDDAIADAVVAQLLYLEAEDPEKEIQIYVNSPGGSVTAGLAIYDTMQQVAPDVV
FT                   TICYGLAASMGAFLLSGGTKGKRLALPNARIMIHQPLGGAQGQAVDIEIQAKEILYLKE
FT                   TLNGLMASHTGQDLAKVSEDTDRDYFLSPDEAVAYGLIDRVVRD"
FT   CDS_pept        complement(62419..63894)
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SynRCC307_0067"
FT                   /product="Trigger factor"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26970"
FT                   /db_xref="GOA:A5GQ11"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ11"
FT                   /protein_id="CAK26970.1"
FT                   /translation="MTTALKVKTSSLPGSRLALEVGVPADRCKASYEAAVERLSRSVRL
FT                   PGFRKGRVPKPVLLQQIGPLRVKASALEDLVDSVLRDAVEQEKVEVLGQPSLSGNFEEL
FT                   LEKFDPAKELVVTLEMDVAPTPTLKSTKGLSAEAESVAYDPARVDELLDQSRRQLATLV
FT                   PVSDRAAAMGDVAVVSFSGVFSDDKSAIEGGSANGLDVELEEGRMISGFVEGVVGMKPG
FT                   DKKDVDCQFPDDYPEETCRGRKALFSISLDELKGRELPELDDAFAQQASDKKTLSELRE
FT                   DLENRLKQDAEQRQKNNRHEALLKALVDQLEVELPESLIKEEINSLLQETAAQMAQQGM
FT                   DVKKLFTPETVQNLAQASRGEATERLQRSLALKALAKAEGISVADKDLEAKIKEVSAGF
FT                   SDTNKIDPQRLRDAVAEDLLRETLLSWLEENAKLTMVDPASEDKPAKASKAKSSKAKAE
FT                   KEPAAEGQAKAKPAAKTSKSKTKAAEKLITPID"
FT   CDS_pept        64049..65077
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="SynRCC307_0068"
FT                   /product="Aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26971"
FT                   /db_xref="GOA:A5GQ12"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ12"
FT                   /protein_id="CAK26971.1"
FT                   /translation="MTFASAAIPPTVAILGATGAVGQELLTLLEERSFPLKQLRLLASP
FT                   RSAGQTVAFKGQTLTVEPVSAEALSGVDVVLASAGGSVSRQWAPVAVEQGAVVIDNSSA
FT                   FRMDPAVPLVVPEVNPQAALTHQGIIANPNCTTILLTLALAPLAALRPLRRVVVSTYQS
FT                   ASGAGARAMEELRQLSRTVLDGGEARSEVLPHSLAFNLFLHNSPLQANGYCEEELKMLN
FT                   ETRKIMQLPELSLSATCVRVPVLRAHSEAVNIEFEAPLSVVEARAALAQAPGVELIEDF
FT                   ETNRFPMPTDVTGRDPVAVGRIRQDLSHPQALELWLCGDQIRKGAALNAVQIAELLLEA
FT                   AR"
FT   CDS_pept        65074..65973
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="SynRCC307_0069"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /note="Amino acid transport and metabolism / Cell envelope
FT                   biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26972"
FT                   /db_xref="GOA:A5GQ13"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ13"
FT                   /protein_id="CAK26972.1"
FT                   /translation="MSSLSSAPFGRVVTAMVTPFAADGSLDLPLAARLAQHLVAHGSDG
FT                   LLVCGTTGESPTLSWDEQLALIKTVLDAVGEKVPVLAGTGSNSTAEAVEATREAAALGA
FT                   HGALVVVPYYNRPPQEGLEAHFRAVAAAAPELPLMLYNIPGRTGCSLHPATTARLLDCD
FT                   NVVAYKAASGTTSEVSALRLACGSRLAIYSGDDGLTLPMLAAGAVGVVSVTSHLAGVEL
FT                   SAMIDHYMAGRHAEALALHERLLPLMEGLFCTSNPTPVKAALELQGWPVGAPRLPLMPA
FT                   DSSVRDTLSTLMAALRPT"
FT   CDS_pept        66035..67894
FT                   /transl_table=11
FT                   /gene="SynRCC307_0070"
FT                   /locus_tag="SynRCC307_0070"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26973"
FT                   /db_xref="GOA:A5GQ14"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ14"
FT                   /protein_id="CAK26973.1"
FT                   /translation="MSSNGSKTQQPTLRVIPLGGLHEIGKNTCVFEFGDDLVLIDAGLA
FT                   FPSDGMHGVNVVMPDTSFLRENQKRIRGMIVTHGHEDHIGGISHHLKHFNIPIIYGPRL
FT                   ALSLLEGKMSEAGVADRTVLQTVTPREVVKLGQHFKIEFIRNTHSMADSYSLAVTTPVG
FT                   TVIFTGDFKFDHTPVDGEHFDMARLAHHGDQGVLCLFSDSTNSEVPGFCPPERSVFPCL
FT                   DRRIAEAEGRVIITTFASSIHRVAMVLELAMKNGRKVSLLGRSMLNVIAKARELGYMRC
FT                   PDDLFVPIKQIRDLPDRETLLLMTGSQGEPLAALSRISRGEHPQVQVKSTDTIIFSASP
FT                   IPGNTISVVNTIDRLMMLGAKVVYGKGEGIHVSGHGFQEDQKLMLALTKPKFMVPVHGE
FT                   HRMLVQHARTAHSMGVPENNTLIIDNGDVVELTADSIRKGDPVKAGIELLDNSRTGIVD
FT                   ARVLKERQQLAEDGVITLLAAVSVDGKMVAPPRVNLRGVVTTAEPRKLSMWAEREVNWV
FT                   LDNRWKQLCRNTGGKAPEVDWIGVQREIEVGLQRRLRRELQIEPLIICLVQPAPAGTPP
FT                   YKSKAMEEKDDRPAPRHQRNNDRGGDRNNDNRQRRRRSTAVAG"
FT   CDS_pept        complement(67891..68811)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0071"
FT                   /locus_tag="SynRCC307_0071"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26974"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ15"
FT                   /protein_id="CAK26974.1"
FT                   /translation="MGYDAAEQAYGEHRFAEAQELLNEHLTEQPDDPRALLLQAYIHFY
FT                   GFQDTAAAASSYRRVLELATEGPYHDLALEGLKHCPVSERQAKTAEPTVEPAQTQEPAD
FT                   ENEQPAAAPWLAELKPQPEQPRQTTAKPDPEPEPEPAKLQQEPQAEVSYAMAEQAYQER
FT                   EFTAAQQLLNTLLAESPNDLRCLLLQGYVSSFGLHDEPAAITSYQRVLELETEGPYRDL
FT                   AIEGLSQCGINLEPAPAEPGESEPEPDPADDAAELSSLADAAAEPETPQPEPKPAQAED
FT                   KPATKTASEQALADGWLLVDLSAEA"
FT   CDS_pept        complement(68811..69824)
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="SynRCC307_0072"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26975"
FT                   /db_xref="GOA:A5GQ16"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ16"
FT                   /protein_id="CAK26975.1"
FT                   /translation="MRTILPSGKQPWSRWHHRLHQLLLDDPSLLPQGSGLLIAISGGQD
FT                   SLALTRLLLDLREQHHWQLQLWHGNHNWRQDAAANAQHLQQVAAQWGLPLTVDCAEPAP
FT                   KSEAAARQWRYERLQRQAETSSCPLVLTGHTATDRAETLLFNLIRGADLTGLSSLRQTR
FT                   PLGAGITVVRPLLAFSRADTQACCEQLGLLVWHDITNADRQFSRNRLRLDVIPELEALN
FT                   PGATQHLARAAQLLEELEGQHSALEALALEAIRSEPGRADLNRQRWQEQPIKLQKRLLH
FT                   RWVQQTSQQQLSAALTTEIWRQLQKPGRRPPIALSHGWQLQAEACMLKLIPPAASD"
FT   CDS_pept        69729..70595
FT                   /transl_table=11
FT                   /gene="SynRCC307_0073"
FT                   /locus_tag="SynRCC307_0073"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26976"
FT                   /db_xref="InterPro:IPR007570"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ17"
FT                   /protein_id="CAK26976.1"
FT                   /translation="MGQQAWIIQQELVQPVVPAAPGLLARWEDGSHPMPLGMSPAASLP
FT                   TSLQRALEQRRLLKVIAGLANFDSASVARVARAAAAGGADLVDVACDPELVALAAAESG
FT                   LPICVSAVDPELFPAAVAAGAAMVEIGNYDSFYPQGRLFDAAEVLELTRRTRQLLSEVT
FT                   LSVTVPHTLPLDQQEQLAIDLVDAGADWIQTEGGTSANPLSPGVQGLIEKASPTLAAAH
FT                   VISRAVAVPVLCASGLSAVTLPLAQAAGAAGVGVGSAINRLSDELAMVAVVRGLRDALS
FT                   ALNPVQV"
FT   CDS_pept        70629..72635
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="SynRCC307_0074"
FT                   /product="Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26977"
FT                   /db_xref="GOA:A5GQ18"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ18"
FT                   /protein_id="CAK26977.1"
FT                   /translation="MDFRLEAPYSPNGDQPTAIETLVQGVEGGQRYQTLLGATGTGKTF
FT                   SIANVIQRTGRPALVLAHNKTLAAQLCNELRQFFPHNAVEYFISYYDYYQPEAYVPVSD
FT                   TYIAKTASINEEIDMLRHSATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVPFSVGE
FT                   TLNLRGSLRELVNNQYSRNDTEIARGRFRVKGDVLEIGPAYEDRLVRIELFGDEVEAIR
FT                   YVDPTTGEILQSLETINIYPAKHFVTPKDRLESAVGAIRQELRDRLDWLNANGKLLEAQ
FT                   RLEQRTVYDIEMLQQVGYCNGVENYARHLAGREAGTPPECLIDYFPDDWLLVVDESHVT
FT                   CSQLQAMYNGDRSRKQVLIDHGFRLPSAADNRPLKGTEFWDKAKQTIFVSATPGDWEMQ
FT                   VSDGQVAEQVIRPTGVLDPLIEVRPSGGQVDDLLGEIRVRAERNERVLVTTLTKRMAED
FT                   LSDYLAENQVKVRYMHSEIHSIERIEIIQDLRNGEYDVLVGVNLLREGLDLPEVSLVAI
FT                   LDADKEGFLRAERSLIQTIGRAARHVSGVALLYADNMTDSMVKAISETERRRAIQMAYN
FT                   EKHGITPHAAGKKSTHNPILAFLEMSRKLNDEQLDEAVEEAKQDAVPLENLPELIQQLE
FT                   ERMKGAASKLDFEEAANLRDRIKQLRQKLVGKA"
FT   CDS_pept        complement(72639..74441)
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="SynRCC307_0075"
FT                   /product="Aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26978"
FT                   /db_xref="GOA:A5GQ19"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ19"
FT                   /protein_id="CAK26978.1"
FT                   /translation="MALLVQKYGGTSVGSVERIQAVAKRVAAARLDGHDLVVVVSAMGH
FT                   TTDELTALARALNPDPPQREMDMLLATGEQVSIALLSMALQAEGVAATSMTGPQVGIVT
FT                   ESAHGRARILEVRTERVKRRLHDGHVVVVAGFQGTSTGSAGTPEITTLGRGGSDTSAVA
FT                   LAAALGADACEIYTDVPGVLTTDPRKVPEAQLMTQVSCDEMLELASLGAAVLHPRAVEI
FT                   ARNYGVPLIVRSSWSDEPGTRLFSQPSRRIGSEGLELGKPVDRAELLEGQAVVALAHVP
FT                   DEPGVAARLFEGLGAAGLNVDLIVQATHDGSSNDIAFTLAEAELPAAEAFCREHLGEGS
FT                   QLQVQSGLAKLSIGGAGIMGRPGVAAQLFDGLSKMGISLRMIATSEVKVSCLIQGEQAA
FT                   KALRTAAQVFELDDHQLQHNPLPGGEGEPDVRGVALDRDQAQLTVTAVPDRPGSAAALC
FT                   RALADGGISLDTIVQSERQRQTDLGLCRDIAFTLPRDDLSRASEALRPLLKLWPGAELV
FT                   EGKAIARVSAVGAGMPSTPGSAAKMFRALADAGINIEMIATSEIRISCVVPEDDGIGAL
FT                   QAVHQAFGLNGESQHQAQGSEWAG"
FT   CDS_pept        complement(74465..75430)
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SynRCC307_0076"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26979"
FT                   /db_xref="GOA:A5GQ20"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ20"
FT                   /protein_id="CAK26979.1"
FT                   /translation="MPIHLYWGDDATARERAVQELIDQIIEPAWVSLNLSRLDGSSADQ
FT                   AAQALNEARTAPFGGGGRVVLLQRSPFCERCPAELAEQLESALPLIPEQSHLVLVSAGK
FT                   PDARLRTTKALRKVAEEKKFPLPAIWDGAGLIELVQRSAAAAQLQLEPAAAELLADTIG
FT                   NDSSRLAGELEKLALYCGEKAVDVEAVKALAGPAQHNALAVGEALLAGDVGGALTQIDG
FT                   LMAANEPPLRLVASLVSQLRGWLWLTLLEQSGEQDPMVIAKAAGIGNPKRIYVMRKQLR
FT                   GVRPQRLLKLLGRLLDVEAALKLGSPADVAFRDGLLGQSG"
FT   CDS_pept        75424..76059
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="SynRCC307_0077"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26980"
FT                   /db_xref="GOA:A5GQ21"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ21"
FT                   /protein_id="CAK26980.1"
FT                   /translation="MASAAGLDHPIFTESIQRIQALLGPTGLPLLEQEVLERLIHSSGD
FT                   PALAPLLRFTPGACTTAASDLAQGAVILTDTAMAAAAAAPMAARTFSNPVHSVLQWAPP
FT                   QAPEGQTRAALGMAAALQAHPGAVVLIGSAPTALELLLDRVAQGDRAPALVIGMPVGFV
FT                   GVADSKRRLAASGLPQIRLEGSRGGAGLVAAAVNALLRRAWLDQQANG"
FT   CDS_pept        complement(76041..78698)
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="SynRCC307_0078"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="Low identity with RCC0315"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26981"
FT                   /db_xref="GOA:A5GQ22"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ22"
FT                   /protein_id="CAK26981.1"
FT                   /translation="MAPGEQQLSLVPDDTIQGSLFAPEPSEDKTEESERPKQRRSHPGR
FT                   RTAPAAQHNEDSSNNDDEGLPRWHHHGLVDPLALTPMLRHYVELKAAHPERVLLYRLGD
FT                   FFECFFEDALLTSRLLELTLTGKEGGKSIGRVPMAGIPHHAAERYCSELVRRGHAVALC
FT                   DQLETTAAKGALLKRDITRVLTPGTVLEEGMLAARRNNWLAAVVLDDEQRWGLAVADVS
FT                   TGELLLHERQGTTELQQQLLQLEAAELLLPGIEAAEWCPDGLGLTQQPRTPFEAASADR
FT                   ALKQRFGVRNLEGLGLADHPLARRAAGGLIAYLDASQPGSTVPLERPQLVFAGDALVLD
FT                   HQTRRNLELTATQRDGQFQGSLLWAIDRSHTAMGGRALRRWLEAPLLDATAIRGRQEAI
FT                   TELVEQRPLRLSVRRLLRPMADLERLAGRCGAGRASARDLVALADGLERLPLLADLLKS
FT                   SSAAPLADLQQPRPDLQQLAELLRFQLVDQPPMSLSEGGLIHDGVDEDLDDLRNRLDEQ
FT                   ENWLAGVEKRERKASSNPNLRLQFHRSFGYFLAVSRAKATAVPDHWIRRQTLSNEERFV
FT                   TPELKEREGRILQLKARSHQREYDLFCRLRDQVGEQATAIRDAARAVASLDALAGLAEL
FT                   AATQGYCRPELTDGRCLEIEGGRHPVVEQLLSESAFVPNSVALGHGDKPDLVVLTGPNA
FT                   SGKSCYLRQCGVLQLMAQMGSWIPAERAAIALADRIFTRVGAVDDLASGQSTFMVEMAE
FT                   TANILQHASERSLVLLDEIGRGTATFDGLSIAWAVAEHLASAPPHGLGARSIFATHYHE
FT                   LNALAGSHSNVANFQVVVEEQDAELVFLHKVMPGGADRSYGIEAARLAGVPPSVVQRAR
FT                   QMLERIEGGQPLAC"
FT   CDS_pept        78830..79018
FT                   /transl_table=11
FT                   /gene="psbZ"
FT                   /locus_tag="SynRCC307_0079"
FT                   /product="Photosystem II protein PsbZ (ycf9)"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26982"
FT                   /db_xref="GOA:A5GQ23"
FT                   /db_xref="InterPro:IPR002644"
FT                   /db_xref="InterPro:IPR036512"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ23"
FT                   /protein_id="CAK26982.1"
FT                   /translation="MQILNTLTVLALVVMSFALIVAVPVLYASNDESGNSNRLILFGGL
FT                   AWVGLVLLNWGMSFFVV"
FT   CDS_pept        79068..79547
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SynRCC307_0080"
FT                   /product="Riboflavin synthase beta-chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26983"
FT                   /db_xref="GOA:A5GQ24"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ24"
FT                   /protein_id="CAK26983.1"
FT                   /translation="MTVFEGRFTDAGGLRIAVVVARFNDLVTGKLLSGCLDCLSRHGID
FT                   VAETSSQLDLAWVPGSFEIPLLAKRLASSGRYDVVITLGAVIRGDTPHFDVVVAEVSKG
FT                   VAAVARESGVPVIFGVLTTDTLQQALERAGIKSNLGWNYGLQALEMGSLMRSVPA"
FT   CDS_pept        79544..80434
FT                   /transl_table=11
FT                   /gene="rmlA, rfbA"
FT                   /locus_tag="SynRCC307_0081"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26984"
FT                   /db_xref="GOA:A5GQ25"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ25"
FT                   /protein_id="CAK26984.1"
FT                   /translation="MSASRKGIILAGGSGTRLHPITRAVSKQLLPVYDKPMVYYPLTTL
FT                   MLAGIREVLVITTPHDQPSFERLLGDGSAWGMEIQYAVQPSPDGLAQAFLIGADFLAGS
FT                   PAALVLGDNLFHGHDLVLQLQASNQQQHGATVFAYPVSDPERYGVVEFADDGRVLSIEE
FT                   KPKQPKSRYAVTGLYFYDDTVVERARQVKPSPRGELEITDLNASYLNDGQLQVELMGRG
FT                   MAWLDTGTYDSLQEAGAYIRTLEHRQGLKVACPEEVAWRLGWISSDQLAALAGPLRKSG
FT                   YGNYLLQLLEVPIAG"
FT   CDS_pept        80424..81005
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="SynRCC307_0082"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26985"
FT                   /db_xref="GOA:A5GQ26"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ26"
FT                   /protein_id="CAK26985.1"
FT                   /translation="MQVEQLRSATGATVEGPLLITPRVFGDERGWFFESWNQRRFDEAA
FT                   GEAVTFAQDNHSRSAQGVLRGLHYQLPPEPQAKLVRVTVGEIFDVVVDLRQSSPTCGQW
FT                   VGAQLSAENHQQLWVPEGFAHGFLTLSAVAEVQYKTRGFWNKGCERAIRWDDPALAIAW
FT                   PLEGLTVQVSEKDGLAPSLAQAQQAGDLFR"
FT   CDS_pept        81002..81880
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="SynRCC307_0083"
FT                   /product="Putative dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26986"
FT                   /db_xref="GOA:A5GQ27"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ27"
FT                   /protein_id="CAK26986.1"
FT                   /translation="MKVLLTGCAGQLGQALVASAPDGVELLATSRAELDLADPEACCCI
FT                   VEEQRPDWVLNAGAYTAVDQAEQEPALAEAVNAQAPAAFAAALKQTGGRLLQLSTDFVF
FT                   NGAQGHPYGPKQPREPLGVYGASKARGEQAALQHPQARLLRTSWVYGPVGKNFCRTMLR
FT                   LHAAKAKAGEPLRVVADQVGCPTSTLTLAKACWRAIGIGADPDGPRVLHWSDAGAASWY
FT                   DFAMAIGELAQAHGLLRQAARVEPITTADYPTPATRPSYSLLDCTASRQALGLPAVHWR
FT                   DALAEVLARAQ"
FT   CDS_pept        81906..82991
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="SynRCC307_0084"
FT                   /product="dTDP-glucose-4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26987"
FT                   /db_xref="GOA:A5GQ28"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ28"
FT                   /protein_id="CAK26987.1"
FT                   /translation="MPDSLLPAGINRVLVTGGAGFIGGAVVRRLLSDSDALVFNLDKCG
FT                   YASDLASIEALPEAKGRHQLLQLDLADAEATAAAVQQADPDLVMHLAAESHVDRSIDGP
FT                   GAFISSNVNGTFALLQAARSHWEGLSEERRSRFRFHHISTDEVFGSLGATGRFSESTPY
FT                   DPRSPYSASKAASDHLVNAWHHTYGLPVVLTNCSNNYGPWQFPEKLIPVVILKAIAGEP
FT                   IPLYGDGANVRDWLYVEDHVDALLLAATRGQLGASYCVGGHGERSNREVVETICQLLDE
FT                   RRPEGAPHARLITRVADRPGHDRRYAIDPARISSELGWQPRHDFNAGLAATVDWYLQNQ
FT                   QWCNSVRQRAGYSGERIGTRA"
FT   tRNA            complement(83058..83129)
FT                   /locus_tag="RNA_2"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGY"
FT   CDS_pept        complement(83121..83609)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0085"
FT                   /locus_tag="SynRCC307_0085"
FT                   /product="Possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26988"
FT                   /db_xref="GOA:A5GQ29"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ29"
FT                   /protein_id="CAK26988.1"
FT                   /translation="MERPLEDVAMNGTRLLMHAPGAPGLRLLGLGPGLRPTRGLYKLQR
FT                   LLNQHAFWAQGRSISQLRRMLAGSAAVASLWRGKRLVGFARASSDGAFRAVLWDVVIPE
FT                   DVQGRGLGRQLVEALLQHPSLQGVERIYLMTTNGEGFYTQLNFRRSNGQTLMLKESSG"
FT   CDS_pept        83543..86479
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SynRCC307_0086"
FT                   /product="Preprotein translocase SecA subunit"
FT                   /note="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26989"
FT                   /db_xref="GOA:A5GQ30"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ30"
FT                   /protein_id="CAK26989.1"
FT                   /translation="MHRAHALEALCRSWQHPPKASPSPRSPFCHCPMLKLLLGDPNARK
FT                   LKRYQPLVSDINLLEEDIAPLSDEDLRRRTSEFRQQLENAGSLERQRPVLDQLLPEAFA
FT                   IVREAGKRVLGMRHFDVQLLGGMVLHDGQIAEMKTGEGKTLVATLPSYLNALTGRGVHV
FT                   VTVNDYLARRDAEWMGQVHRFLGLSVGLIQQDMSPAERRQNYGCDVTYATNSELGFDYL
FT                   RDNMATDISEVVQREFQYCVIDEVDSILVDEARTPLIISGQVERPQEKYNQAAALALQL
FT                   DRAAEMSKDGIDPEGDYEVDEKQRSVILTDEGYAKAESILGVEDLFNAADPWAHYVTNA
FT                   LKAKELFIKDVNYITRDNEVVIVDEFTGRVMPGRRWSDGLHQAVEAKESMPIQPETQTL
FT                   ASITYQNFFLLYPRLAGMTGTAKTEEVEFEKTYKLEVTVVPTNRTRARRDLVDQVYKTE
FT                   TGKWRAVAQETAEVHRTGRPVLVGTTSVEKSEVLSALLQEEGIPHNLLNAKPENVEREA
FT                   EIVAQAGRTGAVTIATNMAGRGTDIILGGNTDYMARLKVREALLPRLVRPEEGHRPPVP
FT                   LQREASSGFAAAASAPAKPPSEARALGRLYPCELSPDTDAALADVARELVKLWGDRTLT
FT                   VLELEDRISSAAEKAPSEDAGIMQLRQVLAQIRADYDAVISTEQASVRETGGLHVIGTE
FT                   RHESRRVDNQLRGRAGRQGDPGSTRFFLSLEDNLLRIFGGDRVAGLMNAFRVEEDMPIE
FT                   SGMLTRSLEGAQKKVETYYYDMRKQVFEYDEVMNNQRRAVYVERRRVLEGRDLKKQVLG
FT                   YGERTMDDIVEAYVNPELPPEEWDLSHLTNKVKEFVYLLQDLEPQQLAGLSMEELKAFL
FT                   HEQLRIAYDLKEAEIEQLKPGLMREAERFFILQQIDSLWREHLQSMDALRESVGLRGYG
FT                   QKDPLIEYKNEGYDMFLEMMTQVRRNVIYSMFMFQPQPAPAQEDEAVV"
FT   CDS_pept        complement(86489..87190)
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SynRCC307_0087"
FT                   /product="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26990"
FT                   /db_xref="GOA:A5GQ31"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ31"
FT                   /protein_id="CAK26990.1"
FT                   /translation="MLHSLRADIAIIRDRDPAARGVLEILLCYPGLHALCLHRLSHRLW
FT                   TAGLPLIPRLMSQLGRLITGVEIHPGASIGQGVFIDHGMGVVIGETAVVGNRCLLYQGV
FT                   TLGGTGKQSGQRHPVLGENVVVGAGAKVLGGISVGANTRIGAGSVLLRDVDADCTVVGV
FT                   PGRVIHQSGVRINPLAHSQLPDAEAQVIRNLMERIDALENALARGGQAPAAQAQSLRDR
FT                   EILEFLEGSGI"
FT   CDS_pept        complement(87193..88293)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0088"
FT                   /locus_tag="SynRCC307_0088"
FT                   /product="cyanobacteria-specific GntR-like HTH domain
FT                   containing transcriptional regulator"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26991"
FT                   /db_xref="GOA:A5GQ32"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ32"
FT                   /protein_id="CAK26991.1"
FT                   /translation="MAKPTQRTRQELSRGTCATTVARSICCHTPGVRFHIQQESDIPAS
FT                   TQLYNQICFAIAARHFPPGHRLPSTRQLAMQTGLHRNTISKVYRQLENDGVVEAMAGSG
FT                   IYVRDQQKPREVKAPSGPRHRIRPDIDQEVRRSIDGLLNAGCTLQQARELLTREIDWRL
FT                   RCGARVLVSTPREDLGASLLIAEELTPKLEVPVEVVPLEELEAVLESSNNGTVVTSRYF
FT                   LQPVEELAKQHGVRAVAVDLNDFRHELAMLKELRAGSCVGLVSISPGILRAAEVILHSM
FT                   RGQELLVMTASPDVGSRLLALCRAASHVLCDRPSLPLVEQTLRQNRSQLMRLPQVHCAQ
FT                   SYLGASTIDMLCKEIGLDSSANAPSP"
FT   CDS_pept        88238..89020
FT                   /transl_table=11
FT                   /gene="SynRCC307_0089"
FT                   /locus_tag="SynRCC307_0089"
FT                   /product="Putative carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="Secondary metabolites biosynthesis, transport, and
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26992"
FT                   /db_xref="GOA:A5GQ33"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ33"
FT                   /protein_id="CAK26992.1"
FT                   /translation="MAHVPRDNSWRVLCVGLAMAWLTISGSQVSLRCWFERPPQPRSLV
FT                   LVLPEVFGINSWLRDVASRLVAAGHGVLVMPLFARTAPALDVGYDAAGLAEGRQHRDAV
FT                   TAAGFQSDVDAVLSWLVQEPELAHLPLAGLGFCFGGHLAWHLAARPELKATASFYGARV
FT                   STFSPGGGPPTLQLAAEIPGRLLVWLGADDPLMPADEQQAIGSALRAADPSAERLQCRI
FT                   APAAGHGFMCSQRSDFKPEAAQQGWQSLLELLDQVAEV"
FT   CDS_pept        complement(89017..89664)
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="SynRCC307_0090"
FT                   /product="Translation initiation factor IF-3"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26993"
FT                   /db_xref="GOA:A5GQ34"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ34"
FT                   /protein_id="CAK26993.1"
FT                   /translation="MAPRPRFDRRAPVRELPNINDRINYPKLRVVDADGTQLGVISRDE
FT                   ALDVARERELDLVLVSEKADPPVCRIMDYGKFKFEQEKKAKEAKKKSHQTEVKEVKMRY
FT                   KIDAHDYQVRIGQAVRFLKAGDKVKCTVIFRGREIQHTALAEKLLMRMAKDLEESAEVQ
FT                   QPPKREGRNMIMFLGPRKTPLQKDKPEQATKAERTLPIAKPPGKTAAPAAAN"
FT   CDS_pept        complement(89712..90602)
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="SynRCC307_0091"
FT                   /product="tRNA
FT                   delta(2)-isopentenylpyrophosphatetransferase"
FT                   /EC_number="2.5.1.8"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26994"
FT                   /db_xref="GOA:A5GQ35"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ35"
FT                   /protein_id="CAK26994.1"
FT                   /translation="MTPLMVLVLGPTASGKTSLGIALAQQLDCRVLSIDSRQLYAGMDI
FT                   GTAKPTRDEQQQARHELLNLSTPDQPINLQQFCSHAQTLIEQEQQRGRPALLVGGSGLY
FT                   LQALSQGLQPPALPPQTGLRQQLQQLGQSCCHQLLSQADPQAAAKIEPNDPVRTQRALE
FT                   VLYGTGQTISSQQGRCPPACRVLELGLNPSDLKERIEQRTASLYARGLVAETETLSRRY
FT                   GADLPLLQTIGYGEALAVLAGRLSESEAQALTSRRTWLFAKRQRTWFRNRHQPLWLNTE
FT                   SALEEALEAIAAARS"
FT   CDS_pept        90734..92707
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SynRCC307_0092"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26995"
FT                   /db_xref="GOA:A5GQ36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ36"
FT                   /protein_id="CAK26995.1"
FT                   /translation="MSEATRPSSSQVQAAYGAEQIQVLEGLEPVRKRPGMYIGSTGPRG
FT                   LHHLVYEVVDNSVDEALAGHCNTIDVCLRADGSCSVADNGRGIPTDVHPRTGKSALETV
FT                   LTVLHAGGKFGSGGYKVSGGLHGVGVSVVNALSEWVEVTVHRQDKVHRQRFERGAPIGS
FT                   LASEAGEKGRTGTSVCFKPDIEIFTGGISFDYATLSGRLRELAYLNGGVKIVFRDERPE
FT                   AAGEDGQPHEEIYFYEGGIREYVNYMNAEKDPLHPDIIYVNSEKDGVQVEAALQWCVDA
FT                   YSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFARKRGKRKDSDGNLAGENIREGLT
FT                   AVLSVKVPDPEFEGQTKTKLGNTEVRGIVDTVVGEALSEYLEFHPQVIDLILEKAIQAF
FT                   NAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDR
FT                   RNQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEEFDVSNLRYHRIVIMT
FT                   DADVDGAHIRTLILTFFYRYQRELVEGGYIYIACPPLYKVERGKNHTYCYNEQDLKKTL
FT                   DGFGEKANYTIQRFKGLGEMMPQQLWETTMDPTTRTMKRVEIEDAAQADRIFTILMGDK
FT                   VAPRREFIETHSAELNLADLDI"
FT   CDS_pept        92707..93027
FT                   /transl_table=11
FT                   /gene="SynRCC307_0093"
FT                   /locus_tag="SynRCC307_0093"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26996"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ37"
FT                   /protein_id="CAK26996.1"
FT                   /translation="MVLRWAWVLGLALMAPVALPAGGADLRHPDPRRRGSSGPLLSGGR
FT                   DQLKSSPASKAPSLLTLGRETPMTVLRHWNSPDGRRWAYVQVLTGSGLGVGQVHKRGWI
FT                   NV"
FT   CDS_pept        93020..93442
FT                   /transl_table=11
FT                   /gene="SynRCC307_0094"
FT                   /locus_tag="SynRCC307_0094"
FT                   /product="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26997"
FT                   /db_xref="GOA:A5GQ38"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ38"
FT                   /protein_id="CAK26997.1"
FT                   /translation="MSEVVAPAPFYWEAILVALGAVPGAWLRLRVVNHFEPVVPHKHWG
FT                   TFFVNVSAAFFLGLFSGLHTLQLKACSGVDGTAPMMLLVGVGFFGSLSTFSTFVVELLN
FT                   TLQSRQFLQFVGLMVFSLVIGLLAAAAGYQLGLSHG"
FT   CDS_pept        93435..93848
FT                   /transl_table=11
FT                   /gene="SynRCC307_0095"
FT                   /locus_tag="SynRCC307_0095"
FT                   /product="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26998"
FT                   /db_xref="GOA:A5GQ39"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ39"
FT                   /protein_id="CAK26998.1"
FT                   /translation="MAESQAQDSPNLDWRLLELILVAIGAVPGALIRWQAAGVYFGDGD
FT                   NVVVNVAGAFILGLLVGRGVDARWQLLVGTGFCGSLTTFSAWMVDCVVLMAAGQWLQAA
FT                   GLLGITLGLGLGFGALGVLLGRLLRRPRPSQSP"
FT   CDS_pept        complement(93817..94287)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0096"
FT                   /locus_tag="SynRCC307_0096"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26999"
FT                   /db_xref="GOA:A5GQ40"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ40"
FT                   /protein_id="CAK26999.1"
FT                   /translation="MALSLNGVSVTSADGSSRDLATDNGSVLLIVNVASQCGFTKQYAG
FT                   LQQLHERYGKQGLKVIGFPCNDFGAQEPGTIEEIKTFCSSNYGVSFELMSKVASDAAPF
FT                   DTLTQADPAGPIAWNFEKFLVGKDGGVIARFKSGVEPESSELTTAIETALAA"
FT   CDS_pept        94359..95741
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="SynRCC307_0097"
FT                   /product="Mg/Co/Ni transporter MgtE"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27000"
FT                   /db_xref="GOA:A5GQ41"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ41"
FT                   /protein_id="CAK27000.1"
FT                   /translation="MSDSATAIPELTEYLQRLIDAGNYDAVKQLLNPEQPVDAAEAISN
FT                   LPTLQQAIAFRLLPKDEAIEVYEYLEPAVQQSLLERMRSSEVLELVEEMSPDDRVRLFD
FT                   ELPAKVVRNLLQQLSPDERRVTAELLGYESETAGRLMTTEFIGLKEFTTAAQALEIVRR
FT                   QASATETVYTLYVTDAARRLTGILSLRQLVVSDPQATVGEVMTRDVVRVQTGTDQEEVA
FT                   RLIQRYDFLALPVVDSEDRLVGIVTVDDVIDVIEQEATRDLYAAGAVQAGDEDDYFKSN
FT                   LFTVARRRVVWLVVLLLANSGTAAVIASMDGVLKQVVVLAAFIPLLIGTGGNVGAQSST
FT                   VIIRGLSTQRLQSLGSWRAIWREAVAGALLGFLLMLVVIPWAAYVSGGNWLVAWAAGIS
FT                   LVGITTLAATAGAALPLLFNRLGLDPALMSAPFIATATDVAGVFIYLRTAMILLERFSS
FT                   AS"
FT   CDS_pept        95821..96795
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="SynRCC307_0098"
FT                   /product="Alternative RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27001"
FT                   /db_xref="GOA:A5GQ42"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ42"
FT                   /protein_id="CAK27001.1"
FT                   /translation="MATTAVDQRPPVDGDLVRSYLRDIGRVPLLSHEQEITLGRQVQEL
FT                   VRLEEAEAEFKMRQGHEPSREELASSFGISPAVLRRRLINGRRAKERMVAANLRLVVSV
FT                   AKKYTKRNMELLDLIQEGTIGLVRGVEKFDPTRGYKFSTYAYWWIRQGITRAIAEKSRT
FT                   IRLPIHITETLNKLKKGQRELSQELGRTPTVGELAEFLELPEPEVKDLLSRARQPVSLE
FT                   MKVGDSDDTELCELLQNDAPMPHELVDGDCLKGDMRSLLEQLPPLQGRVLKMRYGIDVE
FT                   EPMSLTGIGRELGMSRDRVRNLERDGLAGLRRLSEAVEAYVVA"
FT   CDS_pept        complement(96761..97672)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0099"
FT                   /locus_tag="SynRCC307_0099"
FT                   /product="Permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27002"
FT                   /db_xref="GOA:A5GQ43"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ43"
FT                   /protein_id="CAK27002.1"
FT                   /translation="MATDQSISFSKKSPAQVMVASAFSFSLMSLCVKQLGGRIPVAEVV
FT                   FIRALISLGLSWWVIQRQGVSPWGHRRPMLVWRGVVGTLALFCFYGAISQLPLAAATVL
FT                   QYLYPTFTAALAWGALGERAGKRILLAMALGWLGVLLVAQPDWLAQLTGDSAMDPLPAL
FT                   AVTIGITGALLTALAYVTVRHLATDEHRSVIIFYFPLMSVPMALPFVLANPVWPNAVDW
FT                   AWLIGVGLFTQLGQIFLTQGLASMPAARATAINYVQVVFAALWGLLFLGESINELMVMG
FT                   AVLVLGATLISIKPPRTPQPLH"
FT   CDS_pept        97820..98803
FT                   /transl_table=11
FT                   /gene="SynRCC307_0100"
FT                   /locus_tag="SynRCC307_0100"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27003"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ44"
FT                   /protein_id="CAK27003.1"
FT                   /translation="MQELPVLLLTWRRPDATQKVLEVLRKVKPLILYVASDGPRHQSDW
FT                   DAIRCTRATIEKLVDWPCLVKKRYLSSNLGPGLSQSSSIDWFFGEQIKGLILEDDCIPH
FT                   PDLFPFCSELLNRYEMDMRVWTISGSNHQLGRRRGNASYFFSRYHHSWGWATWRSRWQE
FT                   YSQASQIWETLVSSTDAVNSLLDNLPSDLEAKYWMEKWTPLFVLSKPNWDYRWLLVCMA
FT                   NNGLTIIPNENLVENIGFGKDATHTTQLKQQGQLPERFFLRDHPICIYPNSQADQFTFD
FT                   FHYGGLQLKKDRRFHNQILRRLRLIVTNPMHYIRKINCYARGKQNH"
FT   CDS_pept        98871..100190
FT                   /transl_table=11
FT                   /gene="SynRCC307_0101"
FT                   /locus_tag="SynRCC307_0101"
FT                   /product="Glysosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27004"
FT                   /db_xref="GOA:A5GQ45"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ45"
FT                   /protein_id="CAK27004.1"
FT                   /translation="MALRVTHLSESDLSGGAARAAYRIHRSLSRYISPDILQTTMLVKN
FT                   RISDDLDIRASRHGGHPVKNLFDTILGKWAYRRFSTSNHGLYSVAWPETGLGKEIASQI
FT                   HDNEIDIIHLHWIHNHLISIEEIGSVACPIVWTLHDQWPICGAEHYAEFVEECQQEGTF
FT                   THLPRYSCGYSEKSKLYHEPRRDLNRITWLRKKKSWDKKMFLVCPSQWMAKCVRSSALM
FT                   ADWPLAVIPNPIDLKRWKPIDPQIARNLLGLPANKHLLCFGAISGLNDPRKGNDLLLKS
FT                   LFYLKDIAINDSIEVVIFGQSEYSSCPSIPFPVHFMGQLNDDITLALTYSSCDLMMVPS
FT                   RQDNLPSTATEAHACGIPVVAYAVGGIPDIVDNNITGLLVEPGNYIKFAEAVLELVLDN
FT                   SKRMEMGKAARIRASLLWDQELIADQYAKLYQMLSRQPTT"
FT   CDS_pept        100196..100954
FT                   /transl_table=11
FT                   /gene="SynRCC307_0102"
FT                   /locus_tag="SynRCC307_0102"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27005"
FT                   /db_xref="GOA:A5GQ46"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ46"
FT                   /protein_id="CAK27005.1"
FT                   /translation="MPYLINQKLFFVHIPKTAGSSIERAFGVHPSCNKTTSNSSASLRS
FT                   GPSLVNDVLRKTINLGLSFFASSSKHKEKNNFLIGYDQPSLVLQHLTLSEMFWLGYLSQ
FT                   AELSKSTFFSVVRHPKDRIISAWRSHQRHVEFPDINDFIESRLNSLSCTTHDERAHIRP
FT                   MSHYLDISNLPCPIRLHVLRLETIQTCWSSFGERVLRDPSINLRSWPSLPHYGSNRSHV
FT                   SPVSNQSLTVKSADLIKRYYSCDYENFAYQ"
FT   CDS_pept        100926..102086
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="SynRCC307_0103"
FT                   /product="A/G-specific DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27006"
FT                   /db_xref="GOA:A5GQ47"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ47"
FT                   /protein_id="CAK27006.1"
FT                   /translation="MIMRILPINSLLRSVNFAPCVTSYLQLSLLIWSEQFGRKAIPWKH
FT                   ANTSGLLDIYGIWIAEVMLQQTQLQVALPYWQRWMQALPTVDALAAADEQQVLLLWQGL
FT                   GYYSRARRLHQAAQQLQGQPWPQDLEAWLALPGIGRSTAGSILSSAFDRPFAILDGNVK
FT                   RVLARLTAFEHPPARHSAHFWSLSEQLLDRQRPRDFNQALMDLGATLCTPRQPDCPRCP
FT                   WQSHCSAYAAGSPEQFPVKESPKPLPLQVIGVGVVLNEAGEVLIDQRLNEGLLGGLWEF
FT                   PGGKQEPGEAIEATVVRELQEELAIEVEVTEPLISLDHAYSHKRLRFEVFLCRWISGEP
FT                   QALASQQVRWVHPTGLAAFPFPAANARIIAALLQRFGHSEESSKVA"
FT   CDS_pept        102086..103057
FT                   /transl_table=11
FT                   /gene="csck"
FT                   /locus_tag="SynRCC307_0104"
FT                   /product="Fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27007"
FT                   /db_xref="GOA:A5GQ48"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ48"
FT                   /protein_id="CAK27007.1"
FT                   /translation="MAQVFCLGEALIDRLLPWGDDLGRDCLGGAPANGACALARLGTAA
FT                   GFVGRLGRDPIGAAFAELFEQRGLDTSGLQWDEQRPSRVVLVERDASGDRCFGGFDGDL
FT                   GAGFADTALAADQLPAGLGIGWLACGTIPLATPTSALALEQAISRHRAGGGRLVLDVNW
FT                   RPTFWGLAANAEPTAEIQQQMQPLLRQADLLKLAAEEAEGLFSSRDPQAVAAALPQRPA
FT                   VVVTDGGKGVSWSMGAASGALPAYRVPVVDTTGAGDAFLAGLLHRLVKEPTLLAGSDPD
FT                   RVRQALQFASACGALVCQGAGAIDPQPAEAAALAFIEQQPAG"
FT   CDS_pept        complement(103032..103475)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0105"
FT                   /locus_tag="SynRCC307_0105"
FT                   /product="Uncharacterised P-loop hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27008"
FT                   /db_xref="GOA:A5GQ49"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ49"
FT                   /protein_id="CAK27008.1"
FT                   /translation="MDLFLADAGQTHARGIALARELPKGSVLLLSGELGAGKTSLVQGL
FT                   AAGLGITEAVTSPTFALAQHYSRPDAPQQPVLVHLDLYRLELPEAADELFAQEEEVAAE
FT                   SCALLAVEWPQRLSFTPSQAWQLQLLYCDGGRQLVISPPAAAQ"
FT   CDS_pept        103547..104983
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="SynRCC307_0106"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27009"
FT                   /db_xref="GOA:A5GQ50"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ50"
FT                   /protein_id="CAK27009.1"
FT                   /translation="MVAAPEALSFAGLQATDTYVIADIAQAAFGRKEIAIAETEMPGLV
FT                   ELRNKYGAQQPLKGARICGSLHMTIQTAVLIETLVALGADVRWASCNIFSTQDHAAAAI
FT                   AERGIPVFAYKGETLDEYWAFTHRIMEWSDGGTPNMILDDGGDATGLIMLGSKAEQDIS
FT                   VLDNPSNEEEIALFKSIKARLAVDPTFYSRIKANILGVTEETTTGVARLYQMVETGELP
FT                   FPAINVNDSVTKSKFDNLYGCRESLVDSIKRATDVMVAGKQALVMGYGDVGKGSAQSLR
FT                   GLGATVCIAEVDPICALQAAMEGFRVVRLDDVVDQMDIFVTATGNFQVIRHEHLVRMKD
FT                   EAIVCNIGHFDNEIDVASLKQYEWDNIKPQVDHITLPSGNKIILLAEGRLVNLGCATGH
FT                   PSFVMSNSFTNQTLAQIELFTKRDQYENKVYVLPKHLDEMVARLHLDKIGAKLTELTSE
FT                   QAAYINVPVEGPYKVDHYRY"
FT   CDS_pept        105034..105693
FT                   /transl_table=11
FT                   /gene="SynRCC307_0107"
FT                   /locus_tag="SynRCC307_0107"
FT                   /product="Uncharacterised conserved membrane protein, DedA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27010"
FT                   /db_xref="GOA:A5GQ51"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ51"
FT                   /protein_id="CAK27010.1"
FT                   /translation="MGLTELVTQLPELIGQAVEANQWLGYTAIGAAMFLENLFPPIPSE
FT                   LIMPLGGFYVQQGQLSFIPVVLAGLIGTVIGTLPWYGIGRLINEERIEHWLERHGRWIG
FT                   ISPADLVRSRKWFSRYGTLLVFWGRLLPGIRTLISVPAGIELMPFVPFLLWTTAGSLIW
FT                   TLLLTLAGFALGEGYSNVEVWIEPVSKVIKVGLVVAAVAVAVWLGLRIWRRRHTAD"
FT   CDS_pept        complement(105696..106070)
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SynRCC307_0108"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27011"
FT                   /db_xref="GOA:A5GQ52"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ52"
FT                   /protein_id="CAK27011.1"
FT                   /translation="MGVNSVTLVGRAGRDPEVRYFESGSVVANLTMAVNRRSRDDEPDW
FT                   FNLEIWGKQAQVAADYVKKGSLLGIIGSLKLDRWTDRASGEERSKPVVRVDRLELLGSR
FT                   RDSEQNANFGGGASDDDVPF"
FT   CDS_pept        106210..107271
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="SynRCC307_0109"
FT                   /product="Rod shape-determining protein MreB"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27012"
FT                   /db_xref="GOA:A5GQ53"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ53"
FT                   /protein_id="CAK27012.1"
FT                   /translation="MAWHLMFWRRFQLSRDIGIDLGTANTLIYATGKGIVLREPSVVAI
FT                   DLDKGVPLAVGEEAKLMLGRTPGNIRAVRPLRDGVIADFDAAEQMIKYFIQKGNEGRGM
FT                   VAPRLVIGIPSGVTGVERRAVREAGLGGAREVHLIDEPVAAAIGAGLPVTEPVGSMIVD
FT                   IGGGTTEVAVLSLQGTVISESVRVAGDELSDSITSYLKKVHNLVVGERTAEEIKIRIGS
FT                   AFPDDEFDQTAMDVRGLHLLSGLPRTINVRAGDIREAMIEPLNVIVEAVKRTLERTPPE
FT                   LAADIVDRGIMLAGGGALVRGISDLVSNETGILTHVAEDPLLCVVNGCGRVLEDFKRLG
FT                   RVLDASEFSRLAN"
FT   CDS_pept        107275..108012
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="SynRCC307_0110"
FT                   /product="Rod shape-determining protein MreC"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27013"
FT                   /db_xref="GOA:A5GQ54"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ54"
FT                   /protein_id="CAK27013.1"
FT                   /translation="MAMGRRLSRLLDRSLLLSTGPWLVLLLFFLVVRVSKGAPLADLYA
FT                   QLSRPFWPGSAQSEWLKESQQLEDQQRIATLEGRLARLEQDQQLRNQAGDWITAPVISR
FT                   RIEGWWQQLELGAGRVQGIKTGAVVTGPGGVLGRISSVTPSTSRVQLLTDPSSRVGVEL
FT                   QGGRGHGLLFGEGSSRPLVKFLNNDVTVQPGDVVVTSRASSVFPANLIIGVVQSVNTQA
FT                   GPAPQGLVQLSAPADQIDWVRVR"
FT   CDS_pept        107994..108518
FT                   /transl_table=11
FT                   /gene="SynRCC307_0111"
FT                   /locus_tag="SynRCC307_0111"
FT                   /product="Uncharacterised conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27014"
FT                   /db_xref="GOA:A5GQ55"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ55"
FT                   /protein_id="CAK27014.1"
FT                   /translation="MGAGALMADRSWWRLQALILTSLLLLLLTIATPAWLRLDGMPPSW
FT                   PVLWLLPWAVVEGPIAGALAAVLVGLGFDSFYGQGISSIPVLVLLALWWGQFRDARRPL
FT                   ERSTTLGLQALLGSLLLSASFALQLHWRGGSVALAWQVSLAQALLTALLAPVVCSVQVL
FT                   LWRRLTPDDGR"
FT   CDS_pept        108508..109782
FT                   /transl_table=11
FT                   /gene="SynRCC307_0112"
FT                   /locus_tag="SynRCC307_0112"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27015"
FT                   /db_xref="GOA:A5GQ56"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ56"
FT                   /protein_id="CAK27015.1"
FT                   /translation="MAVKKRLLLLGLLVALLGGCSPGPKPNELQFWTIQLSPKFDPLIR
FT                   SMLAEWEEQNPGVNVRWTDLPFGSVERKLLAAVFARTAPDVVNLNPLFSANLASKGGLL
FT                   PLQQRLTPEVKALYLPRVLKAAEQDGELYALPWYLTARITLANQRLLKAAGYSKPPATW
FT                   AEVPAYAEAVKKRTGRYALFVTVVPDGSAELLESMVQMGVQLVDERYRATFNSLEGRRA
FT                   FAFWTDLYRRGLLPREVVSQGFRRAIELYQSGELAQLASGAEFLATIETNAPHVAADTV
FT                   PYPPVTGTDGAANVAVMNLAVSRQSRRPQLAVDLASFITNPANQLRFAQAARVLPSSEP
FT                   ALKQLEQELAGAQGRDGLVGAARLMSAETLARARVLVPADPGIKRLQAIIYGQLQRAML
FT                   GRMSSDAAIAEAERQWNAYAAARWP"
FT   CDS_pept        109897..110670
FT                   /transl_table=11
FT                   /gene="SynRCC307_0113"
FT                   /locus_tag="SynRCC307_0113"
FT                   /product="Two-component system response regulator"
FT                   /note="Signal transduction mechanisms / Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27016"
FT                   /db_xref="GOA:A5GQ57"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ57"
FT                   /protein_id="CAK27016.1"
FT                   /translation="MQSGESTPNQPTATLLVVDDEPAVRRVLSMRLQLSGYRVVCAEDG
FT                   EQALELFASEQPDLVVLDVMMPKLDGFAVCRRLRAESAVPIVFLSSLDAIAEKVAGLDL
FT                   GADDYLSKPFSPKELEARISRILGRVVGRGTASQDPREPVAGLGVLRLGDLVVDTNRRQ
FT                   VSRGGERISLTYTEFSLLELLFREPGRVVPRAEILEQLWGYPPRRTADLRVVDVYVARL
FT                   RGKLEPDPRNPELILTVRGTGYASQRLGELSAAGA"
FT   CDS_pept        110673..112181
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SynRCC307_0114"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27017"
FT                   /db_xref="GOA:A5GQ58"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ58"
FT                   /protein_id="CAK27017.1"
FT                   /translation="MSELRDTRLEKAQALIECGQVPYALRFEPSHRTAELQQAHADLPN
FT                   GEERDVSVAIAGRVMTRRVMGKLAFFTLADETGPIQLFLEKAALGDAFKQITSLVDAGD
FT                   WIGVKGTLRRTDRGELSVKAAQWQMLSKSLQPLPDKWHGLADVEKRYRQRYLDLIVSPD
FT                   TRDTFRRRAQLVSGIRRWLDERDFLEIETPVLQSEPGGADARPFETHHNALDLPLTLRI
FT                   ATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAFADYNDMMDLTEEL
FT                   ISSVTQQVCGSTLINYQGTEINLAPGWRRATMHELVKEATGLDFAGFSSREDAAAAMEA
FT                   KGLQTPALADSVGRLLNEAFEQAVEETLIQPTFVTDYPVEISPLARSHRSKPGLVERFE
FT                   LFIVGREHGNAFSELTDPVDQRQRLEAQQERRAAGDLEAQRVDEDFLNALEVGMPPTGG
FT                   LGIGIDRLVMLLTDSPSIRDVIAFPLLKPESRDGSAAVDNGSTE"
FT   CDS_pept        112194..112457
FT                   /transl_table=11
FT                   /gene="SynRCC307_0115"
FT                   /locus_tag="SynRCC307_0115"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27018"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ59"
FT                   /protein_id="CAK27018.1"
FT                   /translation="MSGERVGFRFTHADAVVKRNPQGRSRRGWVMEAVEQTTSRGTKMP
FT                   AYRIRWRDSERPEIVLQHMLIADPDPTPPPEGVNLVPPAPKA"
FT   CDS_pept        complement(112454..113251)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0116"
FT                   /locus_tag="SynRCC307_0116"
FT                   /product="Uncharacterised conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27019"
FT                   /db_xref="GOA:A5GQ60"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ60"
FT                   /protein_id="CAK27019.1"
FT                   /translation="MGFFLSKLLPQLIYPLGLGLLLQLIAIGGRKQRWALPLSITGWLV
FT                   IAVPAMPVVSDALLRQLEDQAASLTPKSLPEADAVLVLGGGIRPAPAKGQGVEVNEAGD
FT                   RLLCGVRLWRQGKAPVLITSGARVSFTLNDPIAPEAVLSQQLAQELGVPASALLLNEKA
FT                   RTTAEEAQRINQLAAEQGWKQLILVTSAFHMPRALASFKRQSELQIIPVACDYQLDPQH
FT                   QNQAFSWGELLIDLIPSSDALDQTTQVLKEHLGLLVYQLRGQA"
FT   CDS_pept        complement(113251..113733)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0117"
FT                   /locus_tag="SynRCC307_0117"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27020"
FT                   /db_xref="InterPro:IPR030812"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ61"
FT                   /protein_id="CAK27020.1"
FT                   /translation="MESSWWQRLEQELEQQFDRFLSDHPNQKELLDQEHFNEQQRRKHH
FT                   RLLTIDQEAQDLRQRLLKLSKEISAWSERVGRARTAGAHDLAGRAESHLSHLMGQGRAQ
FT                   WQALAALGEEAKQLKQELAAAKQPPKTTTGKAADLEDAWQRFEAEQELDELRRRKS"
FT   CDS_pept        complement(113737..113973)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0118"
FT                   /locus_tag="SynRCC307_0118"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27021"
FT                   /db_xref="InterPro:IPR030810"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ62"
FT                   /protein_id="CAK27021.1"
FT                   /translation="MGREEQRAAVRRMRESLIEELEGVYRRAFDAIGSDDMGEGAVARL
FT                   TQLLLRSREGAIAPLQEEIEAPLITKAPEPPQS"
FT   CDS_pept        complement(113977..114975)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0119"
FT                   /locus_tag="SynRCC307_0119"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27022"
FT                   /db_xref="GOA:A5GQ63"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ63"
FT                   /protein_id="CAK27022.1"
FT                   /translation="MSPHATAQHFELIDLHPAPTDVSKAVIDGLNRSPKQLPAWLLYDR
FT                   QGSALFDAICEQPEYTLTRLEKDLLGTQAQAIAEALPTGCLVVEFGAGSAEKVSPLLDA
FT                   MHEPSYLAIDISAEHLQEAGTRLQERHPSIPMLGICADYSQPLDLPLPKAWQSKPMVGF
FT                   FPGSSLGNFEPDAAINFLQRIRQLLGEKAQLLIGIDQPREPSLLEAAYDDNAGVSAAFA
FT                   KNLLRRLQRDLAIELDPEPFTYQAAWQPEHQRIAMALVANTPQTWTIGASRIPFAAGEA
FT                   LMTEYSYKYAPIDFLDLAAQAGWQGSQRWCDADDHFSLHLLTQGDDARMNA"
FT   CDS_pept        complement(114975..116258)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0120"
FT                   /locus_tag="SynRCC307_0120"
FT                   /product="Uncharacterised conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27023"
FT                   /db_xref="GOA:A5GQ64"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ64"
FT                   /protein_id="CAK27023.1"
FT                   /translation="MLPTAPTNPRVIPILLSTAFAQARVPPPGALRMIRHSPAPVLERL
FT                   SAIRDRSVDLVAPLEPEDLMLQGMADASPPKWHLAHTTWFFDTFLLQPNRPNWQPLPEG
FT                   WGVLFNSYYEAAGPRHPRPQRGLLSRPTIAEVLHWRERVDQELQSWLLEGMNHEQAQLL
FT                   ELGLQHEQQHQELLLMDLLDGFSRNPLAHGYNPDTPAPPAQGRSGHWLELRSGVISIGV
FT                   EPGNPEFHFDNETPRQRVWLDACALADRLVTNAEFEAFIAAGGYQKPHLWMSEGWSLVQ
FT                   ENGWAAPRYWRADGMEFSLRGLQPREAQAPVRHLSWFEADAYARWAGARLPTEAEWEQA
FT                   ARQYSAAAADWFGSLWQWTASPYTPYRGFNPAAGAVGEYNGKFMSSQMVLRGSCFLTPA
FT                   GHGRLSYRNFFGPQCRWQAAGIRLAVDR"
FT   CDS_pept        116218..117219
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="SynRCC307_0121"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27024"
FT                   /db_xref="GOA:A5GQ65"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ65"
FT                   /protein_id="CAK27024.1"
FT                   /translation="MGITRGFVGAVGNTPLIRLEHLSECTGCEILGKAEFMNPGGSVKD
FT                   RAALGILLAAEASGDLKAGGTVVEGTAGNTGIGLAHLCNARGYRCVIVIPETQSAEKID
FT                   LLRSLGAEVRTVPAVPYRDPNNYVKLSGRIAEEIPGAVWANQFDNRANRQAHADTTGPE
FT                   IWQQCEGRLDGWVAATGTGGTYAGVALYLKQQSDAVRCVLADPHGSALYSWASNGELAS
FT                   EGSSVTEGIGNSRITANLEGAPVDEAIRIDDQTAIDVLYDLLWHEGLFLGGSVGINVAA
FT                   AVELARRLGPGHRIVTVLCDGGDRYRSRIWNQEWLQSRGLRQPERQQLGSVA"
FT   CDS_pept        117231..119204
FT                   /transl_table=11
FT                   /gene="SynRCC307_0122"
FT                   /locus_tag="SynRCC307_0122"
FT                   /product="Possible serine/threonine protein kinase"
FT                   /note="General function prediction only / Signal
FT                   transduction mechanisms / Transcription / DNA replication,
FT                   recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27025"
FT                   /db_xref="GOA:A5GQ66"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ66"
FT                   /protein_id="CAK27025.1"
FT                   /translation="MAVPTPAEAASGALLERRYRLDEVLSEAEGTRLWRGADTLVGELP
FT                   VAIRAWWGLTDEELAALQQRLERLKAVLHPQIPRLGEQLPAEGGCWQVREWISGRTYQD
FT                   LLQARQERQLVFGSGEVLLLLRQLLPALAALHGQNLVHGDLTPANLVRRDSDGLPVLID
FT                   FGLQAAVVGQPLTAATAGYAPPQARHEPYGLWMDLYSLGVVALVLLSGEEPAALMDPVS
FT                   LAWRWPEGIDLDAAFRQVLERLLATSPEQRFNSAAEVAEALTALPVPESTGPVSRSDRT
FT                   AVLLPQLKPEQQAEASPAPAPTRPTRDERRRAKEQAAEGRFWPVVIALLLAALVGSALG
FT                   WLLLGRNRQSNRPASALAPELSLPPAELDQRQQLLNRLRALQVDQAWFLKLVDSSLAAQ
FT                   FPERGGRAPTDSLEDAPLRKIWNDLAQEWLVRVEQLPVPLRQRLGSYTDADWKQREKSL
FT                   TKEGLSPLVLRQLVSSSAQNLLPGRNPETIPAEPVRQIWYAAALRSLEGLKVEQLKPVL
FT                   NVPSSLSTSVDGQGAKLIAINVPKNHRLVLGVNGTPLMQMSLFAANGKVLEPRGPLRVL
FT                   SVARVENSPVQLLIRNDGLAPGLISLSVRVDPPLPKPARETQRPRQQQPSAQPPNQPQP
FT                   QTPKQDSVLDEIKQPTVDPFGN"
FT   CDS_pept        complement(119201..119701)
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="SynRCC307_0123"
FT                   /product="SsrA-binding protein"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27026"
FT                   /db_xref="GOA:A5GQ67"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ67"
FT                   /protein_id="CAK27026.1"
FT                   /translation="MAGKGKGAKAAAKKRLEAQKLLADNRQARHQYEILDTLETGIELL
FT                   GTEVKAIRAGKANLRDGFCLIRQGQLQLHNVHIAGHEQASRYFNHEPLRVRRLLAHRRE
FT                   IDKLRGQLDTKGLTLIPLNIHLKGSWIKLTIGLGKGRKLHDKRQEERRKQDQKDLRSAL
FT                   KRL"
FT   CDS_pept        119756..120790
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SynRCC307_0124"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27027"
FT                   /db_xref="GOA:A5GQ68"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ68"
FT                   /protein_id="CAK27027.1"
FT                   /translation="MAIQSSSSGSKPPAPKRLVAPEATAAEGDGGRDEGLRPRRLADYI
FT                   GQSELKQVLGIAVEATRLRNDALDHVLLYGPPGLGKTTMALVLAEELGVSCRIASAPAL
FT                   ERPRDIVGLLMNLQPRELLFIDEIHRLNRVAEELLYPAMEDFRLDLTVGAGPAARTRSL
FT                   ELPPFTLVGATTKAGSLSSPLRDRFGLIQRLEFYSCSDLEAIVSRSAQLLQLELAAEAA
FT                   AEIARRCRGTPRIANRLLRRVRDFASVRGIAAVGAPVVVEALAMHRVDGRGLDPSDRRL
FT                   LSLLETSYGGGPAGLDTLAAALGEDPDTLEAVVEPFLLQLGFLQRTPRGRVLTDAGRAH
FT                   LEAA"
FT   CDS_pept        120790..121548
FT                   /transl_table=11
FT                   /gene="SynRCC307_0125"
FT                   /locus_tag="SynRCC307_0125"
FT                   /product="Secreted tetratricopeptide repeat domains
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27028"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ69"
FT                   /protein_id="CAK27028.1"
FT                   /translation="MAWLMPTLLALLLGTTGLADQFHQALEASQQGRFAEALGLWDGVI
FT                   ELAPADSAAWSNRGNVRLALGDPEGAIADQTEAIRLEPEAIDPHLNRGTAEEALAQWDQ
FT                   AAADYNWILERQPDEAAALYNLGNVAGSLGDWPAARERFEAASLAQPGMAMARSSAALA
FT                   AFQIDELETSEKELRRLIRRYPLFADARAALTALLWQQGNAGEAESHWAAASGLDERYS
FT                   DPQWLLQVRRWPPEPVSALQRFLALDGGQP"
FT   CDS_pept        121545..122711
FT                   /transl_table=11
FT                   /gene="SynRCC307_0126"
FT                   /locus_tag="SynRCC307_0126"
FT                   /product="Zinc metallopeptidase M20/M25/M40 family"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27029"
FT                   /db_xref="GOA:A5GQ70"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ70"
FT                   /protein_id="CAK27029.1"
FT                   /translation="MNDQAALLEIRRYLHAHPELSGHEQRTAALVAGELRQLGWQVREG
FT                   VGRTGVVAELGPENGPVIGLRVDLDALPIEERTGLPFASKELGLMHACGHDLHTCVGLG
FT                   VAMALARDPRPLPGRVRLLFQPAEETAEGARWLVEAGAVEGLSGLYGVHVFPSIPVGSI
FT                   GVRHGSLTAAAAELEVEVLGESGHGARPHQSVDAIWIAARLISGLQEAISRRLDALQPV
FT                   VLSFGRIEGGRAFNVIADRVKLLGTLRCLDTALYKELPAWVESTAQQICRAYGGEATVR
FT                   FRGIAPPVQNDLELTRLLEQVALEQLGRERVLELEQPSLGAEDFAHYLGHVPGCMFRLG
FT                   VAGPEGCAPLHNGAFNPEEACLPLAVELLSATLRRWLEQHGQQSGAAL"
FT   CDS_pept        122708..122926
FT                   /transl_table=11
FT                   /gene="SynRCC307_0127"
FT                   /locus_tag="SynRCC307_0127"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27030"
FT                   /db_xref="GOA:A5GQ71"
FT                   /db_xref="InterPro:IPR021524"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ71"
FT                   /protein_id="CAK27030.1"
FT                   /translation="MNSRLLLALATPLLVLLALLGLFGVGQRQGAERLQALPAVLIGSG
FT                   LLVAGSAGYGRRRRQLLRALREREPTP"
FT   CDS_pept        122923..123456
FT                   /transl_table=11
FT                   /gene="nblB"
FT                   /locus_tag="SynRCC307_0128"
FT                   /product="Putative NblB protein (PBS lyase with HEAT-like
FT                   repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27031"
FT                   /db_xref="GOA:A5GQ72"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ72"
FT                   /protein_id="CAK27031.1"
FT                   /translation="MSTEAQQPSGMDLPAIEAAITSGDTTLRMRAITAMQPFEPQECVP
FT                   LLLQCLDDDAFVVRSLACMGLGYKRNPQGLQALLKVMQAESDHNVRAEAANAVARHGGE
FT                   QALQALLDLYARDEHWLVRTSILAAMAAEDDMPMEPLQQLAEQGCADDNETVREAGQGL
FT                   KLRLQQRRLEKLLP"
FT   CDS_pept        123610..125010
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="SynRCC307_0129"
FT                   /product="Thiamine biosynthesis protein ThiC"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27032"
FT                   /db_xref="GOA:A5GQ73"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ73"
FT                   /protein_id="CAK27032.1"
FT                   /translation="MRSAWIEKRRGSANVSQLHYARQGVVTEEMAYVAKRENLPESLVM
FT                   EEVARGRMIIPANINHANLEPMAIGIASKCKVNANIGASPNASDASEEVKKLELAVKYG
FT                   ADTVMDLSTGGVNLDEVRTAIINASPVPIGTVPVYQALESVHGSIERLSEDDFLHIIEK
FT                   HCQQGVDYQTIHAGLLIEHLPKVKGRLTGIVSRGGGILAQWMLYHHKQNPLYTRFEDIC
FT                   EIFKRYDCTFSLGDSLRPGCQHDASDDAQLAELKTLGELTRRAWKHDVQVMVEGPGHVP
FT                   MDQIEFNVKKQMEECSEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTP
FT                   KEHLGLPNADDVREGLIAYKIAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSL
FT                   DPERAKEYHDETLPADIYKQAEFCSMCGPKHCPMQTKITDKDLESLEEVLKAKGGAELS
FT                   TAKLDRAD"
FT   CDS_pept        complement(125083..127092)
FT                   /transl_table=11
FT                   /gene="tktA, cbbT"
FT                   /locus_tag="SynRCC307_0130"
FT                   /product="Transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27033"
FT                   /db_xref="GOA:A5GQ74"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ74"
FT                   /protein_id="CAK27033.1"
FT                   /translation="MVAAPVSLDTLCINSIRMLAVDAVNKSNSGHPGLPMGCAPMGYTL
FT                   WDKFLKHNPKNPKWFNRDRFVLSAGHGCMLLYALLHLTGYDSVTIEDIKQFRQWGSKTP
FT                   GHPETFETPGIEVTTGPLGAGISNAVGLAIAEAHLAAKFNKPDAKVVDHYTYVIMGDGC
FT                   NQEGVASEACSLAGHLKLGKLIALYDDNHITIDGRTNVSFTEDVLKRYEAYGWHVQHVA
FT                   DGNTDVNAIAKAIESAKAVTDKPSIIKVTTTIGYGSPNKSDTAGVHGAPLGEEEAALTR
FT                   QQLGWDYGPFEVPQEAYDQYRQAIERGSSLEAEWNQALAGYRSKYPSEAAEFERMLRNE
FT                   LPQGWDKDLPTYTADDKGLATRKHSQICLGALGPNLPELIGGSADLTHSNYTDIKGETG
FT                   SFQPETPEKRYLHFGVREHAMAAVLNGIAYHNSGLIPYGGTFLVFADYMRGSMRLSALS
FT                   ELGVIYVLTHDSIGVGEDGPTHQPIETIPSLRAIPNMLVFRPGDGNETSGAYKLAIENR
FT                   HRPSALCLSRQGMANQANSSIEKVAHGGYILEDCDGTPELILIGTGTELDLCVQAAKQL
FT                   TAEGKKVRVVSMPCVELFDEQSDAYKEQVLPSAIRKRIVVEAAEAFGWHRFIGLDGDSV
FT                   TMNRFGASAPGGTCMKEFGFTVENVVAKSKALLG"
FT   CDS_pept        complement(127126..128373)
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SynRCC307_0131"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27034"
FT                   /db_xref="GOA:A5GQ75"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ75"
FT                   /protein_id="CAK27034.1"
FT                   /translation="MAESSRRVVITGLGAVTPIGNTVATYWAGLQSGANGVAPITLFDA
FT                   SKHACRFAAEVKDFDPTGVLDPKETKRWDRFCQFGVVAAKEALAHSGLEITDANRQRIG
FT                   VIIGSGVGGLLTMETQAHVLEGKGPGRVSPFTVPMMIPNMATGLAAIALGAQGPSSAVA
FT                   TACAAGSNAIGDAFRLLQQGHADAMICGGAESAITPLGVAGFASAKALSFRNDDPATAS
FT                   RPFDAERDGFVIGEGAGILVLETLDHAQARGAEILGEVVGYGMTCDAHHITSPIPGGLG
FT                   GARAMSLALSDAGLKADDIDYVNAHGTSTPANDSNETAAIKTALGERAKAIPVSSTKSM
FT                   TGHLLGGSGGIEAVAAVLALQNGVVPPTINHQNPDPACDLDVVPNQAREQIISTALSNS
FT                   FGFGGHNVCLAFRRYA"
FT   CDS_pept        complement(128401..128640)
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SynRCC307_0132"
FT                   /product="Acyl carrier protein"
FT                   /note="Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27035"
FT                   /db_xref="GOA:A5GQ76"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ76"
FT                   /protein_id="CAK27035.1"
FT                   /translation="MSQEILEKVRSIVAEQLSVDAAEVKPESNFQNDLGADSLDTVELV
FT                   MALEEAFDIEIPDEAAEGIATVGDAVSYIQEKKG"
FT   CDS_pept        128777..129022
FT                   /transl_table=11
FT                   /gene="psaC"
FT                   /locus_tag="SynRCC307_0133"
FT                   /product="Photosystem I iron-sulfur center subunit VII
FT                   PsaC"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27036"
FT                   /db_xref="GOA:A5GQ77"
FT                   /db_xref="InterPro:IPR017491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ77"
FT                   /protein_id="CAK27036.1"
FT                   /translation="MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRT
FT                   EDCVGCKRCETACPTDFLSIRVYLGDETTRSMGLAY"
FT   CDS_pept        129094..130980
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SynRCC307_0134"
FT                   /product="Glucosamine-6-phosphate synthetase"
FT                   /EC_number="2.6.1.16"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27037"
FT                   /db_xref="GOA:A5GQ78"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ78"
FT                   /protein_id="CAK27037.1"
FT                   /translation="MCGIVAVIGTRDAAPLLLDGLRQLEYRGYDSAGIATVHGGHLSHL
FT                   RAEGKLINLTQRFEASGAAGSCGIGHTRWATHGKPEERNAHPHLDGSGELAVVQNGIIE
FT                   NHRSLRERLAAGGAAFQSDTDTEVIPHLVSQELKGLLAAGSPADGATLLKAVQQALPQL
FT                   DGAYALAVVWAQCPDALVVARRQAPLLIGFGEGEFLCASDTPALAGVTRTILPLEDGEV
FT                   ALLGPLGIELYNEAGERQQRPPTQLQGTDHVADKRSFRHFMLKEIHEQPETAARWLLRH
FT                   LPEGGPNDPLVALPLERSLLEGVQRIQILACGTSRHAALVGAHLLEQLAGIPTSVHYAS
FT                   EFRYSPPPLAPHTLTIGVTQSGETADTLAALAMEQQRCADHGDPAYAARLLGITNRTES
FT                   SLGRLVPQLIDIAAGVEVGVAATKTFLGQLLAFYGLAIQLTDLRGARSREQLHPLLAEL
FT                   RALPAQLQTLIDRLDLRCAELAHAFADTRTVIYLGRGINYPIALEGALKLKEISYIHAE
FT                   GYPAGEMKHGPIALLDADVPVVSVAMPGPVFDKVLSNAQEAKARDARLIGVAPECPDTE
FT                   IFDELLPVPAVDELLSPLLTLIPMQLLSYHIAARRGLDVDQPRNLAKSVTVE"
FT   CDS_pept        complement(130990..131517)
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="SynRCC307_0135"
FT                   /product="RimM protein, required for 16S rRNA processing"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27038"
FT                   /db_xref="GOA:A5GQ79"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ79"
FT                   /protein_id="CAK27038.1"
FT                   /translation="MADEFLVVGQVVAAQGLKGEVRILPASDFPQRFTEPGSRWLRRRG
FT                   HNEQQVQLLSGRQLPGKELFVVRFEGINDRTAAESLVHQEFLVAADDIPELEDGEFHVR
FT                   DLQGLSVRLDTESDPIGVVVDLHHGGNDLLEIELKADGRRCLVPFVDAIVPQVELEEGW
FT                   LLITPPKGLLDG"
FT   CDS_pept        131547..131720
FT                   /transl_table=11
FT                   /gene="SynRCC307_0136"
FT                   /locus_tag="SynRCC307_0136"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27039"
FT                   /db_xref="GOA:A5GQ80"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ80"
FT                   /protein_id="CAK27039.1"
FT                   /translation="MVMILPGSTVRVSDGRSIYNGYQGFVQRISGDRAAVLFEGGNWDK
FT                   LVTLPLKTLTEV"
FT   CDS_pept        complement(131698..132408)
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="SynRCC307_0137"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27040"
FT                   /db_xref="GOA:A5GQ81"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ81"
FT                   /protein_id="CAK27040.1"
FT                   /translation="MTTLQELLIRLGLQQPADEAALKPLHTALTHTSAGLEVNHEELEF
FT                   LGDAVLRLACAEFLEENNSKLSVGERSAFRAQLVSDRWLAELAAELQLDGLIKQGSATA
FT                   ADTTARATVRAECCEALVGAVYLAWGGADGGLHAVRQWLDPQWQRSCLELAEDPHRHNW
FT                   KSALQELTQAQQAGLPSYSTTEENSNHGDQRRFRSVVSVNAKEKGCGWGPSRRLAEQEA
FT                   ARAALEQLKPRSGS"
FT   misc_RNA        complement(132414..132775)
FT                   /gene="rnpB"
FT                   /locus_tag="RNA_3"
FT                   /product="Bacterial ribonuclease P RNA component of
FT                   ribozyme"
FT   tRNA            complement(132816..132889)
FT                   /locus_tag="RNA_4"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   CDS_pept        132974..133291
FT                   /transl_table=11
FT                   /gene="SynRCC307_0138"
FT                   /locus_tag="SynRCC307_0138"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27041"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ82"
FT                   /protein_id="CAK27041.1"
FT                   /translation="MTQLHDLRLRLLVQQESERIASTQPSELDLSVVQARSLCWLALLA
FT                   EAHEDQASDAERRGDTEQAMGWFADAMRLRDAIQVVTTIEIPLPATIDEAEEDDDQSMA
FT                   A"
FT   CDS_pept        133327..133764
FT                   /transl_table=11
FT                   /gene="SynRCC307_0139"
FT                   /locus_tag="SynRCC307_0139"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27042"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ83"
FT                   /protein_id="CAK27042.1"
FT                   /translation="MPEEPCQCPDCRRFYREHDRLIRENPSLRQQQELNWAALQAFRTL
FT                   AGRVLEDLQKNQPHPGEASPAAAGGAATEDNSLQQALGDLETINAHLFSIEVLMERIFD
FT                   VRVPEAVEQKFQELAGELAPDPLNVDRLRLNRLLHQTPDLP"
FT   CDS_pept        complement(133761..136328)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0140"
FT                   /locus_tag="SynRCC307_0140"
FT                   /product="Glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27043"
FT                   /db_xref="GOA:A5GQ84"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ84"
FT                   /protein_id="CAK27043.1"
FT                   /translation="MPSLRSVVTVVPPNPMSEQPAEFSMPTPGGFQDPERSGLSADDLF
FT                   AGITEHLFFTLGKLAPSATRHDLYMALSYAVRDRLMTRYLAGKEALNEHPAKSVAYLSA
FT                   EFLIGPQLGNNLLMLGIEKEAAEALHRFNGITLDDVREVEEEPGLGNGGLGRLAACYME
FT                   SLASLEVPAVGYGIRYEFGIFDQLIRDGWQVEITDKWLKGGWPWELTHPDQAVFVGFGG
FT                   RTEGYTDEHGRYRSRWIPGEHAIGIPHDIPVLGYKVNTCDRLRLWRATATESFDFYAFN
FT                   IGDYYGAVEEKVGSETLSKVLYPNDGTDEGRRLRLKQQHFFVSCSLQDMLRNLEQRKIP
FT                   VTEFPQHWAVQLNDTHPAIAVAELMRLLIDDKNLDWDLAWDITSRSLAYTNHTLLPEAL
FT                   EKWGLPLFASLLPRHLELIFEINRRFLQQVRLKHPGDDAILRKLSIIDEEGQKAVRMAH
FT                   LATVGSHHVNGVAKLHSDLVKSSLMPEFAQLWPEKFTNVTNGVTPRRWIGLCNPQLRGL
FT                   LDEVIGQNWLHNLDELKQLERFQNDSSFLERWDHTKLESKRQLASYIHRHTSVLVDPAS
FT                   LFDVQVKRIHEYKRQHLNALQVIAQYLRIKNGQGDGLAPRTVIFGGKAAPGYYMAKLII
FT                   RFINGIAETVNSDPDMDGRLRVVFLPDYNVKLGERVYPASDLSEQISTAGKEASGTGNM
FT                   KFAMNGALTIGTLDGANVEIREQVGVDNFFLFGKTTPEIEALRKSGYRPWELLEALPEL
FT                   QEVLHLVEQGHFSNGDTELFRPLVDNLRGQDPFFVFADFAAYLDAQDSVSEAWGNRQHW
FT                   NRMSLLNSARTGYFSSDRSVREYCDGIWKAAAVPVKVTCQSNP"
FT   CDS_pept        136355..136843
FT                   /transl_table=11
FT                   /gene="SynRCC307_0141"
FT                   /locus_tag="SynRCC307_0141"
FT                   /product="S-isoprenylcysteine O-methyltransferase related
FT                   enzyme"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27044"
FT                   /db_xref="GOA:A5GQ85"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ85"
FT                   /protein_id="CAK27044.1"
FT                   /translation="MMRDWGLSWGGWLDNRRGEWWLLGQLVLIALDIAMPAWPSLWRSP
FT                   PGVMVVGVVVLIGGLVLAAVAFVQLGSSLTPLPEPMPNAELKAQGLYGFCRHPLYLAVL
FT                   VCALGMALIKGGVLHPLLLLGLVVLLRVKAKREEQALLRHYPDYGAYQQRVPAFFPGL"
FT   CDS_pept        complement(136845..137189)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0142"
FT                   /locus_tag="SynRCC307_0142"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27045"
FT                   /db_xref="GOA:A5GQ86"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ86"
FT                   /protein_id="CAK27045.1"
FT                   /translation="MLGIRGVCRRALPLSSSDWITLASGSALWALALYIPLSGPLSRLE
FT                   AELSGTGLSESLQTTILVLSSLLLAAAIGLISQIAMSWALGPSWGASLGLMAVLSGAFW
FT                   SLASRREQDD"
FT   CDS_pept        137199..138074
FT                   /transl_table=11
FT                   /gene="SynRCC307_0143"
FT                   /locus_tag="SynRCC307_0143"
FT                   /product="Alpha/beta hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27046"
FT                   /db_xref="GOA:A5GQ87"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ87"
FT                   /protein_id="CAK27046.1"
FT                   /translation="MACAAVSASWTFRGSPIHCVAAGDDQQRPAVLLVHGFGASTDHWR
FT                   HNLPVLSESYEVHALDLLGFGRSAKPAGVAYGGALWRDLLCAYTRERIGRPTVLVGNSL
FT                   GGYSALAAGAALGDDCAGVVLLNAAGPFSEEKAPLKGWGAIARKSIGTAILKSPVVQRL
FT                   LFENLRRPATIRRTLRQVYIDQTNVDDELVEAIRQPSLDPGAFGVFRTVFDIPSGQPLD
FT                   ELFAQLKAPLLLLWGIRDPWINAAGRREAFQRYAPEATTEVVLEAGHCPHDEVPSIVNA
FT                   ELLQWLGTLP"
FT   CDS_pept        138078..138932
FT                   /transl_table=11
FT                   /gene="SynRCC307_0144"
FT                   /locus_tag="SynRCC307_0144"
FT                   /product="Galactose mutarotase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27047"
FT                   /db_xref="GOA:A5GQ88"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ88"
FT                   /protein_id="CAK27047.1"
FT                   /translation="MPLQELSAPYDHSVFTAENGDLIRVVPERGGLLTGWQVQGREIIY
FT                   LDLERFLTPGQSVRGGAPILFPICGNLPGDSLPLPDGRTATLKQHGFARNLPWSLSALS
FT                   DGRGVRLELSDSEQTRSEFPFEFLLQLDYRLAPGVLEVAMTLHNRSDQPLPFSFGLHPY
FT                   FSVSGLTSLSFEGMPEQGFDHKPMAAANTASVLTQLDQGIDLLVRPAGNVALVDAAAGQ
FT                   KLTMELSDPWNLAVFWTDPPRSMVCMEPWTGPRQSLISGDRKLELAPGEQRSLCTRYVV
FT                   STV"
FT   CDS_pept        138954..141038
FT                   /transl_table=11
FT                   /gene="SynRCC307_0145"
FT                   /locus_tag="SynRCC307_0145"
FT                   /product="Predicted membrane associated acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27048"
FT                   /db_xref="GOA:A5GQ89"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ89"
FT                   /protein_id="CAK27048.1"
FT                   /translation="MNGSGVQQLLQNPVSVASKQSSWTYRPDIDALRGIAVLAVILYHF
FT                   NEAWLPGGFTGVDVFFVISGYVVTGSLIKHQGESLGSQLGGFYLRRLRRLMPNLLLMVG
FT                   LTSVSIALLVPPSETRRMFTAASKSLYGWSNNFFALNGTDYFAQDANLNPLSHTWSLGV
FT                   EEQFYLLFPLLILVLARWLRPARVVQVLLGLITASLVLSLVWTAQAPNLAFFLMPSRFW
FT                   ELSAGALLLLAQRQNWLSACQGPRALVGARLLGAGLLLVALLTTSSEQGFPAPGALPAV
FT                   VATLLLLHAGSDWSVLQRPLVQLGLLSYSLYLWHWPVLTLMRWTTGLDQPALMLLALGL
FT                   MVAMAWGAYRFVETPCRRWSLPGLWQAILAIAAVVLTWCGLDALGFTYRGAVFQGSRSA
FT                   FVPTSDRFSLGGCTVDPWVIYGPETQTDLVKCSQAGSNPAAGEIFLMGDSHALAMLPML
FT                   KTAAKSTGQKVTYSFKGSCLNSSRLVPTLRKKAYGPCVGYSRGEFERTLKRLNPGDSLM
FT                   VSNWFNVYLTDITVKGRANTYPYVVDGERLEDHAKVREIYIADMRALASQLQQKGINLI
FT                   LVVDPPVLRREPVACEAWAHLQGPENRSLLCSADPEIVAQMQQTQRDVFDAVAKGHPNV
FT                   RVFDPTEEFLQNGRVTHLLPDGQLRYFDSNHMTISGSQSLAPRFLDFLRANGLDRSNAG
FT                   "
FT   CDS_pept        complement(141000..142151)
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="SynRCC307_0146"
FT                   /product="Glycolate oxidase subunit GlcE"
FT                   /EC_number="1.1.3.15"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27049"
FT                   /db_xref="GOA:A5GQ90"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ90"
FT                   /protein_id="CAK27049.1"
FT                   /translation="MPGMPDLAPLLTPDRHELVELVRALHSQASPWVPSGLGNHLHWGP
FT                   QPQIESSVLSLRRHNQVLEHATGDFTVTVEAGMALSELQAVLAERGQWLPIDPPLAGPS
FT                   SIGGVVARGVSGPLRHKAMGLKDQVIGISLLRSDGTTAHAGGQVVKNVAGYDLMRLLTG
FT                   SWGSLALITQLTLRTQPLPNHRLCFAVKGSLPSLQQLRQDLLLHSPLALERLEWKHQAG
FT                   EISLWLSLVSLNPEGLQQQQEQLKVSLAPELNLQPLDWEPSPTFVEQELWLLRIGVEPD
FT                   RADDLLGLAAIKPWTLQLGAASGLGLATGQAASHQVAELRQHCESLEGYLTVLQAPQGQ
FT                   DIQAWGNAPARPVIEAVKRQFDPLQQLSRGRLPGVAPVQAVRA"
FT   CDS_pept        141953..143395
FT                   /transl_table=11
FT                   /gene="SynRCC307_0147"
FT                   /locus_tag="SynRCC307_0147"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27050"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ91"
FT                   /protein_id="CAK27050.1"
FT                   /translation="MHAPAPGCGGAGSARSFRFGVAGPSADGSQGRWGPRGWLGCGERA
FT                   PTPPARAGRALGVEPDPACQAMASSPKIIVFDDDPTGSQTVRGCPLLLEFSTANLQAGL
FT                   ADPSPLLFLLTNSRALEPEQVRQELTALCRRLKPLLAQLTRPWLVVSRGDSTLRGHTPL
FT                   ELEVIRAELGPFAANVLVPAFPQGGRTTRDGVHLLHGEPLHHSAFARDQRFGYPSSDLP
FT                   QWLQHKTAGATPADCVARLKPADSFAELETGQWAVLDASTPNDLDVIGEQVLAELAKGR
FT                   KHLCQSAASLLNGLSEMPSVLLEPGEVPPIAAPGLVLVGSHVPLSDAQLSSLLQQPGCC
FT                   GVEFSLDGTPELGALTAQVQRLLSAGLTPVLFSSRGERTGYSPARQRELALQMAQVVMD
FT                   LEPPLGYVIAKGGTTSLTFLQQGLQLQQVRLLGQLLPGLSMVQPPLPHPRFGRLPVVTF
FT                   PGNLGDQTTLSRCWQLLEAARR"
FT   CDS_pept        complement(143355..144719)
FT                   /transl_table=11
FT                   /gene="glcF"
FT                   /locus_tag="SynRCC307_0148"
FT                   /product="Glycolate oxidase iron-sulfur subunit"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27051"
FT                   /db_xref="GOA:A5GQ92"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ92"
FT                   /protein_id="CAK27051.1"
FT                   /translation="MVVGRKAEDAHQKPAGARSLPWGAIKSQTAAMTNPLPASDPCVHC
FT                   GFCLPTCASYRVLGTEMDSPRGRIHTLKAIAAGELELDAAVPPHFDSCLGCFACVSACP
FT                   AGVRYDQLIEQVRPQLNKAELRSPWQRQLRRLLLGVIPYPQRLRALLQPFRLYAGGPIQ
FT                   RFARMSGLVKLFGPEVAAMEQLLPALPEDAFGPDPQGVLPAQGKQRARVGLVLGCVQRV
FT                   FDPAVNQATIAVLRANGVEVVLPASQGCCGAASHHQGELEQTRDLARDLVKQFEGEPLD
FT                   AVLVAASGCGHTLKQYGELLPGEEGFSAPVLDVHEFLSQLGLSETFQAQLQPLPKAVAY
FT                   HDACHMIHGQGIAAQPRQLLRAIPELQLREATEAGVCCGSAGIYNLVQPEEAAALGQLK
FT                   AADLSGTGAELIASANIGCSLQIRQHVGPDGPPVLHPMQLLAISAGLLPATASNG"
FT   CDS_pept        144453..146531
FT                   /transl_table=11
FT                   /gene="SynRCC307_0149"
FT                   /locus_tag="SynRCC307_0149"
FT                   /product="Carbamoyltransferase"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27052"
FT                   /db_xref="GOA:A5GQ93"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ93"
FT                   /protein_id="CAK27052.1"
FT                   /translation="MGGHGGIEFQLPGGNGFEGVDAPSGRVHFCAEHPVAGTGGQAKTA
FT                   VHAGVASGQGVGHRCSLAFDGPPWETARPGWFLVRILGLSAYYHDSAAALVVDGVATAA
FT                   AQEERFSRKKHDSRFPQHAVRYCLESQGLTLADLDAVVYYEKPLLTFERLLETYLGAAP
FT                   RGGRSFVAAMQVWLKEKLFLKTELKKQLNAVAESMGAEVELPELLFSEHHLSHAGAAFY
FT                   PSPFDSAAVLCMDGVGEWATTSAWLGEGSSLKPLWEINFPHSLGLLYSAFTYYCGFKVN
FT                   SGEYKLMGLAPYGEPKYVDQIKDHLIDIKPDGTYRLDLSYFKFHRGFRMTGRKFHKLFG
FT                   RPPRKGETELTQFHMDLAASIQVVTEEIVIKLARSMQQETGACNLCLSGGVALNCVANG
FT                   KLLREGIFDQVWIQPASGDAGSALGAALVAWHQHLEKPRQVQSGDGMNGTYLGPRFENA
FT                   EIRSYLEQIKAPFHALDDPLLFERLAELLDQGKVIGWFNGAMEFGPRSLGARSIIGDPR
FT                   NQQMQSVMNLKIKYRESFRPFAPSVLEEEVSNQFELTSKSPYMLLVAPVKQSLCKPMTA
FT                   EQEKLFGIEKLNIARSELPAITHVDYSARVQTVSPSTNPRYYNLIKSFQRRTGCPTVVN
FT                   TSFNVRGEPIVCTPQDAYRCFMRTEMDVLVLENQLLLKEEQPAEERDERWMQEFELD"
FT   CDS_pept        146528..146929
FT                   /transl_table=11
FT                   /gene="SynRCC307_0150"
FT                   /locus_tag="SynRCC307_0150"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27053"
FT                   /db_xref="GOA:A5GQ94"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ94"
FT                   /protein_id="CAK27053.1"
FT                   /translation="MTPMATSPTTKQLREFGLLLAIAFPLLLGWLLPALRGHGFHSWTL
FT                   WIAIPALSLGLIAPRTLRQPYQWWMALGHALGWFNSHIILGAVFLLVLQPIALVMRLTG
FT                   YDPLRRRSQQLTTYREKRHTAGINLTRIF"
FT   CDS_pept        146944..147114
FT                   /transl_table=11
FT                   /gene="SynRCC307_0151"
FT                   /locus_tag="SynRCC307_0151"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27054"
FT                   /db_xref="GOA:A5GQ95"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ95"
FT                   /protein_id="CAK27054.1"
FT                   /translation="MSPMDAFLDLTKDIWDFLRVRKKYWLAPLIITIVLMGALIVFTQG
FT                   SVVAPFIYSIF"
FT   CDS_pept        complement(147099..148244)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0152"
FT                   /locus_tag="SynRCC307_0152"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27055"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ96"
FT                   /protein_id="CAK27055.1"
FT                   /translation="MSEQRRSWLVLLITTVVCLGAAEVFARLLPKNYYEWQHRYMFISE
FT                   GVNTNKTFADGTTAQWYKPDSAINWAVFYGYPWQKPKQEYSIWSTTNNLGLVQASDAQL
FT                   GKPSIAIFGDSFTEPQATTPWFYSLENHWKRLDPQGNSQLLNFGFQGTGIGRWDQVSRN
FT                   LSEPYNFQKVIYVAIGQDFARLGETGWNERDLQCLDNAEKCRKNHYYQAIAGDDQSEAK
FT                   LQERTQQLMAKRNNTLDKKLRYGLCGISELARQVASVIGSPCFDGSPPTDYQSNLKTAV
FT                   GHGLHLFRQQVARYGANNVFLVWIPERNEAATSRVSPISQQLLKVADHDLPKGHVIRCP
FT                   LTAADFYDKDGHQNEAGSRIIYNCVAQALTQASEGNDQKIE"
FT   CDS_pept        complement(148241..149668)
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="SynRCC307_0153"
FT                   /product="Isocitrate dehydrogenases"
FT                   /EC_number="1.1.1.42"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27056"
FT                   /db_xref="GOA:A5GQ97"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ97"
FT                   /protein_id="CAK27056.1"
FT                   /translation="MVSYEKLTPPSNGGVIRFDNGQPVVPDNPIVPFIRGDGTGVDIWP
FT                   ATQKVIDAAVAKAYGGSKAIEWFKVYAGDEACDLYGTYQYLPKDTLTAIEQYGVAIKGP
FT                   LTTPIGGGIRSLNVALRQIFDLYSCVRPCRYYSGTPSPHKRPQDLDVVVYRENTEDIYI
FT                   GIEWAADDPVGRELLRHLNETVIPASPKLGNKKIREGSGIGIKPVSKEGTQRHVRRAIQ
FT                   HALRLEGKQRHVTLVHKGNIMKFTEGAFRDWGYELATTEFRADCVTERESWILDNKDRN
FT                   PDLSTSDNSRLIEPGYDNLTPEKQAAIDAEVDGVLSSIGSSHGAGRWKEMVLVDDRIAD
FT                   SIFQQIQTRPQEYSVLATLNLNGDYISDAAAAVVGGLGMAPGANIGDKAAIFEATHGTA
FT                   PKHAGLDKINPGSVILSGVMMLEFMGWQEAADLITKGLSGAIEAQKVTYDLARLMEPPV
FT                   DPLSCSGFADAVIEHFA"
FT   CDS_pept        149727..150134
FT                   /transl_table=11
FT                   /gene="SynRCC307_0154"
FT                   /locus_tag="SynRCC307_0154"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27057"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ98"
FT                   /protein_id="CAK27057.1"
FT                   /translation="MNAAEQARSVELAQLIASALNQFRQRFPELKPNLRPWRDDPQTRA
FT                   FAEGSSLDLAFHLPGWSPRWQCRSLLVQLRLADAEQPRLMGMLISGMTFQGEQWRLATV
FT                   GPWSVSGERVPDEAICTQLQQVCRELVGPLP"
FT   CDS_pept        150209..150925
FT                   /transl_table=11
FT                   /gene="ho1"
FT                   /locus_tag="SynRCC307_0155"
FT                   /product="Heme oxygenase"
FT                   /EC_number="1.14.99.3"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27058"
FT                   /db_xref="GOA:A5GQ99"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ99"
FT                   /protein_id="CAK27058.1"
FT                   /translation="MAVALAAQLREGTKKSHTMAENTGFVSCFLKGVVDKLSYRKLVAD
FT                   LYFVYEAMEEEMHRLKDHPVLAPIAFEQLDRRQALEEDLTFYFGADWRNQVETSPAAKE
FT                   YVARIREIAQSSPELLVGHHYTRYLGDLSGGQILKTIAQKAMNNPTDDGLHFYVFPQIE
FT                   DEKAFKTTYRSAMDELPIDQPMADRIVEEANHAFHLNMKMFQELEGNLVAAIGKVLFGF
FT                   LTRRQRTGSTEEPVAA"
FT   CDS_pept        150943..151935
FT                   /transl_table=11
FT                   /gene="SynRCC307_0156"
FT                   /locus_tag="SynRCC307_0156"
FT                   /product="Glycosyltransferase of family GT4"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27059"
FT                   /db_xref="GOA:A5GQA0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA0"
FT                   /protein_id="CAK27059.1"
FT                   /translation="MRFLVPGTGDRFRCGGLSVELQSARLCEGLAPSVEVVTYRRREPG
FT                   RPFLSDLLKQERSPGEALWLVSWGFHVPELLRQLRGRPVAYHAHSSGYGFDLPAGVPVL
FT                   AVSRNTLGYWGDRAPRAPLQWVPNAIDSGFGGGTGERPIDVLVQVRKSSAYVREQLLPA
FT                   LRQRGLQVELQQGWVDDLGDLFRSAKVVLYDSADHWRRAGVSEGFGLPPIEALACGCVV
FT                   FSSFNHALADTLDPGHLAWQIGRGTLSADLDRITAAARATQQWLPEPALLQRLLASHSE
FT                   SAVRQRWREALEVVNDHWDRVVSGEQPLKALSPWRLRWGRRLSRLRRRS"
FT   CDS_pept        151958..153853
FT                   /transl_table=11
FT                   /gene="SynRCC307_0157"
FT                   /locus_tag="SynRCC307_0157"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27060"
FT                   /db_xref="GOA:A5GQA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA1"
FT                   /protein_id="CAK27060.1"
FT                   /translation="MAVKPHLNDMTGPLGWIRRRSQTLDLLVRLLSHLPAQRRRTLLRL
FT                   LPFSVLPGLTDLALVAVGARMVGSLVGTRLADNLPGVKVFGGNQIDQSLWLVCLFIGIA
FT                   WLASFSKIALQLAQERVTARIWRDLSNEIHARVLRQSYSYHLTRSTAELTTSILSNIRQ
FT                   AANGVISPCLRMVSATVSILLLSLGVLWIGRFPGFLLLVTVVISYLGLSMVVTPYLRHA
FT                   RQQNLRLEVRTTHLLLESLASVRDITLTGTEEHFQSSFSSAGERARRYALRSVLLPIIP
FT                   RQLIEPLGITLIFVIGAVPALVQQDPSKVLGILPFLSALAIAAQRLTPPLQQLFHSLTE
FT                   FRGGLPQVSNTVAMLELPIERFTLSSPGVPSPAGVFPQHTIRLRDAWFRYPKSEDWVLR
FT                   GVNLTIPVGSRIALVGQTGSGKSTIAHLLLGLLKAEMGELELDGNPLTPEELPAWQASC
FT                   AQVPQMIQLLDASVRANVAFGIDEQFIDDDKAWEALEAAQLAEYVADLPYGLLTPVGEN
FT                   GHQLSGGQRQRLALARAFYRNASVLVLDEATSALDNRTESEVINALEVVGRRCTMVVIA
FT                   HRLSTIARCDRIYEFDKGEVVASGTFAQLQERSASFRDLAQLEGLESTDSLLVSE"
FT   CDS_pept        complement(153870..155114)
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="SynRCC307_0158"
FT                   /product="Histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27061"
FT                   /db_xref="GOA:A5GQA2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQA2"
FT                   /protein_id="CAK27061.1"
FT                   /translation="MEQLQSLRGMVDLLPAATSRWQWLEQTAREHFRRSCIREIRTPLL
FT                   EATELFARGIGEATDVVGKEMYSFNDRGDRSCTLRPEGTASVVRAAIQHGLLSQGAQRL
FT                   WYGGPMFRYERPQGGRQRQFHQIGIEFLGFADPRSDVEAIAIAWDLLEALGITGLQLEL
FT                   NSLGSRVDRQTYRDALVGWLSERQNQLDADSQQRLATNPLRILDSKNPQTQQLLQDAPN
FT                   LEQSLSDPSRERYEQVKAGLSALKIPYLCNPRLVRGLDYYGHTAFEITSDALGAQATVC
FT                   GGGRYDGLVEQLGGPAAACVGWAMGLERLMLLLGDESQQSQPPDVVVISQGNAAEALAV
FT                   PVARQLRQIGQAVDVDLSGAGFGKQLKRAGKSGARWAVLIGDEEASSGQLQRKDLHSGD
FT                   SSTIALQSLAENWIS"
FT   CDS_pept        155191..156204
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="SynRCC307_0159"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27062"
FT                   /db_xref="GOA:A5GQA3"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA3"
FT                   /protein_id="CAK27062.1"
FT                   /translation="MARLLLTGGAGFIGSHTAVMLQQAGHQLVVLDSFSNSSPEALRRV
FT                   EAITGQSIDVVTGDLRDPKAVERALAHDVDAVVHFAGLKAVGESVEQPLLYWDVNLTGS
FT                   RVLLEAMTAAGCRTLVFSSSATVYGIPDHVPIPETAPVQPNNPYGRTKAAVEQMLADVA
FT                   ASEPGWRVASLRYFNPVGAHPSGQIGEDPLGIPNNLFPFVSQVAVGQRPQLKVFGSDWP
FT                   TPDGTGVRDYIHVMDLAEGHRAALEVLLDSADQQLTLNLGSGQGHSVLEVVQAFEQASG
FT                   RPVPYELVARRPGDAASTVADPGLAKELLGWSTKRGLEECCRDGWAWQQANPTGYR"
FT   CDS_pept        156171..158213
FT                   /transl_table=11
FT                   /gene="SynRCC307_0160"
FT                   /locus_tag="SynRCC307_0160"
FT                   /product="Selenophosphate synthase fused with a
FT                   FAD/NAD(P)-binding domain"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27063"
FT                   /db_xref="GOA:A5GQA4"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA4"
FT                   /protein_id="CAK27063.1"
FT                   /translation="MAAGQPHRLPVSHLLLAGGGHSHALLLRQWAMRPSTRPAVEAITL
FT                   VSAQPTSLYSGLIPACISGALAPKACVLDVWGLCRAAAVSFVQATVTGLDTANRQLSLK
FT                   GDRPPLAYDWLSLNLGAEVRAPKRLGCLPIKPLEPVLAALAALPLGAAVRVVGSGPAAV
FT                   EVSLALAARGFAVNLSGQPERAFWQGFRDSLNAAGVVLDPSLMRAHVELELHCTGSWGP
FT                   SWLAQSGLAVDGRGRVLTGADLRSVNDSSVFASGDCGVIDGRERPPSGVWAVRAAPVLA
FT                   ANLQRAVSRRRLRRWRPQPHALQLLGDGRGRAWALWAGRQLGPSRRIWRWKQHLDQRFM
FT                   AMLRPPQMASDQPMACSGCAAKLADAPLRGALQQLAGGQLPPAEDAAVAGDGWLQSVDG
FT                   FPALVADPYLNGRLTALHASSDLWACGASLRHGQALVTLPRCSELLQQELLVQSLAGVQ
FT                   SVMPLIGGHTLQALEASDPSKPLAKQLSLGLVVNGQLSPGQLSWGKGPLRPGHVLLLSR
FT                   PIGTGVLFAAAQAGSAEPQWLIAALEVMQQSQAPLVELLAAHGCSACTDVTGFGLLGHL
FT                   NEMLDASMGVDVQLQADQVPALAGSLELLEAGITSTLAPSNAVALARWPELLGTRARLL
FT                   IDPQTCGPLLAAVPEQQAGPCLAAMRLAGFSQAVRIGTVQSKGLL"
FT   CDS_pept        158210..160225
FT                   /transl_table=11
FT                   /gene="SynRCC307_0161"
FT                   /locus_tag="SynRCC307_0161"
FT                   /product="Uncharacterized conserved membrane protein,
FT                   specific for cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27064"
FT                   /db_xref="GOA:A5GQA5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA5"
FT                   /protein_id="CAK27064.1"
FT                   /translation="MKRLFWPLLALLWLLSTVLDRRWLALDQRLPSWDQADYLNSALDH
FT                   GRALGLLPGGSWQGWSALLDHSPKIPPLASLVNGTVMAVSGDSPDQAAWTLSLWFGLLL
FT                   VGVALWGRQWQGPGLGLLAALFCVVAPGLAEWRVDYVLEIPLCAGCIWAQWLLGRWLRP
FT                   NGATWIAALLAALAIASALLIKQSALLVLLGPALWAVVVGLQERKRRWQLLASFGFVLA
FT                   LVAPWLGHNLITAIGGTNRATLESAAREGDPNATSLAGWLWYPKRLSGLIGQIPLIGGL
FT                   AGAVVAARRPSWPRGDGAWLWFVVLSGWLLTTLSPNKDPRYLAPLLPLLALLLARTWLV
FT                   LLAVMPKSWGQPLLGVGLLVSAWGTVQTRFQGILWAPVFPQPIEQIVDAAQGADPSTAR
FT                   TLIVVPSRPQLNQHSISFLGRRGGGGLVGRQLGSSSADIQPALKQAKQVLLATGDQGSV
FT                   RRSAEQFSQAIRSSGSFALQQQWPRPEGGTYELWARRPEASQPVPFEQRFPQLAAGLAL
FT                   GPAGLDPVFAAVGVEHQLDGHRLYQQRVEQQATAALAADPNDRQALWSLALLKVLQNRP
FT                   LEADHWFERLQKLEPKSPWPAAYRAVVLTAAGRLWQARAVADQAQGLNPSPVLEGLGDL
FT                   SGVLGGQLWRLPAASRSLPAATQAVEQQLKTPESAR"
FT   CDS_pept        complement(160200..160508)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0162"
FT                   /locus_tag="SynRCC307_0162"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27065"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA6"
FT                   /protein_id="CAK27065.1"
FT                   /translation="MPTVLKFSSEDCGTCHRMSHYDGKVAEELGLGFVSVMLQDTETYR
FT                   KYRKVLMAQYPNKEGMGWPTYLIVTNPEGEFVIHGELKGGMPKGDFRDKLSALIPAS"
FT   CDS_pept        160468..161358
FT                   /transl_table=11
FT                   /gene="SynRCC307_0163"
FT                   /locus_tag="SynRCC307_0163"
FT                   /product="Glyscosytransferase"
FT                   /note="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27066"
FT                   /db_xref="GOA:A5GQA7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA7"
FT                   /protein_id="CAK27066.1"
FT                   /translation="MPQSSELNLRTVGTALPLVVVSVAYHSQSSLASLAADLGRHQGGL
FT                   TRWIVVDQAPKSAPLDPEPLRRHLGSVPLLVLQGEEGDGFGAGCNRGFDYLQKTGSSGW
FT                   VWLLNPDTSLPQGDEARRLLEAVADLPAQAVVGTAVQDATGTIEPSAGWIDQGLNFRRR
FT                   KVSTADALLHEPLRLDWLSGCSLLLRPMAHQPPARFDPCFPLYYEDMDLCLRLAQQEAP
FT                   VLWLPQVVVSHQKGEGSVTPSSRRIELSTISYLRFLRRHCPPWVRLLRQLRLLLSALLR
FT                   PRRAGAIWRGFKRSG"
FT   CDS_pept        complement(161342..162574)
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="SynRCC307_0164"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27067"
FT                   /db_xref="GOA:A5GQA8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA8"
FT                   /protein_id="CAK27067.1"
FT                   /translation="MDWLATVAMAHGLHLSVVGGAVRDRLLGKSTPDKDLDLVVEGVCS
FT                   WPAIQLLELINTQALPPGFQLKQSQSFEAFGTAQLHLQTPAGRLLCDLSSARSERYTFP
FT                   GAHPEVQPTDLVGDLRRRDFSINAIAERLPLGSSPLLDPFDGTGDLKAGQLKLLHPLSL
FT                   EDDPSRLLRGVRYGARLRLELAPETTAQMQSTLDDWPWPDDAPALASRSRMELELLFAE
FT                   SCWRSALQCLETWRGLELIQRGWKALPPRSPAWLQRLGQWGHAIDPNWSAEELKLVGLL
FT                   WLVPHQNNLLAIAKRLQLAHRQQQLLSRGLELQTWLQGLNPESTHAWKPSNWTNALEER
FT                   GAKTEPAMVLMLLGPNHQPYRRPLLRWLLRWRLIQSPLSAKELMNQGLSAGPELGSRLK
FT                   ELRVEAINQNA"
FT   CDS_pept        162533..164053
FT                   /transl_table=11
FT                   /gene="SynRCC307_0165"
FT                   /locus_tag="SynRCC307_0165"
FT                   /product="Glycosyltransferase of family GT2"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27068"
FT                   /db_xref="GOA:A5GQA9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA9"
FT                   /protein_id="CAK27068.1"
FT                   /translation="MQTMGHGNGCQPVHPLLGSAAGVHYGLPGFRTAVTSPAQGDDWFS
FT                   KFKRWRLAKAVRLIKELEIYRNFFPADLIRQWLIGIQPGIAPLRQRLSQQVEFVLWLPP
FT                   GWQLSVAQRKRLHRVLVRRQARTGAQVVSCDDWLLLPTGKRLWRQKGRLDPLLDRATGE
FT                   AEGPLWIQRNLLQQLGEPPEQVQARPAWRAHLFETVGAEAWAHVALPLAISPPVELPPA
FT                   QPAQPKGNPLVSVLIPSGGFHKPIGGRNTMLLRHCLTCLLQRSDYRELEIVLIDGGELS
FT                   AAELEEFENLIGYGLGPGRWRHGRSDLSYSYSQRINQAAAAARGEFLLQLNDDTELLEP
FT                   GAIGSMLAHAQEPQIGVVGALLLYPGGRVQHAGVAVDNLAPRHAWVGCWPNRLPPGLLA
FT                   AARQFQAVTAAVSLCSAELWQQLGGLRNDLPINYGDVDFCLRARQRGHAVVLDPASRWT
FT                   HFESASRSTAGIPPELPRFRELWSTELGGRWSIDPYVSRWRELMLQKG"
FT   CDS_pept        164053..165183
FT                   /transl_table=11
FT                   /gene="SynRCC307_0166"
FT                   /locus_tag="SynRCC307_0166"
FT                   /product="Possible glycosyltransferse"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27069"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB0"
FT                   /protein_id="CAK27069.1"
FT                   /translation="MAKHFWIYTHNFTHSGAPLVMASVARELAAAGWREQLRVVSWGGL
FT                   HDRRHSTLQHELTVEGIHCQVLDLHQRPPHIKRRDRLLLNSLALPEAVVCQALDWLWDG
FT                   KLSRLDWYCHEGNPEAFFSGQKWPENINQALNTGRFRMRVPSLKALQVYTNWLHYKGAG
FT                   LDVQAPQVLVPEHLIASACSDFSSLKIQLTGSVGFGQKGHLWILQLLEKVLSQYPQTTK
FT                   VLRPIRLEFIGIETGPYAALARKVCSYGVNLLGENFSWSPQDSHENTLRTMAKSNLSIS
FT                   CSQDETFSLVSAESMALGQPILRNETGGFDEQLNCGDCGFSLGPPSPYVSSLCVQLLGS
FT                   LRDPQTHSEQSFLDKRKQALNRYACFASSNIINWLI"
FT   CDS_pept        complement(165180..166400)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0167"
FT                   /locus_tag="SynRCC307_0167"
FT                   /product="Uncharacterized conserved secreted protei"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27070"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB1"
FT                   /protein_id="CAK27070.1"
FT                   /translation="MKTNFLFMIGLLMCSQHVHAQVQWIQDKSEAQSDNAQQETSIYWQ
FT                   SESKNAAEVSVVWEPMPETESWIDPTKQPTPTAIVWRQIKQEQGPLLEPKPEWVADNKE
FT                   PIPLEAITIESEQPTKRRGPLPTQPKLQALDRSIAFSNGFVGPDISTYIPNGLRWSQIY
FT                   SFNASLRGSSRQDNDKQKFLAWNNGDGTAIINANLFQIDDFSIGLNASFRSVYQGTSAA
FT                   GGGSAVGEGKSLGFRIASQLGNNAGIAFGGEQIIQLDDRTDTGRNFYLMATKAWPLGPE
FT                   GVYFPYFVINGGVGTGRFANQDIGSGFQNPLKFGCFRTEQKNTRTTSFGVDTELCWAPI
FT                   GSTALVINKWWSIFSEYRSGRAQAATSVSLGGTLPIRLTWGVNFAQQNELLESNRWIWT
FT                   FRTSLGF"
FT   CDS_pept        complement(166419..167366)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0168"
FT                   /locus_tag="SynRCC307_0168"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Possible frameshift with RCC0171"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27071"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB2"
FT                   /protein_id="CAK27071.1"
FT                   /translation="MMALKGQIQEAQRAGNVSIYFASQLANLTDKSSTFDQLTRIETEL
FT                   AEKRSRFKDNDPLITRLERMRLALVQYINQQTIALLNGELDLAKANLQSLNRPKEIVSR
FT                   HRELTQQALRDEATLVNLQNQYQQVQLEQAREGDPWELISTPRVLENPVSPNKKRSLAL
FT                   GLLGGFVLGAGGALVMDRRSGRVFSENELEASLPGQRLQTITSIERVQLMQSVELLANG
FT                   PLQQFSCIAIVPVGSIKQSLFNEFCSTLEQNLKSKHVVIDEDLSATRDCDTQVLVASPG
FT                   ASTREELTLLREQLSLQNAPVAGWILLNPKASAA"
FT   CDS_pept        complement(167397..168170)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0169"
FT                   /locus_tag="SynRCC307_0169"
FT                   /product="Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /note="Possible frameshift with RCC0170"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27072"
FT                   /db_xref="GOA:A5GQB3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB3"
FT                   /protein_id="CAK27072.1"
FT                   /translation="MTSSLPIQSQAPAAGSTTSPQDEIDLREVIAALRRQWRWIGAGAG
FT                   VGLGAAALSLLTTKPVYQGEFQILLDDKNSSSSMARVLANNPALALLGTSGVNSETQTE
FT                   IAILNSPSVLLPVFKAVQARKPKEVAEKMRFSDWRDSALSIENAKGTSVLNVEFRDTDK
FT                   TIIAPITQLLSNEYQKYSNRGRNRELSNMSTYLQQEINKIKPISLASNREALEFGFANG
FT                   LGRARRACPWPGSRGGEFRGNNSNFPGGRGRRGQR"
FT   CDS_pept        complement(168167..169348)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0170"
FT                   /locus_tag="SynRCC307_0170"
FT                   /product="Periplasmic protein involved in polysaccharide
FT                   export"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27073"
FT                   /db_xref="GOA:A5GQB4"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB4"
FT                   /protein_id="CAK27073.1"
FT                   /translation="MLSRAVAAAMLSLSAVQPVLSQEITPTSQVINLAPKAYTGDSYIL
FT                   GPGDAVVVELLDVPEYSGVFSIGPDGSLYLPRLRALQVEGLTVEELQAFLTQQFSMYVQ
FT                   EPQVYVSPAAFRPIRVYVGGEVRRPGYYYLTGLQAAVSTGSAPTTDVSTIAGMSSPGFQ
FT                   QGGGLSQLATNPNASIRGTELATGIVMPTVFDAMRNAGGVTPYSKLEDVVVVRRRPLGT
FT                   GGGKMRTSLNFLSVITEGNESQNIRLFDGDTVIVSRSEEELRDQIIKAGQTNLSPDFLE
FT                   VFVSGRVRQPGTKVLPQGATLEQALASAGGTKILRGTVEFVRFNRDGTTDKRQIFGVGS
FT                   QPGGSYENPVLMEGDLIRVNNSPLSATTEILGEITAPAVGVLAIYDLVDRYQK"
FT   CDS_pept        169358..170551
FT                   /transl_table=11
FT                   /gene="SynRCC307_0171"
FT                   /locus_tag="SynRCC307_0171"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27074"
FT                   /db_xref="GOA:A5GQB5"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB5"
FT                   /protein_id="CAK27074.1"
FT                   /translation="MKDPGKLRGMPLLSGSRWPVRHLPKWRAAVDALFLISIVLFLWPL
FT                   DPWISSIPAVLWVLLQLLVAPVQRRWAAWPMLFVLLLFSRSWWLNQMPHPVAAQDGVLV
FT                   AGALLAGACVAPQRWQLLLRLPLLVLPLLLFEMGAKPWTPNPLAGANQGGYLLGLIWLL
FT                   AIAWFRQGNQPHLQRVLAGVATALAAVMVWQTGSRAAFVAAVVSAALLWIQQGIGLGQV
FT                   CKRGFLLLGFGAAALAAKQLLRPSSTGIPGIDLSSDTGRLAIAQCYGAIPFSGNNRFLY
FT                   GVGFDRAGEFCSDPINGGVADHAHNIYLQLFASSGVLGVFGLFLLLALLVQAWRSAAPV
FT                   MDPFPLVAGQLALLYTLIQGFLDLSLLHWPVTLVLTGVLLGIPLSWHRASDNQFTQI"
FT   CDS_pept        170579..172513
FT                   /transl_table=11
FT                   /gene="SynRCC307_0172"
FT                   /locus_tag="SynRCC307_0172"
FT                   /product="Nucleotide-diphosphate-sugar epimerase, membrane
FT                   associated"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27075"
FT                   /db_xref="GOA:A5GQB6"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB6"
FT                   /protein_id="CAK27075.1"
FT                   /translation="MRPASRQQLSPVIRRLLLLAADAALLPLALWMSFWLRLGLDEPWS
FT                   EQWLQSGPWMVAALWVFGLPLLLFTGQYKGLTRYVGSRSLYQLAGRTAVLTLALLAVGE
FT                   LLRLPLPPRSCWILFWVLATAMAGALRFSLRDVFFKFSNRNTQASAQRVVIYGAGAAGV
FT                   QLAASLRHSGTHRLVAFVDDDPFLWGRSIGSIEIKSANQLPALSQRFDQVLLAIPSIQK
FT                   AERRRIVDSVQTLGCSILEVPSIDALTSGRASIDALHPIAIEDLLGRDQAAPDPQLLGR
FT                   AFAGKVVCVTGAGGSIGSELCRQIVQLQPAALLMLERSEPALYAIDQELSNRGLDAVKL
FT                   RPVLGSASDQALVRELFAREQVQVVVHAAAYKHVPLVEANPLAGIANNVFSTRVICQTA
FT                   AALGLERVLLISTDKAVRPTNVMGASKRLAELVVQGAAQTSETTSFSMVRFGNVLGSSG
FT                   SVVPLFTKQIGAGGPITLTHPEIVRYFMTIPEATQLVLQAAGMATGGEVFVLDMGEPVR
FT                   IHDLAQQMVKLSGLQLKDEANPDGDIEIKCTGLRPGEKLYEELLIDAHAQPTAHPLICC
FT                   AQENSWPAAQLELLLDQLQQIVQQQDLAAVLDLLKQLVPEWQQGAEVSTSAKLLPFPVV
FT                   PSRSTAQAG"
FT   CDS_pept        172510..173844
FT                   /transl_table=11
FT                   /gene="SynRCC307_0173"
FT                   /locus_tag="SynRCC307_0173"
FT                   /product="Sugar transferases involved in lipopolysaccharide
FT                   synthesis, membrane associated"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27076"
FT                   /db_xref="GOA:A5GQB7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB7"
FT                   /protein_id="CAK27076.1"
FT                   /translation="MSWRAPWLRERLLLLSLALWDLVVVWAMYGSIYRLRLGHTPGVTL
FT                   ALLVLVLLWLGGSYLLGLYTQQRRGWASWQRTAQLALLVLAVFVAQAWLAGIADSGTRL
FT                   RSFLLPLLSAIALGSGLGHQALAALRPELEAVVLLCTAAERPILQAELASLPTTRQQQI
FT                   TFVEEHEDPEVLAGLPRRGLNVAISDQARIPDAHLERFITLRPLGARVSSLVDWAERSL
FT                   QRVPPELLSERWLLAADGFSLQPGRWSWRVKRFFDVLGASSLLLITSPLVLMAGLAIWL
FT                   EDRGPIFYSQIRSGLYGDPVRIWKLRSMRVDAEASGLQWAQKQDPRITRCGAWLRSLRI
FT                   DELPQLWAVLRGDLSLIGPRPERPELELELEQAIPHYRVRHWIRPGLSGWAQVNYRYGN
FT                   SVADSRIKLSYDLYYLRNAGILLDLLILLKTIRLVLRAQGAQPQQ"
FT   CDS_pept        173841..175046
FT                   /transl_table=11
FT                   /gene="SynRCC307_0174"
FT                   /locus_tag="SynRCC307_0174"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27077"
FT                   /db_xref="GOA:A5GQB8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB8"
FT                   /protein_id="CAK27077.1"
FT                   /translation="MNQPLRLAVLITHPIQYFRPVFAELAQQPGLELRVFFGCDHGRRS
FT                   SLDPDFGVSFAWDVPADEGFPHAFISHAPLDQLSRLRSALPLACRAARAISAWQPDQVL
FT                   IFAYTPVFIGLSTLLLKIRGQSLLLRADGTDRAFPRSWLKSSIKDLVLRIWYRQFRHLF
FT                   PIGVDSDRHFARLGVAASRRHPVSYAVDVDFFAQQQQHWSPQRLSLRHELGIAPTDLVL
FT                   LWSAKMTPVKAPFLLVEALAALPEPVRQRFWVVAMGDGPLRQAFEAQLQTLLPGHTHFL
FT                   GFCNQSEIGRGYAMADALVFPSVQGETWGLVVNEALQFGLAVMASDHPGCAADLLASER
FT                   PVPTGSAVFPSGDPIAFANALLAFAKAHPEGFSPQPSTDLPHPRDLASTIQHWASHSAS
FT                   TT"
FT   CDS_pept        complement(175010..176698)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0175"
FT                   /locus_tag="SynRCC307_0175"
FT                   /product="Asparagine synthase"
FT                   /EC_number="6.3.5.4"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27078"
FT                   /db_xref="GOA:A5GQB9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB9"
FT                   /protein_id="CAK27078.1"
FT                   /translation="MCGLFGAWGWSQQLDTTAALEALKSRGPDDQGEFHDPCGLSLLHT
FT                   RLAIQDLSPLGHQPMQASDQSLVLVFNGEIYNQHKLRRELEAAGYNFRSHSDTEVLLNG
FT                   FHHWKQDLWHRLEGIFAVACWEPHDQRLTLARDRFGVKPLLWQRKPQRLAFASELSALI
FT                   ASGCCNKEALNPKAIESYLLWGSVAAPNTIVDGVQVFPAGHWASWELGESWQLRLFSPD
FT                   QPPAQRSDLNLSAATEQTRFALQQAVQRQSIGDRPVGLFLSGGLDSGLLAAELRRQQQG
FT                   AIHSVSVGFEGLPGAVDETDLAGQTADALELTHQRLGIGPQQLDHSFDGFLEAIDQPTI
FT                   DGFNSHLVTQAAHDQGMVVAFSGLGADELFGGYSHMQPGPLKGQLQARRLKLHGINQQS
FT                   RQALEQTRSSGLPSDLSLSECSELELRGYLHDTLLRDSDAVSMAQGLELRVPFLDSELV
FT                   DLALSIPADLHRAEGPKTLLRRLARNQLPEAVLNAPKRGFNLALAPWLLQHQRFHPTRI
FT                   WSLLQKQPLQLSRRSFWGSWILLRLSGRFKPYWRYVVLAEWLAQC"
FT   CDS_pept        complement(176910..177728)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0176"
FT                   /locus_tag="SynRCC307_0176"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27079"
FT                   /db_xref="GOA:A5GQC0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC0"
FT                   /protein_id="CAK27079.1"
FT                   /translation="MILLLCFDLRRRGGIERLSLQVRDSLKRQGHRVQVISTRRLGPGA
FT                   LGRWLGRCVFVLQLLWWLPRAQQVLSMHVLLLKPALWLRPQQLSCWLHGIEVWGAAGGK
FT                   HTGDLQRCQRLIASSQFTLNQLGFRPQRAAVVHPMADLIDPELKPTPIPAELRLLTVAR
FT                   LCSQENYKGHGLVLQALAQLPAAIHWQVVGDGDQRGQLEAKAMSLGLNNQVQFSGSLND
FT                   QELKEAFENCSIFVMPSRFGVKANGDAHWAKALASFILEAALAGRASNCL"
FT   CDS_pept        complement(177728..178915)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0177"
FT                   /locus_tag="SynRCC307_0177"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27080"
FT                   /db_xref="GOA:A5GQC1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC1"
FT                   /protein_id="CAK27080.1"
FT                   /translation="MPRRLILVSEHYQPSSGATAQLMHDLSRGLADLGWNITVLTATSA
FT                   LPIDDADNHHRVVRLGQQKQAADATKSVGGKTLAGIRFLCSCFLWCSFRAHQNDLVFIV
FT                   SNPPFIGLIGPLLKIVRGLRYLFLFQDLFPRSAVLSGILPAQGFSTQTWTALMQWICRH
FT                   SAATVVLNQAMAERLQQDSSHRLPLKVIHNWAIEQSSALPQATNPFAIKYGFAGRFTLQ
FT                   YSGNFGRLHDINTLIDTAAQLQNDPRIQFLFIGGGAKQQVIQQAALSNVLLLPYQPRSR
FT                   LPETLAACDLACISLIPGAENTLAPCKLYGILASGRGLVLISGPNCDLAELVQREGIGI
FT                   VVAPGDSELLAQELQHLSQQPEKVAAMGERAKRVYAESFGFERSLKRYNELLLSL"
FT   CDS_pept        complement(178915..179841)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0178"
FT                   /locus_tag="SynRCC307_0178"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27081"
FT                   /db_xref="GOA:A5GQC2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC2"
FT                   /protein_id="CAK27081.1"
FT                   /translation="MDSAALQLRGSGYSSSFHLPANTQITPTVKHASSPTIAGVVLCLN
FT                   EASNLARALRSLSWCDELMMIDSGSSDGSQAIASSFGARVMEHRQEGRFLISEQRNWAL
FT                   SHGKLQSQWILFLDADEEISITCQQAIQQVIQHPAAADAYELTPRYWFLGRWLKRTQGY
FT                   PNWHPRLVKRGVVGFEGGVWESFTAGHTIGRIQEPYEHYAFSKGIDDWLERHRRYADWE
FT                   AEKIDAVLSGQGVQALGTRRWQHLRLAMAHAWPLRPILRFSQKYVLQGGFLEGWQGLLF
FT                   ALLMAGYDLITITKLIQRRRLKQGLPL"
FT   CDS_pept        complement(179754..180944)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0179"
FT                   /locus_tag="SynRCC307_0179"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27082"
FT                   /db_xref="GOA:A5GQC3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC3"
FT                   /protein_id="CAK27082.1"
FT                   /translation="MNNPLTIIHAIPVYAPAWQYGGPVLSVSRLCEALAMTEHRVRVLT
FT                   TNAGLRQLKYEDLGRCTQRHGVEVNYFPVNEKDGMITSTSLEKVLPELLDGADIIHLSA
FT                   VWQPFGIPLQRVAHELGIPVLHSLRGALSPYSWRRSWWKKIPYYLLREQPWLQRAAGLH
FT                   VTTQQEENELVKLRLKAPFYQLANPIDLKYLQLDPSSGEAWRYKNGISPDIPLLLICGR
FT                   QHHKKGLDLLIPVLQKLNQCQWKLLLVGNDDDGTGTQFVNSLNEIGLRDRLIQLPSQAA
FT                   TELGPIYNAADLLLLPSRHENFGNVVIESLACGCAVAVSDKTGVGGDLSNGAPTNFGAV
FT                   LPREAGAWADWLASWLNNPQRAGKNCAQWIAQRYSSEAVAIQAVSIYQQILKSRQR"
FT   CDS_pept        complement(181457..183301)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0180"
FT                   /locus_tag="SynRCC307_0180"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27083"
FT                   /db_xref="GOA:A5GQC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC4"
FT                   /protein_id="CAK27083.1"
FT                   /translation="MGKLFTLLTYLPSKRRAQMVLVSLGLIISSANKALLVLGVGPFLL
FT                   VLTGSRVETGDNTDKLQQVLEPLTNHPILACLLFAATAISAGLAGLFTSWAIGRYTNCL
FT                   SLDLMRYCLESALNEPFVIHSSKNRNHTINDVNRIQSLSTLVFAPVIQLIGASLTILST
FT                   ITVACLVNWRATLVSILLGGGIYLLAVARTKKILNRDGIILVENGRILATTLREAFSGI
FT                   RDLLLDNKQKEILAIQERISAQILQTSVRAGLIQATPRYLLETSGYLLLAGFGFIVVIS
FT                   GQNTELNIATIGTLALAIQNLLPSMQQAFSCWSTFTSSQPTLDVALKLLHSTGTIDDVD
FT                   ITWPGNHKYEANSSSTNKRQIFAGNIKLENACFNHKLVSKNIIELSSKGIYNVNLEIHT
FT                   QDVIGIAGKTGSGKSTLLDVIMGLLPLDSGKLFVNEESLYTSKQFRQWWISQISHVPQQ
FT                   IFLSDASIAKNITDQNDEDKIDQDKLEWACEKAQASEFIMSLPDRWNSLVGERGSRLSG
FT                   GQRQRLGIAKALYRQRSLLVLDEATSALDQLTEAKVIEAILNLKNKPTIIMVAHKMSTL
FT                   DHCRRVILLKDGFIIQQGRATEIQAMISAQEKYERKGL"
FT   CDS_pept        complement(183314..184021)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0181"
FT                   /locus_tag="SynRCC307_0181"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27084"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC5"
FT                   /protein_id="CAK27084.1"
FT                   /translation="MDASQMEALDRPKRTVMPMRSDERLAQRIATEVLPRYPVTSILDI
FT                   GCGDGVVSKHLTGQTNYRGLDINEACIYEQEHDNPIVNYVQPEAIAKITQEEGPWDMIL
FT                   LLDVLEHTRDFTGLFEQAMLSSEKYVIVSLPNELFFLDRLRMLRGRELNAHSLDLVGLT
FT                   EGFKHQFIVNINKARSLLIKKAREHSFLLIEEVVRPLKPKRQLLGPIAQIITKLRQDQV
FT                   WSQGSIFIFHNHT"
FT   CDS_pept        complement(183973..184935)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0182"
FT                   /locus_tag="SynRCC307_0182"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27085"
FT                   /db_xref="GOA:A5GQC6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC6"
FT                   /protein_id="CAK27085.1"
FT                   /translation="MNITIILPVYGNSPWLKEAVESVVNQNSNSWKLLIADDGSDEITR
FT                   RWLRSKLNKLQDARIQWILRPKNLGLFRNLNQAIKESITDWVLLLCSDDKLHPNAITSL
FT                   ELLQQSWPQVGLILSSFDSINANGSPREPDSSQHHDQLRVNTGLVAPEKMVPGLLRLGS
FT                   LNGNLTGMAFSKEHWQNSGPFREDWRHAADWEWLIRASETKAVLLNRNPIASVRTHGGQ
FT                   LSVRNRQSGHECKEIADVIAALKRHPLLQGATERERWAGHVMQFQLWNLIKASSQGEWS
FT                   QLSDGLKAIHNSAGLRQTGRSLLRWMPARWKRWIGQNAR"
FT   CDS_pept        complement(184932..186149)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0183"
FT                   /locus_tag="SynRCC307_0183"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27086"
FT                   /db_xref="GOA:A5GQC7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC7"
FT                   /protein_id="CAK27086.1"
FT                   /translation="MAGTMRITIVVGGRWHAFDLAHELNKQGHLFRLITNYPTWFVKKW
FT                   GIPHEKIVSLPLTFWVVKAIYKLGGESLMMHCQWRVHQWFAKRAAKYLSGSECIHGWSQ
FT                   WSEPSFQWAKTRGIPIVLERSSAHILEQSRLLHEEHQRLGLKWTETHAKIEKMELREYE
FT                   LCDSVAVPSLFVERSFIKRHFRREKLFRNALGVNLSSFKPATKAPPAPSDDGLRIIYAG
FT                   SLSVRKGLADLLEAFALASLPKATLKLLGGETPELKLLLREQPPQVKILGHIPQEALVG
FT                   HYQQSHCFVLASVEEGMAMVQMQALACGLPLICTTNTGGEDLLRMTGSEGKPLELGIKQ
FT                   FPAGFLVPIHSPAAISSCLRKIANEETLWISMHNEAINLASNQLSWESYGQRAIEHYKD
FT                   LIEARK"
FT   CDS_pept        complement(186134..187156)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0184"
FT                   /locus_tag="SynRCC307_0184"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27087"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC8"
FT                   /protein_id="CAK27087.1"
FT                   /translation="MKKLLLIGDTSLPEALGSKLLRGAKTLDVRSQWEVSVSYHSPAPS
FT                   YSRSMNRKRGKLFYRLAGKRSWEWWGYQKLLHKQIEELKPDLLLVTGVLPLDKKIFATV
FT                   KSQGGCIVNYLTDDPWNPIHQRRSFLENLPDYNHIFSTKQALQARLKQAGTPSTSWLPF
FT                   AYDPELHHPVPGVAGPDVVFIGTGAQERLPWLKAVAELPEIQRRIHGNSWHGINTPGWE
FT                   QQPAATGVQYCQTINGAKVVLGLLRAANGDQSTDRSYEIGAIGGCGIYQDTDEHRKLLP
FT                   EYPEEGFFKDPIELAQRVKTVLSSPALQQCLRRVGASAIRKPENTYAARLQTILGWQAQ
FT                   "
FT   CDS_pept        complement(187153..188166)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0185"
FT                   /locus_tag="SynRCC307_0185"
FT                   /product="NAD dependent epimerase/dehydratase"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27088"
FT                   /db_xref="GOA:A5GQC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC9"
FT                   /protein_id="CAK27088.1"
FT                   /translation="MKHPILVTGAAGFIGAAVCKRILADGESIIGIDNINDYYDPGLKI
FT                   SRLKTIEHGNWQFEKLDISNQSSMKELFAKHKPCRVIHLAAQAGVRYSIENPSAYIQSN
FT                   LVGFGNILEGCRHHDVKHLVYASSSSVYGGNTNLPFQESQAVNHPISLYAATKKSNELM
FT                   AHTYSHLYGLPATGLRFFTVYGPWGRPDMAPMLFAKAILSGQPIRIFNNGLMQRDFTYI
FT                   DDIVEGIVRVLRKPAAANPKFDKMKPDPATSWAPHRLFNIGNSNPIPLMEFINCMEDAL
FT                   GIEAIKQFEPIQPGDVEATAADTAALHEWVGFKPSTSIEEGVKAFARWYRNYYQLA"
FT   CDS_pept        complement(188163..189104)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0186"
FT                   /locus_tag="SynRCC307_0186"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD0"
FT                   /protein_id="CAK27089.1"
FT                   /translation="MTRRHLVTGGAGFVGSHLVDRLMEAGEEVLCLDNYFTGRKENIRQ
FT                   WIGHPSFELIRHDVTEPIKLEVDRIWHLACPASPVHYQFNPIKTAKTSFLGTYNMLGLA
FT                   RRVGARLLLASTSEVYGDPEVHPQPEGYRGCVNTIGIRSCYDEGKRIAETLCFDYKRMH
FT                   GTEIRIARIFNTYGPRMLENDGRVVSNFIVQALQGIPLTLYGGGQQTRSFCYVDDLVEG
FT                   LLRLMEGDHTGPINLGNPNEFTIRQLAEKVRDQINPSLAFVGEPLPQDDPLQRQPVISL
FT                   AQEELRWQPSIELDEGLKKTIADFRRRVEDKI"
FT   CDS_pept        complement(189104..190477)
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="SynRCC307_0187"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27090"
FT                   /db_xref="GOA:A5GQD1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD1"
FT                   /protein_id="CAK27090.1"
FT                   /translation="MPIKSICCIGAGYVGGPTMAVVADRCPGIQVHVVDLNSQRVAAWN
FT                   DPDLSRLPVYEPGLDAVVARARGRNLFFSTKVNEAIASADMVFLSVNTPTKTRGIGAGQ
FT                   ASDLRWIEACTRQVAAAAQGHTIVVEKSTLPVRTAEAIQTILSAAQGEGKSFSVLSNPE
FT                   FLAEGTAISDLEAPDRVLIGGNNAEALDALAWVYAHWVPEEKILRTNLWSSELSKLTAN
FT                   AFLAQRVSSINSIAALCESTGADVREVAKAIGTDSRIGPRFLQSGPGFGGSCFQKDILN
FT                   LVYLCRHYGLAEVADYWEQVVELNTWQQQRIARLVVQRLFNTVAGKSIAILGFAFKADT
FT                   NDTRESPAIRIAQELLEEGAQLAIHDPKVSLEQISLDLGREAGVGEGSWHIASDPQSAC
FT                   GGADACLILTEWGQYKQLDWQAIASGMRRPAWLFDARAIADADAARTAGLQVWRVGEG"
FT   CDS_pept        191233..191439
FT                   /transl_table=11
FT                   /gene="SynRCC307_0188"
FT                   /locus_tag="SynRCC307_0188"
FT                   /product="Possible pseudogene of GDP-mannose 4,
FT                   6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27091"
FT                   /protein_id="CAK27091.1"
FT                   /translation="MLVCWYSLAKQTKSQLSYDLSAQAHVAVSFESAEYIANYDALGSL
FT                   RILGSVRILCLTEKTRIFQASTS"
FT   CDS_pept        191540..191602
FT                   /transl_table=11
FT                   /gene="SynRCC307_0189"
FT                   /locus_tag="SynRCC307_0189"
FT                   /product="Possible pseudogene of GDP-mannose 4,
FT                   6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27092"
FT                   /protein_id="CAK27092.1"
FT                   /translation="MGNLDSLREWGHARDYVEIQ"
FT   CDS_pept        191795..191992
FT                   /transl_table=11
FT                   /gene="SynRCC307_0190"
FT                   /locus_tag="SynRCC307_0190"
FT                   /product="Possible pseudogene of GDP-mannose 4,
FT                   6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27093"
FT                   /protein_id="CAK27093.1"
FT                   /translation="MEAQTLLGDPSKAREKLAWTPTPTLEELVAEMVAADGEEVKKEAF
FT                   LKRKSFSVVGLMETESTNEF"
FT   CDS_pept        192017..192247
FT                   /transl_table=11
FT                   /gene="SynRCC307_0191"
FT                   /locus_tag="SynRCC307_0191"
FT                   /product="Possible pseudogene of GDP-L fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27094"
FT                   /protein_id="CAK27094.1"
FT                   /translation="MSTLTKADDHFFVAGARGMVGSSIFRALEQKGYGDEVCSDALLKP
FT                   TRQTLDRFDREAVKIWFRDKKLTVGVGYGED"
FT   CDS_pept        192438..194225
FT                   /transl_table=11
FT                   /gene="SynRCC307_0192"
FT                   /locus_tag="SynRCC307_0192"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27095"
FT                   /db_xref="GOA:A5GQD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD6"
FT                   /protein_id="CAK27095.1"
FT                   /translation="MTRSPAYDIPPVRALLLSLWSHLSRKRRRQVIALVGVMIISGFAE
FT                   LISLGAVIPFLAVLTNPGSAFDLPIVSAIASYFGLTSSSQIIIPFTILFAFTAVVVSLV
FT                   RSVNLWLNGRLVAAVATDLSCESYKRTLFQPYKVHLLRNSGNVITKTTTQVTYTLQALS
FT                   AMLNMGTSAIVAASLTVGLLLINFKVAISASLLFSSLYLIIARRIRPILRKNSKRISSA
FT                   NASQLIALQEGLGAIRDVLLDGSQPFYLNIYTKADKPLRRLQAQNLFLTNVPKYLLEAF
FT                   GLVIISLLGGVLVIYNGSQSSVIPLLGAMALGAQRLLPSLQQIFRGWSSLKSNQAAIAA
FT                   VVELLEQPLPSIFEVNKVQKLNKFICCKNVSFKYNENQKFVLENLNLEIHAGQKIGLIG
FT                   STGSGKSTLADLLMGLLEPYMGCILVDDIDINDSLTPDISQVWRNSIAHVPQAIYLADC
FT                   TIAENIAFGISRENIEMSRVKLAAQKAQLSSFIDSLPDGYNTFVGERGVLLSGGQRQRL
FT                   GLARALYKNSSFLVLDEATSALDNTTEEEVMKSIDSLGRDLTVLIVAHRISTLKNCDRV
FT                   IKIENGKICADGPPSLILN"
FT   CDS_pept        194347..195456
FT                   /transl_table=11
FT                   /gene="SynRCC307_0193"
FT                   /locus_tag="SynRCC307_0193"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27096"
FT                   /db_xref="GOA:A5GQD7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD7"
FT                   /protein_id="CAK27096.1"
FT                   /translation="MSNLDPIYVTKPHLPPLEDFIPLLQQIWERRILTNNGPFHQELED
FT                   ALCKYLGVKHLSLFSNGTIALVTALKALGVSGEVITTPYSFVATAHSLLWNNITPVFVD
FT                   IDPVTFNLDPSKIEAAITDKTTAILPVHCYGFPCDVDAIQEIADRNGLKVIYDAAHAFG
FT                   VNCHCGSVLNHGDLSILSFHATKVFNTFEGGAIICHDKDTKQKIDKLKNFGFVGETEVE
FT                   ATGINGKMNELQAAIGLLQLQSIDVAIDQRSVISSTYREQIEKIEGLSCPPPSSALHYN
FT                   EAYFPILVKPEYRLSRDGLYEKLRQANIYARRYFYPLITDFSMYRHLFSSSPEKLPIAN
FT                   LVASQVICLPIYSTLSTEDLDRVLAILAY"
FT   CDS_pept        196145..197101
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SynRCC307_0194"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27097"
FT                   /db_xref="GOA:A5GQD8"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD8"
FT                   /protein_id="CAK27097.1"
FT                   /translation="MFITDIHSFIPGNQIDNVQLASTYGKSEDFVLSKIGALRLPRKMP
FT                   NQTSLFFAIEAAQKLFKCNSSIKPENIDCILVVTQNPGNGGVPHISPQIQSALSISNKC
FT                   HTFDISLACSGYPYALSIISSYMAANNLCNGLLITSDQYSDILDSDDKNTSLLFGDASA
FT                   VTLVQSEPTSYYSLKINDISAYTDGNSHDAIEMRNGLLYMNGRNVFNFALQTVPLAIKN
FT                   HLADRDLSLLDIDYVICHQGSKAIVESIRKKLELSVDKVPICIEQIGNTVSSSIPLVLK
FT                   DKFFTPTREKNCNRILICGFGVGLSIATMILTKISKC"
FT   CDS_pept        197020..197319
FT                   /transl_table=11
FT                   /gene="SynRCC307_0195"
FT                   /locus_tag="SynRCC307_0195"
FT                   /product="Hypothetical protein"
FT                   /note="Possible pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27098"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD9"
FT                   /protein_id="CAK27098.1"
FT                   /translation="MQQNSYLWIWCWAINSYNDINKNFKMLDSQLLDCLRNSGYDEIVD
FT                   IDFSKSFSDNGLDSLDVFSWISEVESETGISIEDDELQELKTPAQLLHLITSKQ"
FT   CDS_pept        197319..198263
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="SynRCC307_0196"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27099"
FT                   /db_xref="GOA:A5GQE0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE0"
FT                   /protein_id="CAK27099.1"
FT                   /translation="MIPFREKRQFISAESKTLDVRGVCLPSDLSPGCLAFTNSFESYPI
FT                   KFKDTYKASAVSSITKILTTYIFISDRDFSENPSVKEDLKEKCIELIPVTNPRDHFIFA
FT                   INSNSYAIDFKSLLGKNPSIHSSAHIHPSAFISENVYIDSGVTVGPGCVIGEGTYIGKN
FT                   TIIQSNCTIGCDGINAYNSSITNKLTMMPHFSGVFIGENVYIGSGSTINRGVFNMTMIS
FT                   NHCILGSNVLIGHNASLDNKVWLSSGVLVGGGSHLSECTKIGLGAIIRDNLSIGSNVNV
FT                   GMGSVVYKNVLANRSLIGNPARITPKLSAGPDF"
FT   CDS_pept        198371..199279
FT                   /transl_table=11
FT                   /gene="SynRCC307_0197"
FT                   /locus_tag="SynRCC307_0197"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27100"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE1"
FT                   /protein_id="CAK27100.1"
FT                   /translation="MLYSPVSITVYNRFFHFKKCIENLKKNVLADKTTLFIFSDAPRLG
FT                   DEENVQKVRDYAKNIDGFKDVRLHFQTTNNFAKNGYESRRIPISEFGSVIRMEDDILTA
FT                   PGFLTFLNHAYQFYQNNPSIVNITGYCPPLRINSDYSKDYFILKRPCAWGWLYDQEILD
FT                   IVESQIDIGELNSFIKNSRHKITECGEDVLRMAFKDATKQIQAGDVRSMFYQIKYNKYT
FT                   IYPRYSLVQNIGHDGSGLHCGSTKKFMHDILWDKVDNFDFELLPKPDPEIVRANYQFRS
FT                   RPLSTAIKIKLKDTIRAWLQS"
FT   CDS_pept        200385..201086
FT                   /transl_table=11
FT                   /gene="SynRCC307_0198"
FT                   /locus_tag="SynRCC307_0198"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27101"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE2"
FT                   /protein_id="CAK27101.1"
FT                   /translation="MAGIRLKLKRLFLDEINSHLNPQIPPILIASMGRSGSTLLFDAVA
FT                   EALISTRNLLIPRAFAKALIRRGGAWNLRTIRFFPGVVYKTHGFPDHLPENFTGKIIFI
FT                   YGDPIDAALSIINCRDKLGEMWFSSHLTHLFAKESFLSDDNDPFQFSRQIQSWMNYQGS
FT                   PVLVLRYETLWDYTNKISEFLGFNISLPPRKARSNISESELDVARYIDAYTPLRAQMLD
FT                   LPDVYIYTPLQ"
FT   CDS_pept        201083..201916
FT                   /transl_table=11
FT                   /gene="SynRCC307_0199"
FT                   /locus_tag="SynRCC307_0199"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27102"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE3"
FT                   /protein_id="CAK27102.1"
FT                   /translation="MNIFSSLLLFAYLFLPNSPTQSVSSTPPVKFGIWGVDKISPSKEK
FT                   DLFCQLKKDNFDFIQSYSSFKTHSFKRLEGLLENIQECRINAILAIQPFRKNILVNPVF
FT                   NSKLQLLSLYSRNVLVQIADEPRSKNQVRFLPKICRHIEKFSLDAHLQEGVNPTILQCV
FT                   TQNGLHSHRKRPNINPSLKQIALNSHKLRRSRKDIVYTMRMFNSENQNNFVNVTYEDAK
FT                   NELCYVLQNIKPNKIAFYTYNKRYKGAGMMQDPGLYKIATQLVLKYKNNKLICQK"
FT   CDS_pept        202620..203888
FT                   /transl_table=11
FT                   /gene="SynRCC307_0200"
FT                   /locus_tag="SynRCC307_0200"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27103"
FT                   /db_xref="GOA:A5GQE4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE4"
FT                   /protein_id="CAK27103.1"
FT                   /translation="MLVLFTLCLFQATRWFGIERSIFYILTCILLALLIGLIGKYSITK
FT                   QSTLAFLLIATFSLPAIINFALIPTVSLSQALLPFVGFLKVFLLLLLLSSLPLTTSINF
FT                   IHRFMLFATSYGFLQWIISSLGFAQRASLIDSHYEIVGFFPIWRVNSLWGESQHFSQVL
FT                   VFYLLFCFVESSLLNPTENISRKFGIYLSLFMLATSGSTTGYFLSLFVITSHLILSLTK
FT                   PFLSNLPLSYSSLHSPLTSLKKIFHFILRKQYFFLLLTVFFAFTVFVSTSDALLRQFAK
FT                   QSSRASLVASFILDTNNLSTGSSGWDSGTRAQSLIRAKDYLSNPSKLPQYSPELATKSK
FT                   DGFLLNFVRFGFIGSFMVTISLLIVCYIYNFDPLMSLGFLALVLIFWFRGETINATSFQ
FT                   FGLVLSLFMLSFKYGNSRVPARN"
FT   CDS_pept        203892..204839
FT                   /transl_table=11
FT                   /gene="SynRCC307_0201"
FT                   /locus_tag="SynRCC307_0201"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27104"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE5"
FT                   /protein_id="CAK27104.1"
FT                   /translation="MTVSLITGCHRSGSTWLGKTICYASNSIYFWEPFNLNSPQLYKSL
FT                   ISSSLNNNKYWYPFLPSTHQFWPDLIRVCSKRRLLYSNISFSDFFADSPKRTLFALKKA
FT                   VALQFSLLTGGNIVIKDPLMLFSVEPALESSAVDNVVILTRDPRAFYTSVKKANWAFDF
FT                   SHLLPVTSTYPHLFKYHNLVTHKSIQGSLLDLESVSLLWNILHEHILYLSNLSLVTLFK
FT                   YEDICADPESFFPSIAQSLFGNDFTFNQEAFSAYLLGLKDQPSTPEDKKGVQMVRRGES
FT                   KAISKLWLNRISETESLSIYNSCHKLMNFFGYSR"
FT   CDS_pept        204836..205603
FT                   /transl_table=11
FT                   /gene="SynRCC307_0202"
FT                   /locus_tag="SynRCC307_0202"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27105"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE6"
FT                   /protein_id="CAK27105.1"
FT                   /translation="MTATLFLCCPSLSFSGSTARTANSFNRLKNLLSVFDISVKTLFLS
FT                   SDQNDLASAEAHSYFDYIFFSPCEGVYAAFNAAIKKSLSLSADWIWLLGEGDTILCERL
FT                   DLSILSQNLSLGSHILMMNMFVGDRKLRCKLKEAFPSPLFSLDTMRFNHPASIISANAY
FT                   SINGLYSLDYKVVSDYYWLHKACAANLSITHLPFVSVYHELGGISTSSGKSRFFEHYQC
FT                   LLALNRVYGFSFSVFFALIFRLTRCLVSSFFAK"
FT   CDS_pept        205600..206670
FT                   /transl_table=11
FT                   /gene="SynRCC307_0203"
FT                   /locus_tag="SynRCC307_0203"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27106"
FT                   /db_xref="GOA:A5GQE7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE7"
FT                   /protein_id="CAK27106.1"
FT                   /translation="MTKYSFVILTCSSPWHGRGGASRVISSYIDFYTRKKVPLKICLFH
FT                   FMHKYRLFRVLPSLKSLFYALTLLFCRQPYAIHHHHTSLYDLGFLFLFKLFSFSGRDRI
FT                   AITLHNPKHFVESSSLFRTFHFSLVRFCAKHLHFLNSQDQSTFTRNHFLCLPIFDCVSV
FT                   VSSNPLSNRSLIELRLLLDSDTYCLTDADIYLGVMAVLRPGKRIDLCIKALVQLPPTFK
FT                   LLIAGEGSDMQILIKLVQSLNLSDRVQFLGWLDDDQKPCFFSQVDLFLNASQFDTQSLV
FT                   FLESLTHSTPVISVPNPIFLEIYPPSPCIYYSSAFTVEAFSKAVQSAAHSVFSFSQTAN
FT                   TLLERDSVKVFPFPCR"
FT   CDS_pept        207383..208579
FT                   /transl_table=11
FT                   /gene="SynRCC307_0204"
FT                   /locus_tag="SynRCC307_0204"
FT                   /product="Sulfolipid biosynthesis protein
FT                   (UDP-sulfoquinovose synthase)"
FT                   /EC_number="3.13.1.1"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27107"
FT                   /db_xref="GOA:A5GQE8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE8"
FT                   /protein_id="CAK27107.1"
FT                   /translation="MKVLVLGGDGFCGWPCAVNLADQGHDVLIVDNLSRRKIDIDLEVE
FT                   SLTPITNIGERLKAWSEIGGKPMRFVHLDIAHEYQRLLDLLLEEKPDSVVHFAEQRAAP
FT                   YSMKSSATKRYTVDNNVNGTHNLLAAIVESGLDIHVVHLGTMGVYGYGSHRGATIPEGY
FT                   LKVEVPQPDGSRFEEEILHPASPGSVYHMTKTLDQLLFLYYNKNDQVRITDLHQGIVWG
FT                   TNTEATDRDPRLTNRFDYDGDYGTVLNRFLMQAAIGYPLTVHGTGGQTRAFIHIRDSVR
FT                   CVQLALDNPPVKGERVKIFNQMTESHQVGELAKKVAALTGAQVNNLPNPRNEAVENDLI
FT                   VDNRCFIELGLNPTTLDDGLLKEVVEIATRYADRCDRNRILCTSAWTKTQEQAIRAGS"
FT   CDS_pept        208620..209447
FT                   /transl_table=11
FT                   /gene="SynRCC307_0205"
FT                   /locus_tag="SynRCC307_0205"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27108"
FT                   /db_xref="GOA:A5GQE9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE9"
FT                   /protein_id="CAK27108.1"
FT                   /translation="MTSSNQPLVSIIIPCFNCASTVLESLQSVQSQTFSNFQCIIVDDC
FT                   STDQTQALVMSFIEGDSRFRYLITQSNQGVSSARNLALDNCSSQYIAFLDSDDLWHPEF
FT                   LTLALDYMSTNSARFVYSPVLRFIDNAKRTGFVKVPPFRVSLSSLLTNNHIPLVTAVFD
FT                   ASLLSPSLRFTPQRPEDYIFWIQLFTLNPSLEGFRFSNLPLGFYRVSPKQRSSNKIINI
FT                   KRAYYVYRSVWHFGYVKSLFMTLVYVANSLLDYIFQFSAPRNFPSSVFLGPNS"
FT   CDS_pept        209444..210406
FT                   /transl_table=11
FT                   /gene="SynRCC307_0206"
FT                   /locus_tag="SynRCC307_0206"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27109"
FT                   /db_xref="GOA:A5GQF0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQF0"
FT                   /protein_id="CAK27109.1"
FT                   /translation="MKVAITGSSGFVGSNLVSSFIANSIDFICIDRFPLDPLVVSRPCQ
FT                   FFVDYADITRLVNLLKDVDCVVHLAGRAHKPVQNDESAFQEFKQANVEVLACVVKASQA
FT                   VSVKRIIYVSSIGVLGSNTPNTPFTDFTSPSPSALYGHSKLEAERFLVSYLSNDFSIDW
FT                   VILRPPLIYGPNCPGNMSRLLRILPYLPLIPFASLSSQKSFMSIDNFIDILNLCLSSSV
FT                   VSRKTFVVSDNDDISVGDLFAVLLSGLRISSRRLVPFPPAILALVMRIFGLSALWQQIS
FT                   SPLVIDSSNFSSSTGWFPRFSSRNQLYVTARSFLRNKKY"
FT   CDS_pept        complement(210513..210713)
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="SynRCC307_0207"
FT                   /product="Photosystem II reaction center J protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27110"
FT                   /db_xref="GOA:A5GQF1"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF1"
FT                   /protein_id="CAK27110.1"
FT                   /translation="MSGKKSGLPDGRVPDRNPDGTPAVPWKSRWTEGPLPLWLVATAGG
FT                   MAVMFVVGLFFYGSYVGVGSA"
FT   CDS_pept        complement(210725..210844)
FT                   /transl_table=11
FT                   /gene="psbL"
FT                   /locus_tag="SynRCC307_0208"
FT                   /product="Photosystem II reaction center L protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27111"
FT                   /db_xref="GOA:A5GQF2"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF2"
FT                   /protein_id="CAK27111.1"
FT                   /translation="MDRNPNPNNLPVELNRTSLYLGLLLVFVTGVLFSSYFFN"
FT   CDS_pept        complement(210856..210993)
FT                   /transl_table=11
FT                   /gene="psbF"
FT                   /locus_tag="SynRCC307_0209"
FT                   /product="Cytochrome b559 beta subunit (PSII reaction
FT                   center subunit VI)"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27112"
FT                   /db_xref="GOA:A5GQF3"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQF3"
FT                   /protein_id="CAK27112.1"
FT                   /translation="MTSTPSPATPRNYPIFTVRWLSLHALGIPTVFFLGALAAMQFVRR
FT                   "
FT   CDS_pept        complement(211000..211251)
FT                   /transl_table=11
FT                   /gene="psbE"
FT                   /locus_tag="SynRCC307_0210"
FT                   /product="Cytochrome b559 alpha subunit (PSII reaction
FT                   center subunit V)"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27113"
FT                   /db_xref="GOA:A5GQF4"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF4"
FT                   /protein_id="CAK27113.1"
FT                   /translation="MAAGSTGERPFFEIITSIRYWVIHAVTLPAIFLAGFLFVSTGLAY
FT                   DAFGTPRPDSYFQAADVKAPVVSQRYEGKSQLDTRLKN"
FT   CDS_pept        complement(211324..212319)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0211"
FT                   /locus_tag="SynRCC307_0211"
FT                   /product="Uncharacterized protein related to plant
FT                   photosystem II stability/assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27114"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF5"
FT                   /protein_id="CAK27114.1"
FT                   /translation="MIPVIRSFLSLLLCVGLTFGLGGCVTTSLPMAAASPWNSQKLGIE
FT                   SNPLDVAFTNESHGFLVGSNRLVMETSDGGETWEEREIDLPADENFRLISIDFNGDEGW
FT                   IAGQPGLLLHSDDAGQSWSRLLLDTKLPGDPYLITALGSKKAELATNVGAIYQSSDAGK
FT                   SWQAEVVDAAGSVRDLRRGDDGRYVSVSSLGNFFSTWDPGQSNWQVHQRVSSQRLQSMG
FT                   YQPDGQMWMVTRGAQLRFNPEGGDYEEWSKPVIPITNGYGYLDMAWDPQGNIWAGGGNG
FT                   TLLVSSDGGKEWEKDPVGTATPSNFTRFVFLGGNKAFALGERGAILRWVG"
FT   CDS_pept        complement(212316..212705)
FT                   /transl_table=11
FT                   /gene="rub"
FT                   /locus_tag="SynRCC307_0212"
FT                   /product="Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27115"
FT                   /db_xref="GOA:A5GQF6"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQF6"
FT                   /protein_id="CAK27115.1"
FT                   /translation="MEQEPSTPEEVLIEAPVEEAEPAENPDTHRFECRSCGYVYDPAEG
FT                   VKKVGIEPGTPFSSLDVASFRCPVCRSPVAAFRDIGPRDKPSGFEENLKFGLGVNVLTP
FT                   GQKNVLIFGGFALAFAFFLSLYSLR"
FT   CDS_pept        212801..213163
FT                   /transl_table=11
FT                   /gene="ndhC"
FT                   /locus_tag="SynRCC307_0213"
FT                   /product="NAD(P)H-quinone oxidoreductase chain 3"
FT                   /EC_number="1.6.5.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27116"
FT                   /db_xref="GOA:A5GQF7"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF7"
FT                   /protein_id="CAK27116.1"
FT                   /translation="MFVLPGYDAFLGFLLIAAAVPVLALITNAVLAPRSRQGERRLTYE
FT                   SGMEPVGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAIL
FT                   VVALAYAWRKGALEWS"
FT   CDS_pept        213170..213898
FT                   /transl_table=11
FT                   /gene="ndhK, nukC"
FT                   /locus_tag="SynRCC307_0214"
FT                   /product="NAD(P)H-quinone oxidoreductase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27117"
FT                   /db_xref="GOA:A5GQF8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF8"
FT                   /protein_id="CAK27117.1"
FT                   /translation="MSDTSLDSMRDLRAASCGPVGSPEVTTDLSENVILTSLDDLHNWA
FT                   RLSSLWPLLYGTACCFIEFAALIGSRFDFDRFGLVPRSSPRQADLLIVAGTVTMKMAPA
FT                   LVRLYEQMPEPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPVDLYLPGCPPRPEAIF
FT                   DAVIKLRKKVGDEAIAERGKLEQTHRYSTVEHRMTAVDPIVDGRYLRAETQQKALAAAE
FT                   AVSPLNLAPAEQPETIPAKS"
FT   CDS_pept        213895..214425
FT                   /transl_table=11
FT                   /gene="ndhJ"
FT                   /locus_tag="SynRCC307_0215"
FT                   /product="NAD(P)H-quinone oxidoreductase subunit J"
FT                   /EC_number="1.6.5.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27118"
FT                   /db_xref="GOA:A5GQF9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF9"
FT                   /protein_id="CAK27118.1"
FT                   /translation="MSETPTSPNQDLPEAPQAGPLSQWLTSQGFDHQILGNDHLGIERL
FT                   GVEPLALPLVATALKSKGFDYLQVQGGFDQGPGEPLVSFYHLVQVGGSDGASTAEVRLE
FT                   VSLARDGDLTVPSLYPLFRGADWQERETFDLFGINYSGHPHPKRLLMPEDWVGYPLRKD
FT                   YVQPDFYELQDAY"
FT   CDS_pept        complement(214426..215877)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0216"
FT                   /locus_tag="SynRCC307_0216"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27119"
FT                   /db_xref="GOA:A5GQG0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG0"
FT                   /protein_id="CAK27119.1"
FT                   /translation="MSRLARGSKPATDRLLTVQAMTRLPRAGEQSRRGELVDRSRRAVQ
FT                   WLQPGLVVKRWVLTSALGFVLALLGAAIWADLKPIYWILTTVDDLLRVLAGAGREFTGP
FT                   LVLLVGIGLVLLGQSRSFGSIQRALAPQKDTALVDALLAQRRLNRGPNIVAIGGGTGLS
FT                   TLLSGLKRYSGNLTAIVTVADDGGSSGVLRRELGVQPPGDIRNCLAALAREEPLLTRLF
FT                   QYRFTAGGGLEGHSFGNLFLSALTAITGNLETAITASSKVLAVQGQVVPATSADVRLWA
FT                   ELENGERLEGESCIGQANSPIVRLGCTPSRPAALPRALEAIAHADMIVLGPGSLYTSLL
FT                   PNLLVPELVEAISRSQAPRLYICNLMTQPGETDGLDVSGHLRAIESQLASIGVQQRLFD
FT                   AVLAQDTLPSGPELDYYRARGAEPVDCDLDGLKQEGYRVMLASMQGPQQRSEGRAFKGT
FT                   LRHDSRSLALAVMRFYRAKQKRQIN"
FT   CDS_pept        215923..217029
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="SynRCC307_0217"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27120"
FT                   /db_xref="GOA:A5GQG1"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG1"
FT                   /protein_id="CAK27120.1"
FT                   /translation="MSSDQSRKTALITGITGQDGSYLAELLLEKGYEVHGIKRRASSFN
FT                   TDRIDHLYQDPHENDPRLVLHYGDLTDSTNLIRIVQQVQPDEIYNLGAQSHVAVSFESP
FT                   EYTANSDALGTLRILEAVRILGLTNKTRIYQASTSELYGLVQEIPQKESTPFYPRSPYG
FT                   VAKLYAYWITVNYRESYGMYACNGVLFNHESPRRGETFVTRKITRGLARIDAGLDDCLY
FT                   MGNLDSLRDWGHARDYVEMQWRMLQQDKPEDFVIATGRQESVRCFIELTALELGWGAMQ
FT                   WEGKGIDEVGCRADTGDVVVKIDPRYFRPAEVETLLGDPTKAKEKLGWTPTTTLEELVA
FT                   EMVATDKEEAQKEAYLKRKGFNVVGARE"
FT   CDS_pept        217026..218024
FT                   /transl_table=11
FT                   /gene="wcaG"
FT                   /locus_tag="SynRCC307_0218"
FT                   /product="GDP-L fucose synthetase"
FT                   /EC_number="1.1.1.271"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27121"
FT                   /db_xref="GOA:A5GQG2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG2"
FT                   /protein_id="CAK27121.1"
FT                   /translation="MTLIQPTDRFAIFGARGMAGSAISRALGRQGYQDQLLPSRQQLDL
FT                   LDGGSVDQWMATNKPDVVVLAAAKVGGILANNTYPADFLLENLKIQTHVIESAWRHGVR
FT                   RLLFLGSSCIYPKLAKQPIREESLLKGDLEPTNEWYAIAKIAGIKLCESLRKQYGFDAI
FT                   SLMPTNLYGPGDNYHPQNSHVLPALIRRFHEAVQADATSVTCWGSGSPLREFLHVDDLG
FT                   DACVFALERWSALAANAPKDQSGDALAFLNVGTGVDCTIKQLAEQVAAATGFVGEIQWD
FT                   TSKPDGTPKKQLDVSRLQAMGWSARIPLNQGIPMAFQDFKQAEAAQLVRSK"
FT   CDS_pept        218127..218912
FT                   /transl_table=11
FT                   /gene="SynRCC307_0219"
FT                   /locus_tag="SynRCC307_0219"
FT                   /product="ABC-type transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27122"
FT                   /db_xref="GOA:A5GQG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG3"
FT                   /protein_id="CAK27122.1"
FT                   /translation="MTQASSAVVEMRGLSLLRGNRVILDDIDLRLEAGQSLAVVGPSGA
FT                   GKTTILRLLAGLEMPSAGELHLFGRRQDYLRLDQHLPPDVRLVSQNPALLGSLSVLHNV
FT                   GFLLYRGGLLSDKEIKERVARCLEAVGLAGTEDLMPAELSGGMQKRVSFARAMIDDPAA
FT                   DSANPLLLFDEPTAGLDPVASTRIEDLMVTTTRLSRGTSVVVSHVLSTIERSAEQVVLL
FT                   YDGKLRWQGSVEAFRCSDNPYVVQFRTASLTGPMQPQEL"
FT   CDS_pept        218920..219816
FT                   /transl_table=11
FT                   /gene="SynRCC307_0220"
FT                   /locus_tag="SynRCC307_0220"
FT                   /product="ABC-type transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27123"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG4"
FT                   /protein_id="CAK27123.1"
FT                   /translation="MRRSVREATIGFSLLAALVGGLGLWFWLTGVVFGQKTYSIRLRFQ
FT                   DAAGLAPQSVVTYQGVPVGSVHSVTPEAGWVAVEAKINDRSLKLYRPITAQIRSGSLLG
FT                   GDPQVALDTQATIPASDTSGGPTSSTCNPTRIVCEGGLIKGEVTPSLTTVMGLMERILT
FT                   QADQDKLISKGATTLTALTKTSEDFSALAEKAEGLVAELQSAVENAGPVIDNLDSATAH
FT                   ASNVLGALDNPKSLNELKKTVSNAEQLTRRIDVISGDIQQLTSDPNVINGFRSVSIGLG
FT                   KFFDELYPSIKPETTDD"
FT   CDS_pept        complement(219817..221778)
FT                   /transl_table=11
FT                   /gene="chlD"
FT                   /locus_tag="SynRCC307_0221"
FT                   /product="Protoporphyrin IX Mg-chelatase subunit ChlD"
FT                   /EC_number="6.6.1.1"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27124"
FT                   /db_xref="GOA:A5GQG5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG5"
FT                   /protein_id="CAK27124.1"
FT                   /translation="MLPVFPLAAVTGHPTLKLALLLAAIDPGLGGVVIAGGRGTGKSVL
FT                   ARGLHALLPAIEILEGSWNEEPDGVNPSKVIPAPFVQIPLGVTEDRLVGSVDVTRSLSE
FT                   GRTVFQPGLLAEAHRGVLYIDELNLLDANALNLVLAAVGSGTNQVEREGLSVAHPCRPL
FT                   LIATYNPEEGAVRDHLLDRFAIALSADQTIDSASRVSIAEAAIAYGENAEAFRAQFQEE
FT                   TDALATQLLLARQWLPDVQISREQIAYLVNEALRGGVEGHRAELYALRVARAHAALQGR
FT                   DQVEAEDLQLAVRLVIAPRAKLMPPPDDQQQPPPPPPPPPGDNEEQPDPPESEDNNEEE
FT                   EPDPPEPDEPEDDTPPSVPEEFMLDAEATAIDPELLQFQSAKNRAASSGSRGIVLSESR
FT                   GRYVRPVLPRGPVRRIAVDATLRAAAPYQKARRAREPHRKVIVQDGDLRAKQLQRKAGA
FT                   LVIFLVDASGSMALNRMQSAKGAVLRLLTEAYENRDEVALIPFRGEQAEVLLPPTRSIT
FT                   AAKRRLETMACGGGSPLAHGLAQAARVGNNALQTGELSQVVVVAITDGRGNVPLGRSLG
FT                   QPELEGEPPVDLKQELKDVASRYAQLGLQLLVIDTERKFIGSGMGKELAAAAAGRYVQL
FT                   PKASDQAIAAVALEALNR"
FT   CDS_pept        complement(221797..224151)
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="SynRCC307_0222"
FT                   /product="UvrD/REP helicase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27125"
FT                   /db_xref="GOA:A5GQG6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG6"
FT                   /protein_id="CAK27125.1"
FT                   /translation="MSFLAGLNDAQRRAVDHHEGPLLVVAGAGSGKTRALTHRIAHLIG
FT                   EHGADPAQILAVTFTNKAAREMKERLQLLLAQKLAQSQFGQPWGTLPAVEQRQLRSRIE
FT                   REVIKELWIGTFHALFSRLLRFDIDKFKDPEGLCWTKQFSIYDEADAQSLVKEIVTQEL
FT                   QLDPKRVEPKKIRWAISNAKNQGWLPDQLEANSEGQRGKLTADVYRRYRKALAANNALD
FT                   FDDLLLLPVQLLQQNEQVRSYWHRRFRHVLVDEYQDTNRTQYDLIKLLVTGGQDPQLYN
FT                   EWNGRSVFVVGDADQSIYSFRAADFTILMGFQQDFGDQAADDATRTMVKLEENYRSTAT
FT                   ILEAANALIANNSERIDKVLRPTRGEGELISLTRCDDEIAEAEAVVHRMRMLDAAHPEL
FT                   SWGSMAVLYRTNAQSRAIEESLVRWRIPYVVVGGLRFYDRREIKDVLAYLRLLINPADS
FT                   VSLLRVINVPRRGIGKTTIQRLNDAANQLAIPLWDVVSDGEAVRSLGGRSAKGLLQFCE
FT                   LINGLREQAQVAPPSELIQQVLEKSGYLRELITEATDEAEERRRNLQELVNAALQYQEE
FT                   NEEGDLEGFLASAALASDADSKDTAADRVTLMTLHSSKGLEFPVVCLVGLEQGLFPSYR
FT                   SLDDPASLEEERRLCYVGITRAKERLFLSHASERRLWGGMREPAVPSIFLAELPEALVQ
FT                   GDIPRSGGAALRREQRLERLTRVDRAEAQPKARVSAARSWSVGEKVIHANFGEGEVTHT
FT                   FGSGEKISIAVKFIGMGSKILDPRLAPIEPA"
FT   CDS_pept        224187..224717
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SynRCC307_0223"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27126"
FT                   /db_xref="GOA:A5GQG7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG7"
FT                   /protein_id="CAK27126.1"
FT                   /translation="MPLCRKTSAVALGSNLGDSLELLSTAAQALQQLAAAGSFRCSPLF
FT                   RTAPVGGPVDQPDFINAVVLLDWQDTPEQLLQQLQQLEAAAGRQRLIANGPRSLDLDLL
FT                   WCGMEQRCSAFLELPHPRLAQRRFVLQPLAALDPTLVPPGQGLSVSALLARVEQLGEEP
FT                   PPEQLQFPHSWPG"
FT   CDS_pept        224752..225315
FT                   /transl_table=11
FT                   /gene="SynRCC307_0224"
FT                   /locus_tag="SynRCC307_0224"
FT                   /product="NUDIX hydrolase"
FT                   /note="Very low identity with RCC01407"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27127"
FT                   /db_xref="GOA:A5GQG8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG8"
FT                   /protein_id="CAK27127.1"
FT                   /translation="MSPLPAPEPSELLDTVATLAVRKLRMEIQHLRLPTGVEGNYGCIR
FT                   HPGASLAVPVLADGRVVVLRQYRFAVQRRILEFPAGTLEPNEQPQPAMERELQEEAGYS
FT                   ASQWDSLGLLLPCPGYSDEVIHLFLARQLTPVPAPVAGDDDEDIEVVVMQPEELDAALA
FT                   SGDEALDGKSVTAWYRAKQVLGLG"
FT   CDS_pept        225315..226718
FT                   /transl_table=11
FT                   /gene="phr"
FT                   /locus_tag="SynRCC307_0225"
FT                   /product="Deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27128"
FT                   /db_xref="GOA:A5GQG9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG9"
FT                   /protein_id="CAK27128.1"
FT                   /translation="MGPWLFWHRRDLRLADNLGLAAVSAITPEVMGVFVLDPAELEHPT
FT                   MAPARRWFLLESLRELQQRWRQAGSQLLLLEGNPVELLPRLAQQLGAAGVAWNRDVEPL
FT                   VRQRDRELAAALKAIGVRVAADWDQLLVPPEQLKTGGGDPYRVYGPYWRSWEKQPKAKP
FT                   VPAPSELKALLKPDLSGLPVLNEVPVEPWEGADLCPCRPGETAALEQLEHFAARAMEHY
FT                   CEGRNLPGDEGTSTLSAALRAGSLSPRTAWAASLDVWSHCRSDEQRQSVTVWQQELAWR
FT                   EFYQQALFHFPELADGPYRPQWRQFPWEDDPVRLKAWQDGLTGVPIVDAAMRQLVQTGF
FT                   MHNRCRMIVASFLVKDLICDWRHGEAFFMAHEVDGDLAANNGGWQWSASSGMDPKPLRI
FT                   FNPFTQASKFDPEATYIRRWLPELAHINTKDLISGDIGALERRGYPEPIVNHKQQQARF
FT                   KALYAALPR"
FT   CDS_pept        complement(226719..226997)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0226"
FT                   /locus_tag="SynRCC307_0226"
FT                   /product="ranscriptional regulator, luxR family"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27129"
FT                   /db_xref="GOA:A5GQH0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH0"
FT                   /protein_id="CAK27129.1"
FT                   /translation="MVLPGPRNSGSYQAKIHLSERELEIIELVAAELTNQEIALRLSIS
FT                   KRTVDNHVSNIFTKTGSRNRVALVNWALSNGKICKDGFNCCNLPDEG"
FT   CDS_pept        227055..227966
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SynRCC307_0227"
FT                   /product="5-10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27130"
FT                   /db_xref="GOA:A5GQH1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH1"
FT                   /protein_id="CAK27130.1"
FT                   /translation="MSNLLASSLEKALASGQPVITAEITPPVGADPSHALEMAEGLRGQ
FT                   VQAFNVTDGSRAVMGMSSLALCRLLLERGLEPILQLGCRDRNRIALQADLLGAHALGIR
FT                   NVLCLTGDPVKAGNQPEARAVFDLESVRLLRQVQQLNGGVGPAGKPLADGAPALFPGAA
FT                   ADPQSASWSGLKSRMRRKAEAGARFVQTQMVMDASALRRFCTEIAAPLNVPVLAGVFLL
FT                   KSAKNAAFINRVVPGAQIPLPLIDRLAAAENPRLEGIRIAAEQVQSYSAIAAGVHLMAV
FT                   KAEESLPQVLELAGLPKVVAQV"
FT   CDS_pept        complement(227931..229118)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0228"
FT                   /locus_tag="SynRCC307_0228"
FT                   /product="Nucleoside-diphosphate-sugar transferase"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27131"
FT                   /db_xref="GOA:A5GQH2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH2"
FT                   /protein_id="CAK27131.1"
FT                   /translation="MKAMILAAGKGTRVQPITHTIPKPMIPILQKPVMEFLLELLRQHG
FT                   FTEVMVNVSHLAEEIENYFRDGQRFGVEIAYSFEGRIEDGELIGDALGSAGGLKKIQNF
FT                   QKFFDDTFVVLCGDALIDLNLSEAVRKHRQSGALATIITKRVPKEKVSSYGVVVTDDDG
FT                   RVKAFQEKPGVEEALSDEINTGIYLFEPEIFEHIPDGVSYDIGSQLFPKLVEKGLPFYA
FT                   LPMDFEWVDIGKVPDYWHAIRSVLQGDIRQVSIPGKQVRPGIYTGLNVAANWDKIEVEG
FT                   PVYVGGMTKIEDGARIIGPAMIGPSCHICAGATIDNSIIFDYSRIGAGVTLAEKLVFGR
FT                   YCVDKTGDHLDVQEASLDWLITDARRLDLVEPSPEQKALAELLGSDLGNNLGEAS"
FT   CDS_pept        complement(229160..230053)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0229"
FT                   /locus_tag="SynRCC307_0229"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27132"
FT                   /db_xref="GOA:A5GQH3"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH3"
FT                   /protein_id="CAK27132.1"
FT                   /translation="MIQAGDSGTRLAIRLLQDAAERGEIEPWDVDVIAVVDGFLDQLRQ
FT                   KLELPRLIASAGGSYEQDLAESSEAFLAASVLVSLKAEHLEASTFQAAEVDDDDVDLLL
FT                   EQLAEDDGDWPALRALPSRPEKLLQRRTVAPPPLQRPVTLGELIRQLEDIGERLEQEGG
FT                   RQPKQRRKRYSDREAIAQVASLAHREKLPETTAALSQFLSRWDVGWEWQQFDGLVAAWA
FT                   AVAPEDLDQDRVGVFWALLFLCSQGRVDLQQDERDLFGPLQLRVRPSEEDQQRQGVLHF
FT                   VPPGSAALPASELKAA"
FT   CDS_pept        complement(230092..230445)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0230"
FT                   /locus_tag="SynRCC307_0230"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27133"
FT                   /db_xref="GOA:A5GQH4"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH4"
FT                   /protein_id="CAK27133.1"
FT                   /translation="MPQINFVLIFVFGLAMVMFTLENTAATTVRFLPGMSTTMPLAVLL
FT                   LIVGGVGATAAWVFAVWTGVTRNITAGEQNQAQQVQIQELQQDVERYRAAMDAQLSMLP
FT                   ASGQSSSGVAEAS"
FT   CDS_pept        complement(230500..232134)
FT                   /transl_table=11
FT                   /gene="ndhD"
FT                   /locus_tag="SynRCC307_0231"
FT                   /product="NAD(P)H-quinone oxidoreductase chain 4"
FT                   /EC_number="1.6.5.3"
FT                   /note="Energy production and conversion"
FT                   /note="N-term extended 48 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27134"
FT                   /db_xref="GOA:A5GQH5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQH5"
FT                   /protein_id="CAK27134.1"
FT                   /translation="MCVKGDAQLAAAAEISTLQPDAAKELDSFPWLTTAILLPIAASLA
FT                   IPLVPDPGNGKGVRWYALGVSLTTFLITVGAYLNGYDPDIAGLQLRQVIPWVPDLGLGW
FT                   SVGADGLSMPLILLTSFITTLACLAAWPVTFKPRLFFFLLLAMDGGQIAVFAVQDMLLF
FT                   FLAWELELIPVYLLLAIWGGKKRQYAATKFILYTAVSSLFILLVALAMAFSGGGPVSFE
FT                   YSDLAAKHLGAGFQALCYAGLLIAFGVKLPIVPLHTWLPDAHGEATAPVHMLLAGILLK
FT                   MGGYALFRFNASMFPDAHVQFAPLLVVLGVVNIIYAALTSFAQRNLKRKIAYSSISHMG
FT                   FVLIGIGSFSPLAASGAMLQMISHGLIGASLFFLVGATYDRTHTLQLDEMGGVGQRMRK
FT                   MFAMWTACSLASLALPGMSGFVSELMVFVGFATDDAYTLPFRIVIDGAAAIGVILTPIY
FT                   LLSMLREIFFGQEKPELSDANLVDAEPREIYIISCLLVPIIGIGLYPKLVTDSYRATIE
FT                   QVVARDESSMKALTAPYLPLRSAPKLS"
FT   CDS_pept        complement(232136..233077)
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="SynRCC307_0232"
FT                   /product="UDP-N-acetylmuramyl
FT                   pentapeptidephosphotransferase/UDP-N-acetylglucosamine-1-ph
FT                   osphatetransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27135"
FT                   /db_xref="GOA:A5GQH6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH6"
FT                   /protein_id="CAK27135.1"
FT                   /translation="MNGLLNLLAAAAACAACWKLLGVLIPQLQQRLLDQPNERSAHSKP
FT                   TPRGGGMAFVLITLLFNSLLLLAGPSPALWIPWICAPLAVVGLLDDRLNLPALLRYGIQ
FT                   ILTAIALLLPTALPTPLWPWLCGPLVVIAVTAVINFVNFTDGLDGLVAGCMTISLGAIA
FT                   INGATGLWPLVGALAGFLIWNWAPAKVFMGDVGSTFLGAVFAGMVLQAGTWPQALALLL
FT                   LATPLLADACLCVIRRAAAGQRIFQAHRLHLFQRLHQAGWPHQNVAGLYVGATAVLAVL
FT                   QLSIGLGGVLVGAVAVIGLGLWLDQKEAVPFA"
FT   CDS_pept        complement(233079..235076)
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="SynRCC307_0233"
FT                   /product="NAD(P)H-quinone oxidoreductase chain 5"
FT                   /EC_number="1.6.5.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27136"
FT                   /db_xref="GOA:A5GQH7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH7"
FT                   /protein_id="CAK27136.1"
FT                   /translation="MPSAAEVAWLIPLLPLVGATLVGLGLISFNRTLNRLRTPVAALLI
FT                   SCVGGSAVLSYGVLLEQLNGAAPYEQLFTWASAGTFNLQMGFCVDPLGAVMLALVTTIA
FT                   LLVMVYSHGYMAHDKGYVRFFTYLALFSSSMLGLIVSPNLLEIYVFWELVGMCSYLLVG
FT                   FWYDRDGAAHAAQKAFVVNRVGDFGLLLGILGLFWATGTFDFEGMATGLSTAMADGQVA
FT                   GWAAVALCLFVFMGPMAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLVARLE
FT                   PLYNLFPQVLTVIAVVGTITCFLGASIALTQMDLKKGLAYSTVSQLGYMMLAMGCGAPV
FT                   AGMFHLVTHAFFKAMLFLDSGSVIHAMEEVVGHEPVLAQDMRLMGGLRKKMPITASTFF
FT                   IGCVAISGIPPLAGFWSKDEILGQAFGSFPLLWAVGFLTAGMTAFYMFRLYFLTFEGEF
FT                   RGTDSAVQQQLLAAAGKGDETVHGHASSPHESAWPMTVPLMLLAVPSVLIGLLGTPWNN
FT                   RFAGLLNPAEALEMAEHFSWEEFLPLAGASVAISVAGIGLATAAYALRKVDLGTAVAGR
FT                   FPAINAFFANKWYLDALNDKLFVQGSRKLARQVLQVDSKVVDGVVNLTGLVTLGSGEGL
FT                   KYFETGRAQFYALIVFGGVIGLVVIFGALG"
FT   CDS_pept        complement(235111..235860)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0234"
FT                   /locus_tag="SynRCC307_0234"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27137"
FT                   /db_xref="GOA:A5GQH8"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH8"
FT                   /protein_id="CAK27137.1"
FT                   /translation="MQMHHSSVVMLILLIGFAVLHSGGASLRAWGAEKIGERAWRLLFA
FT                   AVSIPAAVVVIAYFLEHRYDGLRLWNLQDQPWIIPLVWIGTAVSFLFLYPATYNLLEIP
FT                   AVLKPQVRMYATGIIRVSRHPQAVGQILWCATHLLWIGSSFMVVTCVGLIGHHLFAVWN
FT                   GDRRQHNRFGEAFDELKANTSLIPFVAVLDGRQPLPWREFVRPAQLGIAIAVGVFWWAH
FT                   QWIGVAATSFARTGFAHWLDGAYGLMA"
FT   CDS_pept        235914..236897
FT                   /transl_table=11
FT                   /gene="rbcR"
FT                   /locus_tag="SynRCC307_0235"
FT                   /product="RuBisCO operon transcriptional regulator"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27138"
FT                   /db_xref="GOA:A5GQH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH9"
FT                   /protein_id="CAK27138.1"
FT                   /translation="MADLPFTLDQLRILRAIASEGSFKKAADSLYVTQPAVSLQIQNLE
FT                   KQLDVSLFDRGGRKAQLTEAGHLLLSYSERILSQCQEACRALDDLHNLKGGSLIVGASQ
FT                   TTGTYLMPRMIGLFRQKYPDVSVQLQVHSTRRTGWSVANGQIDLAIIGGELPPELMEQL
FT                   QVVPYASEELALVLPVKHPMARLQELQKDDLYRLSFICLDAQSTTRKVVDQLLSRGGLD
FT                   VQRLRIEMELNSLEAIKNAVQSGLGAAFLPVVSIERELASGTLHRGVMADLSVRRQLRL
FT                   ITHPARYCSRASAAFRREILPVFASPDSPLRRAQPSAESAQAPDAA"
FT   CDS_pept        complement(236901..237518)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0236"
FT                   /locus_tag="SynRCC307_0236"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27139"
FT                   /db_xref="GOA:A5GQI0"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI0"
FT                   /protein_id="CAK27139.1"
FT                   /translation="MAPRRPPSRYDDDRYDERDRYERRPPQRGGSGGNKGGGGAGLTFN
FT                   TATIAVLAGILIIGIGIGTSLTSNTSGSQGNIASSEQLDLAVPDPEFCKQWGASAFVMD
FT                   VEMYTTMNPSTSFVTQPKLQPGCVIRRENWAVLQKAGAVTTDQMRDCKQRMNTFAYIGS
FT                   IRDKPIVRCVYQTDAGENKFQNPGIAGAADDTVGITPEADQF"
FT   CDS_pept        complement(237518..237868)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0237"
FT                   /locus_tag="SynRCC307_0237"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27140"
FT                   /db_xref="GOA:A5GQI1"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQI1"
FT                   /protein_id="CAK27140.1"
FT                   /translation="MSDTPLKCTTRHVRIFTATVEDNGELKASSDKLTLDLDPDNEFEW
FT                   DQPVLAKVQQRFAELVDAAAGTELSDYNLRRIGTDLEGFIRQLLQAGELRYNLGARVLN
FT                   YSMGLPRTPETL"
FT   CDS_pept        237901..239301
FT                   /transl_table=11
FT                   /gene="crtD,pds"
FT                   /locus_tag="SynRCC307_0238"
FT                   /product="Phytoene dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27141"
FT                   /db_xref="GOA:A5GQI2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI2"
FT                   /protein_id="CAK27141.1"
FT                   /translation="MVSPQCATGATMRVAIAGAGLAGLSCAKYLSDAGHTPVVVEARNV
FT                   LGGKVAAWQDQDGDWYETGLHIFFGAYPNMLQLFKELNIEERLQWKSHSMIFNQQEVPG
FT                   TYSRFDFPDLPAPINGVAAILGNNDMLSWPEKISFGLGLVPAMLRGQGYVEECDKYSWT
FT                   EWLQLHNIPERVNDEVFLAMSKALNFIDPDEISSTVVLTALNRFLQEKNGSKMAFLDGN
FT                   PPERLCQPMVEHIESKGGEVHLESPLREIELNADGSVAGFRIGGVAGKEPYTLTADAYV
FT                   SAMPVDPFKLLLPEPWKQMPFFSKLDGLRGVPVINIHLWFDRKLTEIDHLLFSRSPLLS
FT                   VYADMSNTCREYEDAERSMLELVFAPAKDWIGRPDEEIVDATMKELERLFPQHFGSENP
FT                   AVLRKSKVVKTPLSVYKTVPNCQPLRPTQKTPVPNFFMAGDYTLQRYLASMEGAVLSGK
FT                   LCAEAVAA"
FT   CDS_pept        239305..240234
FT                   /transl_table=11
FT                   /gene="crtB"
FT                   /locus_tag="SynRCC307_0239"
FT                   /product="Phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27142"
FT                   /db_xref="GOA:A5GQI3"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI3"
FT                   /protein_id="CAK27142.1"
FT                   /translation="MVLSPPAPALGVPALEQAYEDCRVETERWAKTFYLGTLLMPPAKR
FT                   RAIWAIYVWCRRTDELMDSPEAQALPVAELSARLDAWEQRTRELFAGQVRDGLDRVMAD
FT                   VIEHYPQPLEAYLEMIEGQRMDLAKHRYSDFAELKQYCFRVAGTVGLMTQEVMGLDPAY
FT                   TTAPWSERPDTSEAAVALGIANQLTNILRDVGEDRGRGRIYLPQEDLQRFGYSEAELMA
FT                   GTLNENWRALMAFQLERARDWFARSEAGVRWLAPDARWPVWTSLRLYRGILDAIERLNY
FT                   DVFNHRAYVPRVGKLMDLPLSYLIAQAR"
FT   CDS_pept        complement(240231..241160)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0240"
FT                   /locus_tag="SynRCC307_0240"
FT                   /product="Alpha/beta hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27143"
FT                   /db_xref="GOA:A5GQI4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI4"
FT                   /protein_id="CAK27143.1"
FT                   /translation="MPLPPLQHWTWQGEEGIFAVGFRQQSSEGTGAPVLLVHGFGASSD
FT                   HWRANIAPLAEQQPVWALDLLGFGSSDKPRSRLVDEPQGPGSVRYCFDLWAQQVADFAC
FT                   QVVQPQKPLQLVGNSIGGIVALRAAQLLSERGQAPGQVILLNCAQRALDDRRAALLPIW
FT                   ERWSRPMVKRLVRQRWLLQPLFRTVARPLFVRQVLAQAYPSGANVDQDLIELLLRPARQ
FT                   AGAVESFRGFVNLFRDHMAPELLPQLELPVRLLWGTADPWEPIAEARSWAESHSCIQEL
FT                   HELPGVGHCPHDEAPEQVNPVLQRWLAA"
FT   CDS_pept        complement(241173..241607)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0241"
FT                   /locus_tag="SynRCC307_0241"
FT                   /product="RNA-binding protein, RRM domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27144"
FT                   /db_xref="GOA:A5GQI5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI5"
FT                   /protein_id="CAK27144.1"
FT                   /translation="MSTRLYVGNLPQNFDQKELEGMFAAVGAGVRFKAVLDRDTGVCRG
FT                   FGFVNLDDPKLTDAVIEQFNNREYGGNQLRVEVSERRESRGNDRGGDRRRGPGGGPAVA
FT                   RKSVDKVVHSEPADKEAPDPRWAGELSKLKDLLANQKASV"
FT   CDS_pept        complement(241685..242869)
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="SynRCC307_0242"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27145"
FT                   /db_xref="GOA:A5GQI6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI6"
FT                   /protein_id="CAK27145.1"
FT                   /translation="MCRGQDEVMHALSATQAAAQAWEALQPERWPLEPGCFPPGSALVG
FT                   GAVRDALLQRLGPYPDLDLVVPQGAIKLCQRLAKQHRGTAVVLDRERDMARLVLGPWSL
FT                   DLAAQEGPDLISDLQRRDYGINALALPLTPGEALLDPTGGLGDLATRQLRALSEANLLA
FT                   DPLRLLRGPRLAAELNFSLESHTAALIRRHGPALPQVAAERVLAELEKLASCPGGDAGL
FT                   KQASDLGLLQLWERPLTAGEPGSLEVAGLSDEELRTAMPLARLAQRFDGAALGQLKASR
FT                   KLQQRCGMLRHWLQQLSQPLGEAAMLQLCRELEEDLPALVLLAPKATDGWLQRWRDRSD
FT                   PLFHPRSPLDGRTLQRELGLAPGPQLGKLMEQLMLERAFGRPHCIKTAKGLCRD"
FT   CDS_pept        242898..243146
FT                   /transl_table=11
FT                   /gene="SynRCC307_0243"
FT                   /locus_tag="SynRCC307_0243"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27146"
FT                   /db_xref="InterPro:IPR019656"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI7"
FT                   /protein_id="CAK27146.1"
FT                   /translation="MCICVDCQWVDRCKAYHRVETQHGEPHLNAEPNFEPEQPRIHVSL
FT                   RPIENSWGIEWDVRSCSSFALDRGHWQRLRPGAPVPT"
FT   CDS_pept        243143..243739
FT                   /transl_table=11
FT                   /gene="SynRCC307_0244"
FT                   /locus_tag="SynRCC307_0244"
FT                   /product="Inactive homolog of metal-dependent protease,
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27147"
FT                   /db_xref="GOA:A5GQI8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI8"
FT                   /protein_id="CAK27147.1"
FT                   /translation="MSCALALHSCSPALGLALLDGGQSRSIAHPLGRQLANGLFEAVEE
FT                   LLPAARWPQLQWLAVATGPGGFTGTRLTVVLARTLAQQVGCPLWGWGSFELIARRRQQE
FT                   LQGLEACWIGQTLPRRGVVAGRYCWQSQGVVELEAPRLYRQGWSELPGPSWEAEMDAAA
FT                   DALQLLQLGQVAAAAKQPGPWQPVLPIYPTSPVQS"
FT   CDS_pept        243739..244299
FT                   /transl_table=11
FT                   /gene="SynRCC307_0245"
FT                   /locus_tag="SynRCC307_0245"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27148"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI9"
FT                   /protein_id="CAK27148.1"
FT                   /translation="MRRLLRWSVVVLLLWGGWRLLPRLLEPWMPPPQMILVLGGDVERE
FT                   KQAAALARQSNLPVLITGGSNPEYAQWVFEGQGVDAQKLQLDYAARDTLSNFTTLVDRL
FT                   RRRGIRHVLLVTSSDHMDRALLVGRVVAGSRGIHLTPVPVPCGDDCRPERRSKVWGDGV
FT                   RALVWVVSGRDLKEEMQGAPAGR"
FT   CDS_pept        complement(244262..244915)
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="SynRCC307_0246"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27149"
FT                   /db_xref="GOA:A5GQJ0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ0"
FT                   /protein_id="CAK27149.1"
FT                   /translation="MASSALVPSPPPSPTYRVVKWAFVTPLFRLFLRGRCRGMELVPLS
FT                   GPLVVVANHGSHLDPPLLGHALPRPVSFMAKAELFKVPVLGPLIRAMGAYPVSRGASDR
FT                   EAIRTALRRLEEGWATGVFLDGTRKASGRVEDPQLGAALLSARSGAPLLPVALVNTHRA
FT                   FGPKQRWPRPVAVEIRVGHPIEPPASRSRADLDATTAECQLAINALLEHPASPL"
FT   CDS_pept        complement(244917..245810)
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SynRCC307_0247"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27150"
FT                   /db_xref="GOA:A5GQJ1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ1"
FT                   /protein_id="CAK27150.1"
FT                   /translation="MGNAWVFPGQGSQKQGMAAGLADHPLGKERFDLASELLGRDLAAI
FT                   CAGEATGELSDLNDTRNTQPALFVVESCLVDLLHEQGRQAELLAGHSLGELVALYAGGV
FT                   FDARTGIELVIRRSQLMAAAGGGAMTAVMGFERSALDDAVANTPDVVIANDNSDAQVVL
FT                   SGSKEGVDAVVAAVTCKRAVPLAVSGAFHSPFMAEPAAAFAEQLDGLSFADSRVPVLSN
FT                   THPTPCTEGGQLKQRLRAQMTTGVRWRETMQTLAAEGISTTVEVGPGAVLSGLIKRSLK
FT                   GVTPAQINGIESLGQA"
FT   CDS_pept        complement(245846..246847)
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="SynRCC307_0248"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27151"
FT                   /db_xref="GOA:A5GQJ2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQJ2"
FT                   /protein_id="CAK27151.1"
FT                   /translation="MKGIRLCGSGAAVPRLRISNDDLSGRVETSDEWIRTRTGIAARRV
FT                   ADESESLTSLAAAAGKQALERAGWDASSVDLILLATSSPDDLFGSAPKVQALIGAGSAV
FT                   AFDLTAACSGFLFSLVTAAQYLRTGAMTRALVIGADQLSRWVDWDDRRSCVLFGDGAGA
FT                   VAIEACPAENDGLLGFRLNSDGARGDCLTLAQTSERAELLPGMSHQRGGYAPIGMNGQE
FT                   VYKFAVREVPAILKQLLADTNTEPASIDWLLLHQANQRILDAAAERLGIAADKVLSNLA
FT                   NYGNTSAGTIPLMLHEAVSDGRIQSGQLIASSGFGAGLSWGAALLRWDGPTS"
FT   CDS_pept        complement(246844..248061)
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SynRCC307_0249"
FT                   /product="Fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27152"
FT                   /db_xref="GOA:A5GQJ3"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ3"
FT                   /protein_id="CAK27152.1"
FT                   /translation="MAEPQSLPGRTRRPRPRRAIKRLVIWYRRTGPVIRLVNTAHSALG
FT                   PLRLGQTRPGGARAVKGPRLSIAVDGMGGDYAPGPILEGCLGAIEELPLKVMFFAEEKP
FT                   LQAAIKALELQEAVDQAVAKGHLELIASGPSVGMDDEATSVRRKRQASINLAMDRVKAG
FT                   EALAVYSAGNSGAVMAAAIFRLGRLKGIERPAIGALFPTKDVGQQVLVLDVGANTDCKP
FT                   SYLHQFALLGNIYARDVLGVKQPRVGLLNIGEEECKGNELALKTHPLLVEEKRLNFAGN
FT                   CEGRDVLSGEFDVVVCDGFTGNVLLKFLESVGSVLLEVLKAELPRGRRGKVGSAFLISN
FT                   LRRIKKRLDHAEHGGALLLGVDGLCVIGHGSSKARSVMGALRLAHAAASHNTLDNLHRL
FT                   SDEGVG"
FT   CDS_pept        complement(248067..248825)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0250"
FT                   /locus_tag="SynRCC307_0250"
FT                   /product="Two-component system response regulator"
FT                   /note="Signal transduction mechanisms / Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27153"
FT                   /db_xref="GOA:A5GQJ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ4"
FT                   /protein_id="CAK27153.1"
FT                   /translation="MAVAAPAHNGKETILVVDDEASIRRILETRLSMIGYNVVTAADGE
FT                   EALEAFHREPTDLVVLDVMMPKLDGYGVCQELRKESDVPIVMLTALGDVADRITGLELG
FT                   ADDYVVKPFSPKELEARIRCVLRRVEKEHGGGSIPNSGVIQVSDLKIDTNKRQVYRAGE
FT                   RIRLTGMEFSLLELLVSRSGEPFSRGEILKDVWGYTPERHVDTRVVDVHISRLRSKLED
FT                   DPANPELILTARGTGYLFQRIIDGATGEGA"
FT   CDS_pept        248917..250308
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SynRCC307_0251"
FT                   /product="DNA repair protein RadA"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27154"
FT                   /db_xref="GOA:A5GQJ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ5"
FT                   /protein_id="CAK27154.1"
FT                   /translation="MPRTVTTYVCQNCGAQSRQFFGRCSSCGSWNSLVEQTSGPPPDGR
FT                   RRRQSAEAAEPAPRRSEAMAAVGERAVQRLGTGFAELDRVLGGGLVPGSLVLVGGDPGI
FT                   GKSTLLLQTAADLAQRQSVLYVSAEESAQQVKLRWQRLAAAGSDGDGPQLLAETDLEHV
FT                   LQELEALRPDVAVIDSIQALHDADLSSAPGSVAQVRECAASLQRLAKKLDIALLLVGHV
FT                   TKEGMLAGPKVLEHLVDAVLTFEGDRFASHRLLRAVKNRFGATHELGVFEMRDRGLLEV
FT                   SNPSELFLGSPEGSVGMATIVACEGTRPLVVELQALVSTTSYASPRRMATGIGTNRLHQ
FT                   ILAVLEKHLGLPLSRFDCYLAVAGGLEVEEPAADLGVAAAVVASFRDLALPAGTVLVGE
FT                   LGLGGQLRPVGQLELRLQEAARLGFRRAVVPKGSGVSCPELAIEEASGIAEALVAALGV
FT                   NPADD"
FT   CDS_pept        complement(250309..250830)
FT                   /transl_table=11
FT                   /gene="ycf3"
FT                   /locus_tag="SynRCC307_0252"
FT                   /product="Photosystem I assembly protein Ycf3"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27155"
FT                   /db_xref="GOA:A5GQJ6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQJ6"
FT                   /protein_id="CAK27155.1"
FT                   /translation="MPRSQRNDNFIDKSFTVMADLILKVLPTNQKAKEAFAYYRDGMSA
FT                   QGDGEYAEALENYQEALRLEEDPNDRAFILYNMALVYASNGEHNRALEQYEQALALNAK
FT                   MPQVLNNMAVIHHHLGSIAQEKGESDEADRRFDLAADFWSKAIRLAPNNYIEAQNWLKT
FT                   TGRGSADVYL"
FT   CDS_pept        250863..253139
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="SynRCC307_0253"
FT                   /product="Copper-transporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="Copper efflux"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27156"
FT                   /db_xref="GOA:A5GQJ7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ7"
FT                   /protein_id="CAK27156.1"
FT                   /translation="MAPEALLLDIEGMKCGGCVSAVEKRLRAQPGVQEASVNLLSRSAW
FT                   VELEPPATAESLLESLAALGFPGHLRDPDGELERLQQARQQQSWWSCWRQLVVALVLLL
FT                   ISSAGHLSSGGVLADMRLHALVATVALAGPGRPILVRGWKGLAQGVPGMDSLVGLGVGT
FT                   AYLASMVALIWPSVGWSCFFNEPVMLLGFVLLGRFLEARARRRTGAALEELAQLQPETA
FT                   LLLLGDGSTRSIRVGGLRPGDHLRVLPGDRLPVDGVVIDGSSSLDESSLTGEPLPRSVA
FT                   SGDELAAGSLNLQAPLDLKVLRPGSESALARVIALVEQAQARKAPVQAMADRWAGRFTW
FT                   IVMALALATFLFWWLLGSDLFPQVLDGMAHGPGHHRSLGSGAETPFALALQLAIAVLVV
FT                   ACPCALGLATPTAISVATGRAAHLGLLFRGGDVLEVAASVRTVLLDKTGTLTRGRPLLE
FT                   DQLVIADGLDASGLLQLAASLEQTTRHPLAWALLQAAEGQGLNLLSCSSSTTQAGDGVE
FT                   GQLDSQQQLCRLGRLAWLEHHGVHVPAMASAWQQQQEQGGATVLALAHGQELLGLLAVR
FT                   DAMRPDAAEALAQLRSDGLALAVLSGDREGPVRQLGQQLSLQPDQLAWGLRPEHKLQRL
FT                   HQASGPVAMVGDGLNDAPALAAADLGIAVGTGTQIAQDSADLVVLGERLMAVPQALALA
FT                   RSAQAKIRQNLSWAFGYNLLVLPLAAGVLLPGFGLLLTPPLAALLMALSSITVVANALL
FT                   LRAPA"
FT   CDS_pept        253136..253774
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SynRCC307_0254"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27157"
FT                   /db_xref="GOA:A5GQJ8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQJ8"
FT                   /protein_id="CAK27157.1"
FT                   /translation="MRGRFLVLEGIDGCGKTTQLKALADWLPASGLMPSGAQLITTREP
FT                   GGTALGQALRQLLLHPPEEQAPATRAELLLYAADRAQHVQTRLEPALAAGDWVLSDRYC
FT                   GSTAAYQGYGRGLDLDLITQLEQLATAGLQPDLCLWLELSPELAAQRRSGQQQDRIEAE
FT                   GLAFLARVHQGFAELSQRPLWRRVDASLPPEQVHQQVQHLVREGLELAL"
FT   CDS_pept        253771..254703
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="SynRCC307_0255"
FT                   /product="DNA polymerase III delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27158"
FT                   /db_xref="GOA:A5GQJ9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ9"
FT                   /protein_id="CAK27158.1"
FT                   /translation="MSEALFAGIEGQQQALELLTAALNQQRLAPAYLFAGPDGVGRSLT
FT                   ARRFLEGLCAGGAQPDPDLRRRLQQGNHPDLIWVEPTYLEKGERITATEAKERGLSKKT
FT                   LPQIRLEQIREVSRFLARPPLDASRSMVVIEQAEAMAESAANALLKTLEEPGQGLLVLI
FT                   TAAPERLLATILSRCQRIPFKPLPAHTMLQLVGGAQDDPPALVDLAAGSPGALLLWRER
FT                   WAELPPELLAQLQQLPTQPIDALTLAREVCEALDTEQQLWLLQWWQWHLWRQQAQDNVQ
FT                   RRLTKLRRHLVGHVQPRLAWEVALLDLIA"
FT   CDS_pept        complement(254700..255482)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0256"
FT                   /locus_tag="SynRCC307_0256"
FT                   /product="Two-component system response regulator"
FT                   /note="Signal transduction mechanisms / Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27159"
FT                   /db_xref="GOA:A5GQK0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK0"
FT                   /protein_id="CAK27159.1"
FT                   /translation="MKPCILLIEDDRDMRELVAGNLEHSGFDVQKADDGIKGQALALQY
FT                   IPDLIVLDLMLPRVDGLTLCQRLRRDDRTAQIPILMLTALAGTKDKVTGFNSGADDYLT
FT                   KPFELEELLARVKALLRRSDRAPLSSKHSEILSFGPITLVPERFEAIWFDQPVRLTHLE
FT                   FELLHCLLQRHGQTVAPSLILKEVWGYEPDDDIETIRVHIRHLRTKLEPDPRKPRFIKT
FT                   VYGAGYCLELPSGANLDDSSRVMKEFRAERQGNLEQIA"
FT   tRNA            255729..255800
FT                   /locus_tag="RNA_5"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAY"
FT   CDS_pept        complement(255817..256485)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0257"
FT                   /locus_tag="SynRCC307_0257"
FT                   /product="ABC-type transport system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27160"
FT                   /db_xref="GOA:A5GQK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK1"
FT                   /protein_id="CAK27160.1"
FT                   /translation="MIPLAVERLRYRWPNGTSALERCSFSIPGPGLWMLVGGNGSGKST
FT                   LLRLIAGLLEAESGVIQSPGRPALVFQNPDHQLLLPSCGSELAFHLPEETALSTAAIDQ
FT                   ALKQVGLEGMADRPIHSLSGGQKQRLAIASGLLSGAQLLLLDEPTALLDPESQQSVLQL
FT                   IRQLSPPLTALWVTHRLEELERCDGALQLECGVAGPWQSGAELRRKLERQGLPGSAAGR
FT                   "
FT   CDS_pept        complement(256491..256754)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0258"
FT                   /locus_tag="SynRCC307_0258"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27161"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQK2"
FT                   /protein_id="CAK27161.1"
FT                   /translation="MFVVELSLKLSPMPISVQRKSLEAAQGLYGEIRQAMESGHPQLMD
FT                   LRCEKSEEKQICLRSSEIVSVQLYEKSAMGAGSKRPGFSTGG"
FT   CDS_pept        256888..257946
FT                   /transl_table=11
FT                   /gene="psbD"
FT                   /locus_tag="SynRCC307_0259"
FT                   /product="Photosystem II D2 protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27162"
FT                   /db_xref="GOA:A5GQK3"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005868"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQK3"
FT                   /protein_id="CAK27162.1"
FT                   /translation="MTIAVGRAPAGRGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYMAL
FT                   GGWLTGTTFVTSWYTHGIASSYLEGCNFLTAAVSTPADSMGHSLLLLWGPEAQGDFVRW
FT                   CQLGGLWAFVALHGAFGLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLG
FT                   QSSWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTL
FT                   FEDGDGANTFKAFEPTQEEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWT
FT                   SSIGIIGLALNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFI
FT                   FPEEVLPRGNAL"
FT   CDS_pept        complement(258219..259709)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0260"
FT                   /locus_tag="SynRCC307_0260"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27163"
FT                   /db_xref="GOA:A5GQK4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK4"
FT                   /protein_id="CAK27163.1"
FT                   /translation="MRPRLISTRSVWPLLLIGAALRLVNLHAPVLGVHSWRQADTAAIA
FT                   RNAFEAGLPLWLPQVDWGGASSGFAETDPPLYSQAVAWLYGWFGVKEWLARGLSLVLSL
FT                   LALWLLVRLGQRLLGADAGWWGGLLFAVLPLSVFYGRSIQPESLLLACSALALERGLAW
FT                   RHSGHYRDLSLASLGLTGAVLIKVLPALWLGLPLLWLAWLRHGPGLLRRLELWLVAAVV
FT                   LGVTGAWYWHAHQLFLQTGLSFGFWGAGANRYSWGELIGPGYWGNLLLRTSVRGLAVLG
FT                   LPLLVIGLLNKQLKAEARLLPIGLVSVLAAGALAPESSGVHEYYQLPLLLFACPLMGLG
FT                   WVQLWQQAGRRSRRWLTGSMALLLGCSLVVLNLEYWAKEVPDGNPTWELAQRIQRDTPQ
FT                   EARIISVSGGDPTLLYLAHRKGWLKGPGAITESWLKERQAEGATHIAGSWEVIQSYSPF
FT                   PENGAKARLRQLLGPQASHGPNYVVALPLQNDAPGSQP"
FT   CDS_pept        259710..260660
FT                   /transl_table=11
FT                   /gene="SynRCC307_0261"
FT                   /locus_tag="SynRCC307_0261"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27164"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK5"
FT                   /protein_id="CAK27164.1"
FT                   /translation="MPVNLRLLAPQSRRLMLHVGTVKTGSTSLQAYFAEHQQALAEAGW
FT                   CYLPAIGRPDRRDLAAACIAIDDQRDELLRALRLVAPQQRLAFRQQVKAELEEQLKAVP
FT                   DELGVILSSEHFHLSLQRPEEIETLKQLLLELGLEVQQVVIYLREPLALIESLFSTMVR
FT                   SGDQRPLPADPADPFVALICDHRASLQRWRAVFGEAVVQPRAFPPRAGGSLSADFLQLL
FT                   GNAPVAGWPPEPQRQRNRGLNPSALNLLAWLNRHCTWLTPQARFRWQRGLRRLLDGALS
FT                   RWASGSYRMPGPQRSRYGQLYSDGYAAWLRRELPQ"
FT   CDS_pept        complement(260654..261832)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0262"
FT                   /locus_tag="SynRCC307_0262"
FT                   /product="Possible glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27165"
FT                   /db_xref="GOA:A5GQK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK6"
FT                   /protein_id="CAK27165.1"
FT                   /translation="MPPTGLQRRWLASMAVRSYPVTVSSPPLSLSVVLATFNEKDNLGP
FT                   MLEQLKALLGQRYQLELVVVDDDSPDGTSELARQLARQDPRIHLIRRVGRSGLSSAIRE
FT                   GLLAACGDVAVVMDADGQHEPEAVQRAVDRLLAGDLDLVMGSRFHPEASIAGLSASRQK
FT                   GSERANQLARFSLPAYAQLSDYMSGFFALRLDRCNSAIRSVDVSGFKFLYELLAVSKGQ
FT                   LKVEEIPLNFRSRQAGDSKLDNAVVWDWLVSLVHTATFRLLPRRAVSFGMVGVSGMVVH
FT                   VGLYALLRSAGVGFFGTQVVAVITAACSNYLINNSLTFRSRRLRGRSLVIGLLKFLLVS
FT                   SLGMAANVGVSTVVFASLQGGPIAMIAVASGILVDFIWKYAASSRFVWNVPY"
FT   CDS_pept        complement(261769..263391)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0263"
FT                   /locus_tag="SynRCC307_0263"
FT                   /product="Glycosyltransferase of PMT family"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27166"
FT                   /db_xref="GOA:A5GQK7"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK7"
FT                   /protein_id="CAK27166.1"
FT                   /translation="MGVYQETIGPITAVPIRRLGPLFLFWLAALALLLIPGLDLPIRDW
FT                   DEGIVARVAYERGGALLQWLSGQAPFSNIWLPTYWDAPYLNKPPGLHLPASLPLLPWVS
FT                   AGTVPPPWAVRLIPALAASAVVPLAGVITRQLNHKQQGAAVAAAAIALTLLPLMRHGRL
FT                   AMLDGALVSASGLLWWQLLLCRQSRGWRLLGCGLLTGLACSALLLLKAPLVIPVLGIGL
FT                   LLLLLERQLGAQQWLVLFLGLCLGLLPGLGWHLFHWMQRGSDALLLWGGDGASRVLLSA
FT                   GEGSDLGWRIPFLEVLEGGWPWLALWPFAVVLAWKQRHLSAGRWPLGLQLGMAAAVLPL
FT                   RTQLPWYSHILWLPFALLCAPALAQLVESGKPRAVSWLWLLLGLALLPVALLQPEFRTV
FT                   LLPASGALLLGGWGLRPASTIKVQAAGVMVGLWWLGLLLLFSGPLWHWELNEQRPVAAA
FT                   AVLVQSADPTLPIALWGQSERPSLSWQSQRRLQPLSKLGLSNEPLQLLSPPGAPIPEVA
FT                   GQQCRQQGSSEDGWLLWLCAPIP"
FT   CDS_pept        263461..265899
FT                   /transl_table=11
FT                   /gene="SynRCC307_0264"
FT                   /locus_tag="SynRCC307_0264"
FT                   /product="Porin, P stress induced"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27167"
FT                   /db_xref="GOA:A5GQK8"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK8"
FT                   /protein_id="CAK27167.1"
FT                   /translation="MNAFRKLLLAPVVLGLAAPVAAQAQSFDMGNVNRYTQQQDTDRMR
FT                   ALEAQMGQVTSVSQFSDVYPTDWAYQALANLVETYGCVAGYPDGTFKGNIALTRYEAAA
FT                   LLNACLDRVTEITEELKRLMKEFEKELVVLKARVDGLEAQTAELAATQFSTTTKLSGVA
FT                   YFWLGGAVYNDSGYSPIQNAGLAGAEITAYQDAIENNGLAMAPGGALYNYATENAVPPT
FT                   SKFGLGKILTKGATWVGSTGAGGVANTNAYDGNPTTYAGANAANITVASTVNNAVPVTV
FT                   ADLTGGASTGALAVTGLRGNGLNVGTPGLRTNDIPAGIGLTPGNFRKNVIGTTYVQGLD
FT                   KTGVTLGGFELDTVDLGNLIRLGNASRRAKSAVMIGYEDNVVAGSPGFVATDGYTVAAG
FT                   GYFTNTNVYTDPFNLSVAEYGSLGPIQANQKYVKNAARTLLKDLFYGEVALGEAVSFNY
FT                   DTRLDFNTSFTGKDLLRTRLRSGNFQGNTFAGNPFPVTGAEIAFEEGAQGFNVNRLFYQ
FT                   FPVGDSWTVTAGPFVRQDDMLAVWPSQYPAETIMDFFTYAGAPGAYSLNLGAGAGLSYA
FT                   GDILGMDGFAVSANYVANGGNESFSNSSSQSDAALLGGIANENSRGTGTVQIAYTGDDW
FT                   NLTAAYAYNQGGAYGYIPVGTPMAGDPFGGLSNFSVSSVAISGWFAPEDWGRWMPSVSA
FT                   GWGLNGYTANADASVWGISAVDEGDNAESQSWYVGLQWPDVFLQGNYLGTAVGQPTFIS
FT                   SNDSFLESDESTFAWEIWYKFQVTDNIAVTPAYFFIDNPSGLGNGGNVQGGVLKTTFTF
FT                   "
FT   CDS_pept        266168..268957
FT                   /transl_table=11
FT                   /gene="SynRCC307_0265"
FT                   /locus_tag="SynRCC307_0265"
FT                   /product="Porin"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27168"
FT                   /db_xref="GOA:A5GQK9"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK9"
FT                   /protein_id="CAK27168.1"
FT                   /translation="MNLFQQLMLAPAALGLVAPMGAMAGELNFGGVSKYASADEQVTSI
FT                   SQFSDVYPTDWAYQALANLIERYGCVAGYPNGTFQGNRALSRYEAAALLNACLDRVTEI
FT                   TDEVRRLMKAFEKELAVVKARVDGLEAAVGELEATQFSTTTKLKGKVRFIQGSAYRGDG
FT                   YVRFGRLKNVMKAAQLYGIRTYDGSTGGLQDRTVNKIKDGKSNGEAYYYYLRDPDNGAK
FT                   GSVTTQGFTDPTAPASFSLDKQNARQVAFATSWNGVTPANETSGMETRSGVAGSGLYTN
FT                   ANGTIAPVGDTNMLIVPTIAGLGNGSTNANGSTNTVNYAPDRSRMSLYFKDGQRTDNSY
FT                   GVGADQFLISTQGVKSFIGQDSFLRARNFFEQDKFGNTQKLRVQTSNSGSSNYKAKSIQ
FT                   FDKADYGALINLANKARRVKAYDYYVLPNQGTTSINGLTKVTKAAGVPDPVKISDVQRG
FT                   YVAVLPEFTSNAAATTAILSGYNSTGMDDRNGGASFVVAPGGYVQSNTAFNNVSNYLIA
FT                   EYGSLGSAQRNTGYVKKAAQLFVRSLAAYPANKNGVADRNAFTFGHDAQLNFNTSFTGK
FT                   DKLNFRLRSNTIYSFAKRVNAPFADLAFDGSLPENWKGKHKVFVDKLYYKFPVGDWGKV
FT                   SFGTRAPQDSFLPSRGTMYTKDALLEFFNTSAGVFPSYTGTGAGVGISRFGGKKLKIAN
FT                   GTVGFGIGYLTAEGDAANPASYNYLQEGLFGRDTRFRLPVQLAWKSKDKKWLFTANYAY
FT                   ERGNNSMGKVGTELAKNPFGASTLIESNQYGFTLAYKWSKQFQITGAYGGASMNSRYDS
FT                   SILGIDMVNAGDSAQTSSWMIGLNFKDVFIQGNKAGFAIGGVPTVNSNDSGWGTDGSMP
FT                   IALETWYQFQVTDNISVTPGVFWVSGQNDEKTGRYGQVTLEASNGDVWGGIVKTEFKF"
FT   CDS_pept        269055..271070
FT                   /transl_table=11
FT                   /gene="SynRCC307_0266"
FT                   /locus_tag="SynRCC307_0266"
FT                   /product="Conserved hypothetical protein with
FT                   tetratricopeptide repeat domains"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27169"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL0"
FT                   /protein_id="CAK27169.1"
FT                   /translation="MTYSYFSGARALDSALRALFEAGEWRQLIVALDETELDQKNDPEL
FT                   WFLLGKAHRELGQAELGFDAFAKALQLDPVSPLLRLEAVEALLSCNEWALARQLLQQPA
FT                   GAIAAQLPLGRWALARCASRLGEPNQAESQLMGLQADGGLDLERLGVGLSECNLLLGDL
FT                   DRARFCLDRLFELAPHHVDGLLLEVELLRAKPSVDFAGSVDALLSRSPGSRRLQLACAE
FT                   ALFDWKEPDQADDLFQAAIRQHGLAGRLVNGYVRMLVSTYRLDALKQAKQQCNAPYPPL
FT                   QFEILEAKCLIGLNRWAEAIAALQALPMQFSTAYLLCQIYRHSGQFDQSLALALQLPQL
FT                   AGLNPDRGYDAAMELLALGQWQLGWSLYENRFFGASKRFITPAGVEPRMSQELPHAQQV
FT                   IVFSEQGIGDSIMMASMLPDLQAVAADLTVLVQPRLMSLFVHSFPDLRICSSIDESIFR
FT                   SADRCYGLGSLGQFFRPKPEHCPGTPFLAVPDQETLRWRQQLQRLPPGRRVGVAWFGGG
FT                   LVETAQHRSIPLTQLLPLLQVEGVNWVNLQYNHDPTELDQLAREHGVQIHHFEGVTADL
FT                   QATAALTAQLDLVITVQQTAAHIAGAIGTPAWVLLPRSAEWRYGMQGSQMPWYNSVELF
FT                   RQSSPGDWNVPIKAIQSRLGAWLAEPASQNEGQQLS"
FT   CDS_pept        271080..272021
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="SynRCC307_0267"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27170"
FT                   /db_xref="GOA:A5GQL1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL1"
FT                   /protein_id="CAK27170.1"
FT                   /translation="MAIAPDITTLVGRTPLVRLNRLPAEENCKAEIVAKLESFNPTASV
FT                   KDRIGVAMIRDAEAAGRIAPDRTVLVEPTSGNTGIALAMVAAARGYRLILIMPDTMSTE
FT                   RRSMLRAYGAELELTPGSEGMKGAISRARELADELPNAYLLQQFSNSANPAIHAATTAE
FT                   ELWSDTEGRIDALVAGVGTGGTITGCSEVLKQRKPSFQAFAVEPTGSPVLSGGPPGPHR
FT                   IQGIGAGFVPDNYQPSLVDEVLQVDDAEAMVMGRRLARVEGLLSGVSSGAAMAAALKLG
FT                   QRPEMEGKLIVVVLASFGERYLSTPMFTEIGF"
FT   CDS_pept        272021..272689
FT                   /transl_table=11
FT                   /gene="SynRCC307_0268"
FT                   /locus_tag="SynRCC307_0268"
FT                   /product="DnaJ-class molecular chaperone"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27171"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL2"
FT                   /protein_id="CAK27171.1"
FT                   /translation="MTRDPYQVLGVSPSASAAEIKSAYRALVKQHHPDAADGISDDPER
FT                   ILEINAAWELLGDAEARQRFDAGRGERSARATAQARASSGKRRRGAANDAELERWLEQV
FT                   YHPVDRLLGQVLDPFPEQLRELSADPYDDTLMEAFCDYIERSQSKLQTAETLYRSMPCP
FT                   SSAQGFGLSLYHFLSGVQDAVMELERYTAGYVDDYLRDGREMIREACLRRQRIQDQLPA
FT                   "
FT   CDS_pept        complement(272674..272898)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0269"
FT                   /locus_tag="SynRCC307_0269"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27172"
FT                   /db_xref="GOA:A5GQL3"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQL3"
FT                   /protein_id="CAK27172.1"
FT                   /translation="MADALKKGSLIRVNREAYLSSVEAKASAGDPPAYLLEGPGEVLAV
FT                   KGDYAQLRFRQPVPDIWLRMDQLEAYAGS"
FT   CDS_pept        272972..273886
FT                   /transl_table=11
FT                   /gene="SynRCC307_0270"
FT                   /locus_tag="SynRCC307_0270"
FT                   /product="Predicted nucleoside-diphosphate sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27173"
FT                   /db_xref="GOA:A5GQL4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL4"
FT                   /protein_id="CAK27173.1"
FT                   /translation="MRLLLLGCTGLVGRELVPQLLAAGHTLTVVSRQQRQLAGVTCLQA
FT                   DPSRSESWAAGSALQQALAQAEGVVNLAGEPIAEKRWTTAHLEVLRRSRIDTTRHLVAA
FT                   INASPTPPQVLLSASAVGFYGTSETASFNEDSPAGTDVLGKLCSQWEAAAEEVNPGTRL
FT                   VITRIGIVLAADGGALGKMLPIFRAGFGGPIGSGQQWMSWIARADLCGLIAAALTDASL
FT                   QGTYNATAPNPVSMREFCSELGRALRRPSLLPVPGAVLKLLLGDGAEVVLQGQQVLPQK
FT                   LQAQQFAFQAPQLDQAFELSLKS"
FT   CDS_pept        complement(273870..274112)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0271"
FT                   /locus_tag="SynRCC307_0271"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27174"
FT                   /db_xref="GOA:A5GQL5"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL5"
FT                   /protein_id="CAK27174.1"
FT                   /translation="MESLKSWLDRLLVADVFVVIAGAFWFLTAVLCEARGIHQPLAVFQ
FT                   QLWEPLFTPAIGLLMAAAVISGVLGWWQRRTKTSG"
FT   CDS_pept        complement(274112..275284)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0272"
FT                   /locus_tag="SynRCC307_0272"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27175"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL6"
FT                   /protein_id="CAK27175.1"
FT                   /translation="MQLLLLSNGHGEDLSGARLGQALQQQGASVRAVPLVGDGAPYRQA
FT                   ELPIAGRTQSFSTGGLGYASFAGRLKEIVQGQVLYLLKRSWRLLQEARHADGIVVVGDV
FT                   IPVILAWLSGKPVITYLVAYSSHYEGRLRLPWPCGPCLASKRFAAVFSRDALSASDLSE
FT                   QLGRPVEFLGNPFMDGLVALDASERSGRVLLLPGSRLPEARQNLERMLALLEELPAGLR
FT                   HHDFQAALVRELPAAAVEALAASRGWSLSSSTSRSLWLKRKGLVLQCCWGQFTTLLPAA
FT                   QVVVSMAGTASEQAVGLGKPVLQLAGHGPQFTVGFAEAQRRLLGPGVHCAEGDVDDPHT
FT                   LIASADLLEQLLQLPEATLQQLREEGDQRLGQAGGTKRMARAILERLQHA"
FT   CDS_pept        complement(275286..275717)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0273"
FT                   /locus_tag="SynRCC307_0273"
FT                   /product="TPR-repeat protein, specific for cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27176"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL7"
FT                   /protein_id="CAK27176.1"
FT                   /translation="MTEEQPSLSESQFGQALQRYQDGAEAADVIADFEAITRRDPRQAA
FT                   GWTCLAWLQLLTEQPEDALRSAKTAVKLNAQDPQGRLNLALAMLETGAKGVREHIEIVK
FT                   RVMVFSPELGQELEASIADGLQRRPGWPALLKVQAWLAD"
FT   CDS_pept        complement(275760..276143)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0274"
FT                   /locus_tag="SynRCC307_0274"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27177"
FT                   /db_xref="GOA:A5GQL8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL8"
FT                   /protein_id="CAK27177.1"
FT                   /translation="MATETLTHTGKDGKGILITEPAMKQLANLMQQQGSGSVLRVGVRS
FT                   GGCSGMSYTMDFIDAAQIQGDDERYSYEPADAPSFEVVCDPKSLLYIYGMQLDFSTELI
FT                   GGGFNFTNPNASQTCGCGSSFAV"
FT   CDS_pept        276234..277685
FT                   /transl_table=11
FT                   /gene="crtQ, zds"
FT                   /locus_tag="SynRCC307_0275"
FT                   /product="Zeta-carotene desaturase"
FT                   /EC_number="1.14.99.30"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27178"
FT                   /db_xref="GOA:A5GQL9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL9"
FT                   /protein_id="CAK27178.1"
FT                   /translation="MRVAIVGSGLAGLSAAVDLVDAGHSVDLYEARPFMGGKVGSWVDD
FT                   GGNHIEMGLHVFFFNYTNLFALMRKVGAFDNLLPKDHTHLFVNEGGDLRELDFRFALGA
FT                   PFNGLKAFFTTPQLDWIDKLRNALALGTSPIVRGLVDYEGAMRTIRALDRISFSEWFLG
FT                   HGGSPESIRRMWNPIAYALGFIDCEAISARCMLTIFMMFAARTEASKLNLLKGSPHRWL
FT                   TGPIFDYIKARGGQLHLRHRVTAVHHKGDNGTTEVTGLTMGTPDGDVEVEADAYLAACD
FT                   VPGIQRLLPEEWRRFEQFDNIYKLEAVPVATVQLRYDGWVTELGDQPQAAAARADVAHP
FT                   AGLNNLLYTADADFSCFADLALASPEDYRKEGQGSLLQCVLTPGDPWIPRKTEEIVAHT
FT                   DAQVRKLFPSSSGLKLVWSNVVKLAQSLYREAPGMEPYRPDQRTPVSNFFLAGSYTRQD
FT                   YIDSMEGATMSGRLAAKAILNGAGG"
FT   CDS_pept        277687..278133
FT                   /transl_table=11
FT                   /gene="SynRCC307_0276"
FT                   /locus_tag="SynRCC307_0276"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27179"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM0"
FT                   /protein_id="CAK27179.1"
FT                   /translation="MGRWLEHSVAVDIAAPVDLVWAVWSDLESMPLWMRWIESVKTLDD
FT                   PDLTEWTLAAQGFRFQWKARITQRVEAQQLHWQSVGGLPTKGAVRFYPEADERTAVKLT
FT                   VSYELPGVLAPLMDPKILGGLVSKELQANLDRFQELVEERARAR"
FT   CDS_pept        278201..278656
FT                   /transl_table=11
FT                   /gene="SynRCC307_0277"
FT                   /locus_tag="SynRCC307_0277"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27180"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM1"
FT                   /protein_id="CAK27180.1"
FT                   /translation="MLSACGAQTPPQASTPPAAEANKDTANSLPEPTADPQLIPLYDPD
FT                   EVLGSLPRGRQDPFAPPPQALVAAQDDASDSGGDGVPELMGVSSVGGVAQAFVSYGSYS
FT                   GPVAPGDVGDPDRLPWLPTGVGVAGVDVQRGRLLLERDGRPLSPLQL"
FT   CDS_pept        complement(278653..279441)
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="SynRCC307_0278"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27181"
FT                   /db_xref="GOA:A5GQM2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM2"
FT                   /protein_id="CAK27181.1"
FT                   /translation="MPPDLSGHTVVLTRAEHQLGAARKLFEAAGAQVLDLPALVIGPPD
FT                   SWGPLDDALSELEDFHWLVVSSANGVTAVDERLQAQGRSLARRPASLKIAAVGRKTAQQ
FT                   LEDLGATADFIPPDFVADSLLENFPVGVWGQRILLPRVQSGGRTLLAEAFGEAGARVSE
FT                   VAAYESRCPKDLPALTAAALEAGMAEAICFSSGKTVRHTVQLLEAQFGESWNEHISRLA
FT                   VISIGPQTSAVCRELLGHVDAEADPHDLDGLVAACSRALA"
FT   CDS_pept        complement(279431..280627)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0279"
FT                   /locus_tag="SynRCC307_0279"
FT                   /product="Glycosyltransferase of family GT2; modular;
FT                   contains a TPR-repeat domain"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27182"
FT                   /db_xref="GOA:A5GQM3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM3"
FT                   /protein_id="CAK27182.1"
FT                   /translation="MLSLSMIVRDEEQQLGACLESVKGFCDELVVVDTGSTDNTVAIAK
FT                   DAGARVEEIEWPGDFTPARNKALEFVSGEWVLVLDADELLLDDVKPALQALMAQPDVLV
FT                   INLLRYEDGAVQSPYSSVSRLFRKHPAIQWSRAYHSMIDDSVEELLKSESQWRVVDCAE
FT                   PALFHTGYRPEELIAGNKANRLREAMEAELASKPGDPYACAKLGGLEVDQGNTTRGLAL
FT                   LEMGLEHCQSDQHRERYELLLHLGIANSSNKPEEAERYYRLALEEPLSPQVLVGARLNL
FT                   GALLLRLNKLAEATEVTSAVTRQLPEVMLGWYNLGLIQRKAGDIGGAIEAYQSGLQLDP
FT                   NSPELHQNLGAAQLAGGNFEAARSSFLMAIGLLLQQNRKDDAEALARSAGELVNLNAA"
FT   CDS_pept        complement(280681..282240)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0280"
FT                   /locus_tag="SynRCC307_0280"
FT                   /product="Beta-glycosidase of family GH3; possible N-acetyl
FT                   b-glucosaminidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27183"
FT                   /db_xref="GOA:A5GQM4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041518"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM4"
FT                   /protein_id="CAK27183.1"
FT                   /translation="MSLRRQLAQLLVLRASGYALDGQRRYPRWELSNDELQRGLAEGVG
FT                   GVILLGGSAADLALRCRQLQRWAQGPLLLCADVEEGVGQRFDGASWLPPPLGLAKLWNR
FT                   DPTQAEVLATAYGRCTALEARSLGLNWVLGPVCDVNNNPANPVINVRAWGETAEAASAL
FT                   SCCFLVGLQREGVLGCAKHFPGHGDTASDSHLELPLIPHDLERLQRLELLPFEAAIDAG
FT                   AASVMTAHLLLPALDAERPATLSKAVLTDLLRQQLGFNGLVVTDALVMEAIADRYGPGE
FT                   AAALAFDAGADLILMPADAAAALDALEEGFSSGRWPMERLEQSLQRREQALAQSHTSLI
FT                   EPTTAIQELALLQHQHRNLQQQLLAASFEHRGGPLASGGGVNLIRVDNSLQCPALPLNA
FT                   PALIRPQAAGWRPWRIDDQSPPWNLPEEKVLLQLFVRGNPFRAGKNSNENWPEQVQKLI
FT                   QQERLAGLVVYGSPYLWHELQALLPADLPAAYSPGQMPAAQAMALAQLGLVGHAHEGGF
FT                   TD"
FT   CDS_pept        complement(282237..282632)
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SynRCC307_0281"
FT                   /product="Ribosome-binding factor A"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27184"
FT                   /db_xref="GOA:A5GQM5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQM5"
FT                   /protein_id="CAK27184.1"
FT                   /translation="MAHGRRVERVASMIRREMSELLVNGVRDERVNQGMVSITNVVVAG
FT                   DLQHCKVSVSIFGSESEQDQAMAGLRSAAPYLRGELSRRLNMRRTPELVFHHDKGLAQG
FT                   VEVLGLLSKLEEERQERGPVPDGSEEM"
FT   CDS_pept        complement(282636..282899)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0282"
FT                   /locus_tag="SynRCC307_0282"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27185"
FT                   /db_xref="GOA:A5GQM6"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM6"
FT                   /protein_id="CAK27185.1"
FT                   /translation="MAGGRNSACRQSSHGFCEVMGEFFANVTRYPRYLIAFGLGVASSV
FT                   FEPLLARTRNPVTAVALIGALISGLLTLTLVLRAMVTPVPLA"
FT   CDS_pept        282898..283650
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="SynRCC307_0283"
FT                   /product="Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27186"
FT                   /db_xref="GOA:A5GQM7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM7"
FT                   /protein_id="CAK27186.1"
FT                   /translation="MELFQFRHSAFCEKVHLLLAAKGLSYSVNDVTPGVGQIELFQLTG
FT                   QRQVPVLRDGEQLIADSSAIAMHLESKHPEPALLPSDAAQRAEVLLLEDWADTALASSA
FT                   RMALLQGAAEDPVLRGALLPDATPALLRNLIGAVPGDLLGGVGQLLPMGRDSLIFALEQ
FT                   LLTLLEQRPYLVGERPTVADVAVAAQLYLLRFPSVAGPQLASRGVAGVADQPRFEPLFQ
FT                   WRDELYRTLGRRPDGSEASAPVEAMPVG"
FT   CDS_pept        283728..284753
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="SynRCC307_0284"
FT                   /product="Polysialic acid capsule expression protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27187"
FT                   /db_xref="GOA:A5GQM8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM8"
FT                   /protein_id="CAK27187.1"
FT                   /translation="MNPLAPVLQQEAQALLNTAAQLRPDQAEAALDLLQHCSEQGAKLV
FT                   VTGVGKSGIVARKIAATFTSIGLMALYLNPLDALHGDLGVVGAEDVVLLLSNSGESSEL
FT                   LALLPHLHRRGSACIALTGRLDSSLARGAQVVLDGSVDREVCPLNLAPTASTAVAMAIG
FT                   DALAAVWMQRQGITQADFAVNHPAGSLGRQLTLSVADLMVPIDTCPPLPPDAALPEVVD
FT                   QLTGALAGAAWVQQPDQPKRLLGLITDGDLRRALRTHSPQAWASIQAADLMTTDPITAA
FT                   PDQLAVAALELMERNRRKSISVLPVQAVSGELVGLLRLHDLVQAGLSRASGTTTDIPQA
FT                   A"
FT   CDS_pept        284750..285586
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="SynRCC307_0285"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27188"
FT                   /db_xref="GOA:A5GQM9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM9"
FT                   /protein_id="CAK27188.1"
FT                   /translation="MSIPFTLIAGPCVLESPELVFDMAAALKAMSERLGIRLLFKTSFD
FT                   KANRSSGGSFRGPGMEQGLEVLAQLKQELGVQLLTDIHESHQAAVVAQVVDVLQIPAFL
FT                   CRQTDLLLAAAAAVQNPEAAASVVNVKKGQFLAPWDMAQVVSKLREAGLQSPEQLWLTE
FT                   RGTTFGYNTLVVDMRSLPQLRQQGCPVIFDATHSVQQPGGRGSSTGGQREFVAPLARAA
FT                   MAVGVDGLFIETHPDPDQALSDGPNMVPLHRLEPLLEQLLAIRAAAAAQPEAVSSL"
FT   CDS_pept        285583..286116
FT                   /transl_table=11
FT                   /gene="SynRCC307_0286"
FT                   /locus_tag="SynRCC307_0286"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.45"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27189"
FT                   /db_xref="GOA:A5GQN0"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN0"
FT                   /protein_id="CAK27189.1"
FT                   /translation="MSRLSQSLRGLELLVLDVDGVLTDGGLSYAPDGQVWRRFDVRDGL
FT                   GLKLLQQAGITLAVISGGRSGAIERRAQDLGIEHCFTEVRDKQAQLGQLQQQLQVLPAA
FT                   TGFVGDDLNDLVVRSQVGVMAAPADACKALRRQADLVLRRRGGHGAVRELAERILKARG
FT                   EWTALAAGGWRQRN"
FT   CDS_pept        complement(286104..286892)
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="SynRCC307_0287"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27190"
FT                   /db_xref="GOA:A5GQN1"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN1"
FT                   /protein_id="CAK27190.1"
FT                   /translation="MNHPTTVVAIPARLESKRLPRKLLADVGGKPLLQRVLERCLEAQH
FT                   PAAVVLCTDSEELRDKAGQWPLARPVPVVMTPASCSSGSERLACALPELLELAGSNDPA
FT                   HCWVLNVQGDQPFVDPNIIDAMAERCSEARSDVLTPVYRLPPEKIHNPAVVKCLLAHDG
FT                   RCLTFSRSALPHVRDVPPEQWHAHAPYWGHVGIYGYRAEVLAQWNDMPASPLEAIEKLE
FT                   QLKLLEAGIAIGSFPVEADSLSVDTAEQLEEARAIAAQLR"
FT   CDS_pept        complement(286889..287590)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0288"
FT                   /locus_tag="SynRCC307_0288"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27191"
FT                   /db_xref="GOA:A5GQN2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN2"
FT                   /protein_id="CAK27191.1"
FT                   /translation="MQQQPISIFIGMDPRERAATNVLIDSLVDTSSAPLAITPLVTPQL
FT                   EQQKLYWRQRDPKQSTAFSFTRFLVPQLMGFQGWAIFMDCDMLCRADISDLWALRDERF
FT                   AVMCVQHDHQPTEASKFLGETQSAYPKKNWSSLMLLNCSRCQALTPEYVNSASGLDLHR
FT                   FHWLDGDHQIGALPNRWNHLVGVQEPASEEAALLHWTLGGPWFRGQRSMGGTVAAEWFG
FT                   ARDDAMALWDE"
FT   CDS_pept        complement(287680..288318)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0289"
FT                   /locus_tag="SynRCC307_0289"
FT                   /product="Uncharacterized conserved secreted protei"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27192"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN3"
FT                   /protein_id="CAK27192.1"
FT                   /translation="MATSLLGLILALLLPISAAAGPLNLRLEQWPSWQLPAPLPRPRPG
FT                   DDLIYPAWFEGDWQLSSSDGISAEVHFQRRADGAVVGTRAANAMAIGRAVLGEELLEVQ
FT                   DDPGNPNRQLARLSDDRVLDTRISGRRSESPSPNAFLADELSLQLLRQGGAPPRISRIE
FT                   TLSSYELLGPDQISGEQWQASYGSPEDGLAGAARSSQKLSLKLERISAP"
FT   CDS_pept        288293..288571
FT                   /transl_table=11
FT                   /gene="SynRCC307_0290"
FT                   /locus_tag="SynRCC307_0290"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27193"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN4"
FT                   /protein_id="CAK27193.1"
FT                   /translation="MSPSRLVAMSDPLIRELDHYVVLDPAVGEQILSAAETRHWLAEQL
FT                   QRLKQLPADIAAVEGLPQQVEWLIDTACALEIEPGLTVQWFAVRLEP"
FT   CDS_pept        complement(288534..289121)
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SynRCC307_0291"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27194"
FT                   /db_xref="GOA:A5GQN5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQN5"
FT                   /protein_id="CAK27194.1"
FT                   /translation="MHPTDPSQPLGERLQGTNLYLVGMMGSGKSTVGPLLAKALGYRFL
FT                   DADAVISQAAGCSIPEIFERDGEEGFRQLERQVLQQLSQWHSLVVATGGGIVTVPANWG
FT                   ELRQGVVIWLDVAEEELMRRLQADPGGRPLLAGDDPAGRLHGLLEKRQPLYGQADLRVS
FT                   AQGEGASDISERILQQLPGLLKAPGAPQTTAP"
FT   CDS_pept        289136..290041
FT                   /transl_table=11
FT                   /gene="SynRCC307_0292"
FT                   /locus_tag="SynRCC307_0292"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27195"
FT                   /db_xref="GOA:A5GQN6"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN6"
FT                   /protein_id="CAK27195.1"
FT                   /translation="MTILAPQVIGHAATAPHGQGRSCVITRRATFSSSHLYSLPELSAA
FT                   ENQQRFGPCSQAPGHGHNYELIVAMEGGLDANGMVLNLSDVKHAIRSQVTEQLDFRCLN
FT                   TTWPEFDVEGSQQAALPTTEWLLYAIWQRLSTHLPLRSLRLFEQSTLWADYFGNDMEAF
FT                   LTIRGHFAAAHRLAREELSQSENETIYGKCARPHGHGHNYLLDVTVRGQIDPRSGMVCD
FT                   LAALQKLLDDEVLEPFDHTFLNKDVPFFASCVPTAENIALHIADRLKAPIADLGASLHK
FT                   IRLQESPNNAAEIYAEPAQV"
FT   CDS_pept        290038..290688
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SynRCC307_0293"
FT                   /product="Pyrimidine reductase, riboflavin biosynthesis"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27196"
FT                   /db_xref="GOA:A5GQN7"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN7"
FT                   /protein_id="CAK27196.1"
FT                   /translation="MTLRLVLAVSLDGRLAPPAGGAAQLGGAGDRCVLEEALAWADVAV
FT                   VGAGTVRAHGCSCLIHRPELQQQRQSRGQSLQPPLLIASRQATPVGFDPAWRLWGQPLQ
FT                   LWWLSSAPLLAAPPAGFARQLALESWQGLLAQLNAEGHQRVLLLGGAQLAGALLQEDLV
FT                   DELQLTICPLVLGGEHSWLPPSAQPQADRWLLQEQRSLGDGEVLLRYQRKGNS"
FT   CDS_pept        complement(290667..291014)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0294"
FT                   /locus_tag="SynRCC307_0294"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27197"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN8"
FT                   /protein_id="CAK27197.1"
FT                   /translation="MLLPLLILAQTSTPTEDLLMVLRPQLELQMTRECEKAVNSPDGSF
FT                   LNLRSICSEISQPASVCLVEEISQQGSLAQVAREALEGSLGPASLGVASACIERLMQSA
FT                   KPVWDQEFPLR"
FT   CDS_pept        291030..292322
FT                   /transl_table=11
FT                   /gene="SynRCC307_0295"
FT                   /locus_tag="SynRCC307_0295"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27198"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN9"
FT                   /protein_id="CAK27198.1"
FT                   /translation="MTSACSTPQPCDGLIRFCSNSSPTVSESDHSAEALEARWHQQLAE
FT                   IPEQAWDALVASAGLPFYRWAWLEALERSGSIVPSQGWQACHLSLWREQQLIAVAPLYV
FT                   KGHSYGEFVFDQSFAQLAGQLGLRYYPKLLGMSPLSPILGYRFFIASNEEEGACTALML
FT                   RLIDRFCERNQLLSCNFLYVDPAWRPHAEAAGCSAWLNQQSLWSNPGYGSFEDYLASFN
FT                   ANQRRNIRRERKAVQQAGLQVSAIAAEAITPELLERMHGFYEDHCRRWGMWGSKYLTEE
FT                   FFSLAQQLRQHLVLFSAHRHGEDPHQPIAMSLCVREGDHLWGRYWGSTVEIDNLHFEVC
FT                   YYAPIEWAIAQGIRHYDPGAGGSHKRRRGFVARPHASLHRWYEPQFAGLIKRWLPLANA
FT                   QQLEEVEAINAELPFSGRQIPLAPEQGKIEG"
FT   CDS_pept        292336..292722
FT                   /transl_table=11
FT                   /gene="SynRCC307_0296"
FT                   /locus_tag="SynRCC307_0296"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27199"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP0"
FT                   /protein_id="CAK27199.1"
FT                   /translation="MAPLSPQQRRELDDAHSNRTIELDPSGYFLIRVDAAAGELVVQHF
FT                   GNAINDQGLATDPDTGEVLSCRGGGPRAASAEYRGRSAKELGMALTESAEPLPLSRLDH
FT                   ALYLGRELQKAELCLEQGLDYVQD"
FT   CDS_pept        complement(292724..294283)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0297"
FT                   /locus_tag="SynRCC307_0297"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27200"
FT                   /db_xref="GOA:A5GQP1"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034530"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP1"
FT                   /protein_id="CAK27200.1"
FT                   /translation="MRTLFIYPEFPKTFWSYEKILELVNRKVLLPPLGMVTVAALLPQQ
FT                   WEMKLVDRNVREVTEAEWNWAELVIISGMIVQKDDMAVQIANAKERGLPVAVGGPFASS
FT                   TPDAPELDLADFKVLDEGEITLPMFIEAIERGERSGRFSSEGEKPDVTATPIPRFDLLQ
FT                   LDAYDSMSVQFSRGCPFNCEFCDIIVLYGRKPRTKTPEQLVAELQYLYDLGWRRSIFLV
FT                   DDNFIGNKRNAKLLLPEIRKWQEERGYPFSFATEASVDLADDEEMMRMMADCRFESVFL
FT                   GIETPDEASLETARKVQNTRNPLDAAVDRITANGIRVMAGFIIGFDGEKSGAGDRIVEF
FT                   VTRTGIPAAMMGMLQALPKTALWARLEKEGRLIQNEDAAKGVNQTNLLNFVPTRPIREI
FT                   ANEYVDAFCALYEPNAYMDRVYSYYLKMGAPRWKAAAKLPTLVDLRALSIVVWRQGIKR
FT                   STRFRFWRYMVGMAIHNPALLEQFLVVLAHNEHFQEYRGVVTQEIQEQLAELPAKRELQ
FT                   PA"
FT   CDS_pept        294317..294484
FT                   /transl_table=11
FT                   /gene="SynRCC307_0298"
FT                   /locus_tag="SynRCC307_0298"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27201"
FT                   /db_xref="GOA:A5GQP2"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP2"
FT                   /protein_id="CAK27201.1"
FT                   /translation="MWQTLIGFVVGNATSALIPPLTQAAMGIALYLTWVGGFLVTAVVL
FT                   TRLLKGIKLI"
FT   CDS_pept        complement(294487..295713)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0299"
FT                   /locus_tag="SynRCC307_0299"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27202"
FT                   /db_xref="GOA:A5GQP3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP3"
FT                   /protein_id="CAK27202.1"
FT                   /translation="MRQARFSLPAQRNLFLLASGLSTMGSFAGLTAKGWVLMSGTNNPL
FT                   IVALQFAVLALPTLVVSGPAGVLTDRHGCERVLVWAQFGLLGGALVGALAMPLTSGALQ
FT                   AALLLLSTLLVGIASAYELTARNKYCALLVQHPGELGSYLTSFSVVFNVGKLVGPPVGG
FT                   LLVALTGPSLALLLDASTYILPIVSVVWLLQPLREQEQRSQQGESASLWAAWRGCGADL
FT                   RHVLRFTALFCLVGFFHPGLAPVMAADFIGPGPQDLGLFTSVLAAGSITGGVLLQRNSF
FT                   RLSQRPAFLLGSSALLTSLAQLGLGIDGPRAWTLAMAFLIGWGTAVLLSGTNLITQVGA
FT                   SQVLRGRMAGLGQIAFLGGGGISGLLAAGLTMRWGLGATCAVLGAIGLVIAGQELIRHG
FT                   QDRLTLASD"
FT   CDS_pept        complement(295710..297173)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0300"
FT                   /locus_tag="SynRCC307_0300"
FT                   /product="2-methylthioadenine synthetase"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27203"
FT                   /db_xref="GOA:A5GQP4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQP4"
FT                   /protein_id="CAK27203.1"
FT                   /translation="MPAGHGQTAMTREQQPPRFTLNCWADAAMASTATTARPTVAFAHL
FT                   GCEKNRVDTEHMLGLLAQAGYGVSADEADAQVVVVNTCSFIQDARAESVRTLVDLAEQG
FT                   KQIVIAGCLAQHFQEELLESLPEARAIVGTGDYQHIVEVLEQVEAGERVNRVSQVPTFV
FT                   ADENLPRYRTTSEAVAYLKVAEGCDYRCAFCIIPKLRGDQRSRPIESIVAEAQQLAAQG
FT                   VKELILISQITTNYGLDLYGKPQLAELLRALGEVEIPWIRVHYAYPTGLTPEVLAAYRE
FT                   VPNVLPYLDLPLQHSHPEVLRAMNRPWQEGVNGQLLQRIREQLPDAVLRTTFIVGYPGE
FT                   TEEQFEHLLEFVQEQRFDHVGVFCFSPEDGTPAADLPNAVPAEVAEARRGRLMEAQQAI
FT                   SAERNGAWVGRIVDVLVEQENPSSGELIGRCLRFAPDVDGEVRIRAGSHGAAASAGTMV
FT                   PVRITAADIYDLEGEVVGAQEMVDAVRHS"
FT   CDS_pept        297122..297949
FT                   /transl_table=11
FT                   /gene="bptA"
FT                   /locus_tag="SynRCC307_0301"
FT                   /product="Photosystem I biogenesis protein BtpA"
FT                   /note="Missing in Prochlorococcus and in Synechococcus of
FT                   the MC-A cluster"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27204"
FT                   /db_xref="GOA:A5GQP5"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP5"
FT                   /protein_id="CAK27204.1"
FT                   /translation="MVAAAPWSSLFAHDRPALIGVLHLPPLPGSPRWQGDFEAVRRFAL
FT                   ADAAAYLAGGADGLVVENFGDAPFFASAVPSHTVAAMARIAAEVVEAAAGVPVGINVLR
FT                   NDAHAAMGIAAASGASFVRVNVLSGAMLTDQGLIEGRAAELLRLRRQLEATEVGIFADV
FT                   LVKHAYPLAPQPIGEAVEDCLGRAGADGVIVSGVATGAAPDPDDLAAARSAAGSAPVLI
FT                   GSGCHAGNATSLGASADGVIVASSLKRDSLLANPVDPLRVQALRQTLQRCQTS"
FT   CDS_pept        297969..298922
FT                   /transl_table=11
FT                   /gene="SynRCC307_0302"
FT                   /locus_tag="SynRCC307_0302"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27205"
FT                   /db_xref="GOA:A5GQP6"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP6"
FT                   /protein_id="CAK27205.1"
FT                   /translation="MTASRQRPEPPFRRWVRPVMGGLATIGAIDTASITLERWGVIGEL
FT                   ACPGGADGCDKVLNSAWGTVLGQPLALFGFLAYLALVLLSLLPLIPAVQQWLIDRQSSS
FT                   GGLTARRFGRGPDLFWHLGYLLSLGMSVFSAALVGLMLFKIQAICAFCLLSAGLSLALW
FT                   LLHLLGREWEDSGQVLFRSVILVVLVGLLSLAWVASADRPAVLSEKGAPPVVTSVSNPA
FT                   KLALAEHLSSIGARMYSAYWCPHCHEQKELFGQEAAAKLDVIECATDGKNSQASLCQSK
FT                   AIEGFPSWEIKGQIDSGVKSLQKLADLSGYQGPRNF"
FT   CDS_pept        complement(298891..300525)
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="SynRCC307_0303"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27206"
FT                   /db_xref="GOA:A5GQP7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP7"
FT                   /protein_id="CAK27206.1"
FT                   /translation="MFDVPWDVVVIGSGVAGLMSALELPASSRVLLLSRDMSTPPASRW
FT                   AQGGLAAAIGADDSPALHRSDTLAAGAGLCEPAAVDCLVEQAPGCIANLLSLGLNLDRH
FT                   GENLSTTLEAAHSRRRVLHAQDQTGLALVELLEQCIERRPNVTWWRGAIALQLLEEAGR
FT                   CCGVQVLRHGELGWLRSAAVVLATGGSGHLFANTTNPRGAHGDGIAMAWQAGAILRDME
FT                   FVQFHPTALMQPGAPHFLLSEALRGEGARLVQADGQPLFTSGSELLPRDQLSRSMVRAM
FT                   LQQQLAQLWLDLRPVGEAKLIKQFPTILGRCRELGLDPMQVPLPVAPAAHYWMGGIATD
FT                   LDAATTLPGLYAVGEVASSGVHGANRLASNSLSECLVMASQLSRLQPQPNVLVSSGRCQ
FT                   RRPLEWAAPADLEGPCGAPITALRQWSWQAAGVERSGRQLQAALQQCEQLREQLRLDRA
FT                   LAPILQLEPGQSRSLSSSQEQQLGWLWECRQRLQTTVLLLEAAHFRQESRGGHFRCDAP
FT                   ATLPYWQHHSLQQRDQPIRSSAGLDNR"
FT   CDS_pept        complement(300555..300938)
FT                   /transl_table=11
FT                   /gene="psbU"
FT                   /locus_tag="SynRCC307_0304"
FT                   /product="Photosystem II 12 kDa extrinsic PsbU protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27207"
FT                   /db_xref="GOA:A5GQP8"
FT                   /db_xref="InterPro:IPR010527"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQP8"
FT                   /protein_id="CAK27207.1"
FT                   /translation="MSRLFRRLSTLLLCSLLVLGVWLTQPLSVQAAEIRNKVDDKIAET
FT                   AGKVDLNNASVRRFQQYPGMYPTLAGKIVVGGPYDQVEDVLKLDLTERQKELFEKYKEN
FT                   FTVTDPEIALNEGFDRINDGQYR"
FT   CDS_pept        complement(301022..301726)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0305"
FT                   /locus_tag="SynRCC307_0305"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27208"
FT                   /db_xref="GOA:A5GQP9"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP9"
FT                   /protein_id="CAK27208.1"
FT                   /translation="MFTQLLFGAAPVLNPAPQLNAAGVSWKTSAPAMAAALVMLPVFAQ
FT                   APWVRSSPVACALFTAVLVALGLRLRGDLGALLIGFSGSWLAGAVFWGWMRMHPLWHLP
FT                   VEAFALPLAIAGLQGPWRRAGQFYLGALIGTACTDAATALCGLMPLWPQVLQASPSEAP
FT                   LLLSAAAEQVLQPLPLAVVSGFAAAMLAAGRWLWRQGEGGQVVAASLLSTLAVDALFLA
FT                   LALLSPQLSGLV"
FT   CDS_pept        301817..302677
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="SynRCC307_0306"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27209"
FT                   /db_xref="GOA:A5GQQ0"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQQ0"
FT                   /protein_id="CAK27209.1"
FT                   /translation="MDAAAELTLLEACWRTVVLGIVQGLTEFLPISSTAHLKVVPVLAG
FT                   WGDPGVAVTAVIQLGSIAAVIGYFRSDLLQVCRGLARALREGDWGSPDARLGIAIAVGT
FT                   LPVVVAGLLIKLFWPGYETSPLRSVASIGIVSIVMALLLALAERLGQRRKQLPSVQGLD
FT                   GVVVGLAQALAIIPGVSRSGSTLTASLLFGWQRSDAARFSFLLGIPAITLAGLVELKGA
FT                   FAEGSVYGPLPMLLGILSAAVVSWLAIAWLLKFLQTNSTWPFVIYRLVFGVVLLALVLA
FT                   NPTLG"
FT   CDS_pept        302693..304072
FT                   /transl_table=11
FT                   /gene="SynRCC307_0307"
FT                   /locus_tag="SynRCC307_0307"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27210"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ1"
FT                   /protein_id="CAK27210.1"
FT                   /translation="MWNEPSDGVPLQADPSAAAPQPAVVATVEPGSIGEELGFQPGDRL
FT                   VAVNGIRPRDLIDLRMLCGEEDLALEVEDPDGTSHHIELEKDADDGLGLGFTEALFDGL
FT                   KQCNNHCPFCFIDQQPPGRRSSLYLKDDDYRLSFLYGSYLTLTNLLPADWQRIERQRLS
FT                   PLFVSVHATNPALRSRLLVNERAGQILDQIAWFQAKRLQIHAQVVVCPGLNDGDALVQT
FT                   LQDLARFGGGDWPAVLSVAVVPVGLTRFRPDGDGLVPVTPAMAQRTIAVVEPLQQQFSQ
FT                   RFGSRWAWLSDEWYLMAGLPLPQRASYEDLPQQENGVGSIRAFLEQLDDATQELPAALP
FT                   KSRSLSWVVGSLVGPSLKPVVERLHQVEGLDLRLQSLPSPYWGCEQVVTGLLTGQDLID
FT                   GLQGKDLGDAVLLPAVLLRQGQPVFLDDLSLEDVQQCLGVPLQVVGGAAEVVAACLHET
FT                   P"
FT   CDS_pept        304111..305931
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="SynRCC307_0308"
FT                   /product="Outer membrane efflux protein"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27211"
FT                   /db_xref="GOA:A5GQQ2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ2"
FT                   /protein_id="CAK27211.1"
FT                   /translation="MKGRLRSSLLALVLMGSPLAALAQGQEDTTDWLGNPLWTEQPEDI
FT                   GVQPDDSVDPFEGRPLPTAIQEKGPRPKSDPSVVVPAATTLPPDVDELAAPAPLALPNQ
FT                   PAQVRIEDLRPLSLTEAVELMEVNNPFLEALKIRIDEAQSRLRAAIAAWYPTLNLSTNR
FT                   FKFPGRNFGTNYRNFGKPATDAQAAQRKNQKKRQFPDMKLDRYGEWWGTTQTFGASATA
FT                   TLDWKLINPKRVPDVAAARDDYEKAKNNYLITLRDLRLQTAREYFNLQNDDANVLTFRT
FT                   AVQASLINVRDTRAKLQAGVATKLDVLEAETQLARDQSDLSGALRDQSAQRRQLAATLN
FT                   LPQDVTPTASDNLEVLGVWTPSLEESIIASYEFREELDNIILDISIFNSRANSFLGDIQ
FT                   PFLNIAGDARWSKQFGEQRQRDDTVDMGRVAENLDQSIYMGLTWKIFDGGRSQALAREQ
FT                   KQKAKESEYLFARERNEIRQELENQFFDLQKHARNLISDSRQVLSSREAYRLAVLRFQA
FT                   GVGTQRNVIDNQRDVTRAEVDYFTTVVFYNRTLAALRRQTGLDAVVRCTPADLPASPPP
FT                   KDPATDVPVFSTPITEPCEFQRATFVPPAD"
FT   CDS_pept        305937..307325
FT                   /transl_table=11
FT                   /gene="SynRCC307_0309"
FT                   /locus_tag="SynRCC307_0309"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27212"
FT                   /db_xref="GOA:A5GQQ3"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ3"
FT                   /protein_id="CAK27212.1"
FT                   /translation="MGSLRFAALAVRLGLFQACLGALSVLTLGIFNRLLIDEFSVPAAL
FT                   TALALGAQQLVAFTRVWFGQRSDNCRWRGLRRTPFVLCGSLSFCVLFWIAGRTVLWLAE
FT                   ASQAGDGSAVLFRGLVLTVVFLGYGLAISASSTPFAALLVDVTSERQRPALVSVVWSML
FT                   TVGIVAGAILASRFLGTACASTDLNLVIAGVERLIVVAPLVIFGLILLAVVGVERPVDQ
FT                   QSNEAKLAADRPAELSFGQAWTVLRASPQVVYFFGVLSLFTFSLFLQEAVLEPYGGAIF
FT                   GMDVCATTRLNAIWGVGTLVGIASTGFLLVPRLGPQRTALVGGVLAGVFVLLMVVAGAV
FT                   VSEPLFRLALLLFGYAAGVSTNASLTLMLGLTSPALAGTFIGVWGLAQAYARGVATVTG
FT                   GGLLSLFGGVFGGQDTYGAYASVFVIQAVGLLLAGLLLLRVDTTLFQQRVQRALGDLLA
FT                   LELD"
FT   CDS_pept        307325..308119
FT                   /transl_table=11
FT                   /gene="SynRCC307_0310"
FT                   /locus_tag="SynRCC307_0310"
FT                   /product="Inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27213"
FT                   /db_xref="GOA:A5GQQ4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ4"
FT                   /protein_id="CAK27213.1"
FT                   /translation="MATYPHGAHWPALHELVDRVAERQRADFGQIASTVKPDGSLVTDC
FT                   DRWSDATIAAGLAAILPGDGLLSEEGCTDSPTQRHGWIVDPLDGTTNFSVGLPIWAISM
FT                   ARLQDGQPLEAIIDVPPLRERYVAVRGQGVWRNGEPLQPPGGPRHRCNCASLCTRSLPV
FT                   LQKVPGRFPAKTRMLGVASLNLLGVGLGTMLAALEATPKIWDLAAVWLILEELGCVIRP
FT                   LADHPFPMTPGAPLGEASYPLMAACDEEHYQRFLPWGQALVS"
FT   CDS_pept        complement(308116..309111)
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="SynRCC307_0311"
FT                   /product="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27214"
FT                   /db_xref="GOA:A5GQQ5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQQ5"
FT                   /protein_id="CAK27214.1"
FT                   /translation="MQFIDQARIAVKAGRGGDGICAFRREKYVPAGGPSGGDGGRGGDV
FT                   VLQADSNLQTLLDFKYKRLFQADDGRRGGPNRSTGASANTLLIRVPCGTEVRDLGTDLL
FT                   LGDLTDNGEQLMIATGGKGGLGNAHYLSNRNRAPEKFTEGKDGEERELQLELKLLAEVG
FT                   LVGLPNAGKSTLISVLSAARPKIADYPFTTLVPNLGVVRRPSGDGTVFADIPGLIAGAA
FT                   QGAGLGHDFLRHIERTRVLIHLVDGSSPDPIADAQVLLGELEAYGNGLLERPRLLVLSK
FT                   SELLDEEQLEALPAQLSDTLGQPVQVISAVTGQGLDGLLQQVWQELGVSS"
FT   CDS_pept        309187..310401
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="SynRCC307_0312"
FT                   /product="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27215"
FT                   /db_xref="GOA:A5GQQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ6"
FT                   /protein_id="CAK27215.1"
FT                   /translation="MAEVAFRQLRKQYPPRRGSAAVEVLKGIDLEVRDGEFLVLVGPSG
FT                   CGKSTLLRLLAGLEEPSQGQVVVAGRDVSALPPSRRDVAMVFQSYALYPHLSVADNIAF
FT                   GLRRSGHRRLQQQLQDWLARTTGWLRSPREQRIADRVQQVAEMLDLAHLLDRLPKELSG
FT                   GQKQRVALGRAIARQPAVFLMDEPLSNLDAKLRGDTRRQIVQLQRQLGVTTLYVTHDQV
FT                   EAMTMGHRIAVLNAGRLQQLGTPIELYEQPANLFVAQFIGSPPMNLLPVEVLSADQVLL
FT                   AGKRVAADPSLAGLLQGYLGQQLTLGLRPERLRLAPATNRNLPAEVVQLEALGHEQLLS
FT                   CRLLDADHTVQLRTAAEVSVQPGDQCHLEIEAAGWNLFDAAGDALRPKSGDAAVASPDL
FT                   PSLPA"
FT   CDS_pept        complement(310398..312779)
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="SynRCC307_0313"
FT                   /product="Mismatch repair ATPase (MutS family)"
FT                   /note="Low identity with RCC0079"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27216"
FT                   /db_xref="GOA:A5GQQ7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ7"
FT                   /protein_id="CAK27216.1"
FT                   /translation="MEIQAETLALLEWERLGEQVAGFAGSCLGANLCRPLQLAPTLEEA
FT                   QRRQTETTELLVLDGLTEGGLSFQGVSDHSITVQLCSKGGCAGADELLQLADTLAAARR
FT                   LRRQIDDDELRPVTTALLEGLRTLPELEQQLRFAIEEGGRVADRASPPLAGLRRQLQSQ
FT                   RQERQSRLQELMRRWANQLQDSVIAQRHGRPVLAVKAGAAGSLQGQVHDSSASGNTLFI
FT                   EPQAVVGLGNRIAELEAQEQKEERRVLLQLSAAVAAEGDSLMAMQDCLAQLDLGLARAR
FT                   YGAWLGAIKPKLGTESWQLKDLRHPLLVWQERQEAGTAVVPVSLQIEPPLRVVAITGPN
FT                   TGGKTVTLKSLGLATLMARSGLFLPCSGTPQLPWCEAVLADIGDEQSLQQNLSTFSGHV
FT                   RRIARILEALSRLGAAPVPALVLLDEVGAGTDPSEGAALATALLRHLADQVQLSVATTH
FT                   FGELKALKYDDSRFENASVEFDEVSLRPTYRLLWGIPGRSNALAVARRLGLSEAVLGGA
FT                   EQLMDEQGTSSVNTVISGLEEQRQRQQEAAEEAAALLMRAELLHEELQQRWQQEQQQKQ
FT                   ARQGEAQQQLVGSIREGRKEVRQLIRRLRNPKADGEAARQVGQRLRSLEQEHAPESRPQ
FT                   RQHRGWSPAAGDRVRLLSLGKAAEVLSCSDDGQELQVRCGVMRLTVPLTGIEGLQGEKP
FT                   APPEPAPVRIQGRGRRSDSAVRTSRNTVDVRGLRVHEAEAAVEEQLRSVHGPLWVIHGV
FT                   GTGRLKRGLREWLSGLDYIERLVDAEQGDGGAGCTVVWPR"
FT   CDS_pept        complement(312779..313222)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0314"
FT                   /locus_tag="SynRCC307_0314"
FT                   /product="Putative lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27217"
FT                   /db_xref="GOA:A5GQQ8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ8"
FT                   /protein_id="CAK27217.1"
FT                   /translation="MMQPSGCATAEAYCTREWAYCGVAMAVNRLGHVAIRVDDMERAKA
FT                   FYLGLGMRLIWDAEDWAYLGAGNEGLALLGPNYKAAGPHFAFHFDSRDAVQHMHDQLKA
FT                   EGVAVGGLHDHRDGTASFYLRDPEGNWLEMLYEPPGGIPSNQG"
FT   CDS_pept        complement(313191..314192)
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="SynRCC307_0315"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27218"
FT                   /db_xref="GOA:A5GQQ9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ9"
FT                   /protein_id="CAK27218.1"
FT                   /translation="MDIAYRPRRLRRTPGLRAMVREHHVSAADFIYPLFVHEGATNEPI
FT                   GAMPGAQRWSLDGLLGEVGRAWDLGIRCVVLFPKVADGLKTEDGSECFNEGGLIPRAIR
FT                   RIKQEHPGMTVMTDVALDPYSCDGHDGIVSNEGIVLNDETVEILCRQAVTQAAAGADLI
FT                   GPSDMMDGRVGAIREALDDEGYSHVGIISYTAKYASAYYGPFREALDSAPRAAAGKPIP
FT                   NDKSTYQMDPANSREALTEALLDEQEGADIMMVKPGLAYLDIIHRLRAETELPIAAYNV
FT                   SGEYAMVKAAAEKGWIDERAVVLETLLSFKRAGADLILTYHACDAAEWLRHG"
FT   CDS_pept        complement(314219..315169)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0316"
FT                   /locus_tag="SynRCC307_0316"
FT                   /product="DnaJ-class molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27219"
FT                   /db_xref="GOA:A5GQR0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR0"
FT                   /protein_id="CAK27219.1"
FT                   /translation="MSSGGYRDYWKVLGLERGADGDAVKKAFRKLARQHHPDVNPGDKA
FT                   AEARFKEISEAYEVLSDPEKRRRYEQFGQYWNQAGVGSGGPGAGFDVDFGRYGNFDDFI
FT                   NDLLGRFGAGGTPGTPGGFPGGFGGGFGAPPPAANLDAEASIKISLAEAFRGCERTLQV
FT                   NQERVQVRIPGGVKPGSRLRLKGKGNLQPSSGRRGDLYLTINLDSHPLWKLDGDVLRAE
FT                   LPLSPAEAVLGGDVKVPTPDGEAVVTVPAGISSGRSLRLRGKGWPLKAGRGDLLLTVQL
FT                   QLPNQPSEAERQLYQQLRDLPSDNPRDSLFQNSRL"
FT   CDS_pept        315275..315655
FT                   /transl_table=11
FT                   /gene="SynRCC307_0317"
FT                   /locus_tag="SynRCC307_0317"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27220"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR1"
FT                   /protein_id="CAK27220.1"
FT                   /translation="MRRSLWLLPLAAGLVFGSAELPKAQAGNLGDAVEPSNAEQLSLAR
FT                   ELKQAGVIFYGAWWCGACFHQKNLFGTEAGRELPYVECDKDDAGREQCRKAQIKAFPTW
FT                   VLGDQRAEGVMTLPQLRSWAGL"
FT   CDS_pept        complement(315659..315856)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0318"
FT                   /locus_tag="SynRCC307_0318"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27221"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR2"
FT                   /protein_id="CAK27221.1"
FT                   /translation="MRVLLPAALVLSLLVILSASLIRFNYVNRSRQLQLSPFVNRGGYI
FT                   PARQRRKAVRRSTYGVELID"
FT   CDS_pept        complement(315964..316212)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0319"
FT                   /locus_tag="SynRCC307_0319"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27222"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR3"
FT                   /protein_id="CAK27222.1"
FT                   /translation="MRCQAWIHNPQTAHTKRFHRDEKSVPQDPHIFVDSGRPFPGQPPL
FT                   LTTRLHLKAQAAELLWRSLLQGGWRPCAPQWDAEADI"
FT   CDS_pept        complement(316380..316520)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0320"
FT                   /locus_tag="SynRCC307_0320"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27223"
FT                   /db_xref="GOA:A5GQR4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR4"
FT                   /protein_id="CAK27223.1"
FT                   /translation="MHTPMKLDSKQPWGVWAFVIGLNVVGVIGYFILQAKGITLQSIHA
FT                   G"
FT   CDS_pept        316595..317458
FT                   /transl_table=11
FT                   /gene="SynRCC307_0321"
FT                   /locus_tag="SynRCC307_0321"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27224"
FT                   /db_xref="GOA:A5GQR5"
FT                   /db_xref="InterPro:IPR032801"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR5"
FT                   /protein_id="CAK27224.1"
FT                   /translation="MTGNLQAIGFLFTWVLLWCLGGIGIEALLLQVGLIAPGGGSWAGG
FT                   LGFLLWTLLIGFAGWALFNRITGLTQPAPTLQASPWHEVPAPLQPVLAGLAPLANQQRR
FT                   LLLVLSQLGDFDSVEYAQAVMASWPQLREAGVDVRAIGIGDAGSVDRFCDYTGFPKERL
FT                   SVDPEARLHRDLGLYGGAEGFGGPWGNLLAMCAGIGSPGTLREVLRGYHGGGRYLPFWI
FT                   ASIRLRNMVEVLSHWGTYVPDERWMTQRGATFLISSDGSLLYSWKDPGLLGFSASMAEP
FT                   LKFLEL"
FT   CDS_pept        complement(317519..317938)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0322"
FT                   /locus_tag="SynRCC307_0322"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27225"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR6"
FT                   /protein_id="CAK27225.1"
FT                   /translation="MNVFLLLATLVALTPVRANPLVAPPPEASGPRELPAMPKTTAASA
FT                   SQLDPSWEWFKDQTGMYGIKWDGWKDGRYGNRYAAVNDLSPGIGGKLLAVGVNCQAFKI
FT                   AWNQDNGQSKAWTAWEYPISRSVSEQIMLKLCEGN"
FT   CDS_pept        complement(318046..318465)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0323"
FT                   /locus_tag="SynRCC307_0323"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27226"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR7"
FT                   /protein_id="CAK27226.1"
FT                   /translation="MGEAAVGEANYFCAAPKSLRQAFDSCGLSPKERDFLFATVALRRG
FT                   TAARGALAAGLSPESRPSNESPGTFLKVQWNSVVGHACSKLAGQLGWKKPSTGMWIDLL
FT                   VTFERKAAYGLEDAYEEGKESFTWVVRPEWVEALR"
FT   CDS_pept        318748..319008
FT                   /transl_table=11
FT                   /gene="SynRCC307_0324"
FT                   /locus_tag="SynRCC307_0324"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27227"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR8"
FT                   /protein_id="CAK27227.1"
FT                   /translation="MRSTATNPVGEATEVLMALAVERILSKHATSQQRDKARLAMRADL
FT                   ASPGVESCVVGKLGLLHDYAEHLACELINEVLVAGQEPCAD"
FT   CDS_pept        complement(319080..319607)
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="SynRCC307_0325"
FT                   /product="Superoxide dismutase [Cu-Zn]"
FT                   /EC_number="1.15.1.1"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27228"
FT                   /db_xref="GOA:A5GQR9"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR9"
FT                   /protein_id="CAK27228.1"
FT                   /translation="MRLLLSLLLFLSLLVPSMPALAAEQQVWIQRIGGEESGEVLGSVM
FT                   ARDTSDGLVISPSISGLAAGAYGFHLHENGSCESGLKDGVEVAGLAAGGHWDPDNTGSH
FT                   QGPFGVGHRGDLSRLVINADGTSTTPVVAPRLSVDDLKGRAFIVHAGGDTYSDEPPLGG
FT                   GGARIACGVAGE"
FT   CDS_pept        319607..319975
FT                   /transl_table=11
FT                   /gene="SynRCC307_0326"
FT                   /locus_tag="SynRCC307_0326"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27229"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS0"
FT                   /protein_id="CAK27229.1"
FT                   /translation="MEMQADGTGQKIGNAWLDTKTLASGSNHDSFRFSSVLFVAIRTPR
FT                   LVFLPTFEDLLRSKMPPERINTLKWESNGELSAHDVFELVKRLKQQEQPACSSQLLHLV
FT                   NKHRHSSKVKKAAPRAAS"
FT   CDS_pept        320090..320269
FT                   /transl_table=11
FT                   /gene="SynRCC307_0327"
FT                   /locus_tag="SynRCC307_0327"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27230"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS1"
FT                   /protein_id="CAK27230.1"
FT                   /translation="MGDERWVVVNACDVFNNYREVACFYSSDDAFDYIDQHCDEDSHVE
FT                   ERFLPLRRVVMVEP"
FT   CDS_pept        320525..320812
FT                   /transl_table=11
FT                   /gene="SynRCC307_0328"
FT                   /locus_tag="SynRCC307_0328"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27231"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS2"
FT                   /protein_id="CAK27231.1"
FT                   /translation="MGLLAMLQRLIFAAAWLGVALLAASPVQAGSITRSSIWNQAAAMR
FT                   AARSRVPQGAEITDSHCEQISVANDFRWQCTVRFSMSPPSPADTPAAGSD"
FT   CDS_pept        complement(320822..320998)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0329"
FT                   /locus_tag="SynRCC307_0329"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27232"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS3"
FT                   /protein_id="CAK27232.1"
FT                   /translation="MQESTQNLLRLVHDAAFETALKGQFDEDRETVESILQSALNILEG
FT                   KALLAQTGLASQQ"
FT   CDS_pept        complement(321084..321245)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0330"
FT                   /locus_tag="SynRCC307_0330"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27233"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS4"
FT                   /protein_id="CAK27233.1"
FT                   /translation="MLVVPIVERLTSPAGKPPGSVEGWILVETDDAGVSTARLKAAQLI
FT                   DRKQPRLT"
FT   CDS_pept        321263..321481
FT                   /transl_table=11
FT                   /gene="SynRCC307_0331"
FT                   /locus_tag="SynRCC307_0331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27234"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS5"
FT                   /protein_id="CAK27234.1"
FT                   /translation="MKLSFAVCITHPDRREETSFHESVLDAVEDYHSSVLKSALQGWDC
FT                   VALSLCINGQPVEVLESIEPLKNGRPH"
FT   CDS_pept        complement(321478..321657)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0332"
FT                   /locus_tag="SynRCC307_0332"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27235"
FT                   /db_xref="GOA:A5GQS6"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS6"
FT                   /protein_id="CAK27235.1"
FT                   /translation="MLPVFALLIPLLVFGIAFVSLYGQPLEGRLKWLSEHSAQIWIAGM
FT                   VFLITASLIIFLAR"
FT   CDS_pept        complement(321744..322085)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0333"
FT                   /locus_tag="SynRCC307_0333"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27236"
FT                   /db_xref="GOA:A5GQS7"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS7"
FT                   /protein_id="CAK27236.1"
FT                   /translation="MNGRHGSGGASSMGRLWEAVLFIACLVIRLYYSLAMKEAWLKQPN
FT                   GPWVERFWPNPELERDGGARPMAVDLGRHLLLHEPPLLKSRRQLTLSQARELWRNRVKA
FT                   GWKRVEPQW"
FT   misc_RNA        complement(322200..322465)
FT                   /gene="ssrA"
FT                   /locus_tag="RNA_6"
FT                   /product="tmRNA, 10Sa RNA, SsrA"
FT   CDS_pept        322511..323707
FT                   /transl_table=11
FT                   /gene="SynRCC307_0334"
FT                   /locus_tag="SynRCC307_0334"
FT                   /product="Predicted N6-adenine-specific DNA methylase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27237"
FT                   /db_xref="GOA:A5GQS8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS8"
FT                   /protein_id="CAK27237.1"
FT                   /translation="MQDQLWDVIAVVPASLEAEAAAELEAFGAQSLQTLRRAVRCRLDR
FT                   AGFYRAHLQARLPFQLLRLLASFPCSSRAQLYGGVQQAADWQGWLPPQLSFRVEASGRA
FT                   GELNHSHFTALEVKNALVDWQRQHSGQRSDVDLEDPDRVFHLHLGQGRQGPMASLYVAG
FT                   SSSSLHRRGYRAAMGLAPLKENLAAGLMAITGWDGSVPLVDPFCGSATLLIEAVSRVLQ
FT                   RPPGLLPGAALEPAHHAQARRFSCLQWPDADLGLWRSEVVASAEQALAGSQQPLAPVIG
FT                   LEKDPEVLEQARSNVAAAGLEAWIDLRPGDGCELMPPPGPGVLVCNPPYGERLGDEQAL
FT                   DALYHRFGRQLKDHCSGWSLWLLSGNAKLTRALGMKASRRVPVSNGGIDCRWLHYEIR"
FT   CDS_pept        complement(323704..324078)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0335"
FT                   /locus_tag="SynRCC307_0335"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27238"
FT                   /db_xref="GOA:A5GQS9"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS9"
FT                   /protein_id="CAK27238.1"
FT                   /translation="MESQSPRGATGKLASLVVSVMDLHVRIALKEVDREKRRLIVGALL
FT                   MGTALVLLTGALLVAHAALVIVLVEGAALDWLTAFLVVGAIDLVLAGLLLRIGGQLLKG
FT                   PYLPETAAGISRTTRTLLGR"
FT   CDS_pept        complement(324084..324497)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0336"
FT                   /locus_tag="SynRCC307_0336"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27239"
FT                   /db_xref="GOA:A5GQT0"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT0"
FT                   /protein_id="CAK27239.1"
FT                   /translation="MASSGLTQVGERFRERFTELLPEIQERWPQVAHEALTNTRGSFDE
FT                   VVAVIAAQTGRTSAVVQEQLLEFMDVAGEQTRKLGDSLQPLEEQLERLLDDLNANLRPK
FT                   IESPVRERPLLAVGIAAGIGLLAGLILSGGRRR"
FT   CDS_pept        324631..328227
FT                   /transl_table=11
FT                   /gene="SynRCC307_0337"
FT                   /locus_tag="SynRCC307_0337"
FT                   /product="Chromosome segregation ATPase"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27240"
FT                   /db_xref="GOA:A5GQT1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT1"
FT                   /protein_id="CAK27240.1"
FT                   /translation="MVFIDQVSLTHFKSFGGSVTIPLEPGFTVVTGPNGSGKSNILDGI
FT                   LFCLGLASSRGMRAERLPDLINNNALKQGKASEASVSVRFDLRGWQPDTAEDGLEAPEE
FT                   GPWIKAGQTEWTVTRRLRVAPGGTYSTSYSADGVPCNLQQLQTQLRRLRLDPDGSNVVM
FT                   QGDVTRIVSMSARDRRGIIDELAGVALFDSRIEQSRRKLDDVQEREERCRIVEGELEAS
FT                   RTRLERDCQRARLYQDLRQKVQLGRQQEQVLVVEQNRAQLEQLAQNSEQLSGRRESEQQ
FT                   ALIQGQAQLKGAAEELAALQEAVKSLGEDQLIAVQGQLAELEAAGRELQRRAERHQQQA
FT                   SELQQQRHQQQQQRAELQQQSQQLQSTDDVQQRQLADEACRSAEAAVELSRRRLAEVAG
FT                   RSGSWMEEQQERSRRRQELQALLGPQQAEAVQLDERLRQEQERQQELQAELDREQQGNG
FT                   TAAEQLKELQGTQQELLQLIAKHKQRVQELAEALSLQQRTRIRLEQEQQQLERDIARHD
FT                   SRRETLQESRGTGALRLLLEAGLDGIHGLVAQLAEVDDRYRLALEVAAGGRLSQVVVDD
FT                   DRIAARAIELLKQRRAGRLTFLPLNKIRSSARGGGAALQRGGAPSGGGCLGRAVELLHF
FT                   EPIYRDVFGHVFGDTLVYSDLQSARRELGRSRIVTLEGELLERSGAMTGGSLQQRSGSL
FT                   SFGRANDGDEAEPLRRRLLELGETLVASRRREAELSRQLEAAQGEFSSERSRQAGVEAE
FT                   LAAAQRAHGPQVTRQAQLQARLEQVSQSLSSDQTRLQELQASMQPLRQDLEQLEQGEAA
FT                   SSDSADAARWGELQQELEQADAALSAARAQRDGLEAAQRDRGLVLARLNSQLEAVAAED
FT                   QRLQASTAALTAEVQELRDQQLADQARRAELQQQQQALQERFGEQRRARDAAEARLAGL
FT                   RQQQQQREWELQRLAEQIEALAEERRALGERLQQQVAELPDPLPEISDELREAGLEALQ
FT                   EQLRVIQQRMEALEPVNMLALEELEQLEARLAELRERLEVLGNERHELLLRIETVATLR
FT                   QEAFMEAFRAVDGHFRSIFAGLSDGEGELSLENPSDPLEGGLTLVAHPKGKAVRRLASM
FT                   SGGEKSLTALSFLFALQRFRPSPFYALDEVDSFLDGVNVERLAGLIAAQAGDAQFLVVS
FT                   HRRPMIAASTRTIGVTQARGAHTQVVGMPAAA"
FT   CDS_pept        328271..329215
FT                   /transl_table=11
FT                   /gene="SynRCC307_0338"
FT                   /locus_tag="SynRCC307_0338"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27241"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT2"
FT                   /protein_id="CAK27241.1"
FT                   /translation="MQAPPPSDSTPAPSDRLWLRSELMGTQVITTDTGRRLGVVGEVLV
FT                   DIDRREVVALGLRDNPLTRFLPGLPRWMPLEQIRQVGDVILVDSLDSLAEGFNPDRYDR
FT                   VINCQVVSEAGEQLGRVLGFSFDIETGELTTLVVGAVGVPLLGEGILSTWELPVDEIVS
FT                   SGPDRIIVYEGAEEKLKQLNTGLLEKLGIGGGSLEREERERYRLNMVPVENQLPAGVPT
FT                   EQEQRRLEASRQERFEPQRQEDDYEYVELEQRQRREPQRLYMDEERDPYGERDRYAERD
FT                   RYRDRYDAPLDVEPEPLPEPRRGPQPAEEDPWA"
FT   CDS_pept        complement(329217..329627)
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="SynRCC307_0339"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.6"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27242"
FT                   /db_xref="GOA:A5GQT3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQT3"
FT                   /protein_id="CAK27242.1"
FT                   /translation="MDRTIDDPVEASENDWRSKLTPEQFRITREGGTERAFTGAYWNHK
FT                   GDGMYRCICCGAELFRSDRKFDSGTGWPSFWEGVNPEAIRTIQDVSHGMVRTEIRCAKC
FT                   DSHLGHVFQDSPTPTGLRYCVNSASLDFKDKT"
FT   CDS_pept        complement(329611..330894)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0340"
FT                   /locus_tag="SynRCC307_0340"
FT                   /product="Cyanobacteria-specific protein related to lipidA
FT                   disaccharide synthetase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27243"
FT                   /db_xref="GOA:A5GQT4"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT4"
FT                   /protein_id="CAK27243.1"
FT                   /translation="MTSVLRVQVSPSASEPSRAIVLVCNGPGELTTWVRPLAERLHQRA
FT                   LPSTSLQLVLVPCPNATGTEADVARRMNLFDRVLPASRFWWLLLRPQRHGPWPAAGVVV
FT                   FLGGDQFWTVLLSARLGYRHLTYAEWVARWPRWNDRIAAMGPAAADRLAKRWQPRCQVV
FT                   GDLMADLSSSARSSAPLPSGEWVALLPGSKRAKLQVGMPFLLRCAEALRTLRPQTQFLL
FT                   ALAPTTTVAELQAFAGPSNPLQRFYGTQEPELIEQDGQRWLVSSGGARILLVEEHPAHG
FT                   PLSQCALALTTVGANTAELGALGVPMLVLLPTQHLHVMQAWDGWFGLVARLPLLRWLVG
FT                   VALTAWRLRNRGFLAWPNISAGRAVVPERVGAITPEQIASEARDWLAEPQRLRGMQDDL
FT                   RSLRGQPGAVAALSSLVEELLPSVGSNH"
FT   tRNA            330853..330937
FT                   /locus_tag="RNA_7"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUY"
FT   CDS_pept        331042..332391
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SynRCC307_0341"
FT                   /product="Biotin carboxylase (A subunit of acetyl-CoA
FT                   carboxylase)"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.2"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27244"
FT                   /db_xref="GOA:A5GQT5"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT5"
FT                   /protein_id="CAK27244.1"
FT                   /translation="MGIGKLLIANRGEIALRIIRTCREMGISTVAVYSTVDRNALHVQL
FT                   ADEAVCVGDPPSGRSYLNIPNIIAAATSRGADAIHPGYGFLAENDRFAEICSAHGLIFV
FT                   GPSPESIRSMGDKSTAKATMQRVGVPTIPGSEGLLASVDEAARLAGSMGYPVMIKATAG
FT                   GGGRGMRLVRSADELENLFKAAQGEAEAAFGNPGLYMEKFITRPRHVEVQILADRFGNV
FT                   VHLGERDCSIQRRHQKLLEEAPSPGLDPETRRRMGEAAVAAAKTIGYEGAGTVEFLLDA
FT                   SGEFYFMEMNTRIQVEHPVTEVVTGVDLIAQQLKIAAGETLELKQDSIKLHGHAIECRI
FT                   NAEDPRHGFRPSPGTISGWLPPGGPGIRIDSHVYTGYDIPPFYDSLIGKLIVWAEDRPA
FT                   ALLRLRRALSECAVIGVPTTIDFHLALLDRPEFQNAQVHTKFVEQEMLSD"
FT   CDS_pept        complement(332388..332678)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0342"
FT                   /locus_tag="SynRCC307_0342"
FT                   /product="YGGT family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27245"
FT                   /db_xref="GOA:A5GQT6"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT6"
FT                   /protein_id="CAK27245.1"
FT                   /translation="MLSVSSWVIGLLLAAWTLLFLFRIVLTWYPQISSENPLVALVVIP
FT                   TEPLLSPTRKLIQPIGGVDVTPVIWVGLVSLLRELLVGQQGLITQLVLKSA"
FT   CDS_pept        332772..332894
FT                   /transl_table=11
FT                   /gene="psbX"
FT                   /locus_tag="SynRCC307_0343"
FT                   /product="Photosystem II PsbX protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27246"
FT                   /db_xref="GOA:A5GQT7"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023431"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQT7"
FT                   /protein_id="CAK27246.1"
FT                   /translation="MTPSLANFLNSLVAGALIVVVPITIALILISQTDQVDRKL"
FT   CDS_pept        332974..333828
FT                   /transl_table=11
FT                   /gene="SynRCC307_0344"
FT                   /locus_tag="SynRCC307_0344"
FT                   /product="Conserved hypothetical protein with a ycf66
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27247"
FT                   /db_xref="GOA:A5GQT8"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT8"
FT                   /protein_id="CAK27247.1"
FT                   /translation="MVNASLNWASIVGIVLAVGGCVLYFLRSFKPGLARDYDVFFAAVG
FT                   LLCGGILFFQGWRLDPILQFGQFLLASTTVFFAYESVRLRSVTTEQARRSAYFDDDEPV
FT                   PSRPRMGRGEWGGDERFDDPQPLRRRIRSRADGSDDGDERGDQEDFYRPRRPERRAIPE
FT                   RAESRFDEADAEDRGGRGSRERSRYGASTREPRPEFGARRRERDASSTRRSGSRPGGAT
FT                   DDMPRSSRRPSSRPVAAARPDRPSSTSMPEGAPISDADFSPISSRPAPSQPANRDNSSR
FT                   FDD"
FT   CDS_pept        333837..334325
FT                   /transl_table=11
FT                   /gene="SynRCC307_0345"
FT                   /locus_tag="SynRCC307_0345"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27248"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT9"
FT                   /protein_id="CAK27248.1"
FT                   /translation="MRRALLLLVLVLLAGCSQRYSAPGLGDQEDPALSGNGRLLVSVVD
FT                   RGGRRSLRLVERSTGRELPLPGLRQGQPHRSPSLSWTGRYLAFIRQRGTRPEAVLLDRL
FT                   SGRLQPLALPNDRLPERLSLAPDGQQLAVQVLRRGQLDLELFRLPGLEPDLPAGAPLP"
FT   CDS_pept        334322..334801
FT                   /transl_table=11
FT                   /gene="SynRCC307_0346"
FT                   /locus_tag="SynRCC307_0346"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27249"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU0"
FT                   /protein_id="CAK27249.1"
FT                   /translation="MRLLASTLLGLVLLSGCQGLRLQPLMGVNTRLSTPGDDRSPSMAR
FT                   QGVVWIAPGPAGQHQVRWFDLASGMGGPLPGLNRPDAQPISVSVDAKGSRIALVRSLDG
FT                   RTELLLYNRNLASVRPLMLVPAGVPARVALSADGQQLAVQVSRGGRWEVEVMRVP"
FT   CDS_pept        complement(334813..335007)
FT                   /transl_table=11
FT                   /gene="hli"
FT                   /locus_tag="SynRCC307_0347"
FT                   /product="High light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27250"
FT                   /db_xref="GOA:A5GQU1"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU1"
FT                   /protein_id="CAK27250.1"
FT                   /translation="MASAPDSNAAAEQKTSATTSEIPSFGWSGYAERINGRFAMLGFVA
FT                   ILLIEAFSGTTFLHWAGLS"
FT   CDS_pept        complement(335071..337122)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0348"
FT                   /locus_tag="SynRCC307_0348"
FT                   /product="ABC-type uncharacterized transport system
FT                   permease and ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27251"
FT                   /db_xref="GOA:A5GQU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU2"
FT                   /protein_id="CAK27251.1"
FT                   /translation="MVAVRWLGRPDKPFDGENAAMTATVAAGPLQSLRQQLSKLRHLSQ
FT                   PFFLPLDQASGWQFLWLLVSLLFCVGGLVLALLTGIIRSLEQLQPALTEKYFGGVAATI
FT                   SGIWSSWWGIGFVSLFILGAASFVAFRQQLRQRRWLHWLLLGVIVVMLLSVNGINAGIG
FT                   FIARDLTNALVEKQEANFYRILIIYAACFVVALPIRISQFFFTYKLSNIWRDWLSKSLI
FT                   GDYMSNRAYYVLNPNDEQATDVDNPDQRITEDTYAFTFQSLGFTIGIFDALLTFSLNIL
FT                   ILWSISQVLTFSLFGYSAVATTLLILAGRKLVGLQFDQLRYEADFRYGLVHIRDNAESI
FT                   AFYAGEEPESQETRRRLDTVIRNFNLIINWRVIIDVMRRTTNYAGNFFPYLVMAPAFFM
FT                   GEVDYGGFVQASFAYGMVEGSLFFIVNQIEELAKFTAGISRLEGFQSKVEEVSTQPLDP
FT                   SNQIIQSGGGIVIRHADLYTPKGELPVIRDLNLSVNDHERMLVVGPSGCGKTSLMRMIS
FT                   GLWSPRRGTVERPETGDLLFIPQKPYMLLGSLREQLCYPSDEERFSDAQLRSVLEQVNL
FT                   PQLVSRYPDLDIKQDWPRILSLGEQQRLAFGRLLLNSPRYVVLDEATSALDVKTEKLLY
FT                   ELLVERDLAFISVGHRPSLKSFHTNVLQLEGNGDWRLMPAVNYDPEAA"
FT   CDS_pept        complement(337088..337792)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0349"
FT                   /locus_tag="SynRCC307_0349"
FT                   /product="HIT family hydrolase"
FT                   /note="Nucleotide transport and metabolism / Carbohydrate
FT                   transport and metabolism / General function prediction
FT                   only"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27252"
FT                   /db_xref="GOA:A5GQU3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU3"
FT                   /protein_id="CAK27252.1"
FT                   /translation="MTPRWGSAVALLQAVAQPLKAANRSFGVVVQFGAAAGIQALLGFV
FT                   HQISQAVDRIQQIHAGILPIGLQAFADGTATPLRKFLLKLPVQHGNGLTATNYRHTLKR
FT                   PGAFRETCAGLRTGPMAENNPTIFGRILRGEIPAERIHEDEHCIAFADIQPQAPVHLLV
FT                   IPRQHIPSLKEAQPSDSALLGHLLLVAAKVAKEAGLQDWRTVINTGAEAGQTVFHLHVH
FT                   VIGGRPLAWPPG"
FT   CDS_pept        337817..339382
FT                   /transl_table=11
FT                   /gene="SynRCC307_0350"
FT                   /locus_tag="SynRCC307_0350"
FT                   /product="Predicted ATPase with chaperone activity"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27253"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU4"
FT                   /protein_id="CAK27253.1"
FT                   /translation="MLAFCGAAALLGLEAHPVAVEVDLAPGLPGFQLVGLSDASGRDAR
FT                   ERVRSALRNSGFRPPQSRVVVSLAPADLPKQGAGFDLAIALALLVASGQLDPARLQAHW
FT                   AFGELSLDGSLRPVQGVLAVVLAAQQAAASGLILPQANASEAPVLDALPLYPASSLSAV
FT                   VAALQGRASWSSRPQLHPCQPPFVGVDLQQVLGQSQGRRAAELAAAGGHHLLLVGPPGC
FT                   GKTMLASALLGLLPPLDNEQALMVSHIHTMVGLRSAGAPLLHHPPFRAPHHSSTAAALV
FT                   GGGLGPRPGELTLAHHGLLFLDELAEFRRPVLDQLRQPLESGEVLIARAKQALRFPSQT
FT                   LLVGATNPCPCGWWGDPRQGCCCGQHRRQQYWNRISGPLLDRFDLQVSLRSDACASPSS
FT                   SPPEATAVVARRVHRARQRMRQRNPSGRCNGRLTAAQLNGCVQLSPQAEGWWRDERLAH
FT                   LLSGRRRHRLLAVAQTLADLAASPVVEPQHLAEALLFRSLERSVARDGGLDPGLAGRPG
FT                   VAAD"
FT   CDS_pept        339478..339753
FT                   /transl_table=11
FT                   /gene="SynRCC307_0351"
FT                   /locus_tag="SynRCC307_0351"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27254"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU5"
FT                   /protein_id="CAK27254.1"
FT                   /translation="MPVALPTTKPALSTTLASGRLVAVFVGMVPEGLHADERRLVQFFL
FT                   ARVAKGVLDGFAPPGADGMKQVAHGDLLNGLFPVCARQHQKKVPSE"
FT   CDS_pept        complement(339794..339964)
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="SynRCC307_0352"
FT                   /product="30S ribosomal protein S21"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27255"
FT                   /db_xref="GOA:A5GQU6"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQU6"
FT                   /protein_id="CAK27255.1"
FT                   /translation="MTQVTVGENEGIESALRRFKRQVSKAGIFADLKRLRHHETPVEKY
FT                   KRKLQQRRRRR"
FT   CDS_pept        complement(340022..340585)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0353"
FT                   /locus_tag="SynRCC307_0353"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27256"
FT                   /db_xref="InterPro:IPR022222"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU7"
FT                   /protein_id="CAK27256.1"
FT                   /translation="MLSAFRRLAPALVGLASATTALLSQPAQAGLFDAKEVETTQFVLV
FT                   AAPIPSGGAQLNIYEQKKDTRPCFSREGNAPTTVKPLLATFDFTGICGRYMDSNGYSVR
FT                   IGEIDYGSAMRLRVEILEEDIVLMSTGPNGGEVVMARAGGIDDGYVELKLEPGWSLKRR
FT                   HYGERALGHLYVHNESLPIRRDQE"
FT   CDS_pept        complement(340648..340845)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0354"
FT                   /locus_tag="SynRCC307_0354"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27257"
FT                   /db_xref="GOA:A5GQU8"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU8"
FT                   /protein_id="CAK27257.1"
FT                   /translation="MPMKPLAGLFLALACVLGIAATGCVFELAYGDPDLGIGVTRGILI
FT                   GALPGCAGSLLVAIRLNTPA"
FT   CDS_pept        complement(340850..341455)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="SynRCC307_0355"
FT                   /product="Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27258"
FT                   /db_xref="GOA:A5GQU9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQU9"
FT                   /protein_id="CAK27258.1"
FT                   /translation="MSLNFAAMARQSERQASTVMVPKGEEQPESPKIHTLGSNELRKPA
FT                   KRISKVNEQVRELAREMLRSMYAAHGIGLAAPQVGVHQQLLVIDLDPEEAANPPLVLIN
FT                   PEIVATSGALDTYEEGCLSIPGVYLNVVRPSQVDVKYRDELGRPQRRKADGLMARCILH
FT                   EMDHLNGVLFVDRVSDELSLSGELQRLGFDRNDVKPVA"
FT   CDS_pept        341506..343380
FT                   /transl_table=11
FT                   /gene="SynRCC307_0356"
FT                   /locus_tag="SynRCC307_0356"
FT                   /product="Dipeptidyl aminopeptidase family enzyme"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27259"
FT                   /db_xref="GOA:A5GQV0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV0"
FT                   /protein_id="CAK27259.1"
FT                   /translation="MAVRSEAIAALPVDQVMGRDRACKEPLLLGEQLFWAEHRPDQGGR
FT                   TTLMRQVAAGAAPQDLTPGRWSLRSRVHEFGGGLFCASSELAVFIEARSGIPHAVSFSP
FT                   GAQPRPLISGPSDECGRYADGLIDTHRQRWLGVRETTSCDQLVALPLSGGEPQVLRQEA
FT                   DFCGYAALSPAGDQLAWLEWSLPAMPWERTELWCSPIDAAGELSHPQRIAGGDGCAESL
FT                   FQPLWSSAGELLVASDRSGWWTPQRWCPDQQPAWQPLPLPQACETAMPQWVYGMRTMAA
FT                   SESALLALACAQGEWSLWQYPWQQQQWRRIPLPLNELSGLTASSQRAVCLGASATQRTT
FT                   LLELDLAAASHHPLQPAAPLPQGLVRISEPRALEFVGGDGQSSHGWYYPPTTSEAGPAP
FT                   LLVKAHSGPTGMARTGLNLAIQFWTSRGWGVVDVNYGGSTGFGRAYRQRLDGQWGVLDV
FT                   ADCAAAVAHLVELGLVDPQRVAMEGGSAGGFTTLAALIREPVFRAGVCRYPVCDLEALT
FT                   KDTHRFESGYLDGLIGLWPQQRSRYDERSPRSCSHQLHRPVLFIQGLQDRVVPPEQVEQ
FT                   MVQALRWRGLSPELMLLESEGHGFRSTSVQRQVLEATEQFLRRVLPQR"
FT   CDS_pept        complement(343377..344303)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0357"
FT                   /locus_tag="SynRCC307_0357"
FT                   /product="Probable aspartoacylase"
FT                   /EC_number="3.5.1.15"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27260"
FT                   /db_xref="GOA:A5GQV1"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV1"
FT                   /protein_id="CAK27260.1"
FT                   /translation="MVASVLVVGGTHGNECNAPWLLQQWGPSFAALQRPRLKVQTALGN
FT                   PRALQCCRRYIDRDLNRSFRGDLLQAQPSPADQWEVQRARELVQSFGPQGTKPCQVVID
FT                   LHSTTAAMGNSLVVYGRRPADLALAAACQERLGLPIYQHEHDPDQTGFMAEAWPCGLVL
FT                   EVGPVPQGVISPVICQQTQLGLETLLDLLDEASQGHLQLRSPLRVHRHSGSLDLPRDSS
FT                   GQPTSCLHPARLKSDWTPLKPGAPLFQQGDGTVIPFSGEPDQVTVFSNEAAYQEKHIAT
FT                   SLARRVSIPCDPSWSRALSDLLQGVDH"
FT   CDS_pept        complement(344318..345760)
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="SynRCC307_0358"
FT                   /product="NAD/NADP transhydrogenase beta subuni"
FT                   /EC_number="1.6.1.2"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27261"
FT                   /db_xref="GOA:A5GQV2"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV2"
FT                   /protein_id="CAK27261.1"
FT                   /translation="MTAAVVIKYAIELVAVLLLALGIKGLSKVRSARAANQIAAVALAL
FT                   AVLGVLINFLSTSGIDSSAWLWIIGGTVVGGLLGAITSQRVPMTAMPETVALFNGCGGM
FT                   SSLLVALGVALDPLAGSDGEGTGALVAGISIVVSVFVGAITFSGSVVAMGKLQGWLDTP
FT                   AWMQSKLRHVINIGLAAVSLVAAIALIASGGDQGLWLLVIGSSLLGIGVTLSIGGADMP
FT                   VVISLLNSYSGVAAAAAGFVVGSQMLIVAGAMVGAAGLILTQVMCNAMNRSLVNVLFGG
FT                   ALGASASAADQGEYQGITSCSAEECALTLETAQRVVFVPGYGLAVAQAQHILREVAELL
FT                   EAQGIDVAYAIHPVAGRMPGHMNVLLAEADVPYEQLIEMETINPEFPRTDVVIVLGAND
FT                   VVNPQARNDSSSPLYGMPVLNVEEATTVFVVKRGLSAGYAGIKNSLFERPNTSMVFGDA
FT                   KKVLSGLAQELRELGVGKAKVG"
FT   CDS_pept        complement(345760..346080)
FT                   /transl_table=11
FT                   /gene="pntAB"
FT                   /locus_tag="SynRCC307_0359"
FT                   /product="pntAB NAD/NADP transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27262"
FT                   /db_xref="GOA:A5GQV3"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV3"
FT                   /protein_id="CAK27262.1"
FT                   /translation="MNDALSLNDALWVLLLGSLLGLELIGKVPPTLHTPLMSGANAISG
FT                   ITVLAALTLIIKAGSSGNGGLMALGAVSLGFALFNVIGGFLVTDRMLAMFSRKPARQKE
FT                   KR"
FT   CDS_pept        complement(346077..347231)
FT                   /transl_table=11
FT                   /gene="pntAA"
FT                   /locus_tag="SynRCC307_0360"
FT                   /product="NAD/NADP transhydrogenase subunit alpha part 1"
FT                   /EC_number="1.6.1.2"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27263"
FT                   /db_xref="GOA:A5GQV4"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV4"
FT                   /protein_id="CAK27263.1"
FT                   /translation="MVKVLIPREWDAGETRVASSPEVVKRLAGRHVQCSVERGAGRQAG
FT                   FSDEDYAAAGADLVNPGDRATWSQSDIILSVGPLGDNTAALKPGAVVIGQLAPHNNNAL
FT                   LDQLEKGQLSAISLELLPRISRAQAMDVLSSQANIAGYKAVLLAAADLDRFMPMLMTAA
FT                   GTVQPAKVVVIGAGVAGLQAVATARRLGAVVSVSDVRAAAQEQVESLGARFIPPPEQGV
FT                   PGESGGYAKQATMSFLDAQRAGLSEHLNQADVVICTAQVPGRPAPMLITSAMVSAMRPG
FT                   AVIVDLAVIQGGNCELSQAGQTVEHHGVKVIGADRLPGSVAHHASSLYARNLMSLLEAL
FT                   IDQEGVLKLDSEDELLAPSLISLDGNLRRTDLVPERATSSEMTP"
FT   CDS_pept        347273..347578
FT                   /transl_table=11
FT                   /gene="SynRCC307_0361"
FT                   /locus_tag="SynRCC307_0361"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27264"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV5"
FT                   /protein_id="CAK27264.1"
FT                   /translation="MPICVWRWPPESPNLAGVDTLESELIDRAMKSIDEHIAKDENEIL
FT                   AAKAQGDEGKVRHLEGELQDLKVFKEHHPGDNHDPTSLEMFCENNPESPECRIYDD"
FT   CDS_pept        complement(347590..347781)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0362"
FT                   /locus_tag="SynRCC307_0362"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27265"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV6"
FT                   /protein_id="CAK27265.1"
FT                   /translation="MKFFCCYDGEGTLLARCQTMADVEVLRRLGRPVIKVVEMEPEEAV
FT                   VCRMTDAPVSPRAFNEEY"
FT   CDS_pept        complement(347868..348089)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0363"
FT                   /locus_tag="SynRCC307_0363"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27266"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV7"
FT                   /protein_id="CAK27266.1"
FT                   /translation="MPLPDVSASCSSAGDPLGLLQSRLPQVRQRIQQLHGSGDHAGGER
FT                   LFEEYREWLCPNDPHSDLLLMRRLAEGP"
FT   rRNA            348765..350203
FT                   /locus_tag="RNA_8"
FT                   /product="16S rRNA"
FT   tRNA            complement(350401..350474)
FT                   /locus_tag="RNA_9"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUY"
FT   tRNA            complement(350483..350555)
FT                   /locus_tag="RNA_10"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCR"
FT   rRNA            350832..353696
FT                   /locus_tag="RNA_11"
FT                   /product="23S rRNA"
FT   rRNA            353791..353905
FT                   /locus_tag="RNA_12"
FT                   /product="5S rRNA"
FT   CDS_pept        353974..354906
FT                   /transl_table=11
FT                   /gene="SynRCC307_0364"
FT                   /locus_tag="SynRCC307_0364"
FT                   /product="Ribonuclease BN-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27267"
FT                   /db_xref="GOA:A5GQV8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV8"
FT                   /protein_id="CAK27267.1"
FT                   /translation="MSLLQRARHQLQLACQVWNRHGCVDLSAAFAFHSLQSFFPFLLVC
FT                   LGVGARLFGQVDGASDQLLAVAAGVLPPGGLEVMEGILQRLVNQGQVAEQIGGLVLIFS
FT                   ASNATLSLQRGADRLWYGLALPNAGDQAWHWHLRRWFFQRLKAIGAALLLALVLLINQI
FT                   TTPFRLLWSSMWSSLGSLSPWLPQPWEVPARTLISVLGSWLGVVIATVLLFSYLPSRRP
FT                   RLGLLWQGSLLVATGLTLVNPLLGRALVWAGSRFLAYGLVGGIILLTLWIWLLGLILYF
FT                   GMAWTVALTQRRQPQLLLANDAQSAEADL"
FT   CDS_pept        complement(354903..355622)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0365"
FT                   /locus_tag="SynRCC307_0365"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27268"
FT                   /db_xref="GOA:A5GQV9"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV9"
FT                   /protein_id="CAK27268.1"
FT                   /translation="MKTPMARSRPAPNLMAELLDLPVVSAGLRTAQSQGVHWGRQLLEQ
FT                   HADLGRDGMVEHAIRRAMWRTAGTGALAGLGGVLTLPAGGGDLLYFLYAEIELSAAIFT
FT                   VFGVELDDEQHRPILLAAAMGLGVNEMVRLIGSRLGERAARQLLLQLSREASQMLQRLV
FT                   GQRLVTHLARRGWLGLGRLVPLTGALVGGSLNAVLIRTAGEAMRHTAREYKRFLDDHGR
FT                   VDPVDVVVLDINADTAG"
FT   CDS_pept        complement(355603..355953)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0366"
FT                   /locus_tag="SynRCC307_0366"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27269"
FT                   /db_xref="GOA:A5GQW0"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW0"
FT                   /protein_id="CAK27269.1"
FT                   /translation="MNSSQGRQLIYLLLTISGTVLTQRANWQFIQENGGFALGEFIAQA
FT                   GATAAGQSLSWDLVIGATAGVMAMIVEGRRLQMRHLQWPVLASMLIAFAAGAPLFLLMR
FT                   ERHLQQLEDANG"
FT   CDS_pept        complement(355950..356207)
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SynRCC307_0367"
FT                   /product="Exonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27270"
FT                   /db_xref="GOA:A5GQW1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW1"
FT                   /protein_id="CAK27270.1"
FT                   /translation="MAAKAKRQADQGLKDLSYSQAQEQLEQALAQLQSDTLPLEELPQL
FT                   YAQAVALENHCRQKLEQVSQDIQKLDPDGISLSAWSEEEG"
FT   CDS_pept        complement(356207..357361)
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="SynRCC307_0368"
FT                   /product="Exonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27271"
FT                   /db_xref="GOA:A5GQW2"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW2"
FT                   /protein_id="CAK27271.1"
FT                   /translation="MELPAYSVSELNEAIGVLLERGFAPRFLVDGAVVKPVLKKGHLWF
FT                   SLSDGDASIQAVAWASTVARLSFRPNDGDGVRVVGKLNFWGARASLSVQALDIRPSLST
FT                   VLRRFEQVKQQLESEGLLDPALRRQLPQRPSCIAILTSVPSSALADLLRTAKQRWPACN
FT                   LRVVPIPVQGDVEKRICAVFDQLETQWQRLGIEAVVLARGGGSREDLSVFDGEDLARAL
FT                   LRCPVPVVSGIGHEDDVTIADLAADYRAATPTAAMVALLPDRQQEQQLLEQRGRHWRSS
FT                   IQNRLEQELRQWDPELRQDQRRALLQRNLERRQWQLHSQRQLLAALSPQRLLQRGYCLL
FT                   RSSEGQLLRNGSTLSAGDAVEAQLHQGVLSLTVQTWQPETSEVS"
FT   CDS_pept        complement(357361..357534)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0369"
FT                   /locus_tag="SynRCC307_0369"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27272"
FT                   /db_xref="GOA:A5GQW3"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW3"
FT                   /protein_id="CAK27272.1"
FT                   /translation="MKLFVDNRRDGSRLLSSALAFSFVGLIRIDTSWGRVLFVAAGALS
FT                   LWWWLCYRKLTH"
FT   CDS_pept        complement(357619..357765)
FT                   /transl_table=11
FT                   /gene="hli"
FT                   /locus_tag="SynRCC307_0370"
FT                   /product="High light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27273"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW4"
FT                   /protein_id="CAK27273.1"
FT                   /translation="MSETNASRFGFVNFAETWNGRLAMMGFVIGLGTELLTGQGILSQL
FT                   GLG"
FT   CDS_pept        357892..358704
FT                   /transl_table=11
FT                   /gene="SynRCC307_0371"
FT                   /locus_tag="SynRCC307_0371"
FT                   /product="Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27274"
FT                   /db_xref="GOA:A5GQW5"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW5"
FT                   /protein_id="CAK27274.1"
FT                   /translation="MARPLMRAQFQAQVQAPLPSAPELVLVTDLDGTLLAGEPADRRRL
FT                   YRWLSDCREQVLHIFATGRERSSVAELFQAPEHALLRQPHLVISDVGCTVACGDSLELV
FT                   PLVVDDIERQWQPFAEQVLALTQGQPGLSPQPVCAERRHAFDADPELMDPGLMQRLRQV
FT                   GVDCVFSDGRYLDVLPPGVNKGSTLQRVLELLELQQVPVVVAGDTLNDLGLFQTGYAGV
FT                   MVGNAEAPLLEWLPQLPNTYLANGAGCSGILEGLEHFGFGGLLAQGAS"
FT   CDS_pept        358701..359000
FT                   /transl_table=11
FT                   /gene="SynRCC307_0372"
FT                   /locus_tag="SynRCC307_0372"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27275"
FT                   /db_xref="GOA:A5GQW6"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW6"
FT                   /protein_id="CAK27275.1"
FT                   /translation="MSDSAQWLGFTAAALTTSSFFPQALKTLRTNETAGISLRMYLLFT
FT                   SGVSAWAVYGLWVQDWPVFWANVVTLLPAAAVLERKVRASLSSAGNRQRQGENR"
FT   CDS_pept        complement(359174..359578)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0373"
FT                   /locus_tag="SynRCC307_0373"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27276"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW7"
FT                   /protein_id="CAK27276.1"
FT                   /translation="MQAGARQADPRTRVVLAVLKAVKLPPRFRLKLVKDDPVRLELTLT
FT                   PAYGKDPILVGIVESQDLVARRDREGRIPRDLQGTWDWTVRHGKVSTGGWNPYLKEALQ
FT                   TMFETGLPAIVYEETTGEAYHPVDGTRHVR"
FT   CDS_pept        complement(359602..359847)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0374"
FT                   /locus_tag="SynRCC307_0374"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27277"
FT                   /db_xref="GOA:A5GQW8"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW8"
FT                   /protein_id="CAK27277.1"
FT                   /translation="MADGLLTQLFPLLYLTCLGLLLWQAFRVMGRGFSAAQKSVQPPAN
FT                   VHPELLDANGQITEEELLTVRFEAEPSADGSDDHAS"
FT   CDS_pept        359975..361066
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="SynRCC307_0375"
FT                   /product="Periplasmic trypsin-like serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27278"
FT                   /db_xref="GOA:A5GQW9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW9"
FT                   /protein_id="CAK27278.1"
FT                   /translation="MRRQLPLLALSTALVIGTAAQAPARLPVSTTNRQSFVAEAVRQAG
FT                   PAVVRIDTERTITSASAPGGIPPVFLMDPLFRQFFGGSGGAMPAPRPSQRTERGQGTGV
FT                   IFEADGLILTNAHVVEGASRVTVGLVDGRTMEGSVIGADPVTDLAVVRVAASEPLPVAP
FT                   LGDSDAVEVGDWAIAVGNPFGLDNTVTLGIISSTNRNATKLGITDKRLDLIQTDAAINP
FT                   GNSGGPLLNADGEVVGINALVRTGPGAGLGFSIPINRARSIADQLIRNGKASHALVGLA
FT                   LSAEPKGVRVNSVMPNGPAARAGVRPGDLVLSVGGEAVRDPAQFLARMERSGVGKPLSL
FT                   ELLRDGQRRTLEVVPVEMASMAT"
FT   CDS_pept        361134..361337
FT                   /transl_table=11
FT                   /gene="SynRCC307_0376"
FT                   /locus_tag="SynRCC307_0376"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27279"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX0"
FT                   /protein_id="CAK27279.1"
FT                   /translation="MRPIDSTFVARQRLALALSLQGNRSWLAARRAQLLEEGRVLEAEA
FT                   LLQEFRGLGQPDQLLTVPAQLG"
FT   CDS_pept        complement(361489..361674)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0377"
FT                   /locus_tag="SynRCC307_0377"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27280"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX1"
FT                   /protein_id="CAK27280.1"
FT                   /translation="MDSAAALSLGQRFELERMNRAIDAEMDPTAVRGIAKQLLQAWQSQ
FT                   RAASRWLLSQQSDQQS"
FT   CDS_pept        complement(361746..361907)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0378"
FT                   /locus_tag="SynRCC307_0378"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27281"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX2"
FT                   /protein_id="CAK27281.1"
FT                   /translation="MSRSYIPGSGEHEQTWDAVETYFQCITECSLDDGECVTRCVEDLR
FT                   ISDGSETD"
FT   CDS_pept        complement(362014..363741)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0379"
FT                   /locus_tag="SynRCC307_0379"
FT                   /product="ATPase component of ABC transporter with
FT                   duplicated ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27282"
FT                   /db_xref="GOA:A5GQX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX3"
FT                   /protein_id="CAK27282.1"
FT                   /translation="MLRLERVGKIYPTGEVLRDVTWEVKSGDRIGLVGVNGAGKSTQLR
FT                   IIAGLEEPSSGQVVRQGDPRIVFLQQEFDVDVRRTVREELFQAFGEAAEVRNRQGHVEQ
FT                   AMASERAAEDPDYLQELIEDLGRLQTRFEGLHGYELDARIDKLLPTIGFNEAKAERLVG
FT                   DYSGGWQMRIALGKILLQEPDLLLLDEPTNHLDMATIEWLEGYLTEINVPLVVISHDRT
FT                   FLDRVCNQIVETERGISRSYLGNYSQHLEQKVLEREASQSAFDRQQKELAAQQAYIDRF
FT                   RASATRSTQAKSREKLLDKVERIDAPVESLGGPQFQFPPAPRSGRQIALIDNLTHHYDD
FT                   NILFLEANLEVERGDRIAFVGPNGAGKSTLLRLVMGLEQPSEGSARLGEHNVEAGYFEQ
FT                   NQAEALDLEKTVIDTLFEAVPDWTQTQVRSLLGSFCFSNDAVFKQVGQLSGGEKARLAL
FT                   ALMLLTPCNLLVLDEPTNHLDIPAKQMLEDALMQYEGAALLVSHDRTFIARVANRIVEL
FT                   RDGELVLYRGDYAYYLEKKEEEAALLRQAEEDEAREAKRAANRAKQKSKAESRRKRPT"
FT   CDS_pept        363824..363979
FT                   /transl_table=11
FT                   /gene="SynRCC307_0380"
FT                   /locus_tag="SynRCC307_0380"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27283"
FT                   /db_xref="GOA:A5GQX4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX4"
FT                   /protein_id="CAK27283.1"
FT                   /translation="MLKRLEAVMALVVTAGLAVVSYWLFFSWAQGGGSQREPLTTPVPQ
FT                   ERSADS"
FT   CDS_pept        complement(363974..364207)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0381"
FT                   /locus_tag="SynRCC307_0381"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27284"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX5"
FT                   /protein_id="CAK27284.1"
FT                   /translation="MGFEQAQALYDIVRSDAQLTRSLFRQALQDPQGTLDQLVAIAEAK
FT                   GLSVSRQEIRDYLNDSADDATRQWLIKARGGL"
FT   CDS_pept        complement(364231..364683)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0382"
FT                   /locus_tag="SynRCC307_0382"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27285"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX6"
FT                   /protein_id="CAK27285.1"
FT                   /translation="MFPFSLDSVASYIWRHSQTEAPASQASCSSQSRPWDSCDHLSGPA
FT                   LTNRPSRGELVHPAHNTSMLSAAVASATQPIALQAECTGSEQMVSFQTPLPGNLAQAMS
FT                   QFIEAHPQWDQYRLMQAALAGFLLQQGVQQRDLTRRYVSSMFGRRV"
FT   CDS_pept        complement(364835..365095)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0383"
FT                   /locus_tag="SynRCC307_0383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27286"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX7"
FT                   /protein_id="CAK27286.1"
FT                   /translation="MRMLMEPAIPAMAASADKSDVLVSAVMSTYLLTHLHHVLQRAEFS
FT                   ATREGRPAMARNYAKLRKVLCLDARTMRDASAMETSEDWAA"
FT   CDS_pept        365143..365415
FT                   /transl_table=11
FT                   /gene="SynRCC307_0384"
FT                   /locus_tag="SynRCC307_0384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27287"
FT                   /db_xref="GOA:A5GQX8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX8"
FT                   /protein_id="CAK27287.1"
FT                   /translation="MPKAVATRQTSSSGRAKSPRIQVVLPEALLERLAVAADQDSRTVS
FT                   NMAKVLIQQGLDRLQGGVRHQLERQQQVQPRLRQGRPRRIRLRGG"
FT   CDS_pept        complement(365416..366540)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0385"
FT                   /locus_tag="SynRCC307_0385"
FT                   /product="Predicted molecular chaperone distantly related
FT                   to HSP70-fold metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27288"
FT                   /db_xref="GOA:A5GQX9"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX9"
FT                   /protein_id="CAK27288.1"
FT                   /translation="MGATVLGLMSGTSADGVDAVLARFDGAPRQPSWRVINAIHHPYPL
FT                   PLRQQLLDAGQGVLLSAAQWLELRQAVSEAQAACAAAADPQHQASLVGCHGQTLWHQPP
FT                   HAGQCGASWQLLDACLLAERLQRTVVSDFRSADLARGGQGAPLVPLTDAALYPAEGGWR
FT                   ALLNLGGIANLTLLPPGQGRDQQPVQGWDCGPANTLLDLAAEHFSGGSSHFDEGGRWAL
FT                   QGQVHEALVQRWLQEPFFQQSPPKSTGRELFGRPDLQRRLEELGESINPADALATLAAL
FT                   SAAAVAADLQRGPAVVEMLVAGGGCRNQALMQQLRSRCRGLWVRSFESLGLNPQHREAL
FT                   AFALLAWWRQLGLPGSAPSITGARAGLLGQVAEP"
FT   CDS_pept        complement(366543..367214)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0386"
FT                   /locus_tag="SynRCC307_0386"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27289"
FT                   /db_xref="GOA:A5GQY0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY0"
FT                   /protein_id="CAK27289.1"
FT                   /translation="MCHDQKDTLSTVMALQLGDTVPNFTQDSQQGPINFYDYAGDSWVV
FT                   LFSHPADYTPVCTTELGAVAKLRAEWDKRNVKTIALSVDSAESHKGWIGDINETQCTVV
FT                   DYPILADEDKTVSDLYGMIHPKALNNLTVRSVFVIDPAKKLRLQITYPASTGRNFDEIL
FT                   RVIDSLQLTDHHQVATPVNWKDGEDCVVVPSIPTDEARNKFPKGVTEVRPYLRMTPQPN
FT                   R"
FT   CDS_pept        367232..368296
FT                   /transl_table=11
FT                   /gene="SynRCC307_0387"
FT                   /locus_tag="SynRCC307_0387"
FT                   /product="Glycosyltransferase of family GT4"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27290"
FT                   /db_xref="GOA:A5GQY1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY1"
FT                   /protein_id="CAK27290.1"
FT                   /translation="MTHCETVTLMQTPLALFNGSYVGERPTGIGVVARDLAAALGPEQV
FT                   PAVWPQGMAPDQGSAGHGRRLWWTQRQLPKLWRASGAPLLLSPLPEAPLLAGVPSVVLA
FT                   HDLLPLRYPQLTPLLAYHLAYVPLVLRRARHVLCNSEATAREVHGRIGVPTRRLSVLKL
FT                   GFNPGQLRPLGYQREAELLVLGRHDPHKNLRRLLKAVAALRDREHRIHFVGPHDRRYTP
FT                   KLQALAQELGIASRCRWTAWVSNDERLELLNRARALVMPSLWEGFGLPALEAMACGTPV
FT                   LASTAGALPEVVGEVAVPLDPMSSAQMAAAIDDFLQSSALQQQLGQQGPLRAAGFSWAQ
FT                   TGADLKQRLQALCP"
FT   CDS_pept        complement(368301..368951)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0388"
FT                   /locus_tag="SynRCC307_0388"
FT                   /product="Predicted hydrolase (HAD superfamily)"
FT                   /note="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27291"
FT                   /db_xref="GOA:A5GQY2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011949"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY2"
FT                   /protein_id="CAK27291.1"
FT                   /translation="MTQAKALLLDAMGTLIGLRQSVGTLYSAAAADYGLDLEAEALDRA
FT                   FAQAYSQAPPLAFPGVAPAHLEQAERSWWQQRIEATFKAVGVKQLPIGLAGELFDRFAQ
FT                   PEPWAVYAEVPDALERWRQSGLALMVVSNFDRRLHGLLERLGLRDAVDGVLVSSEAGAA
FT                   KPDPALLEAALGQVPCSAEQALLIGDSGADEQAAAAAGMRCLRLQRPSGLLVP"
FT   CDS_pept        complement(368948..370078)
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="SynRCC307_0389"
FT                   /product="NADH dehydrogenase, FAD-containing subunit"
FT                   /EC_number="1.6.99.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27292"
FT                   /db_xref="GOA:A5GQY3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY3"
FT                   /protein_id="CAK27292.1"
FT                   /translation="MTSPIVIVGGGFAGLYTALELARRPGHPPLLLVEPRDRFVFLPFL
FT                   YERLSGELPLWQMAPRYDALLAGHGIGWQRDRVTAVEPGSCQVVLESGQRLGYSQLVIA
FT                   TGAKPDSFGIPGVEEHALRFHSLEDVEALQAQLPAIRNRVAIVGAGPSGVELACKLADL
FT                   LRGQANVELIERGERCLPQAKAFNRSQAELALQQRDVRLRCQCGVKAVQPGELTLQDAQ
FT                   GQSSSLAVDAVVWTAGQRTALPGGTLATDGRGRLRCNASLQLESDPRIFSLGDTAAIPH
FT                   DPELPATAQVAFQQSQLLARNLLLARENQPLEEFKWKDLGEMLSLGVGDATLTGMGLTL
FT                   AGSSAYQLRRWTYLTRLPGCRLPLQVAAGWLSAPRP"
FT   CDS_pept        370160..370876
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="SynRCC307_0390"
FT                   /product="Phosphoadenosine phosphosulfate reductase (PAPS
FT                   reductase)"
FT                   /EC_number="1.8.4.8"
FT                   /note="Amino acid transport and metabolism / Coenzyme
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27293"
FT                   /db_xref="GOA:A5GQY4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY4"
FT                   /protein_id="CAK27293.1"
FT                   /translation="MQLVQDLEATQAELEALEAPEQLRWANDHFGSGFAVTTSFGTQSA
FT                   VLLHLLVAVAPDVPVYWIDTGYLFPETYQYAADLTQRLKLNLKVVQPELSPARMEALLG
FT                   RLWESENPDDLVTYHRLRKVEPLDQALDAAEVSCWASGVRAGQTDNRAAMRPLERLRGR
FT                   WSLRPLLRWTRRDVYYYMEKHELPQHPLFEQGYSTVGDWHSSAPDDGLGRASRFGGRHQ
FT                   ECGLHLPEPLVEGAGI"
FT   CDS_pept        370880..371569
FT                   /transl_table=11
FT                   /gene="SynRCC307_0391"
FT                   /locus_tag="SynRCC307_0391"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27294"
FT                   /db_xref="GOA:A5GQY5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY5"
FT                   /protein_id="CAK27294.1"
FT                   /translation="MRRWLLIGNSRWHWAALAPDQSLQLWHTSAAAGLKQLQQAPEAWA
FT                   AVGPVPKDLERWQPQRLLTSDVPLANLPPTLGVDRALAAWGAWQQCRQPVLVADAGTAL
FT                   SLTLVDAAGCFLGGRLMAGGRLQLQALHQGTADLPQLEPVEAAGPLWATQTSEAMASGV
FT                   ARGLAAAIALAFHDRPQPPWPWQLWLTGGDAPVLMPLLQAQGLQPHHDEGLALAALVAL
FT                   SRPAQDP"
FT   CDS_pept        complement(371544..372014)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0392"
FT                   /locus_tag="SynRCC307_0392"
FT                   /product="Peroxiredoxin"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27295"
FT                   /db_xref="GOA:A5GQY6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY6"
FT                   /protein_id="CAK27295.1"
FT                   /translation="MALQIGDPAPDFTLPDQDGQPVALKDLRGQRVVIYFYPKDDTPGC
FT                   TKEACNFRDQWDSFKSHGIKVLGISKDNAKSHAKFIDKYTLPFTLLSDSEPCPVAESYE
FT                   SYGLKKFMGREYMGMMRHTFVIDADGKLEKIYKKVKAATMADDILKDLELAG"
FT   CDS_pept        372013..372672
FT                   /transl_table=11
FT                   /gene="SynRCC307_0393"
FT                   /locus_tag="SynRCC307_0393"
FT                   /product="4'-phosphopantetheinyl transferase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27296"
FT                   /db_xref="GOA:A5GQY7"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY7"
FT                   /protein_id="CAK27296.1"
FT                   /translation="MAAMQSGSEPKQPQLWCGLLPGCSDDRLASLLSAQELAWGEALPQ
FT                   RRRLIFWQTRAVVRQQLAAWLGCTPEAVPLLAPPAHYPQLAAGWGYVSWSHSGEQLLLG
FT                   WSPQPVGVDLEPADRPIRADSLWRRLCPGEPPPAALADAVLQRWVALEALTKRRCSSIA
FT                   VELGRWSWQLEQGRAVHRGDQHNVDVVAQRHHLQQRSWWLGWSGGAMPAVALEEGG"
FT   CDS_pept        372682..373203
FT                   /transl_table=11
FT                   /gene="SynRCC307_0394"
FT                   /locus_tag="SynRCC307_0394"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27297"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY8"
FT                   /protein_id="CAK27297.1"
FT                   /translation="MVQPLRLSMIVLLTLLGVCGLVRLPLMPPLLARSGSDTQLSDLEA
FT                   QEALLEARQEAASQMTRFVGGQITRHYWGGFTPYLDVLGVEIPETMESTLTVGDDRARL
FT                   VLDPKRVNERYVAEVVRAGTRARGVVCRGQGEPGAFVLRGRRLDCPEGWLVINDPLLTS
FT                   SGEQQPEPIN"
FT   CDS_pept        373285..373932
FT                   /transl_table=11
FT                   /gene="SynRCC307_0395"
FT                   /locus_tag="SynRCC307_0395"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27298"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY9"
FT                   /protein_id="CAK27298.1"
FT                   /translation="MLKRISAGLAAGAALSSLAVLPVQAEINTRSTVRWNSGGAVYTTK
FT                   LKDFQKFLKSGGEITSSTNRALAAGVNNSGWTAEEIAKGLSKQYKVNVVYVARFLYSKK
FT                   GYKFLENQTKSYFPYWGMKKTAVQALRSAIVLDSVDGKLSSAGIMKMLPVDMRLADTCG
FT                   TFDGAQNVCAKGKCQGDQQCTSLLSWYVFLPACVQANQIKDKVAARPVRGLW"
FT   CDS_pept        complement(373996..376155)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0396"
FT                   /locus_tag="SynRCC307_0396"
FT                   /product="ATPase related to the helicase subunit of the
FT                   Holliday junction resolvase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27299"
FT                   /db_xref="GOA:A5GQZ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ0"
FT                   /protein_id="CAK27299.1"
FT                   /translation="MWFMDLFGHHADQQLQQQAPLAERLRPRSLDEFIGQDAILGPGRL
FT                   LRRAIAADRLGSLILHGPPGTGKTTLARIIANTTRCHFSSLNAVLAGIKDLRAEVEQAQ
FT                   ERLGRHGLRTLLFIDEVHRFNTSQQDALLPWVENGTVTLIGATTENPFFEVNKALVSRS
FT                   RLFRLQSLDQAALHQVLDRALSDRTHGYGERSIQLDAEARAHLVEVAGGDARSLLNALE
FT                   LAVETTDANASGAIQITLAVAEESIQQQAVLYDKQGDAHFDTISAFIKSIRGSDPDAAL
FT                   FWLARMVEAGEDPRFIFRRLLISAGEDIGLADPQGIVVVEACATAFDRIGLPEGLYPLV
FT                   QATLYLAGASKSNSALGFFDAVKQLRQEKAQQIPKHLRDANRDGSAFGDGVGYRYPHAY
FT                   ADHWVAQQYLPNALQGQVFYQPGSLGWEGERRQQLLTHRAAQLAAAVEWDSQQGEPLSS
FT                   GPDDPAVERWLQRQLALEEGRLVRLQQRFWHAIGLQRHHNVLVMGSRSLLWALPALSGT
FT                   PEGGVTLQLESSADIERIKAQLQVLDPLQQPALIEAPAHAVEGLGDERFELLIGRNLLQ
FT                   GANQRALKAWVKQLETLLYDNAEIHLMSSQPQAGPAELLNSDHPPLVEAEQGWLAKRQP
FT                   LEQLQQLLAAANWSVTKEQWTDQVSLQVDSGLITRWFSKQATYRQAMEGQLGVQAIKAL
FT                   KESYQKRIGTKLRQTISHQHLVARR"
FT   CDS_pept        376209..377411
FT                   /transl_table=11
FT                   /gene="SynRCC307_0397"
FT                   /locus_tag="SynRCC307_0397"
FT                   /product="Possible membrane-fusion protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27300"
FT                   /db_xref="GOA:A5GQZ1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ1"
FT                   /protein_id="CAK27300.1"
FT                   /translation="MDGSVRLFRGLIVLALCPLAGCSWLGSQGPKPLQVSTAVLQPEQF
FT                   RELGDYVATLEAVNQVQLAALADGRVVELPVEEGQQVEQGEVLLRLSSEERQAELIQAQ
FT                   AELSRRRADVAAVQADLERDRRNFERYRYLAKEGAANALDLDSFKASFLASQAKLEANQ
FT                   DLVEAAEAGLGVARTRLDYKTVRAPISGQVSDLSVKLGDVVKERDPFTAIVRNDRLYTQ
FT                   ITIPVTMAERTKPGLPVWLLDPTNGIELAKGELKFVDPDVKVATQGLLAKAEFSNPGNR
FT                   LRSGMRVRTLVGFGSSRQLAVPFDAVIRSAGQSFVYVIGPASELNAKQRQHFKQLKDDT
FT                   PVALKRAVSLGPLQNSCYPVLSGLEPGEQLISSHLLSLRQGTAVKAKASSLEVPICRPL
FT                   R"
FT   CDS_pept        377461..378549
FT                   /transl_table=11
FT                   /gene="SynRCC307_0398"
FT                   /locus_tag="SynRCC307_0398"
FT                   /product="Possible membrane-fusion protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27301"
FT                   /db_xref="GOA:A5GQZ2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ2"
FT                   /protein_id="CAK27301.1"
FT                   /translation="MAAARRNRIRLSVMVWLAVLAGCQSPKPPAVRGHVELIAPKQFRF
FT                   QEQATYQSTLESISNVAMAAEIDGRITSMPMQQGQQVQPGDLLFTLDQVQQRAQVDAAA
FT                   AEARKTRVNANRYIFLNDQGAVSTKDRDYYVTQAIESADRLRADQATLDYKNVVAPIAG
FT                   QVGSIQHKLGSVVSQGETIVNIVDNSKLWVRLDVPSELAYRLRLGMPVVLKAPGLPADL
FT                   PEGEVSFIAPSLDRSSQTVLVKATFDNPNGVLRDQQRVAAVLSFGSNSLLSVPVGAVLL
FT                   QAGQTFVFTAVPAAKAQKQLGRELKPKPAKGDLVAVQTQVGLGTLQDGRYPVLKGLDGT
FT                   EKVVMGNLAQLRSGMVLPVTGQ"
FT   CDS_pept        378546..381839
FT                   /transl_table=11
FT                   /gene="SynRCC307_0399"
FT                   /locus_tag="SynRCC307_0399"
FT                   /product="Multidrug efflux transporter,
FT                   Hydrophobe/Amphiphile Efflux-1 (HAE1) family (2.A.6.2.) ,
FT                   RND superfamily"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27302"
FT                   /db_xref="GOA:A5GQZ3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ3"
FT                   /protein_id="CAK27302.1"
FT                   /translation="MSLSDTFIRRPVLSTVCSILILMAGLISLPLLPIENLPNIAPPTV
FT                   QVSANLPGADAVTVESAVTGPLEEQINGAPGMDYITSSSTSEGSSQISVYFQANTNADI
FT                   DQVNVLNRVQTATPQLPQQVSAQGITVQQTSSSILLVYNLTSTEGQYDASYLNGLYQLN
FT                   LAYPLARAQGVGQVNVYGASNPAYRLWVDPEKLTRFNLSVMDVIDALEAQNQIVVGGTI
FT                   GGPPAPQGTTTTFPILVDGNLETVQEFENLILARGGAGQATARGPDGSLIRLGDVGRAE
FT                   YAFQNFNTAGINGITGHPCIGFGVVQLPGSNAISTAKAVEKVLDQFRSTLPPGVQLEKV
FT                   FDQTDFINASIYGALDALRDAVVLVLLIIFLFLQDWKVTMVPALALPIALLGALVFVKV
FT                   FGFSINELTLLGIILATGLVVDDAIVVVEAVAARIEAGDKPFAAASNAMKELTGAILAT
FT                   ALVLMAVFVPVTFFPGATGVIYRQFALTIVFSIIVSTFNAISGKPLQSALLLGGGKTEV
FT                   GGRRWLWIGAIFGGVYGFLFGGVLWLLLFAGLGALIGGNLKSIFQRFNQGFDRLARAYA
FT                   TLVAQAIRFRRILVSGLLGGVVLTALAFLTIPTGFVPTEDQGYGLGIIQLPPQASLEAT
FT                   MEVADQARTILAKQPEVVSGEFIGGAGFNGGSLNQGLFFFGLKPIDERTKKSQSAQAII
FT                   KDLNQQFQSIKGGLVLAQSPPAVPGFSAQGGLSFQFNDLSNGGYSFTDLREMADELIAK
FT                   AKSTGDYFNLYSQFVSDAPVWRLEPDRDRMASLNVNFSDAMQGLEAIYGGSFVNQTYEG
FT                   GQYRQVYVQAEGSQRAVIESLDNLYVNSVSGDQIPVSELVTVKLDSAPPIINHYDLYRT
FT                   VLIQGVNAVGKSSGQAIDTLQSTFKQMNFANIGMAWSALSRSEVAAGSLAALVFALGLV
FT                   VVYLVLSAQYGSYIDPLVILMTVPLAILGALIFLVLRGQVNNVYAQVGLVTLIGLAAKN
FT                   GILIVDMANQRMEAGMDVIEAASSAAQSRLRPILMTAAAALSGFFPLVVASGAGALSQR
FT                   SIGAVIFGGLLVATVLSLFVVPAFYVLMKKLEANWFPASHEQQDPLPQP"
FT   CDS_pept        381839..382120
FT                   /transl_table=11
FT                   /gene="SynRCC307_0400"
FT                   /locus_tag="SynRCC307_0400"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27303"
FT                   /db_xref="GOA:A5GQZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ4"
FT                   /protein_id="CAK27303.1"
FT                   /translation="MPLPHPTGYRPRQQSRVDRRRIVLAGMLFGFFAVLLMVLGHRAAR
FT                   APGSSLKTMSLDHVLVVMFGVGFCGSWGETMRQLSLVARSRQTRNSLE"
FT   CDS_pept        complement(382109..382948)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0401"
FT                   /locus_tag="SynRCC307_0401"
FT                   /product="Possible ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27304"
FT                   /db_xref="GOA:A5GQZ5"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ5"
FT                   /protein_id="CAK27304.1"
FT                   /translation="MAPRASRLLPSLSRRQLQRVVLEADTPGGRLYNLIIFGTILLSVV
FT                   GLLLEPQPLSFSRELQRGGAVVWIDGFCLLVFLIDYLLHVALSPQPWRYIRSFYGVIDL
FT                   IAVLFFMVPQISSGVVLWMFKFGRILRVFKLLRFVDEADRLLISLRASARRIAVFILFV
FT                   VILQVFLGYLMVLVESGHPNSQFQSVGQGVYWAVVTMTTVGYGDVVPQTVLGRLLAAAV
FT                   MLLGFGIIAIPTGIVSYEAIRQGQNDQRQCSHCGYRGHRHGAEFCDRCGTLLPTSLQ"
FT   CDS_pept        complement(382954..384615)
FT                   /transl_table=11
FT                   /gene="pmg"
FT                   /locus_tag="SynRCC307_0402"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27305"
FT                   /db_xref="GOA:A5GQZ6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ6"
FT                   /protein_id="CAK27305.1"
FT                   /translation="MTLSSPSTEFSVQQIKLPEAFQDQKPGTSGLRKSTQQFEQPHYLE
FT                   SFIEAIFRTLPGVQGGTLVVGGDGRYGNRRAIDVITRMAAAHGLGRIVLTTGGILSTPA
FT                   ASNLIRQRQAIGGIILSASHNPGGPKGDFGVKVNGANGGPAPESLTDAIYACSQQLDGY
FT                   RIASGTALPLDAPAEHQIGALNVEVIDGVDDYLQLMQHLFDFDLISDLLKGSWPMAFDA
FT                   MHAVTGPYASKLFEQLLGAPSGTVRNGRCLEDFGGGHPDPNLTYAKELATLLLDGDDYR
FT                   FGAACDGDGDRNMILGQRCFVNPSDSLAVLTANATLVKGYASGLAGVARSMPTSAAVDV
FT                   VAKQLGINCFETPTGWKFFGNLLDAGRITLCGEESFGTGSDHIREKDGLWAVLFWLSIL
FT                   AKRQCSVAEVMQQHWSTYGRHYYSRHDYEGVETDRAHGLYNGLRDRLGELTGTSFADSR
FT                   IANADDFAYSDPVDGSLTQKQGLRLLLEDGSRIILRLSGTGTKGATLRLYLERYVATGG
FT                   NLDQNPQQALAGMIAAADALAGIRSTTGMDVPTVIT"
FT   CDS_pept        384688..385017
FT                   /transl_table=11
FT                   /gene="SynRCC307_0403"
FT                   /locus_tag="SynRCC307_0403"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27306"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ7"
FT                   /protein_id="CAK27306.1"
FT                   /translation="MARRLLLTSLGWFALLATPAMAAPETSWAEAVQQGREASQAVLGR
FT                   TGTETCLQGKMINALIEVSNRCDEGDGNPELCELAEANVLSGVQPLSVLDQVSSDFLKL
FT                   TSAQP"
FT   CDS_pept        complement(385021..385464)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0404"
FT                   /locus_tag="SynRCC307_0404"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27307"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ8"
FT                   /protein_id="CAK27307.1"
FT                   /translation="MSGLLQNAAAIAVVPLLTLIAGSGLAQTSPDPLAEPLTREELKPT
FT                   YFAIVECARRNQEPGCLAARQLADELMDRPFVTAFCKDTAFAVTQQAKTAEMNSFERKD
FT                   ELVRLARDTMDLCKGKEDPRPVYGELDENKTNDNKINVLDLLN"
FT   CDS_pept        385538..386836
FT                   /transl_table=11
FT                   /gene="SynRCC307_0405"
FT                   /locus_tag="SynRCC307_0405"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27308"
FT                   /db_xref="GOA:A5GQZ9"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ9"
FT                   /protein_id="CAK27308.1"
FT                   /translation="MVLLQTLIRYALVGGGAAAIHLLLLLLLPRLGAPLPLANVAGYLT
FT                   ALLWGYVLHAVLTFRRQTSGELFPRRWLLLQLVINLSLSLGLPQLMPPLATHPVGIALL
FT                   VFTPTAVNALVWWLAAHQVQRLRRGDGLATSALQFHADDLGLCAAVNASILALADRGLL
FT                   QGTSVMLNGSDLSGAVAGLALRPQLNLVLHLVLTEGLPIAEQEQVPDLLNGRGELQLKV
FT                   HRLLLLSFWPRSWDWPQLRRQRHQLRLEVDAQIDRFCSLWPDRPLQVDGHQHVHLMPVV
FT                   WRQLMASRPQHPLAWVRTVHEPLPVGLPLGEWWSVLRSAGWLKWLLLQSLSELQRPDLA
FT                   ARGIATNQWFAGVLCTGRMGDRALQASLRSLRACLLGQEHQHALVLLHPSEPLQSDREL
FT                   ERFAESQAFYRSPWRQREAQALLSRAGWMSRTK"
FT   CDS_pept        complement(386791..387747)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0406"
FT                   /locus_tag="SynRCC307_0406"
FT                   /product="Glycosyltransferase of family GT2"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27309"
FT                   /db_xref="GOA:A5GR00"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR00"
FT                   /protein_id="CAK27309.1"
FT                   /translation="MNTTNNQLWAIACCFNEEAGIITFIEAVLAQPSVDRLLLIDDGSC
FT                   DHTTGAIRQWMEAQPQAPITLVELTRNFGKEAAMLAGLDQAVGRCGAVIQIDSDLQHPP
FT                   ELIAEMVQHWHAGAEMVTAVRDERDQESRLKILSASGFYRLFNRMVDSIELTDGAGDYR
FT                   LLSAPVVQALTELRENDRFSKGLYPWTGFRSVNIAYLRPPRSSGTSAWNPRRLWLYALD
FT                   GIFSFSVLPLKVWTLLGLVISLLSLIYAFYRLTITLVFGIDVPGWTTLVVAILFLGGVQ
FT                   LIGIGILGEYVGRIYMESKRRPAYFVRDIHPALDSKA"
FT   CDS_pept        complement(387744..389420)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0407"
FT                   /locus_tag="SynRCC307_0407"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27310"
FT                   /db_xref="GOA:A5GR01"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR01"
FT                   /protein_id="CAK27310.1"
FT                   /translation="MSNPPIEFTPRPISPRQRLLLGAGLFTALALALQFWRIYTLTATF
FT                   DQGLFLQEIWSALGGRPFESTLASELSSPVLLDKTALPTLGYLHLGQHFTPLLLLWVPL
FT                   VALLGPWSLPIVQIGLISAGGLVLYELARCDLDERIACWIALSYFASGTVIGPSLENFH
FT                   DLCAVPVLVFSLLLGIRRSNRWLYGTAALLLPLVREDVGLLAFSLGLWMVLRQPRWRLA
FT                   GVGLCLYATAAVVLITNTVQPLFGTEVSDRLLSARFGHFLSDQGGKGSTLDLLQAMALQ
FT                   PQRVVQELLTPLGPTLQLLVALWLPLGFLPILGLDAWLLMAVPLFLALAAQGVTALSIN
FT                   LRFMLYLVPGVFAGSVIWWRSRQALFEQRWVRRLWQSCAVASLVFALIGNPHHSLSMLI
FT                   PDSLNPWVYVSPWQQLQRGHQSRALTRNIPKDASVSAETQLIPMLAERRVLLRYPFNYR
FT                   YTDEQGQAHDVEWIVLQPRFKATYAPAFRRQANTLEHGMNLTQHLLASGSYEIARCGPS
FT                   GILLKHRSTTATGDLSTKANLKQCLHQEFERAQQVLNQRQR"
FT   CDS_pept        complement(389401..391044)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0408"
FT                   /locus_tag="SynRCC307_0408"
FT                   /product="Sulfate permease, MFS superfamily"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27311"
FT                   /db_xref="GOA:A5GR02"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR02"
FT                   /protein_id="CAK27311.1"
FT                   /translation="MSCSALPLFKAAVPYGRSRSSPMPVSKTPSSLADQWLGNPQRDLL
FT                   SGLVVAFAMIPEAIAFSGIAGVDPQVGLFGAFCLSLTIAVVGGRMAMITSATGSTALLM
FT                   TGLVATGNARGEGLGLSYLLVAGILTGVLQILWGYLRLAYQMRFVPQGVLSGFVNALAL
FT                   LILQAQFPQLGINLHFGETEAAGHAHDLLPHGAQLPIIWGLVVLGLVIIYGLPRLTRVV
FT                   PSQLVAIVVLTLISILFGFDIPTVRSLGELPLGLPSFGIPFGALADGRVPFNFETLGIV
FT                   LPTALAISLVGLMETFLTQDILDDKTDSNSNKNTEARGQGIANIVSSFFGGMAGCALVG
FT                   QSVMNIDNGGRTRLSTFFSGVSLLAMILLARPWLEQIPMAALVAVMISIAISTADMAGL
FT                   RRLARIPVSDTSVMLMTFAVTMLTTPHNLALGVLAGVALAAILFSRKVAKVIRVDVEEM
FT                   GPDARRYVVRGQLFFVSKIYFLQGFDVHEHPAKITIDMSNAHIWDQSGVGALNQLIRKL
FT                   RKGGSQVEVEGLNEESLDLFERIGDEQPAH"
FT   CDS_pept        391043..392083
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="SynRCC307_0409"
FT                   /product="Dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27312"
FT                   /db_xref="GOA:A5GR03"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR03"
FT                   /protein_id="CAK27312.1"
FT                   /translation="MTPAPDQLVLRRPDDWHVHLRDDVMLEQVLPATARQFARAIVMPN
FT                   LRPPVTTVDAAIAYRQRIEAALPDGMAFTPLMTAYLTDDISPDELERGHREGVFTAAKL
FT                   YPANATTNSAAGVSDLACITAVLERMQAIDMPLLIHGEVTDPDIDIFDREAVFIERHLI
FT                   PLRRQFPQLRVVFEHITTEQAAQFVVDGDPLMAATITPHHLHINRNAMFQGGLRSDFYC
FT                   LPVAKRERHRLALRQAATSGDPSFFLGTDSAPHPRAGKESSCGCAGIYNAPYALESYLA
FT                   VFEAEGALQHFEAFASENGPRFYKLPLNEDTITLKRTAQLVPAQLEGQGLVPFHASEVL
FT                   DWRLAD"
FT   CDS_pept        complement(392080..393432)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0410"
FT                   /locus_tag="SynRCC307_0410"
FT                   /product="Phosphatidylcholine-hydrolyzing phospholipase D
FT                   family protein"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27313"
FT                   /db_xref="GOA:A5GR04"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR04"
FT                   /protein_id="CAK27313.1"
FT                   /translation="MHRLSALALAALCSGCTAAAQYRPWPEATLPQPEFITAGFNHRLG
FT                   SSYISPLTGQRRDGDNLEQQLITAIAGAQREVLVAVQELTLPAIAEALIERHRAGVTVK
FT                   LVLENNYSAPWSLQHPAGLEPHQQKRLRRLQKLGWRDAIALLQHAGVPLLDDTADGSAG
FT                   SGLMHHKFVVIDRQRLLTGSANFTSSGLHGDAGQASSRGNVNHLLQLESPELAELFAEE
FT                   FEQLWGDGPGGKPDSRFGLGKHSRQLQQAQLGSDRAGVLFAPHRRNNPDHGLALIRQQL
FT                   EQAQRSIDLALFVFSAQELADVLALKRDQGVQIRVLVDPGFAHRSYSEWLDLKGLAMAD
FT                   HRCRLEAGNNPWATPLKNVGTPRLSRGDKLHHKFAVIDGQTVITGSFNWSPAAAHTNDE
FT                   TLLVIDSPTLAAHFSREMDRLWQSAELGITPRLQRKLERSQRLCGQSQIAD"
FT   CDS_pept        complement(393450..393731)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0411"
FT                   /locus_tag="SynRCC307_0411"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27314"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR05"
FT                   /protein_id="CAK27314.1"
FT                   /translation="MAADPLTSAVSDRICAHMNDDHAEAVVAYARHYGGAENPSQARML
FT                   KVEPERMLLDVDGSELSIAFDHTLSDSEDAHRTLVAMLRAMPQPGNAD"
FT   CDS_pept        complement(393886..395166)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0412"
FT                   /locus_tag="SynRCC307_0412"
FT                   /product="Sugar kinase"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27315"
FT                   /db_xref="GOA:A5GR06"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR06"
FT                   /protein_id="CAK27315.1"
FT                   /translation="MPPSSRAEALLGCGIDLGTSGCRLALVDATGPIQQLSCPYPGAFR
FT                   QAESWRLGVQQLFAQLQEEQRQQIGAIAIDGTSGTLLACRPTGEPLAPALAYNDACPEQ
FT                   AQQTRELVPNGGSAGSSSGSVARSLRLLEQLNEQPGSELLLRHQADWLMGWLLGNWSWG
FT                   EEGNNLRLGWDLRSNQWTGEITRSSWASALPAVIPSGQLVGPIGNAAAAELQLPASCQI
FT                   VSGTTDANAAVLAAEPQEGDGIAVLGTTLVLKQFAPQPLSGPGINNHRIAGRWLVGGAS
FT                   NAGGGVLRQFFSQEQLEELSRQINPERSSGLSLRPLPRRGERFPVDDPELEPVLEPRPV
FT                   SDALYLQALLEGLSSIERQGWQRLEELGAPKVRRVLSVGGGASNPQWRALRQKLLNKPV
FT                   LNRSKASPAAAMALLARQTAKLEQSSG"
FT   CDS_pept        complement(395144..396367)
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="SynRCC307_0413"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27316"
FT                   /db_xref="GOA:A5GR07"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR07"
FT                   /protein_id="CAK27316.1"
FT                   /translation="MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPASRVACETV
FT                   VNTGLCIITGEVTTTARVDFNTLVRGVIADIGYSSAKAGGFDANSCAVLVALDQQSPDI
FT                   AQGVDEADDHAGDPLDKVGAGDQGIMFGYACDETPELMPLPISLAHRLARRLAEVRHNG
FT                   TLGYLLPDGKTQVSVVYEDDQPVAIDTILISTQHIAEIDGISDEKGLRERISADLWTHV
FT                   VEPATADLSLKPSKDTTKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARFVAKALVAAGLARKAEVQLSYAIGVAKPVSILVESFGTSSHS
FT                   NDELTELVNANFDLRPGAIIENFKLRNLPQQRGGNFYREVAAYGHFGRSDLNLPWEDVS
FT                   VIAAKLKG"
FT   CDS_pept        complement(396392..397090)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0414"
FT                   /locus_tag="SynRCC307_0414"
FT                   /product="Predicted HAD superfamily phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27317"
FT                   /db_xref="GOA:A5GR08"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR08"
FT                   /protein_id="CAK27317.1"
FT                   /translation="MLFDKDGTLCRSDGFLSALAQARALCCAELSGDPGITEPLLLAYG
FT                   LHNSQLDPSGSTAVASRHDNLISTATVLAAAGHSWGQARQWAQAALDQADAQLAGSKAQ
FT                   STPPLPGLQPVLERWHRQGLKLAVISSDLGPSLEAFLQTHGLRHLFCAVHGAERSPRKP
FT                   DPAAALALCQELGVEPQRCGLIGDAADDLAMSQGAGLAWSLAFTGGWSVPFKLEGSHGS
FT                   FANWDQSPNL"
FT   CDS_pept        complement(397114..398217)
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="SynRCC307_0415"
FT                   /product="30S ribosomal protein S1"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27318"
FT                   /db_xref="GOA:A5GR09"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR09"
FT                   /protein_id="CAK27318.1"
FT                   /translation="MTVTPSSSESSAVEQPELESTATEQAENLLDVEQSLDAMAQDMAD
FT                   DIPEEVPSADDGQRTPSANNEDVGFTLEDFTSLLSKYDYHFKPGDVVNGTVFNLEPKGA
FT                   LIDIGAKTAAFMPLPEVSINRVETLEDVLEPGETREFFILSEENEDGQLSLSIRRIEYQ
FT                   RAWERVRQLQKEDATIYSEVFATNRGGALVRVEGLRGFIPGSHISTRKPKEELVAEFLP
FT                   LKFLEVDEERNRLVLSHRRALVERKMNRLEVGEVVLGTVRGIKPYGAFIDIGGVSGLLH
FT                   ISEISHEHIETPHSVLNVNDQMKVMIIDLDAERGRISLSTKALEPEPGDMLTDPQKVFD
FT                   NAEEMAARYKQMLMEQADEDGMDMEMS"
FT   CDS_pept        complement(398310..398795)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0416"
FT                   /locus_tag="SynRCC307_0416"
FT                   /product="Possible transcriptional regulator"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27319"
FT                   /db_xref="GOA:A5GR10"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR10"
FT                   /protein_id="CAK27319.1"
FT                   /translation="MQCPSCQHTDSRVLESRAADSGKSVRRRRECLNCEFRFTTYERVE
FT                   TMTITVVKRSGTRETFSRSKLLTGLVRACEKTGLETNRLELLVEEIELQLQQRNQKEIT
FT                   SQQLGDLVLEELGDLSEVAYVRFASVYGKFSGISDFITTLDALRQRNQVKRQLAKIS"
FT   CDS_pept        complement(398973..399068)
FT                   /transl_table=11
FT                   /gene="psbT"
FT                   /locus_tag="SynRCC307_0417"
FT                   /product="Photosystem II reaction center T protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27320"
FT                   /db_xref="GOA:A5GR11"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR11"
FT                   /protein_id="CAK27320.1"
FT                   /translation="MESFAYILILAFSIGTLFFAIALRDPPKIGK"
FT   CDS_pept        complement(399090..400649)
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="SynRCC307_0418"
FT                   /product="Photosystem II P680 chlorophyll A apoprotein
FT                   (CP-47 protein)"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27321"
FT                   /db_xref="GOA:A5GR12"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR12"
FT                   /protein_id="CAK27321.1"
FT                   /translation="MGLPWYRVHTVVINDPGRLLAVHLMHTALVAGWAGSMALYELAIF
FT                   DPSDAVLNPMWRQGMFVMPFMARLGVTDSWGGWSITGATGVEPGFWSFEGVAAAHIVFS
FT                   GLLFLAAIWHWTYWDLEIWQAPRTGEPALDLPKIFGIHLLLAGLGCFGFGAFHLTGVFG
FT                   PGMWVSDPYGITGHLEKVQPAWGPEGFNPFNPGGIVAHHIAAGIVGIIAGIFHITTRPP
FT                   ERLYKALRMGNIETVLASAIAAVFFAAFIVAGTMWYGAAATPIELFGPTRYQWDQDYFK
FT                   QEIARRAQGAIAEGASAEEAYAAIPEKLAFYDYVGNSPAKGGLFRVGPMVNGDGLPTGW
FT                   IGHIAFTDKDGRDLQVRRLPNFFENFPVVLEDKDGIVRADIPFRRAEAKYSFEQTGVTA
FT                   TVFGGELAGQTFTDPADVKRLARKAQLGEAFNFDRETYNSDGTFRSSPRGWFTFGHATF
FT                   ALLFFFGHIWHGARTLYRDVFAGIDPDLGEQVEFGLFQKLGDKSTRRLPEGYVPPAGTP
FT                   LS"
FT   CDS_pept        400849..401289
FT                   /transl_table=11
FT                   /gene="SynRCC307_0419"
FT                   /locus_tag="SynRCC307_0419"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27322"
FT                   /db_xref="GOA:A5GR13"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR13"
FT                   /protein_id="CAK27322.1"
FT                   /translation="MPVVRFVREGREVLCPPGTNLRELALQEGVELYGLKGRLGNCGGC
FT                   GQCITCFVEVVAERKEGALTPLTPVEQQKLRRRPESWRLACQALVQESVAVLTRPQAGR
FT                   DAQKQAIAAAQAEPLPEGRMPEPDPEEGADDEVDSGAESDEL"
FT   CDS_pept        401343..401453
FT                   /transl_table=11
FT                   /gene="psbM"
FT                   /locus_tag="SynRCC307_0420"
FT                   /product="Photosystem II reaction center M protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27323"
FT                   /db_xref="GOA:A5GR14"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR14"
FT                   /protein_id="CAK27323.1"
FT                   /translation="MVMETNDLGFVATLLFVLVPAIFLIILYIQTNSREG"
FT   CDS_pept        complement(401466..402311)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0421"
FT                   /locus_tag="SynRCC307_0421"
FT                   /product="Possible Universal Stress Protein with 2 USP-like
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27324"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR15"
FT                   /protein_id="CAK27324.1"
FT                   /translation="MFRNLLIADSGKGHVEEMIRMLRDIPGFASTRLNLLHVVSDQNSS
FT                   NLQEHWKEGGALLAEAVQRLGLNPGEVNTILRQGDTKQTVLKVADELDADLIVMGSRGL
FT                   GRLQSILANSTSQYVFQLSTRPMLLVRDDLYVRHINRLMVGIDGTGVGDDALKLACELA
FT                   KSIPGCVLHGVHVSHHDLAPSRSGNSPSDSLLEKAKQRARQFGVDLQTVHRTGDIARGL
FT                   CAAAEELNADMVVIASQDRRPLVARGLVDLDRLLGGSVSDFVRVHAPAPVLLVREPESR
FT                   "
FT   CDS_pept        402368..402811
FT                   /transl_table=11
FT                   /gene="SynRCC307_0422"
FT                   /locus_tag="SynRCC307_0422"
FT                   /product="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27325"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR16"
FT                   /protein_id="CAK27325.1"
FT                   /translation="MAGDVTRLPWVCRKQVLPQDADHAGVLWHGSYVAWLEEARVLALA
FT                   EAGLAYAELSAQGLELMVVDLQIRYLQALAHGEAVELHSWLQPHSGVRLPLLTRFIQGD
FT                   GAVAAEAIVTLALVDRRRGRLQRQRPPELEAALKQLAAGPVAG"
FT   CDS_pept        402836..403930
FT                   /transl_table=11
FT                   /gene="SynRCC307_0423"
FT                   /locus_tag="SynRCC307_0423"
FT                   /product="Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptak"
FT                   /note="DNA replication, recombination, and repair /
FT                   Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27326"
FT                   /db_xref="GOA:A5GR17"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR17"
FT                   /protein_id="CAK27326.1"
FT                   /translation="MIVGRRSWWWTWLQVPGVGISRIKQLEQAFGSLQAAWWAPAEQLL
FT                   ALPGVGPSLLAGRDQLQQRASALPLPVPPKVLLPSDLAMPPALMALPQPPAALFWCGRG
FT                   ALWPLLRRQQAIAVIGSRRASPYGCRWAQQLGVALAAAGWPVISGLAEGVDAQAHQGCL
FT                   EAGGTPIAVLGTSLERVYPRHHQRLQSQVGRRGLLISEQAPGAPGLRGAFAKRNRLLVA
FT                   MAQAVVLVECPQRSGALLAAQIAWSLQRPLWVVPADSDRASAAGSNGWLNQGATALLDP
FT                   TQLVEALGPGPLQPLALPQRPDPSPLLSALGSGASFEALQRRLHLSPGALAQQLLHHQQ
FT                   QGWIEALPGLCWRPRHTEIDLPVA"
FT   CDS_pept        403936..404820
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="SynRCC307_0424"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27327"
FT                   /db_xref="GOA:A5GR18"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR18"
FT                   /protein_id="CAK27327.1"
FT                   /translation="MTCLSGSELQLWRREQLLGQQEQAAALDWLLELEAGLRWRELQAS
FT                   YLHPEAPVQLDCSLQRLEQIWQQHCQQQVPLQHLVGRCPWRDFELEVSPAVLIPRQETE
FT                   LLVELAMGCFEASDAPQRWADLGTGSGCLAVALARHWPSSCGWAVDCSREALAVARRNA
FT                   AALGLLQSAALQWCEGLWWQPLQPLAGQLDLVVSNPPYIPSAVVDGLEPVVRDHEPRLA
FT                   LDGGSDGLDALRLIIEAAPQMLAPGGWLVLEHHHDQAAAVAELLGAAGLQERRQERDLE
FT                   GQMRFAVVRRSNP"
FT   CDS_pept        404817..405404
FT                   /transl_table=11
FT                   /gene="SynRCC307_0425"
FT                   /locus_tag="SynRCC307_0425"
FT                   /product="Possible translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27328"
FT                   /db_xref="GOA:A5GR19"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR19"
FT                   /protein_id="CAK27328.1"
FT                   /translation="MTAEGFQVLAQRLQQGEPALFPTDTLPALAAIPSAAQAIWQLKQR
FT                   PADKPLILMGASVEQLLPCLGQEPPAGWQRLAELGWPGALTLVLPACGPVVEALNPEGG
FT                   CSLGLRVPACEAALQLLRCSGPLATSSANRSGEPACRTAAELAHCFPEVIRLAPEPWLP
FT                   GSGQASTVVSWQSDGWRVLRQGQVVVPEILGP"
FT   CDS_pept        complement(405428..406522)
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="SynRCC307_0426"
FT                   /product="Arsenite efflux pump ACR3 related permease"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27329"
FT                   /db_xref="GOA:A5GR20"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR20"
FT                   /protein_id="CAK27329.1"
FT                   /translation="MGVITAGAALVVEQPAAAPRAATLTGQLMGLFERYLSLWIGLAIV
FT                   AGVLLGWLLPGAASTITALQLSGINLLIALLIWGMIFPMMLAVDFSAIGGIGRQPRGLL
FT                   VTVAVNWLIKPLTMTALAWLFIRGLFGPWIPAAMGQEYVAGMILLGVAPCTAMVFVWSR
FT                   LSDGDPNYTLVQVAINDLIMVFAFAPIATWLLGVSDVLVPWDTMLTAVGLFVVVPLAAG
FT                   WLTRLLLRSETRIQRLEVQLKPVAMLSLIATVLVLFMVQAQAILGNPLAIVLIAIPLIL
FT                   QTYLIFWIAAQWMLRWHQPRSIAAPGAMIGASNFFELAVAVAISLFGLNSGAALATVVG
FT                   VLVEVPVMLSLVAIANRNEDLFPA"
FT   CDS_pept        complement(406438..407697)
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="SynRCC307_0427"
FT                   /product="Permease of the major facilitator superfamily /
FT                   multidrug efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27330"
FT                   /db_xref="GOA:A5GR21"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR21"
FT                   /protein_id="CAK27330.1"
FT                   /translation="MKLSPLQQYGIVTANYWAFTLTDGALRMLVVFHFHQLGYSTLEIA
FT                   FLFLFYEFFGVLTNLYGGWIGARYGLRLTLWAGTLLQILALVMLIPVAASWPKLLSVIY
FT                   VMAAQAISGIAKDLNKMSAKSAIKTVVPETPDDEQQGQKQLFKWVAILTGSKNALKGVG
FT                   FFLGGVLLTAVGFNSAVGLMAAGLALAFALTLVLPGEIGRMKQKPGFSALFSKSKGINV
FT                   LSLARFFLFGARDVWFVVALPVFLEASLGWSFWEIGGFLGLWVIGYGFVQGGAPSLRRL
FT                   WGQSTTPGASAVQFWSAALSAIPALIAIALWRNSDPGLAITAGLAAFGVVFAMNSSIHS
FT                   YMVLAYTDAESVSLNVGFYYMANAAGRLVGTLLSGAVFMLGRTASGGMQACLWVSSLLV
FT                   LLSWLSSLRLPPVPRLSQAN"
FT   CDS_pept        complement(407694..408716)
FT                   /transl_table=11
FT                   /gene="gap3"
FT                   /locus_tag="SynRCC307_0428"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27331"
FT                   /db_xref="GOA:A5GR22"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR22"
FT                   /protein_id="CAK27331.1"
FT                   /translation="MKIGVNGFGRIGRLVFRALWGRPGIELVHVNDNAGDAVTAAHLLT
FT                   FDSVHGRWSQEAHATGSGFQIDGHTISYSQHSDPTAVPWDQAGVEVVLECTGKIKTPET
FT                   LQPYFDQTKVRRVIVACPVKGQIAGAEALNIVYGINHQLYEPSQHRLVTAASCTTNCLA
FT                   PVVKVVHETFGIEHGLITTIHDITNTQVPIDAFKSDLRRARSGLNSLIPTTTGSAKAIA
FT                   MIFPELQGKLNGHAVRVPLLNGSLTDAVFELKQDVTAEQVNAAFKAAADGPLQGILGYE
FT                   ERPLVSCDYTNDNRSSIIDAPSTMVVDGNQLKVFAWYDNEWGYSCRMADLACHVVALEP
FT                   "
FT   CDS_pept        408763..409086
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="SynRCC307_0429"
FT                   /product="Predicted transcriptional regulator, arsR family"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27332"
FT                   /db_xref="GOA:A5GR23"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR23"
FT                   /protein_id="CAK27332.1"
FT                   /translation="MDSLLATDLKADSARTLLKALADPLRLRIIETLAEGERCVCDLTT
FT                   DLELAQSKLSFHLRVLKDAGLLSQRLSGRWVYYRLEPGAIEELRSWLGAVQQCCEKTAP
FT                   PCC"
FT   CDS_pept        409126..409320
FT                   /transl_table=11
FT                   /gene="SynRCC307_0430"
FT                   /locus_tag="SynRCC307_0430"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27333"
FT                   /db_xref="GOA:A5GR24"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR24"
FT                   /protein_id="CAK27333.1"
FT                   /translation="MGGLVLFVIALMALFEWALEPLMISLQRLFTLRELIWIPLMLLVA
FT                   LLLSPNGDPHKAITKGKTP"
FT   CDS_pept        409390..410232
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="SynRCC307_0431"
FT                   /product="Alternative RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27334"
FT                   /db_xref="GOA:A5GR25"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR25"
FT                   /protein_id="CAK27334.1"
FT                   /translation="MAEPVRAYLEQIGRYALLRPEQEVELARLVQRAQQLEQQLQLSPT
FT                   EQRELRRGRRARERMIQANLRLVVTVAKTYQGRGLDLMDLVQEGSLGLIRAVEKFDPTL
FT                   GYRFSTYAWNWIRQAISRGLETKGRTLRLPIHVTQQLRALRRAHERLWQQGLSTDLVAV
FT                   AAEAGVDLKAASLALRMAPGTLSLDTPAAGSESDLLQLLPSAEPSPLDEAERHDGWERM
FT                   GRQLRHLPERDQQVLQWRYLTPERQKLSVVGEQLGCSRERARQIEQRALLRLRLRMAS"
FT   CDS_pept        410293..410454
FT                   /transl_table=11
FT                   /gene="SynRCC307_0432"
FT                   /locus_tag="SynRCC307_0432"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27335"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR26"
FT                   /protein_id="CAK27335.1"
FT                   /translation="MLVRTTHGSISVVGGYGWVNVVPERPSRFESRRPLHWAGWVWDVI
FT                   SQRSLTPS"
FT   CDS_pept        410513..410791
FT                   /transl_table=11
FT                   /gene="SynRCC307_0433"
FT                   /locus_tag="SynRCC307_0433"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27336"
FT                   /db_xref="GOA:A5GR27"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR27"
FT                   /protein_id="CAK27336.1"
FT                   /translation="MFASQYSPLEIVLLKPERIEEMEQAVQWLQRHSTVVVDMALLDDS
FT                   NAQRFIDFLSGAVWSLDGSIQRVSDEVIVAAPMAIRLTSGSEAETEI"
FT   CDS_pept        complement(410768..411073)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0434"
FT                   /locus_tag="SynRCC307_0434"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27337"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR28"
FT                   /protein_id="CAK27337.1"
FT                   /translation="MMPLLLLPVFWAQLQQPCRIWSVREALSYSGLCDVRKQQGTTSLT
FT                   APNELTGEDQTIEVSPKGRRQVHVRGLNSQGDETLWGEARKVGKSCWVGSDFGLCL"
FT   CDS_pept        complement(411070..411846)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0435"
FT                   /locus_tag="SynRCC307_0435"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27338"
FT                   /db_xref="InterPro:IPR024981"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR29"
FT                   /protein_id="CAK27338.1"
FT                   /translation="MGHNGSDFGLGLPVLKRSAMAKAAAALLACTAITPFTLPAAAQSS
FT                   RVARPLSEAAAQQAADQILEAVRQRDGALRYSQFSKALQTTSSPSMVQGTLDQLPQLES
FT                   WTIQSVRTGLSGNSSVEVLLQSENGSREATLVINPQGRLVAQLFNVSDKDSTKVARAFI
FT                   DAVSDGQFISARSLLALDLQKEISPQKLQNKWLRLQQTTGNFQAIEKVMEAEHGSNGSL
FT                   VLVTMRFNRTTDNIFVILNPAGQITGLDFPIDGAVR"
FT   tRNA            411883..411954
FT                   /locus_tag="RNA_13"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACR"
FT   CDS_pept        complement(411962..412255)
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="SynRCC307_0436"
FT                   /product="Cell division Spetum formation topological
FT                   specificity factor"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27339"
FT                   /db_xref="GOA:A5GR30"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR30"
FT                   /protein_id="CAK27339.1"
FT                   /translation="MTLREMIDRLLGRQQASATTAKHRLQLVLAHDRSDLNPDLMEQMR
FT                   REILEVVNRYVELDLEGGDVSLETEERATALVANLPIRRVRDDVLPQVPAVQ"
FT   CDS_pept        complement(412259..413077)
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="SynRCC307_0437"
FT                   /product="Septum site-determining protein MinD"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27340"
FT                   /db_xref="GOA:A5GR31"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR31"
FT                   /protein_id="CAK27340.1"
FT                   /translation="MTGSSTRTILICSGKGGVGKTTLTANLGIALASQGVRTAVLDADF
FT                   GLRNLDLLLGLENRIVYTAQEVLAGNCRLEQAMVKHKLQPNLALLPAGNPRMLEWLKPE
FT                   DMQKIVGLIQPHFDVVLIDAPAGIEDGFKNAAAAADEAIVVTTPEVSAVRDADRVIGLL
FT                   NTRGVEPIQLVLNRVRPKMMQSQEMLGVTDVTDILALPLLGLVFEDEQVIVSTNRGEPL
FT                   TLNGSSSPAAIAYRNVAKRLQGEEVPLPDPTKQRRGLRAKMRQLMQTKLF"
FT   CDS_pept        413190..414197
FT                   /transl_table=11
FT                   /gene="SynRCC307_0438"
FT                   /locus_tag="SynRCC307_0438"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/c
FT                   ardiolipin synthases related enzyme"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27341"
FT                   /db_xref="GOA:A5GR32"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR32"
FT                   /protein_id="CAK27341.1"
FT                   /translation="MTRGVTTAGHHQQLLVMPDDGVEPVTDFIASAQQELRLKQFKLQS
FT                   PAVLEALRQAHERGVQVRVMLNPHTSGGDRWNDQAYAALQSWGVAVAWTSESFPVTHEK
FT                   SIVVDDSAALIATFNLSDKYFTETRDYGVITYAAPAVEQVIDGFEHDWNRSFFNPDLSV
FT                   GLVWSSFHSRGQMAKVIDAAKERLWVQHPKFVDAVILERLIAACERGVKVRVLCGGKHG
FT                   ISDWDIYDTFASLRVLSRSGVKVRRQKHLKLHAKLIVVDKKMALIGSMNIDRSAFDLRR
FT                   ELGIETDAPEVLARCVELYKHDWNEATPYAAPDPLDPAMHEEGELPPDPHFIHE"
FT   CDS_pept        414194..414772
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="SynRCC307_0439"
FT                   /product="Chromate transport protein ChrA"
FT                   /note="Possible HGT"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27342"
FT                   /db_xref="GOA:A5GR33"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR33"
FT                   /protein_id="CAK27342.1"
FT                   /translation="MMAAQLDQEPLAAAPSRKGLFLGMLQVALSSFGGGMSAWSQRIVV
FT                   EQRRWMSNESFITGLTVARLFPGPNQINMAVYIGAQFRAFAGAVAAVGGILLVPFSLLM
FT                   LIGVVYFQFHAAPAVDRVLTGVVAAAAGMALSMGFKILHVYWRDPLALGLAALTFVVLE
FT                   FKGIGLIPVVLVLGPIAMALYWPRQQRHG"
FT   CDS_pept        414765..415334
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="SynRCC307_0440"
FT                   /product="Chromate transport protein ChrA"
FT                   /note="Possible HGT"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27343"
FT                   /db_xref="GOA:A5GR34"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR34"
FT                   /protein_id="CAK27343.1"
FT                   /translation="MVDPSSAWDTWLQVVWTFLRLSLFSLGGGNTLLAEYHHLSVERFG
FT                   WITSSQFADIYALAEAAPGPSSMIVGLLGLGAGWDHGLGWGLLCGVSAEVAVLLPSTVV
FT                   MVAAALSWNRLKDAPIRTAFERGLGPITLGILFHVGLTVLRTADHSVVAYLVSAVVCAL
FT                   MLFTRISPLYFMAVAGVLGAIGVIPS"
FT   CDS_pept        complement(415321..416001)
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="SynRCC307_0441"
FT                   /product="Septum site-determining protein MinC"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27344"
FT                   /db_xref="GOA:A5GR35"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR35"
FT                   /protein_id="CAK27344.1"
FT                   /translation="MVARLDPAPAPGWPHRLQLGDWQAGADPCEAVLHALGADPPQGRV
FT                   VMEAGPWPLQCSHLQAIAQHLEQAGLQLEELSSSEPSTLVASAALGLRSQAEPPAPQNA
FT                   EEPKGTGRELHVHRGTVRAGEHLEVDGAVLVLGDVNPGARISARGDVLIWGRLRGIAHA
FT                   GCHGARNARIVALQLRPLQLRIADAVARGPEEPPPEGVTEQARLEGDEIAISAAQLGVP
FT                   ISWG"
FT   CDS_pept        416049..416708
FT                   /transl_table=11
FT                   /gene="SynRCC307_0442"
FT                   /locus_tag="SynRCC307_0442"
FT                   /product="Hydrolase, haloacid dehalogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27345"
FT                   /db_xref="GOA:A5GR36"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR36"
FT                   /protein_id="CAK27345.1"
FT                   /translation="MDCPAATVFCDFDGTVTSVDTFDAVAARAAPELWADLKAQLFQFD
FT                   ITLLQGMQALADALTPQDLEAMVAHMGEYAPRPCFLPFLAELERAGLPFVLVSGGLVPL
FT                   VEAVLGPHRHRLDQLVAAEVLPHLGGGLRFASPFANGQELVAKAEVVKRYGRGRSVVIG
FT                   DSITDLGMAEVADLVFAREPLSGWLEQRGIAFHPWDSFADVEVVLRQQGLLPGAAA"
FT   CDS_pept        complement(416671..417927)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0443"
FT                   /locus_tag="SynRCC307_0443"
FT                   /product="HD superfamily phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27346"
FT                   /db_xref="GOA:A5GR37"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR37"
FT                   /protein_id="CAK27346.1"
FT                   /translation="MKRRSYHDPLHGEIVLDSNDPAEAMVIALIDAPAFQRLRRIRQLG
FT                   PAFLTFHGAESSRFTHSIGVLHLARRALQHLERLTPELADYRGLIYGAALLHDVGHAPL
FT                   SHAGEEMFGLHHEAWSARLVQECPDLRDPLEAWAPGTAKAVAELLEHGRSPHPAAKALI
FT                   SSQLDCDRLDYLRRDSYSTGTSYGQLDLDRLIAALTLAPDGQLALHPRGRSAVEHYLVV
FT                   RSLMYSTVYNHRLNIVANWLLQQIVRQARQSQPDALFADAVMARWLWDPDAMDSSTYLA
FT                   NDDLRTGYHLQRWREEGPAPLQELCRRLLDRDLLQATDVRGLDHTQRLEALAMAQRLSQ
FT                   AAGLDPDLCCGLRERRSTGYRPYVGGLRLWNGQDLQALEQVSPLVNSLSQPQELAWLLH
FT                   PREVRDQLRQQLQAATPAA"
FT   CDS_pept        complement(417924..419156)
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="SynRCC307_0444"
FT                   /product="Carboxyl-terminal processing protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27347"
FT                   /db_xref="GOA:A5GR38"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR38"
FT                   /protein_id="CAK27347.1"
FT                   /translation="MTRLRLWHAFFRPAFVLALPLLLILQLSGSALALTDDQTLVVDVW
FT                   RLVNESYVDPSFSGVPWRRLRQKALEKTISNRGDAYDAIDAMLAPLDDPYTRLLRPESY
FT                   GQLEAATKGTVSGIGLQLGIHHDSGSVVVIAPVEDSPAAEAGLVDGTLLRSINGQATSE
FT                   LGLDGSAALLRGDSGSSVHLEVTLPDGEEQSLDLERRAIDLRPVRSRRLRSGDHTLGYL
FT                   RINQFSEPVPEAVQEALADLEAKGIEGLVLDLRNNTGGLVSAGLAVADDFLAGDVIVET
FT                   QDRNGINEQRPANGGRLFDGPMLTLINGGTASASEILAGALQDNDRSQLLGSTSFGKGE
FT                   IQTLLPLGDGSGLAVTVARYLTPNGRAIQGQGLEPDEPLSSTEPSGSSIGSDDDAWLRS
FT                   AEEALITQLEA"
FT   CDS_pept        419222..419878
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="SynRCC307_0445"
FT                   /product="Cytochrome b6"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27348"
FT                   /db_xref="GOA:A5GR39"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR39"
FT                   /protein_id="CAK27348.1"
FT                   /translation="MANSSPVYDWFNERLEIQDIVDDISSKYVPPHVNIFYCLGGITLV
FT                   CFLIQFATGFAMTFYYKPTVVEAYSSVQYLMTDVSFGWLIRSVHRWSASMMVLMLILHV
FT                   FRVYLTGGFKRPRELTWVTGVTMAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAVPV
FT                   VGDFMVELLRGGESVGQSTLTRFYSLHTFVLPWLLAVFMLAHFLMIRKQGISGPL"
FT   CDS_pept        419937..420419
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="SynRCC307_0446"
FT                   /product="Cytochrome b6-f complex subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27349"
FT                   /db_xref="GOA:A5GR40"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR40"
FT                   /protein_id="CAK27349.1"
FT                   /translation="MHILKEPDLNDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIL
FT                   GTIACVVALAVLDPAMLADKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTMI
FT                   PLGLMLVPFIESFNKFQNPFRRPVAMAVFLFGTAFTIYLGIGAALPIDKSLTLGLF"
FT   CDS_pept        complement(420433..421986)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0447"
FT                   /locus_tag="SynRCC307_0447"
FT                   /product="Neutral invertase-like protein"
FT                   /EC_number="3.2.1.36"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27350"
FT                   /db_xref="GOA:A5GR41"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR41"
FT                   /protein_id="CAK27350.1"
FT                   /translation="MGAPAIPKVPRSPSKSEHTTRPNSGESEVVRQAEELFEQTLVNVR
FT                   GQLAGAVAALESSVHDSELNYGEIFLRDNVPVMVYLLLRGRFEIVRHFLDLCLELQSRS
FT                   YRTRGVFPTSFVEEDDKILADYGQRSIGRITSVDASLWWPVLCWMYVRASGDTSYGTSP
FT                   KVQRAVQLLLDLVLQPSFYEPPVLFVPDCAFMIDRPMDVWGAPLEVEVLLFGCLKSCCQ
FT                   LMSLVEGGGHGGPLIQQRLELTRTWMRDLRVYLLNHYWVTSKTMQVLRRRPTEQYGDYQ
FT                   SRNEFNVQPEVIPHWLQEWLDDRGGYLIGNMRTGRPDFRFYSLGNALGSLFGLLTGPQQ
FT                   LALFRLVIHNRQHLMAEMPMRICHPPMDQDEWITNTGMDPKNWPWSYHNGGHWPSLLWP
FT                   MAAAVLMHQRLYPNDDLLLLGQTRTMLEECYWQQLNQLPRQQWAEYFDGPTGTWVGQQA
FT                   RINQTWTIVGFLLLHHLMRKAPQDVKLLDLDDVGPLRLSFQDQHEKSSTDERKSFLKNY
FT                   "
FT   CDS_pept        complement(421996..422745)
FT                   /transl_table=11
FT                   /gene="masA"
FT                   /locus_tag="SynRCC307_0448"
FT                   /product="Putative enolase-phosphatase E-1"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27351"
FT                   /db_xref="GOA:A5GR42"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR42"
FT                   /protein_id="CAK27351.1"
FT                   /translation="MIDWESLRAIVLDIEGTTCPVDFVTGSLFPYARQHLGTLLSQDDQ
FT                   QAPLKPLLDEVRIAWKHENSAEAPAYSDSQDPLALLPYLQWLIDQDRKLAPLKELQGLT
FT                   WRHGYQSGALTTPLFADVAPALKRWQQRGLRLAVYSSGSVAAQQLFYGHTSDGDLSDLF
FT                   ERWYDTRLGPKNEAQSYTLLAADLQLPAHAVLFISDSSGELAAAQAAGLQICGSQRPGN
FT                   PETLSAKWPVVVSSLEALAPSGPPGLR"
FT   CDS_pept        complement(422742..423422)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0449"
FT                   /locus_tag="SynRCC307_0449"
FT                   /product="Sugar aldolase"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27352"
FT                   /db_xref="GOA:A5GR43"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR43"
FT                   /protein_id="CAK27352.1"
FT                   /translation="MRHDPAARHTGGTKQSLVSKLSALRQELVDVMADVHRRGWCDGTG
FT                   GNFSCLMSREPLQLVMAPSGVHKGNVSADELIVVDGNAAVIEGTGKASAETLLHLTIVR
FT                   SCAAGAVLHSHSQAGTLLSQWALPRGHLKLQDLEMLKGLAEVSTHQSSVSVPVLANDQD
FT                   LQRLSEAAQPHLAGAPHGLLIAGHGLYAWGEDLFSATRHLEILEFLLEQRWRQLLLQGL
FT                   GVQP"
FT   CDS_pept        complement(423350..424198)
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="SynRCC307_0450"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27353"
FT                   /db_xref="GOA:A5GR44"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR44"
FT                   /protein_id="CAK27353.1"
FT                   /translation="MPELPEVETVRRGLELQVGRFPIGETIVCRSRAVAAPKGDPDGFT
FT                   AALRGCELAGWRRRGKYLVAKLERDGAPAGELGVHLRMTGQFQWLQREERPPCPHTRVR
FT                   FLSEKHELRFVDVRSFGELWFVPLGTPTEQVITGLTRLGPEPFSDAFNANYLRQRLKGS
FT                   SRPIKNALLDQALVAGVGNIYADESLFMAGIRPHTPSGSVSAARLEKLRAALVKVLELS
FT                   IGAGGTTFSDFRDLTGTNGNYGGQARVYRRGGEPCRQCGTILRRDTLGGRSSHWCPSCQ
FT                   R"
FT   CDS_pept        complement(424205..424414)
FT                   /transl_table=11
FT                   /gene="psaE"
FT                   /locus_tag="SynRCC307_0451"
FT                   /product="Photosystem I reaction centre subunit IV"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27354"
FT                   /db_xref="GOA:A5GR45"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR45"
FT                   /protein_id="CAK27354.1"
FT                   /translation="MAISRGDKVRIRRPESYWFNEVGTVASIDTSGIRYPVVVRFEKVN
FT                   YNGFSGVDGGINTNNFAEAELDPA"
FT   CDS_pept        424514..425566
FT                   /transl_table=11
FT                   /gene="SynRCC307_0452"
FT                   /locus_tag="SynRCC307_0452"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27355"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR46"
FT                   /protein_id="CAK27355.1"
FT                   /translation="MVATPASLEAPTLHLDLPDPEQDDLSTLEFHARLEQAWELCDRFD
FT                   LQTEIWRGRILAAVRDREKRGGEGRGAGFLQWLREREISKTRAYSLIQLAESANSLVGD
FT                   GLLEESSVNNFSKRAFVETAQADPEVQQMISEAANEGQQITRKQVRRLTDEFTAATSPL
FT                   LPDEIRERTQQNLLPPKAVAPLVRELARLPEPQQEDLRRVLKEEPELDRIKDVTATARW
FT                   LSKAAEAGMAVRALQHESIDLEKAMQEATRLDMLGLVADVVGQAQQLEQAVLKLHTSWR
FT                   RLGGLHERLWLESGSSTPYLRSLLQGLETLSGSNLRVSLGELAGGKRLRLQLVEEGADQ
FT                   LEAPPLQQAA"
FT   CDS_pept        425605..427197
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="SynRCC307_0453"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27356"
FT                   /db_xref="GOA:A5GR47"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR47"
FT                   /protein_id="CAK27356.1"
FT                   /translation="MKESSASLLQSLQQHFGYSDFRPGQREVVEALLEGRDCLAVLPTG
FT                   AGKSLCYQLPALVRGGVVLVISPLVALMQDQVAQLRRRGIAAACLHNGLPLQELRKLQQ
FT                   QIQQGTLRLLYLAPERLQGEACRQLLEDLHDQRQLVALAVDEAHCISNWGHDFRPDYRR
FT                   LGQLRRLCPGVPLVALSATAPPRVRADIIRLLSLRRPLIQVRSAQRPNLRYRMLWRPED
FT                   PLELVLAEARSARGAVLIYSRTRRGVERWAAKLRQAGLPALAYHAGMDAESRLLALQQF
FT                   QEEPQPVLVATVAFGMGVDRPDVGLVLHLELPASPEGYLQESGRAGRDGQPAEVLLLYS
FT                   DSDRSRLAWAVRQGRDGAAAQLRRMESIAEGPDCRQQALLLAVGEMAEPCGCCDRCEEP
FT                   VLIQDGQQLAQPLLRALQQAEEGLEAADLAADLADQAHPAPLWRWALRRLVEAELVKED
FT                   ASGKRHWLSSAGAGWLRRPRPLRWPQPLPILGSAQAAFTKSRSKASAGDSQVFQVPPEP
FT                   VMLSLRAPQLTAT"
FT   CDS_pept        complement(427053..427685)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0454"
FT                   /locus_tag="SynRCC307_0454"
FT                   /product="LysM-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27357"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR48"
FT                   /protein_id="CAK27357.1"
FT                   /translation="MVRPSNYSLVMRKSLLALLVVMAALPARAQEGVHVMQPKQTLYAV
FT                   SRMYGVPVKTLLQINNFANPNKIKVGTAIRLPAGTKAVNSPATTLATQSVPESTAPTTT
FT                   ETAVVTTVESEDDDTAVLAKKTPTTDWRYFGPLQVDWNNWRTMAGSLVAPTLNKQKQPL
FT                   YVAVNCGARKLNITGSGGTWKTWESPAEAFERDLVKAACADPKIGKG"
FT   CDS_pept        complement(427728..429062)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0455"
FT                   /locus_tag="SynRCC307_0455"
FT                   /product="Aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27358"
FT                   /db_xref="GOA:A5GR49"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR49"
FT                   /protein_id="CAK27358.1"
FT                   /translation="MQQLVRVGSTRQLAWRQQQLNNLEALLQELETPLRAALATDLGKP
FT                   AVEAFFEIVGVQGELKLAKKQLKRWMAPRRVTLPAVQQPGRTWVQDEPLGTVLILGPWN
FT                   YPLMLVLRPLVSALAAGNTAVLKPSEQAPALAQLLAEMVPRHFEADVVRVELGGAETAQ
FT                   ALLKQPFDHVVFTGGTTIGREVMKAAAEQLIPVTLELGGKSPCIVLDDADLQVSARRIA
FT                   WGRFLNAGQSCVAPDYVLVTPAMRQPFEAALKEAIAEFYGPDPRQSPDFGRLVSTRQFD
FT                   RVDALLKDATVLHGGERVREERYIAPTLVEGDPNSALMQEEIFAPVLPLIEVSDLEAAL
FT                   RFIAERPKPLAAYLFSRSNTARQQLIERSQSGSVAFNDVIVQAGVPGLPFGGVGPSGIG
FT                   RCHGEAGFRSLSNQKSVYQRPFALDLAWRYPPYGNRLSLLKRLLG"
FT   tRNA            429163..429237
FT                   /locus_tag="RNA_14"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACY"
FT   tRNA            429248..429329
FT                   /locus_tag="RNA_15"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized:UAY"
FT   CDS_pept        429420..429863
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="SynRCC307_0456"
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /EC_number="4.2.1.10"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27359"
FT                   /db_xref="GOA:A5GR50"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR50"
FT                   /protein_id="CAK27359.1"
FT                   /translation="MRILVLHGPNLNLLGSREPGLYGRDTLSEIDAELQQQAERLGAEL
FT                   VCFQSNHEGALVDQIQQAASEMDGILINAGAFTHTSVAIRDALLAVKLPFVELHLSNVH
FT                   AREEFRHSSYLADKAVGVICGFGPISYYLALEGMVAHLRSSQL"
FT   CDS_pept        429860..430531
FT                   /transl_table=11
FT                   /gene="miaE"
FT                   /locus_tag="SynRCC307_0457"
FT                   /product="tRNA-(MS[2]IO[6]A)-hydroxylase"
FT                   /note="Nucleotide transport and metabolism / Translation,
FT                   ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27360"
FT                   /db_xref="GOA:A5GR51"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR51"
FT                   /protein_id="CAK27360.1"
FT                   /translation="MTATPSKPVASIRWLAAPSSSLWLEQAINRPDEVLIDHAHCERKA
FT                   AGAALQLMFRYPSSETLAEALSPLAQEELEHFDQVLALLQRRGIALRPLPAPAYGSRLA
FT                   GEIRRQEPLRQLDSFLVAGLIEARSHERMALLAEHSPDPELRALYGDLLASEARHFGLY
FT                   WLLCEQHWPREVIIPRLEQLAAVEVEALSGELARPEDVRMHSVGVQLPRKNLDPVAFTP
FT                   T"
FT   CDS_pept        430591..431328
FT                   /transl_table=11
FT                   /gene="phoC"
FT                   /locus_tag="SynRCC307_0458"
FT                   /product="Acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27361"
FT                   /db_xref="GOA:A5GR52"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR52"
FT                   /protein_id="CAK27361.1"
FT                   /translation="MFLPMKRSISLVAAGLSIVVAPWPALRANPAAGLALNAEAYSAVV
FT                   GQPPAAGSAEEAKDLAILRWNQRTRYPQAVEHAWGFLNRDIGVFDTAIGANLAKAAPTL
FT                   AKGLRFFLKEVDRVKNVLKERFRRPRPFLTHKDLKPCLPLESSFSFPSGHSTWYSAAGL
FT                   LLADLLPQRRQRLLSMGQQGGYARAYCQVHYPSDVLASERLARAISKDIIASAQWQAFR
FT                   RQVAVELPALLQPPPGGLPLLSH"
FT   CDS_pept        complement(431335..431892)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0459"
FT                   /locus_tag="SynRCC307_0459"
FT                   /product="ARD/ARD' family protein (methionine salvage
FT                   pathway)"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27362"
FT                   /db_xref="GOA:A5GR53"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR023956"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR53"
FT                   /protein_id="CAK27362.1"
FT                   /translation="MSQLTIYNAVSEGNDPPLPSLHTTDAAIVAAELSQRGIRFQQWPT
FT                   HDELDAASSQEEILAAYSAEIAEVQAAGGYQTVDAISLGPDHPQRAELRQKFLSEHTHS
FT                   EDEVRFFVDGRGLFCLHIGDEVLQVLCERNDWLSVPAGTRHWFDMGERPCFSAIRFFNN
FT                   QDGWVAQFTGDPIAKRYPLLGS"
FT   CDS_pept        431976..432695
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /locus_tag="SynRCC307_0460"
FT                   /product="Precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27363"
FT                   /db_xref="GOA:A5GR54"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR54"
FT                   /protein_id="CAK27363.1"
FT                   /translation="MVGVGPGDPELITVAAQRAIAAATVVAYPVAALERPGMAAQIAQP
FT                   WLVPTQRRLPLLFPMVQEAEPRQKAWQQAASAVAAEVAAGEQVVFLCEGDCSLFASSSY
FT                   LLLALKKEAPELSAQVIPGITAASATAAAACWPLALQDEQLQVVPLPDQPDQARQLLIA
FT                   ARDQGQPLVLLKVGRRWRWLRPLLDELELLESALYGERVGWPEQLVLPAAAVAAEERPY
FT                   FSLVLLRPAWPAVLPWA"
FT   CDS_pept        432668..432988
FT                   /transl_table=11
FT                   /gene="SynRCC307_0461"
FT                   /locus_tag="SynRCC307_0461"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27364"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR55"
FT                   /protein_id="CAK27364.1"
FT                   /translation="MAGGAAMGLIDLQLAEATPVNGLWSELVERLGAERAQLACRQALD
FT                   LQSMRGEAVSLPVLLVETCGVGLIERQQLRRETGLPVPEGEGMVLLFSRPRLQFQLMQL
FT                   QR"
FT   CDS_pept        complement(432942..433949)
FT                   /transl_table=11
FT                   /gene="dus"
FT                   /locus_tag="SynRCC307_0462"
FT                   /product="Probable tRNA-dihydrouridine synthase"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27365"
FT                   /db_xref="GOA:A5GR56"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR56"
FT                   /protein_id="CAK27365.1"
FT                   /translation="MPTGSLTLGGHGVTRTLHSRVLQSPLAGVSDKVFRRLVRRWCPDA
FT                   LLFTEMVNATSLELGHGRGKVEELATEEGPIGVQLFDYRPQAMAEAAKRAEGAGAFLID
FT                   INMGCPVKKIAKKGGGSGLIREPDLAARIVEAVSQAVQVPVTVKTRLGWCGSDADPVTW
FT                   CQQLQNAGAQLLTLHGRTREQGFKGHADWQAIAQVKAALTIPVIANGDINTPDDAQRCL
FT                   AITGADGVMVGRGSMGAPWLVGQIDAALRGLPMPLAPDASGRLQLAKEQLLALVSERGD
FT                   HGLLIARKHMGWTCTGFPGAPQLRHQLMRAPTPDAAVELLNAAAASIETAAAAG"
FT   CDS_pept        434010..434609
FT                   /transl_table=11
FT                   /gene="SynRCC307_0463"
FT                   /locus_tag="SynRCC307_0463"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27366"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR57"
FT                   /protein_id="CAK27366.1"
FT                   /translation="MAMRVLVLAAAFVLAGAPALGQPAEVILLRHGDKDRQRGDYNLSP
FT                   RGFRRAINLGRLLPACFGPIQRIGSYRLAVESEKNARSYQTAVPLAVATGLNIKMFTDS
FT                   ADGTPYDGAELLQAGWAQGKTVVLFWEHRRMPALAMALGWDGMGAIGKDDFDGLYRLRY
FT                   TPGNFLPDVIVSRESELFQQACFVNATSPLPAVPLP"
FT   CDS_pept        434634..435101
FT                   /transl_table=11
FT                   /gene="SynRCC307_0464"
FT                   /locus_tag="SynRCC307_0464"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27367"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR58"
FT                   /protein_id="CAK27367.1"
FT                   /translation="MPMKDVSDLWPISRALLMQILEDRCSDQFVCERIWERLGYAPSSQ
FT                   DWTAGDNTPAPWADAFPQAPQVIAERPASVRLTRSIAKEHKQLLKQQLQFAGYRIGELY
FT                   PRRTRRATAVNWLLAWLAERAEPLEEQGPLAPELPVPEDPVTGHPGDRAVA"
FT   CDS_pept        complement(435115..435495)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0465"
FT                   /locus_tag="SynRCC307_0465"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27368"
FT                   /db_xref="GOA:A5GR59"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR59"
FT                   /protein_id="CAK27368.1"
FT                   /translation="MIDLIITSIVVDLSDQKLYAYNGPQLVRTIPVSSGKASTPTPTFS
FT                   SKVQSKHRSVTMRGRGYVAPGVPWAMCVPGGMICMHGAPWQEAAGQPYGVPRSHGCVRM
FT                   PTVQAKWLFHRTKTGTPITIQT"
FT   CDS_pept        435710..437068
FT                   /transl_table=11
FT                   /gene="SynRCC307_0466"
FT                   /locus_tag="SynRCC307_0466"
FT                   /product="GTP-binding protein engA"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27369"
FT                   /db_xref="GOA:A5GR60"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR60"
FT                   /protein_id="CAK27369.1"
FT                   /translation="MALPVVAIIGRPNVGKSTLVNRLCRSRDAIVHDEPGVTRDRTYQE
FT                   GFWGGRTFRVVDTGGLVFDDDSEFLPEIREQASLAMAEACVALVIVDGQQGLTAADEAI
FT                   AAWLRQQKCPVLLGVNKCESPEQGLAMAAEFWALGLGEPKPISAIHGAGTGDLLDQVLD
FT                   FLPPQDEEEAPEPIQMAIVGRPNVGKSSLLNTVCGENRAIVSPIRGTTRDTIDTSIERE
FT                   GQSWKLLDTAGIRRRRSVNYGPEFFGINRSFKAIERSDVCVLVIDAEEGVTEQDQRLAG
FT                   RIEEEGRACLVVVNKWDLVEKDSHTMPAMEKELRSKLYFLEWAPMLFISALTGQRVERI
FT                   FPLAVLAVEQHRRRVTTAVVNEVLQEALSWRSPPTTRGGRQGRLYYGTQVAVRPPSFTL
FT                   FVNEPKLFGDTYRRYVERQIRQGLGFEGSPVRLFWRGKQQRDAERDQARAASR"
FT   CDS_pept        437068..437949
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="SynRCC307_0467"
FT                   /product="Possible ABC-type cobalt transport system
FT                   permease component"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27370"
FT                   /db_xref="GOA:A5GR61"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR61"
FT                   /protein_id="CAK27370.1"
FT                   /translation="MDWLRQLPLGQYVAGRRGWLRRLDPRLKYAWSLAFLITPILASPW
FT                   WRLALVGLLLLITLASGLPWRLWRRSVPLLLALSLAVGLLAAVLPSPREQPQPVQRPPQ
FT                   ELQLSQPLPAPPAWELWQAGPLRITRRSAELGVNSATLLFTVMQSANLLLVSTPPEALA
FT                   WGLTALLAPLAWLGVPVERLGFQLLLALRFLPLVQEELQNLLRAVATRALNLKQLGWRG
FT                   ATNLVLAVGERLLANVLLRAEQGAEALQARGGQWRAPSQLRLPPPAAAGLNALALAGLL
FT                   LLLAMRWRYGRI"
FT   CDS_pept        437967..438233
FT                   /transl_table=11
FT                   /gene="SynRCC307_0468"
FT                   /locus_tag="SynRCC307_0468"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27371"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR62"
FT                   /protein_id="CAK27371.1"
FT                   /translation="MSVERYLNHPTFGMLYRVCPVATGEEIYATLYAQRMFFRVTSQPQ
FT                   GTSFEAMPFSDARHHAEQNLLRLRRNQSPELPLWKKLFDQTFI"
FT   CDS_pept        438237..438875
FT                   /transl_table=11
FT                   /gene="SynRCC307_0469"
FT                   /locus_tag="SynRCC307_0469"
FT                   /product="Predicted enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27372"
FT                   /db_xref="GOA:A5GR63"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR63"
FT                   /protein_id="CAK27372.1"
FT                   /translation="MGSLAQRYEAILQELPPGVKLLAVSKGRSAAEIRALYGLGQRSFG
FT                   ESRVQEAALKQQELADLADIDWQFIGRLQANKVRPVLKAFTTIHAVDSFNLAARVSRIA
FT                   GELGLCPQLYLQLKLRPDANKAGLSWAEAQSLWPQLQNLPHVHWQGVMVIPPRELAEQD
FT                   LGALFAEAVGHADALGLAGRSMGMSGDWPLAAQQGSTVVRVGSALFGSD"
FT   CDS_pept        438945..439496
FT                   /transl_table=11
FT                   /gene="SynRCC307_0470"
FT                   /locus_tag="SynRCC307_0470"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27373"
FT                   /db_xref="GOA:A5GR64"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR64"
FT                   /protein_id="CAK27373.1"
FT                   /translation="MSIFSRLKKVVAGDDYLDDDYGTELEYEDGLEPSDSTLDRGGAIA
FT                   PIGSFDDGDPFASSNVIGMPGITSAAAEVLVMEPRSFDEMPKTIQALRERKTIILNLTM
FT                   MEPDQAQRAVDFVAGGTYAIDGHQERVGESIFLFAPSCVTVTTASSEESAAPSVMAREE
FT                   EATAPAAPSPAWGTQDAING"
FT   CDS_pept        439480..440322
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SynRCC307_0471"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27374"
FT                   /db_xref="GOA:A5GR65"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR65"
FT                   /protein_id="CAK27374.1"
FT                   /translation="MPSTADSQLSFGVIGLGRMAQALLTPWLEAGLLQREQLQLSVASE
FT                   SSAQALRQRFDCPVHTDPSACLAVSELLLALKPQQLDGLVEQLGGRSAIAAAAASRSEP
FT                   PLLISVLAGVSSERLQDCFPGWRVVRTVPNTPALVRQGLVGLAFADGVSAEQQQRVQTL
FT                   FAAVGEVLELPESQLPAFLALTSSGPAFVALVAEALADGAVAAGLPRARAHHLAHRTLA
FT                   GTAALLFEQDLHPGELKDMVSSPAGATIAGIRVLEQSQLRSALMEAVVRAADRSRELG"
FT   CDS_pept        complement(440319..440921)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0472"
FT                   /locus_tag="SynRCC307_0472"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27375"
FT                   /db_xref="GOA:A5GR66"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR66"
FT                   /protein_id="CAK27375.1"
FT                   /translation="MNPLAILVVPLGYLLGSFPSGYLAGRWCAGVDIRQLGSGSTGATN
FT                   VLRQVGKGPALVVFLVDVFKGSAAVILARALLGAGAYGWLVAAGLAALAGHIWPIWLGG
FT                   KGGKAVATGFGMLLGLVPAVGMACLGVFLTSLALSRIVSISSVLAAAALPLLMAGAGAP
FT                   GAYLGLGVVAAVMVIWRHRSNLSRLLKGEEPRLGQKD"
FT   CDS_pept        complement(440918..441814)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0473"
FT                   /locus_tag="SynRCC307_0473"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27376"
FT                   /db_xref="InterPro:IPR021437"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR67"
FT                   /protein_id="CAK27376.1"
FT                   /translation="MESTPAPEPSWQQLALQELQQQRQSLEGEIKELEQRRDQLQAEIS
FT                   SHFTGQADGLSRRVKGFQDYLQGALVDLARSVEQLELVPETLAVQPSPLDQQQQQEAAK
FT                   ASEEEPAPAPVSASGLFAGETTLITERLAAFRDNPDFHADAWQLRRSLDQSGHDLLSDW
FT                   FLSQGGRGAQPSGGSRSRNVLVTAAAVSLLGDLYGERFQTLVLAGAPERLGDWRRGLQD
FT                   GLGLSREDFGPNSGVVLFERPDALIERADRLEEQGELPFIVVDAAERAVETAILQFPLW
FT                   LVFAADPQELAYEEELL"
FT   CDS_pept        441764..441937
FT                   /transl_table=11
FT                   /gene="SynRCC307_0474"
FT                   /locus_tag="SynRCC307_0474"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27377"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR68"
FT                   /protein_id="CAK27377.1"
FT                   /translation="MQGQLLPARFRRWGAFHCAMCSSLQCDSGADGHREHEEIVGLCQS
FT                   RAEPLYDLFPSP"
FT   CDS_pept        441915..442175
FT                   /transl_table=11
FT                   /gene="SynRCC307_0475"
FT                   /locus_tag="SynRCC307_0475"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27378"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR69"
FT                   /protein_id="CAK27378.1"
FT                   /translation="MTYFRRRELMPQGISPSMQRLVRRKLSRVLGGQAQVISLKEIKRK
FT                   GEWQGYCEVEGRLAQFRFIRGGRQLVVQPLLNVFRWDRSAS"
FT   CDS_pept        complement(442102..442509)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0476"
FT                   /locus_tag="SynRCC307_0476"
FT                   /product="Uncharacterized conserved membrane protein
FT                   specific to cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27379"
FT                   /db_xref="GOA:A5GR70"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR70"
FT                   /protein_id="CAK27379.1"
FT                   /translation="MADTELQPRFWVPLGVVGLGLACGLLSWIAAAVVVLFGLFLMLQT
FT                   ALLRLRFEAEALVVTRSGTEIRRFPYSDWMGWQVFWPMVPVLFYFREVKSIHFLPMLFD
FT                   ANALNEQLTTRIGPSGTRLKEAAPPADAPHE"
FT   CDS_pept        complement(442502..443254)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0477"
FT                   /locus_tag="SynRCC307_0477"
FT                   /product="ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27380"
FT                   /db_xref="GOA:A5GR71"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR71"
FT                   /protein_id="CAK27380.1"
FT                   /translation="MALRTPRWLRRLGSSCLIGGQALAAAARGRVPIGELSENLMEAGP
FT                   SSFLVVLIIGMAAGTVFNIQVAAELTKQGAGSTVGGILALGLAREIAPLLTAMLLTGKV
FT                   ATAYAASLGTMKVTEQIDAITMLRTDPVEYLVVPRVIAMLVMSPVQCLLFFGIGMWSGM
FT                   LSSSMLYRIPPPVFWSSMRTWMQPSDVPSMLLKATVFGLEIAIIACGWGLTTRGGPKEV
FT                   GTSTTGAVVMILLTIAITDVILTQVLYG"
FT   CDS_pept        complement(443261..444664)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0478"
FT                   /locus_tag="SynRCC307_0478"
FT                   /product="Na+/galactoside symporter"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27381"
FT                   /db_xref="GOA:A5GR72"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR72"
FT                   /protein_id="CAK27381.1"
FT                   /translation="MHYGGRLAHFSLVTASAAPLAGSRRRLMIGYGLGDAGTGLAATTL
FT                   GFYLFAFFTCAAGLPAFIAGSLLMVIKVWDAINDPLIGWLSDHTKTRWGPRLPWMLGAA
FT                   VPLGLSLAALWWVPPGGVAQRTIYYVVMAILLMTAYTSVNLPYAALSTELTTEKRIRTR
FT                   LNAARFTGSILSGLSGLIVASLVLNQGAAGYLLMGRITGSIAAVSTLLCCWGLAPFAKK
FT                   AQRPSGQSEPVRLQLQRIRGNGRFLRVLGLYLLLWFGLQLMQVVALIYLVQVMRVPPEL
FT                   STWILLPFQLSALVGLQLWSLLANRLGRVITLRWGATLWIVACILSMLLPPLGDDASGL
FT                   AMAPLVGLIVLVGLGASTAYLIPWSLLPDAIDADPSKPAGLYTAWMVFSQKLVIGFSMQ
FT                   LFGVLLSLSGYISASSCSGALSYIAQPTSALITIRVCMGLIPAVLVVLGLVVMRDWPSS
FT                   VPTRSEVTH"
FT   tRNA            complement(444717..444787)
FT                   /locus_tag="RNA_16"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGR"
FT   CDS_pept        complement(444796..446826)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0479"
FT                   /locus_tag="SynRCC307_0479"
FT                   /product="Alpha-glycosidase of family GH13"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27382"
FT                   /db_xref="GOA:A5GR73"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR73"
FT                   /protein_id="CAK27382.1"
FT                   /translation="MAVSIGKPWPLGSSLVGGGVNFSVAAPEATKVELLLFASGSASEP
FT                   NQIIELTPLHRSGDYWHVEVQGVGIGCCYGYRVHGPVSTAGRGFHPTKVLLDPCARAIS
FT                   GWDVYDRGLATGDHDNSAHCLKAVVTERDHFDFNSHPRPRHDWRETVIYELHPGGFSRD
FT                   LSSPASPEHRGTFLGLIDALPYLQSLGITAIELLPSMAFDPADAPDGRQNYWGYSPLSW
FT                   FAPHHGYVCGDEPLAGRQQLRQLVAACHDHGLEVFVDVVYNHTTEGSSQGPCLSWRGFA
FT                   DRLYYHQSADGIYQDVSGCGNSIAANHPLAVQLIIESMRCWALELGIDGFRFDLGAALT
FT                   RGAGLTPLDQPPLFEAMESDPELADIKLVGEPWDCGGLYRLADFPAQRVGTWNGRFRDD
FT                   LRRFWKGDDNTSWAMAQRLIASPDLYGGEPAAAGKSIHFVTAHDGFTLNDLVSYNGKHN
FT                   LANGEDNRDGDSHNNSWNHGVEGPSTDPAINTLRQRQMRNMLCTLLLSAGTPMLLMGDE
FT                   VHRSQGGNNNCWCQNNPLGWMHWQPDDDGLALKLFVQRLLRLRQQLLPWLDPERPTNLS
FT                   HQWHGVDIDKPDWASWSHCLAWSINSPTQGPRLWCGMNAYYKAMHFDLPPTASGWQRVI
FT                   DTGLPADEDLPAQPPGWRPPSAPLESRSLMLLVASDIELKL"
FT   CDS_pept        446873..447514
FT                   /transl_table=11
FT                   /gene="SynRCC307_0480"
FT                   /locus_tag="SynRCC307_0480"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27383"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR74"
FT                   /protein_id="CAK27383.1"
FT                   /translation="MDGMGIAALGSGLWAFPPSRDSDGGTAWLFHSQSGASVLVDVPLL
FT                   SDEHLSWLQQQPRGWIVLTHRQGHGRCRRLQEQLGWPVLVQEQEAYLLPTLQQRHSFGE
FT                   QRELEPGLQLLWTPGPTPGSCCLHWSQGRRDVLFCGRLLWPRGLEDVEMRIGDSTFHAT
FT                   RQQRSVGRLRTWLDAGQPAQIACAAGLGVLRGAKLVERGSVAIDTLIARN"
FT   CDS_pept        447626..447901
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="SynRCC307_0481"
FT                   /product="DNA-binding protein HU"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27384"
FT                   /db_xref="GOA:A5GR75"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR75"
FT                   /protein_id="CAK27384.1"
FT                   /translation="MNKADLVNLVAARTELTKTDVSQVVDAAIETIIDSVVEGKKVSIL
FT                   GFGSFESRERSARQGLNPKTGEKIAIPAKKVPAFTAGKMFKDRVQG"
FT   CDS_pept        448027..448902
FT                   /transl_table=11
FT                   /gene="SynRCC307_0482"
FT                   /locus_tag="SynRCC307_0482"
FT                   /product="Glutamyl-tRNA synthetase-related protein"
FT                   /EC_number="6.1.1.17"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27385"
FT                   /db_xref="GOA:A5GR76"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR76"
FT                   /protein_id="CAK27385.1"
FT                   /translation="MHLGNLRTALLSWLSARLTGAEWLLRIDDLDTPRNRPGAEAQTIA
FT                   DLQWLGLLWDGPVIRQSERRGLYHSLLSALRSQGCLYPCHCSRRMLADVSAPHGAWPLY
FT                   PGTCRGLAPDWGARKGRLPSWRLRLPAGRLHWPEQGQVSSSNLDGLSEVGDVVLRRADG
FT                   FLAYHLATAVDELWLGITDVVRGDDLWVTTGPQVALMQLLGCAPPSYWHVPLLLDKAGQ
FT                   RLAKRDGSEGLERWRCLGGRAEGLIGQWAAQLGWLPAGAELSAEELLAELKCRNSMPIT
FT                   PEGSRLIPKQ"
FT   CDS_pept        448905..449189
FT                   /transl_table=11
FT                   /gene="SynRCC307_0483"
FT                   /locus_tag="SynRCC307_0483"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27386"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR77"
FT                   /protein_id="CAK27386.1"
FT                   /translation="MLTSAAFLKEVFGIIGPGIIHTGINKTRVPMGSPAKHTKQETCTA
FT                   CGGSGMLRQGCDSYRTCLVCMGVGTVAVHDQEPVTVPAEMLSASSFAAK"
FT   CDS_pept        449186..449527
FT                   /transl_table=11
FT                   /gene="SynRCC307_0484"
FT                   /locus_tag="SynRCC307_0484"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27387"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR78"
FT                   /protein_id="CAK27387.1"
FT                   /translation="MKKAVTATTMASGTAVKSSRMTAVQSVYMAMFGSAQVRHIVGLGV
FT                   LLLLAAAGPAQAGIDFTGCTSGPDGSITCNTEPTGNTLTDDIDARYGLDDEASPGWSEY
FT                   EPYQGFDGE"
FT   CDS_pept        complement(449538..450239)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0485"
FT                   /locus_tag="SynRCC307_0485"
FT                   /product="Predicted kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27388"
FT                   /db_xref="GOA:A5GR79"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR79"
FT                   /protein_id="CAK27388.1"
FT                   /translation="MTHSALSLLQQWCRERSSNGDIVLGLCAPPGSGKSHLSRQIGSGV
FT                   VAVSIDDLYWPQPKLQQHQRGLPGSHDVPRLAQLIDEFRAQGQTLVPRFDKTLAGGAGD
FT                   RVDDQPHQGDQLLLEGWCIGARGLPSLQDYQAIWRRLDALLVLVPPTHNHVLRWRLQAE
FT                   ARQRRRGGGALHAHAVTRMVQSFYSALPPERCFQPLLDSPQLPTWSLKLDHRRRPIGSI
FT                   QPCQTGVGSDP"
FT   CDS_pept        complement(450258..450710)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0486"
FT                   /locus_tag="SynRCC307_0486"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27389"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR80"
FT                   /protein_id="CAK27389.1"
FT                   /translation="MKRLLLAALVNVAWIGASWAAPADLQLKRTSATYPNGDPIWQLQL
FT                   VEAGRVLQSWQAVASAKAHQNLDRRWSPGNGSPLPKGSYRLGQPEPWGQDLWMQLDPLF
FT                   STSRSALGIHNCYPGVGCICIPDRQTLNSLADAVRRYNVDRLTVVN"
FT   CDS_pept        complement(450714..451874)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0487"
FT                   /locus_tag="SynRCC307_0487"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27390"
FT                   /db_xref="GOA:A5GR81"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR81"
FT                   /protein_id="CAK27390.1"
FT                   /translation="MNGSNNDNNKEDNSALVPLAHQEVRYRAAPTWTRALQWAIVGCIG
FT                   FGFLYAVVARIDEVVIARGELKGMGAERPIKAPVSGVVSGIPVTEGELVTPGQVLIQFD
FT                   PEVNTERLRSLGRQKELESRRLKEEIQAFEAREDSLQAKLNSLQMTLKVEASIVDRMAG
FT                   LVSQGAIAEVQYLQQKNRLQELQSEIAQTEATLREVQAESIKSKQQIQRELADLERQLV
FT                   ETNKSQEYESLRAPVKGYVFDLIVASPGYAASSGETLLKIVPEGMLEASVFVTNADVGF
FT                   LRPKMPAQVRVDAYPFTQYGDIPGELKRVGKQSLEPDQQNPEPRFPAQVVLKRQYLEKR
FT                   GKLFPVSAGQSVSVNFIVRDKPVISLLTDSVEKAFDALRGIKTDQP"
FT   CDS_pept        complement(451874..454822)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0488"
FT                   /locus_tag="SynRCC307_0488"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27391"
FT                   /db_xref="GOA:A5GR82"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR82"
FT                   /protein_id="CAK27391.1"
FT                   /translation="MLSQQPQPKSNGWQALPGVSQEMLQPLRLNPGQALHDRDHLPPGV
FT                   LLIEQGDMRLLGLDQRKEAFTLQRFGSGEIVGGELLLRGINGLTLTAATAVEGSLLPAE
FT                   RFFQLLDRQPEHLRQFCSLSAWELWAAAASRQDPRYPTAQELLRWARQACELSDQPIRL
FT                   LAPGSHELGLSDGSWLVSSDNIEGETLGTVLQSPCRLEVLGRLPARLLPLPSHWPPQRQ
FT                   LEPLEDPLTAPAEKSITTTALPTPQVQREALEDWYGRLHNDGSYPQQNGKGPVEEPLAC
FT                   LRMLARHFDLPFRRDVLSRILNDQLKRSGQGALPLQAVAAICDLLGLRTTGLQPNSADL
FT                   LTRLPFPAITLLNGHPLVLWQARQQQLLIGDPVAGQRWINAAELLEQSAGEQLPVLCLE
FT                   RSASTPKARFGFSWFVPAIQKHRNALLQVVITSFFVQLLGLFNPLLIQQIIDAVISQGN
FT                   YSSLNVLGTLLVAMALAQALLGSLRTYLFSDTTNRIDISLGATIIHHLLRLPLGYFAKR
FT                   PVGEVSSRIAELEKIRSFLTGTALTVLLDAVFSVVYIAVMLLYSVPLTFAALGVLPLFV
FT                   GLTMGVAPIIRRQLRQQAEANARVQSHLVETLSGMETVKGQGMELPSEWRWEQLYGGQI
FT                   EAGFRNTITSTAAGSANQFLGQVSGLIVIWFGAMLVLEGKMTLGQLIAFRILSGYVTSP
FT                   LLRLASLWQNFQETALSLERLSDIVDHREEIEIAGENLPPIPPLQGAISYEGVNFRFGS
FT                   SGPLQLLNVNFEIPAGSFIGIVGSSGSGKSTLLKLLTRLFDPLEGTIRIDGYDIAKVDL
FT                   YSLRSQVGVVPQDSLLFDGTVQANIALTRPDASFEEITGAAQVACAHDFIQALPGGYSS
FT                   SVGERGSALSGGQRQRMAIARMVLKRPRLLVLDEATSALDVDTEQQVTRNLAEVYRGST
FT                   VLFITHRLGSLRHADRILVMHQGSLVEQGSHSDLMKLGGRYATLYRQQEAGQ"
FT   CDS_pept        complement(454832..455614)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0489"
FT                   /locus_tag="SynRCC307_0489"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27392"
FT                   /db_xref="GOA:A5GR83"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR83"
FT                   /protein_id="CAK27392.1"
FT                   /translation="MGDANGDQLPLNKEVCSHWLKPLDQAKNPQSSFSSQQLASWGLLR
FT                   QARREAAIDDCLHSIPPPPAEQLKAMLEQWCQQQRIDSPQTLQRWQQQQGLSPEQWQQF
FT                   VARRWRWLLWCEQNLQAKLNSHYLERKSQLDQVSYSLLRVKDQHLANELHLRIKEGEAS
FT                   FEEIASEYSEGPERQQGGRLGPVPLSQPHPMLAKLLQVSTPGQLWPAKQLEDWWIVVRL
FT                   EELHCTELTDSLKQRLLFELGDQHLEEQLSAAKSQGQA"
FT   CDS_pept        455591..455830
FT                   /transl_table=11
FT                   /gene="SynRCC307_0490"
FT                   /locus_tag="SynRCC307_0490"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27393"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR84"
FT                   /protein_id="CAK27393.1"
FT                   /translation="MVAIGIPQWSYISCHCYGWSGNWGWNERRFRNLASGPSDGRRCGG
FT                   ADRVVGERSVEAKFAHAWIGLAFAVQFFSELTQG"
FT   CDS_pept        complement(455750..455992)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0491"
FT                   /locus_tag="SynRCC307_0491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27394"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR85"
FT                   /protein_id="CAK27394.1"
FT                   /translation="MLSPSTIATDRATWVIRAKREAVRRHGDRWGLAHDRTTIKLLFRW
FT                   DILSREERDLALRELREELHSKCQANPGMGKFRFY"
FT   CDS_pept        455983..456168
FT                   /transl_table=11
FT                   /gene="SynRCC307_0492"
FT                   /locus_tag="SynRCC307_0492"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27395"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR86"
FT                   /protein_id="CAK27395.1"
FT                   /translation="MTTRAHADHSISTYGGCGVMAWMPYTISTVEKKIKPTHITCTIKL
FT                   VFLLKRLSLTPSPAVR"
FT   CDS_pept        complement(456261..456524)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0493"
FT                   /locus_tag="SynRCC307_0493"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27396"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR87"
FT                   /protein_id="CAK27396.1"
FT                   /translation="MSVAVATTQTLLSTKISTEATEFMQPSIALSLNQHLELEQSRRHL
FT                   DGIDDLQRLKDMAKEFLLNWQLERAESKRIIQEELSPQSLSL"
FT   CDS_pept        complement(456565..456843)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0494"
FT                   /locus_tag="SynRCC307_0494"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27397"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR88"
FT                   /protein_id="CAK27397.1"
FT                   /translation="MMSESAELLDHLLEAVGAVACSAQSPTHRAAAHKAMGEALQILQS
FT                   APIAALNGIQPQHSAQPSELEGGWHIGVVERSPKQAMAGTHTKQAQP"
FT   CDS_pept        complement(456936..457265)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0495"
FT                   /locus_tag="SynRCC307_0495"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27398"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR89"
FT                   /protein_id="CAK27398.1"
FT                   /translation="MRGALIALSLGAGLGLLSACSNTAEAESKTAWCALFRESDNSAEL
FT                   PEPVPCQFSQKQGDVTISIDGQRYDFAASEQGKTYQRDNHTLGIGFSRQDDFTLVVFWE
FT                   DPRQQ"
FT   CDS_pept        457144..458022
FT                   /transl_table=11
FT                   /gene="SynRCC307_0496"
FT                   /locus_tag="SynRCC307_0496"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27399"
FT                   /db_xref="GOA:A5GR90"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR90"
FT                   /protein_id="CAK27399.1"
FT                   /translation="MSLSRNSAHQAVLDSASAVLLQALSSPSPAPRLSAIRAPRIGSSF
FT                   HRFRSTAFQGLCHGRFIARGWVVLTSVSVLFNLKERLQSLRMLKGLGQFLQHPDDLQSV
FT                   YAVAASVQGSPMAAQMMRHMLSEPGIAAMIQEQWRPAAIDLDALEQLPAGSLGQCYASQ
FT                   LKAQGITPETLIDPAPITNDQDFIVHRLKETHDIVHVLTGFGVDGVGEIGLQAFNLAQN
FT                   RSPLAVLLIFGGMLKTLQDDQPLEALLHAISRGFEMGLKAECVVGYKLEDGWQRPLSEW
FT                   RAELKLPQALA"
FT   CDS_pept        458219..458671
FT                   /transl_table=11
FT                   /gene="SynRCC307_0497"
FT                   /locus_tag="SynRCC307_0497"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27400"
FT                   /db_xref="GOA:A5GR91"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR91"
FT                   /protein_id="CAK27400.1"
FT                   /translation="MSCAVNHPSVDLSMAIQISMAPAFLLVAISNLINGITATRQRIID
FT                   RYRELSAENRDVLIPPDDVEYEKSVLRHRVSLSTRAITLLTSAIMLIALVIFIIFISLV
FT                   SPAIDLTLTLAPLFAFAMLSVIVASVFFLRQLRVSSQQLRRIGLSA"
FT   CDS_pept        complement(458668..458970)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0498"
FT                   /locus_tag="SynRCC307_0498"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27401"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR92"
FT                   /protein_id="CAK27401.1"
FT                   /translation="MRKRFFAGVTEKSRFDFPLRGFSRNPDLPLQLLTSDWGNDEGMTE
FT                   ITYQKLLAAWRFEVVRTQGGVLFIGPNHFFSLPHEPRTKAERKIAIAHIRSLCKL"
FT   CDS_pept        complement(459162..459359)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0499"
FT                   /locus_tag="SynRCC307_0499"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27402"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR93"
FT                   /protein_id="CAK27402.1"
FT                   /translation="MRMGWMQNLWRRDLYARMARLYRLGQPDTKRIARLRAFGMSQRQI
FT                   ANNLGLKPELVNKSVGRYYS"
FT   CDS_pept        459359..459706
FT                   /transl_table=11
FT                   /gene="SynRCC307_0500"
FT                   /locus_tag="SynRCC307_0500"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27403"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR94"
FT                   /protein_id="CAK27403.1"
FT                   /translation="MNVSSQLKCVQLCADISLPSGFFQTSHIGGGLRFAAMGYLRCVMA
FT                   LAMVVPLASQARADGIRFLPDDAQIACRAILPQCFTQAGWHRLCQNDPAMAKAHQVACR
FT                   QAAAGVKDAVD"
FT   CDS_pept        459730..460416
FT                   /transl_table=11
FT                   /gene="SynRCC307_0501"
FT                   /locus_tag="SynRCC307_0501"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27404"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR95"
FT                   /protein_id="CAK27404.1"
FT                   /translation="MGPIAVSGASGKTGWRVVDEALQRGLGVRAIVRPNSVVPTPLAEA
FT                   ERQGRLQVFRLELNTAEALHHAFNGCCALVIATGARPSINLVGPLQVDAFGVRSQLKAC
FT                   AAVGLSRVVLVSSLCAGRWRHPLNLFGLILLWKRLGERWLEQSGLDWTVIRPGGLSEDD
FT                   SRSGQEGVVFSGADQQSSSSIPRRLVAQVCLDALDEPEACGRIIEITSSAQQPRCSLGE
FT                   WLAQPV"
FT   CDS_pept        460493..460663
FT                   /transl_table=11
FT                   /gene="SynRCC307_0502"
FT                   /locus_tag="SynRCC307_0502"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27405"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR96"
FT                   /protein_id="CAK27405.1"
FT                   /translation="MMNAMACVVNPLAPLETPMGSRPRPLHDLAHESHDQFWEKECAER
FT                   PNALGCRLFDD"
FT   CDS_pept        460706..460912
FT                   /transl_table=11
FT                   /gene="SynRCC307_0503"
FT                   /locus_tag="SynRCC307_0503"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27406"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR97"
FT                   /protein_id="CAK27406.1"
FT                   /translation="MNVFPSVMNQSLPQDMASQPSLQLVQPEDFSHGMVSVGAQIAELN
FT                   SLTDLVANLEQDALTGGADFVGK"
FT   CDS_pept        complement(460881..461045)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0504"
FT                   /locus_tag="SynRCC307_0504"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27407"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR98"
FT                   /protein_id="CAK27407.1"
FT                   /translation="MQLAGWGLEVKALPALPVTPQLLLPGAYPVISACRRFEQRAVSAL
FT                   TFQQSQRRP"
FT   CDS_pept        complement(461083..461355)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0505"
FT                   /locus_tag="SynRCC307_0505"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27408"
FT                   /db_xref="InterPro:IPR023810"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR99"
FT                   /protein_id="CAK27408.1"
FT                   /translation="MPEKQQARLMGSSATGMATDKELIKEAGQELWNTVKKLRPGLPKE
FT                   ARSQLVLKALLTIGDLPDQLQASMVLGQIADQEPDEAPEKEGAKS"
FT   CDS_pept        461419..461595
FT                   /transl_table=11
FT                   /gene="SynRCC307_0506"
FT                   /locus_tag="SynRCC307_0506"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27409"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA0"
FT                   /protein_id="CAK27409.1"
FT                   /translation="MKPCSWLAIAVMLSLWASGVVAQQAEEPDQPADRAEDCRIGVDEM
FT                   EHFRRTRRLTKSC"
FT   CDS_pept        complement(461597..461803)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0507"
FT                   /locus_tag="SynRCC307_0507"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27410"
FT                   /db_xref="GOA:A5GRA1"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA1"
FT                   /protein_id="CAK27410.1"
FT                   /translation="MLADLLRIILAFFLPPLAVATQVGVQASAFWLNLIFWLLSFGGLG
FT                   LPVLAIMWPVAVIHALYIIITRK"
FT   CDS_pept        461880..462380
FT                   /transl_table=11
FT                   /gene="SynRCC307_0508"
FT                   /locus_tag="SynRCC307_0508"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27411"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA2"
FT                   /protein_id="CAK27411.1"
FT                   /translation="MHPMLSGSMFKLVSVAAPGLVAIVLGLGGCASFDQNKPAAQSDAA
FT                   SATKELQIKPILQTTTGLSGKTFTYPEGEAELRLLRVEFPVGGSVPLHTHPAPLIAYVS
FT                   QGQIRHTRGDQVNTFGPGQAFVESDQGGPHTVENIGEEPAVVFVAVASKQGLPTTNFMT
FT                   SAP"
FT   CDS_pept        462377..462535
FT                   /transl_table=11
FT                   /gene="SynRCC307_0509"
FT                   /locus_tag="SynRCC307_0509"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27412"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA3"
FT                   /protein_id="CAK27412.1"
FT                   /translation="MTRRTPYGAFSVLALVIFAIAAVIMATTTGRWEQEALEKQPDFQD
FT                   QPTLPAN"
FT   CDS_pept        462923..463093
FT                   /transl_table=11
FT                   /gene="SynRCC307_0510"
FT                   /locus_tag="SynRCC307_0510"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27413"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA4"
FT                   /protein_id="CAK27413.1"
FT                   /translation="MAKVIPLFPGRPPGGLDRSERLDDLRCRLADQEAAIKALNDQLHE
FT                   LVFCLLTREPA"
FT   CDS_pept        complement(463202..463453)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0511"
FT                   /locus_tag="SynRCC307_0511"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27414"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA5"
FT                   /protein_id="CAK27414.1"
FT                   /translation="MDQSLATASTRFNLKSLVHSEVPMERQPSDIRQTLFFSASSMGVE
FT                   AIDDCEQTFANDPSQAIAGLGAAVVSWCVMVERALWMI"
FT   CDS_pept        complement(463472..463843)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0512"
FT                   /locus_tag="SynRCC307_0512"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27415"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA6"
FT                   /protein_id="CAK27415.1"
FT                   /translation="MLAMLRSAAVGLSLALLPAAGLAGLSDFDRTAERVATAICIGVHT
FT                   DASYNQAWDQGKPDALAIGLTVERIEAVKANQGVEAIQNRANEMIRDVGCQALIPEQAY
FT                   GVFGPFKPLGPSSFEGFYD"
FT   CDS_pept        463971..464240
FT                   /transl_table=11
FT                   /gene="SynRCC307_0513"
FT                   /locus_tag="SynRCC307_0513"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27416"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA7"
FT                   /protein_id="CAK27416.1"
FT                   /translation="MNNPQAIPTSICAAGALLREVIQNQLHELEPLQRSKLQLALRPDC
FT                   MSEAMKESLALAVREIHGFTQHTTANLFEAVLDCGEEQEPTPGS"
FT   CDS_pept        464299..464646
FT                   /transl_table=11
FT                   /gene="SynRCC307_0514"
FT                   /locus_tag="SynRCC307_0514"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA8"
FT                   /protein_id="CAK27417.1"
FT                   /translation="MPESGPDPYVQFLENWIPGIGECTELHDKLHEHFELDFSVNSEAR
FT                   LLGFQLGHHPAGNFLHVMIFAVISTLLYPSPYRNDWSGLRDFFRSYVLGKNFQLISYWF
FT                   IPRGILAWRSL"
FT   CDS_pept        464656..465036
FT                   /transl_table=11
FT                   /gene="SynRCC307_0515"
FT                   /locus_tag="SynRCC307_0515"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27418"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA9"
FT                   /protein_id="CAK27418.1"
FT                   /translation="MAGGSPAGGDDPWAGVRPEPQLQTREPNRPAGPVATSAHHGGLMD
FT                   DQIAPSAPITLAAALLSDSLESCLKHLDPTQQFKASMALDPDFISPETRERVGAAIQEL
FT                   YDLAEGSAAILIDELLDGPTTP"
FT   CDS_pept        465067..465327
FT                   /transl_table=11
FT                   /gene="SynRCC307_0516"
FT                   /locus_tag="SynRCC307_0516"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27419"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB0"
FT                   /protein_id="CAK27419.1"
FT                   /translation="MNNVSPSAAEAIAGALFAKSIDDCLEGLNDAERFKASMALKQVYM
FT                   SEQTRSRLNQAVQEVNELALSRAAVFIDGLLDGDKEEITPL"
FT   CDS_pept        465393..465851
FT                   /transl_table=11
FT                   /gene="SynRCC307_0517"
FT                   /locus_tag="SynRCC307_0517"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB1"
FT                   /protein_id="CAK27420.1"
FT                   /translation="MGASDVLIGDLAMKTASSIGIGCLAVAAAFFSLELLTATASASPT
FT                   AGPMRIATTPLLLWRRQEQLSDQQREALFQAQRRWKQTSYSSRAALMQQEKQCVDRATS
FT                   KLAFKRCLKQTRQSRSALREQYYAYINPIRQELGLAPLEWVERRSPRR"
FT   CDS_pept        465872..466138
FT                   /transl_table=11
FT                   /gene="SynRCC307_0518"
FT                   /locus_tag="SynRCC307_0518"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27421"
FT                   /db_xref="InterPro:IPR012663"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB2"
FT                   /protein_id="CAK27421.1"
FT                   /translation="MTKLAQHWTSVEEQLGFRHFRVVGQGGRSAERWVELVAVLDATQR
FT                   LRLPLRDLRDPALWMSGLQPVVEDMPSDPALEAQGSEQEPLPK"
FT   CDS_pept        complement(466097..466261)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0519"
FT                   /locus_tag="SynRCC307_0519"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27422"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB3"
FT                   /protein_id="CAK27422.1"
FT                   /translation="MEDAMTKAIDPSATSNGNQHHNAQRRLTTLGLVAKQLATDDLLGQ
FT                   GLLLRALGF"
FT   CDS_pept        complement(466293..466526)
FT                   /transl_table=11
FT                   /gene="hli"
FT                   /locus_tag="SynRCC307_0520"
FT                   /product="High light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27423"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB4"
FT                   /protein_id="CAK27423.1"
FT                   /translation="MTTSTLPTPTGLITTDGEGHGNVYAREPKMEYAAADAGWGFHERA
FT                   EKLNGRLAMVGFVAALATELLTGEGLLHTIGL"
FT   CDS_pept        complement(466610..466828)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0521"
FT                   /locus_tag="SynRCC307_0521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB5"
FT                   /protein_id="CAK27424.1"
FT                   /translation="MTERNSDRLPHCGWVYGKGQPPQPFLITATNADGSAVGYRAGNNQ
FT                   TIPAGEWFFELPASDEDQVQWAELLGH"
FT   CDS_pept        467234..467389
FT                   /transl_table=11
FT                   /gene="SynRCC307_0522"
FT                   /locus_tag="SynRCC307_0522"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27425"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB6"
FT                   /protein_id="CAK27425.1"
FT                   /translation="MVRAGMFRRPQFADALSWLLFLSVGVLTAEAEPHPGTFVFDEAHP
FT                   PQQQLW"
FT   CDS_pept        complement(467394..468278)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0523"
FT                   /locus_tag="SynRCC307_0523"
FT                   /product="Putative carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase"
FT                   /EC_number="2.7.8.23"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27426"
FT                   /db_xref="GOA:A5GRB7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB7"
FT                   /protein_id="CAK27426.1"
FT                   /translation="MATQRRDAEHLRGLLAQDTCHVMPCCFDALSARLIEQAGFPLTFM
FT                   SGFSVAAARAGLPDTGLLTVSEMLDQGRSICDAVNLPVIGDGDNGHGNAANVHRTMHQF
FT                   ARAGFAGIMLEDQSSPKRCGHTGVKAVVEREQALERIRAAVQAREQGADLVIIARTDAR
FT                   SALAASHGEAQALEEALWRLNAFADLGADVVFLEAPRSEQEMDRFCRQVPGWRMANMLE
FT                   GGLTPWLPPDALAAMGFRLAAYPLTLISAAAFAMKTALSALQSGTAPQQLLSFSELKDL
FT                   VGFPAYDQAASSN"
FT   CDS_pept        468832..469299
FT                   /transl_table=11
FT                   /gene="SynRCC307_0524"
FT                   /locus_tag="SynRCC307_0524"
FT                   /product="Staphylococcal nuclease homolog"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27427"
FT                   /db_xref="GOA:A5GRB8"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB8"
FT                   /protein_id="CAK27427.1"
FT                   /translation="MASTKVSAGWTLLVMAMRKPRHPPRGPRIGRAHALLALLLSGLPA
FT                   VAAPTVMIERCHDGDTCRTTSGEAIRLACIDAPELTGPPNAQRLAQASRDYLRELVVGK
FT                   EVLIRRIGKDRYGRAVAEIYLWPLNIGEEMVASGHARILDRYASQCPWALL"
FT   CDS_pept        469560..469931
FT                   /transl_table=11
FT                   /gene="SynRCC307_0525"
FT                   /locus_tag="SynRCC307_0525"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27428"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB9"
FT                   /protein_id="CAK27428.1"
FT                   /translation="MLTGEELLAKVKEMGGASKSEVVKACGYVSQKKDGSDRLNFTAFY
FT                   EALLEAKGVGIGSGGGVGKGGRKLSYKAVVQGNGNLLVGKAYTALLNLVPGDEFEIKLS
FT                   KKKGVTLVPKGEEEETDEG"
FT   CDS_pept        complement(470150..470398)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0526"
FT                   /locus_tag="SynRCC307_0526"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27429"
FT                   /db_xref="GOA:A5GRC0"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC0"
FT                   /protein_id="CAK27429.1"
FT                   /translation="MDSKDVAIRRIRKRKKLNKQWQVYLFVNLILLLVWGLSGGGYFWP
FT                   IWVIVFWGLSLAWEQWRFDHPEKAITEQEIQDELSRM"
FT   CDS_pept        complement(470448..470639)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0527"
FT                   /locus_tag="SynRCC307_0527"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27430"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC1"
FT                   /protein_id="CAK27430.1"
FT                   /translation="MDPFFGVPMPVTPPAEVRACMATQLGQDVFLSRGGPSGNVTPAGG
FT                   EITQEELNIAHRFCTTLE"
FT   CDS_pept        470676..470921
FT                   /transl_table=11
FT                   /gene="SynRCC307_0528"
FT                   /locus_tag="SynRCC307_0528"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27431"
FT                   /db_xref="GOA:A5GRC2"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC2"
FT                   /protein_id="CAK27431.1"
FT                   /translation="MTASLTNQFGTVGSAGSIRSSGGWQAPMDWNDDALAALKKDVPFF
FT                   VRPAVRRRVESMAAEENRPSIDLSFYQQAKASMGPK"
FT   CDS_pept        470918..471406
FT                   /transl_table=11
FT                   /gene="SynRCC307_0529"
FT                   /locus_tag="SynRCC307_0529"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27432"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC3"
FT                   /protein_id="CAK27432.1"
FT                   /translation="MNQRRFFLKDLNCLAPMIKAGAGLLACSVGLLTSTPAQATSLHPC
FT                   GSIRIANTTFCFLDANGDGRYQEGEEEFCLDGWLTRGGLRCRGEGVKATPGSQASVITI
FT                   RVLTSWDESCPGSMSVDQINHHLRNGYRIVGTKTQTEMISTTGQPIACSYTTYSLQQR"
FT   CDS_pept        471437..471754
FT                   /transl_table=11
FT                   /gene="SynRCC307_0530"
FT                   /locus_tag="SynRCC307_0530"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27433"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC4"
FT                   /protein_id="CAK27433.1"
FT                   /translation="MGKALMRPLVIAFTTVLSAAPAQAEIVQAWCSLMWRDGRAQIEQG
FT                   PCDFRQAFGNVQVWMGERWAFDFPADGQGRYYTRRNRNDFIRFERGGYILTVFQGGQPA
FT                   R"
FT   CDS_pept        complement(471925..472194)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0531"
FT                   /locus_tag="SynRCC307_0531"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27434"
FT                   /db_xref="GOA:A5GRC5"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC5"
FT                   /protein_id="CAK27434.1"
FT                   /translation="MLVEMFAVLYGIAFFVLLGCAFMQMRQGWSARSQQPRANNLMRDR
FT                   TGLKTIHPELLDGNGELIKDELLTVSFDNVSDGPFTSPGAQPGY"
FT   CDS_pept        472316..472570
FT                   /transl_table=11
FT                   /gene="SynRCC307_0532"
FT                   /locus_tag="SynRCC307_0532"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27435"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC6"
FT                   /protein_id="CAK27435.1"
FT                   /translation="MGGNSAGLASSCVGSTTRIVRDSDEVSAGVLCSGGGSGCVLVGGS
FT                   VSCFGSGRMSVGGSGSWFGSGAAKEGLTPVAPGHEPFSR"
FT   CDS_pept        473277..473576
FT                   /transl_table=11
FT                   /gene="SynRCC307_0533"
FT                   /locus_tag="SynRCC307_0533"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27436"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC7"
FT                   /protein_id="CAK27436.1"
FT                   /translation="MAAKYLNNVRVRCKEGCEEKFIAETEQWVNPEGMLDAYWAKTGER
FT                   SYCFVGLWESEEKLVAARPLMIEHLNKVRDFFEEISPELGVTDPVSGSVVTHKS"
FT   CDS_pept        474001..474177
FT                   /transl_table=11
FT                   /gene="SynRCC307_0534"
FT                   /locus_tag="SynRCC307_0534"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27437"
FT                   /db_xref="GOA:A5GRC8"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC8"
FT                   /protein_id="CAK27437.1"
FT                   /translation="MTEPSTPKPKKKGLGFFYAVGTGFLVLLVFASTAYSERESIKLID
FT                   PMQRELAAPMPQR"
FT   CDS_pept        474177..474407
FT                   /transl_table=11
FT                   /gene="SynRCC307_0535"
FT                   /locus_tag="SynRCC307_0535"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27438"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC9"
FT                   /protein_id="CAK27438.1"
FT                   /translation="MKKPRYWLCFWDGHQSRIEPTNATTREEAIREGLEFSLDHLTAVF
FT                   SQEAGFSHAEMVELSAVLPPLGLPLWTPPDQ"
FT   CDS_pept        474513..474695
FT                   /transl_table=11
FT                   /gene="SynRCC307_0536"
FT                   /locus_tag="SynRCC307_0536"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27439"
FT                   /db_xref="GOA:A5GRD0"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD0"
FT                   /protein_id="CAK27439.1"
FT                   /translation="MMPLAQALPIIPLASGSDLAKALLISGLVFLAFFIPWQLRRRHVR
FT                   RFQRRISMRERDRGS"
FT   CDS_pept        complement(474771..474950)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0537"
FT                   /locus_tag="SynRCC307_0537"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27440"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD1"
FT                   /protein_id="CAK27440.1"
FT                   /translation="MSNEMSPIKLTDAPDGFEYYKVCDPQGVCRVVRGFQEAQRVMKET
FT                   PGLTATKLPGAKAT"
FT   CDS_pept        complement(475473..476315)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0538"
FT                   /locus_tag="SynRCC307_0538"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27441"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD2"
FT                   /protein_id="CAK27441.1"
FT                   /translation="MPPTDGLPQLSRRERTVLDDNPWFIDGCQVYARQNLQARHDRHLI
FT                   AAAYAREGYSVQPIEREATTLERQRCSTQKAQTDAANEREAGRVADASPPSDDQSPEAS
FT                   AATRKKDQICNRFNIVPAELTTQHVLDIGNAFPALRNRLLYDNTTALGLFTHGRLKQLG
FT                   DAYVLDRVRIAKLHLQLHWIKQLTTEACAADLLTSKDWFSANDAWVKLSHRLVMEDSCA
FT                   KRYPSRRHSASAVLSALCRQFCASLASARKQSRSGLVGKSFVFTASQARCTTSPLPRC"
FT   tRNA            476447..476523
FT                   /locus_tag="RNA_17"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGR"
FT   CDS_pept        476582..477352
FT                   /transl_table=11
FT                   /gene="SynRCC307_0539"
FT                   /locus_tag="SynRCC307_0539"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27442"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD3"
FT                   /protein_id="CAK27442.1"
FT                   /translation="MAPARLSDSQKQELVSQFKAGVTAAALAEAFGCSPNTVSRTVKAL
FT                   LSPEEYEGLKQKRSGRGTAAVAVKEDEPKADEPETETAPEAPSPEAELEADEPLEGSSS
FT                   LALDDADDFGADDSDEELDELSDDDSVAETFVAIAPLPGLGVIDGGAPCVSKPLVDGSL
FT                   PSTVYLLVDRDVELKGTPVKDFSELGAVAATEMEHKAIALFSNPRQAKRQCGRSQRVIK
FT                   VPDSGVFGRTAPFILAQGISRIVLEGSLYAIPGA"
FT   CDS_pept        complement(477354..477569)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0540"
FT                   /locus_tag="SynRCC307_0540"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27443"
FT                   /db_xref="GOA:A5GRD4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD4"
FT                   /protein_id="CAK27443.1"
FT                   /translation="MLLRLRLLTGTMVSSLLLLVMLCLGSQNLNQREPLQLGFGQSAPL
FT                   PTGFVVGIALVCGVFSGGSVAALLRR"
FT   CDS_pept        complement(477590..478438)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0541"
FT                   /locus_tag="SynRCC307_0541"
FT                   /product="Tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27444"
FT                   /db_xref="GOA:A5GRD5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD5"
FT                   /protein_id="CAK27444.1"
FT                   /translation="MKEPSPGVLYLVGTPIGHRGDLSPRAQQLLAAVDRVACEDTRHSG
FT                   LLLHGLGIQQKLISFHQHNQQQRIPELLQALADGEAVALISDAGLPGISDPGEELVAAA
FT                   RAAGRTVICIPGPCAATTALVSSGLPSGRFCFEGFLPAKGRERQQRLTAIAQEERTSVL
FT                   YEAPHRLLQLLKELIEHCGAERPVQVARELTKRHEQHVGPTLAAALEHFSACKPQGECT
FT                   VVLGGAPASEPEAWNADALRAQLQQLQAGGLSASDAARELASRSGHSRRELYALLHSAA
FT                   D"
FT   CDS_pept        478440..479357
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="SynRCC307_0542"
FT                   /product="3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27445"
FT                   /db_xref="GOA:A5GRD6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD6"
FT                   /protein_id="CAK27445.1"
FT                   /translation="MALACDQSMMPTTEAILVVLRRLVWESADILRAYARSEQPPFGYP
FT                   PALSVDNGGEGPVSAADLAVNQHLLDGFRSNFPDAPWALLSEETAAEQLTAGVPLDAEW
FT                   LWILDPLDGTKDFLQGTGEYAVHLALVHHQRPVLGVVLQPEREEVWFGLVDEQKAWCET
FT                   RDGTQRPAQLSSRVQRSDLVLVASRNHRDERLERLLEALALGDTKAIGSVGGKVATILR
FT                   GETDVYISLSGRSAPKDWDMAAPEAVLLAAGGAFSHADGAPLLYNDGDVRQAGCLIASN
FT                   GKAQAELCELARACLAEIDPGFAV"
FT   CDS_pept        complement(479354..481513)
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="SynRCC307_0543"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27446"
FT                   /db_xref="GOA:A5GRD7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRD7"
FT                   /protein_id="CAK27446.1"
FT                   /translation="MQGETRSISFDGREIRLTTRRYAPQAGGSVLIECGDTAVLVTATR
FT                   ANGREGIDFLPLTCDYEERLYAAGRIPGSFMRRESRPPERATLACRLIDRPIRPLFPSW
FT                   MRDDLQIVATVMSVDERVPPDVLAVTGASLATLLAKIPFYGPMAAVRVGLLGDDFILNP
FT                   SYREIERSELDLVVAGTAEGVVMVEAGAQQLPEEDMIEAIDFGYEAVLELIRHQKETIA
FT                   ELGIEQVVPEKPAEDTTVPDYLAKQCTKDIGAVLSQFTLTKAERDSQLDSIKAKAAEAI
FT                   AALKETDAVRAAVSSNGKLLGNSFKALTKSMMRAQIVKDGKRVDGRSLDQVRPISAAAG
FT                   VLPKRVHGSGLFQRGLTQVLSTATLGTPSDAQEMDDLNPSNEKHYLHHYNFPPYSVGET
FT                   RPMRSPGRREIGHGALAERALLPVLPPKESFPYVLRVVSEVLSSNGSTSMGSVCGSTLA
FT                   LMDAGVPIAAPVAGAAMGLIREGSEVRVLTDIQGIEDFLGDMDFKVAGTEKGITALQMD
FT                   MKITGLAMKTIGEAVTQARPARLHILEKMLEALDKPRDTMSPHAPRRLSFRIDPELIGT
FT                   VIGPGGRTIKGITERTNTKIDIEDTGIVTVASHDGAAAEEAQKIIEGLTRRVSEGEYFD
FT                   GKVTRVIPIGAFVEILPGKEGMIHISQLSDQRVEKVEDVVNVGDEVRVRVREIDNRGRI
FT                   NLTLRGVPQDGSDPQPTVILPIGES"
FT   CDS_pept        complement(481544..482152)
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="SynRCC307_0544"
FT                   /product="Leu/Phe-tRNA-protein transferase"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27447"
FT                   /db_xref="GOA:A5GRD8"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD8"
FT                   /protein_id="CAK27447.1"
FT                   /translation="MNDLLAAYAAGWFPMAEGPDRALGLFRARNRALIPLDQRFHVPRS
FT                   LRRQLRPGRFELKLNSAFAAVVDGCADRPSTWISLELRAIYQELHRLGWAHSIEAWDAH
FT                   GLAGGQLGLAIGRCWIGESMFHSRPHASNVVLVQLQSALRQGGFELFDVQLSNPHLERF
FT                   GCFELSDADYTSCLAKAVQQPARLQIGSSAVSSGAWMPR"
FT   CDS_pept        complement(482149..482451)
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SynRCC307_0545"
FT                   /product="30S ribosomal protein S14"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27448"
FT                   /db_xref="GOA:A5GRD9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRD9"
FT                   /protein_id="CAK27448.1"
FT                   /translation="MAKKSMIARDVKRKKMVERFAAKRSALMEAFANAADPMERLEIHR
FT                   KIQQLPRNSAPTRMRNRCWATGKPRGVYRDFGLCRNQLRERAHKGLLPGVVKSSW"
FT   CDS_pept        complement(482500..483588)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0546"
FT                   /locus_tag="SynRCC307_0546"
FT                   /product="Predicted membrane-associated Zn-dependent
FT                   protease"
FT                   /EC_number="3.4.24.-"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27449"
FT                   /db_xref="GOA:A5GRE0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE0"
FT                   /protein_id="CAK27449.1"
FT                   /translation="MGVLSALLILALLVVVHEAGHFLAAVCQGIRVTSFNVGFGPALLQ
FT                   KQRNGVLYALRLIPLGGFVAFPEDEPDNDIDPRDPDLLKNRPLSQRALVIAAGVIANVI
FT                   LAWVVLVGQGLVVGIPSGFSATGGVLVTGVQPQQAAARAGLEPGDTLIGLNGQPLGGGS
FT                   TAVQTLVDAVKSSPSQELQVEIKRQGETLSVPMIPADLGGSGRIGAQLQPAGVENFRRP
FT                   ANPLEVISRANRDFAAIWTRTIDGFWTLITNFGETASQVSGPVKIVEMGAQLAEQGGSS
FT                   LFLFTALISINLAVLNALPLPMLDGGQFVLLLIEGLRGRPLPERIQMAFMQSGLVLLLG
FT                   LSAVLIVKDTSQLSLVRQLMGN"
FT   CDS_pept        complement(483610..484887)
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SynRCC307_0547"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27450"
FT                   /db_xref="GOA:A5GRE1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRE1"
FT                   /protein_id="CAK27450.1"
FT                   /translation="MLDQRLLRDNPELISQQLGRRGMEVDLTKLQLIAKQERDLEEQRS
FT                   NLQAEGNRTGKEVGMLIKGGAAPDSDEVKALREKGNRIKQQVAVLEEEEKGLEAKLREQ
FT                   LLALPNLPSADAPEGKSEADNVEVKRWGEPRQGKDLEEHWQLADRLGLFETERSVRIAQ
FT                   SRFITLMGDGARLERALISFMLDLHSTKGYTEVMPPILVNSASLTGSGQLPKFAEESFR
FT                   CADDDLWLTPTAEVPLTSLHRDEVIAVEQLPLKYAAYTPCFRREAGSYGRDTRGLIRLH
FT                   QFNKVELYWFCHPEKSAEAHEQLTLDAEAVLEALELPYRRLELCTGDMGFSAARTYDLE
FT                   VWLPGAGSYREISSCSTCGDFQARRSAIRFKEGKGTQLLHTLNGSGLAIGRTMAALLEN
FT                   GQQPDGSIQLPAALVPYFGRERLTPQ"
FT   CDS_pept        complement(484928..485194)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0548"
FT                   /locus_tag="SynRCC307_0548"
FT                   /product="NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27451"
FT                   /db_xref="GOA:A5GRE2"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE2"
FT                   /protein_id="CAK27451.1"
FT                   /translation="MTTDTAAATNDPQALTLENVERTLDELRPFLMADGGNVEVVEIDG
FT                   PIVKVRLQGACGSCPSSTMTLKMGIERKLREAIPEVSEVVQVL"
FT   CDS_pept        485238..486671
FT                   /transl_table=11
FT                   /gene="mqoA"
FT                   /locus_tag="SynRCC307_0549"
FT                   /product="Malate:quinone oxidoreductase"
FT                   /EC_number="1.1.99.16"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27452"
FT                   /db_xref="GOA:A5GRE3"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRE3"
FT                   /protein_id="CAK27452.1"
FT                   /translation="MTDRYDAVLVGAGIMGATLAALLHELDPAMRLLMLERLDGPALES
FT                   SAAANNAGTGHAANCELNYTPQQADGSVATAKALAINAAFERSLEFWATLRERGELDTP
FT                   AFLNSVPHISFVWGQGDVAFLRQRHQQLSALPAFAGMEWSSDPAELAEWMPLVMQGRGA
FT                   SEPVAATRISRGTDVDFGSLTRLYLQDLQRSGALELRTGCEVNDLTRKSNGDWSVELAG
FT                   GERVQTPFVFLGAGGGALPLLQRSTIPEAKAFAGFPVSGQWLVCGDNQLASRHLAKVYG
FT                   KAKVGAPPMSVPHLDTRFINGERSLLFGPFAGFSTKFLKQGSLLDLPRSVRIGNLLPML
FT                   QVGAGNFPLVQYLINQLRQSPEQRLEALQQFLPQAEASDWTLSVAGQRVQIIKNGPKGG
FT                   QLQLGTEVVAAADGSLAALLGASPGASTAVTTMLEVLERCFASRLATPAWQERLKALFP
FT                   SWGGDVLSSRSRNTAVLGL"
FT   CDS_pept        complement(486693..488369)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0550"
FT                   /locus_tag="SynRCC307_0550"
FT                   /product="Sulfate permease, MFS superfamily"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27453"
FT                   /db_xref="GOA:A5GRE4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE4"
FT                   /protein_id="CAK27453.1"
FT                   /translation="MGSFNALMPGVVALHRYRFGQDFSHDLFAGLSVAAVALPVSIAYA
FT                   ELAGLPPAIGLYASIGPLLAYALLGTSPQLVVNPDAASCAILAAAIAPMAAGDPALYLA
FT                   LASALTLFTGVLCVLASAFRLGALADFLSKPILVGFLNGIAISIFLGQIGKVLGFQITA
FT                   SRIIPKLIEIITKLPTTQMPTLLVGLFSVVVLVLVKRFLKTIPAALAVLVLSALLVGLM
FT                   DLPAMGVAVLAPVPAGLPAPALPLVPLETIPKLLGSAAGLALVLFTSGTITSRSFASRG
FT                   GYEVDVDQELVAYGAANIAASLTQGFVVTGADSRTAMAVTAGGRTQVTGLVAAATIAVV
FT                   LLVFTGPLQFVPVAALGVVLIAAALSLLDIASLRQFWRMDQREFGLSLVTTAGVVALGS
FT                   INGILFAVALAIMRFVKHTARPSVELLGEQKGLPGLHSIDRHGKASAIPGLVLFRFNAP
FT                   LVFFNADHFKQRALAAVKASGGELRWFVIDAVPISDIDINGLAVLKDLQQQLQRQNIAL
FT                   IWAGRQSEFLNLIAQIGENTDGLDKLTYPTLRQAVNAYKAL"
FT   CDS_pept        complement(488447..489583)
FT                   /transl_table=11
FT                   /gene="gldH"
FT                   /locus_tag="SynRCC307_0551"
FT                   /product="Glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27454"
FT                   /db_xref="GOA:A5GRE5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE5"
FT                   /protein_id="CAK27454.1"
FT                   /translation="MAYRTDFGSIHQRPLGVFGAPARYVQGPGATWELGRELQRLGFQG
FT                   PVLFIAGGTAQRTLAPIWQEQLPPVGLQPVIDAFGGECSESEIKRLVGMSDHHGFCAVV
FT                   GAGGGKASDTARAVADELGLPVVITPTLASTDSPCSALSVIYSDEGSVTGFRFYNRHPE
FT                   LLLVDTEVIAKAPKRQLVAGLGDGLATWFEARATHESHRNNVVGGKPLTSALMLAKLCH
FT                   DILLADGPAACAAIDAGVPTPALERIVEANILLSGLGFEIGGLALAHAVHNGISTIPGS
FT                   HHNLHGEKVVIGLHTQLVLEGQPQSEIDAVFRYCQQVGLPTTLAQVGIDASNDAELMAI
FT                   AERSVIPGETSHNEPFEVTAIAVMRALKAADQLGRAYL"
FT   CDS_pept        489654..491468
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="SynRCC307_0552"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27455"
FT                   /db_xref="GOA:A5GRE6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRE6"
FT                   /protein_id="CAK27455.1"
FT                   /translation="MTDAPVSRLRNFCIIAHIDHGKSTLADRLLQDTGTVADRDMQAQF
FT                   LDNMDLERERGITIKLQAARMQFKAADGELYTLNLIDTPGHVDFSYEVSRSLQACEGAL
FT                   LVVDASQGVEAQTLANVYLALGNDLEIIPVLNKIDLPGADAERISTEIEEIIGLDTSNA
FT                   IHCSAKTGLGVPEILQAIVDRVPAPPDTTEEPLKALIFDSYYDPYRGVIVYFRVVSGRL
FT                   RKKDKVLLMASKKTYELDEIGVMSPDQKQVDELHAGEVGYLAASIKAVADARVGDTITL
FT                   ASAPAEEPLPGYTEAKPMVFCGLFPTDADQYPDLRDALDKLKLSDAALKYEPETSSAMG
FT                   FGFRCGFLGLLHMEIVQERLEREYDLDLIVTAPSVIYKVNMADGSTVMVDNPATLPEPQ
FT                   ARESIEEPYVKMEIYAPNSFNGTLMELCQERRGTFIDMKYITTDRVTLQYELPLAEVVT
FT                   DFFDQMKSRTKGYASMEYSLIGYRQNVLVRLDVLINGDKADPLTTIVHRDKAYGVGKGL
FT                   VEKLKELIPRQQFKIPLQASIGSRIIASESISAMRKDVLAKCYGGDISRKKKLLKKQAK
FT                   GKKRMKAMGKVDVPQEAFMAVLKLNENK"
FT   CDS_pept        491496..491693
FT                   /transl_table=11
FT                   /gene="SynRCC307_0553"
FT                   /locus_tag="SynRCC307_0553"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27456"
FT                   /db_xref="GOA:A5GRE7"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE7"
FT                   /protein_id="CAK27456.1"
FT                   /translation="MMWSKPTRQQGFVLPSVLLLGLVIITSGLALQAMALQGMLSQQRE
FT                   LKRDQKADAEFSAVMRQALD"
FT   CDS_pept        491699..492094
FT                   /transl_table=11
FT                   /gene="SynRCC307_0554"
FT                   /locus_tag="SynRCC307_0554"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27457"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE8"
FT                   /protein_id="CAK27457.1"
FT                   /translation="MLVSAVLLGIFSSLGLQLSGSIGRAAQQQQQSADQQHWLALQLQR
FT                   DAGLLIRQGALLAVDCSNEKQREQGLLQLQALLEQVGSIEPAETFSTQRQLQVADGLLQ
FT                   LQVSIGELQRQREFSLQGLGACIDELG"
FT   CDS_pept        492081..492554
FT                   /transl_table=11
FT                   /gene="SynRCC307_0555"
FT                   /locus_tag="SynRCC307_0555"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27458"
FT                   /db_xref="GOA:A5GRE9"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE9"
FT                   /protein_id="CAK27458.1"
FT                   /translation="MSLVELLTAVAIVGILAGTSINASRRPLAHQQLLAAARQLELGIE
FT                   QARDQAMDQQAPCALALGEAGWIAPQDGSLPACSDAVSPLLAGDRANGLRLNHNITALQ
FT                   FTANGLVLGGGTVRLAVDGLDQERCVVISLPLGITRRGLWENSQCVPPASAES"
FT   CDS_pept        492526..492804
FT                   /transl_table=11
FT                   /gene="SynRCC307_0556"
FT                   /locus_tag="SynRCC307_0556"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27459"
FT                   /db_xref="GOA:A5GRF0"
FT                   /db_xref="InterPro:IPR014897"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF0"
FT                   /protein_id="CAK27459.1"
FT                   /translation="MCRQRQQNLDAGVTRRVLIFASATAMAVPTWLERMMALMRQTVQQ
FT                   TGIAPKPQPLAKPEPPKAAQASEQIFTGPKGGQYVLTASGKKKYLKK"
FT   CDS_pept        complement(492811..494370)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0557"
FT                   /locus_tag="SynRCC307_0557"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27460"
FT                   /db_xref="GOA:A5GRF1"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF1"
FT                   /protein_id="CAK27460.1"
FT                   /translation="MKRLQRHLGKTHDLHHYHQSGMVSLTEAMVATIASTLVIGASAIG
FT                   LRTTETLIRETNDKATLRQNTANGMNLMRSEIERSIHLVVDNSAGFEEGKEHLDLNDSH
FT                   YSDAIAKCSELAGDKSFKPILGTKMIDLINPVIYGISTNTNGYGYSLIRCGAPLKLDGK
FT                   YNDEGENLFLSIVLDDIGRVPCKTPGCKAEEPLENYLSGVSFQFSEGFTPYRQPFEPAL
FT                   RIETDSNYKLVKFVDPTEESPDVDNIKASFLEKRSNTKTLTKQDLYFAAFARADKRINK
FT                   LGDDSNGGILSGAFFQNISSNRVRFVVDGSGSMSACVMWGDGYANKRKFYKPGYGYFTT
FT                   RRRCAFTRMESLQKELAVLLDNLPDDTRIGLRSFSSSGNTNHKEWDDFGTNLVRLGNEG
FT                   VRESAVEFVYTLDDRSPTYWGGTDPWDAIQAAFEDPETEALYFLSDGQPNRDRDGGYWR
FT                   ESDEAPTAQYYAGLNVDRSKTLKVHTTALGIESLWMEKLADLTGGGYNQVDASSLEEAN
FT                   GA"
FT   CDS_pept        complement(494504..495127)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0558"
FT                   /locus_tag="SynRCC307_0558"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27461"
FT                   /db_xref="GOA:A5GRF2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF2"
FT                   /protein_id="CAK27461.1"
FT                   /translation="MLYNSQSMRSNKAGFTLVELLVVTIIISLGLKWSLPGLIRSAKQS
FT                   EVDNYTQIVESGLFSLQAKVGKTKSSCEINFGSSNQFKAPWEILEFQQPSGTQAFLNER
FT                   ISCCNSKEGCVGGPEYRLISREGMQDRNAVEISTSKPFFEISPPGTSAEASILTILIRS
FT                   KSHDLQSLKNKSGKSRLKIRCVEISGSGNISNGTWSEESEKCLI"
FT   CDS_pept        complement(495291..495632)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0559"
FT                   /locus_tag="SynRCC307_0559"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27462"
FT                   /db_xref="GOA:A5GRF3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF3"
FT                   /protein_id="CAK27462.1"
FT                   /translation="MHSRITAYLSSKVSSDPEGFTLVEVLVAGILMAGIMIGVSRLSTS
FT                   ALASSAKQAERQRIEASISNNIQMLQMEDSYLRFEDMSNEQQVRGCKNPTMELEAHLSQ
FT                   KVPAPDHQA"
FT   CDS_pept        complement(495745..497481)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0560"
FT                   /locus_tag="SynRCC307_0560"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27463"
FT                   /db_xref="GOA:A5GRF4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF4"
FT                   /protein_id="CAK27463.1"
FT                   /translation="MKLYLETKNLQPQNQALFALHKLAAMVRHSPKTAKSEQGMALAMT
FT                   LMMGLLLVAGSGALVSKITMNRRIGASKSYQQMAQSAAINGFNRVLGIVNKDDDDNYRG
FT                   YYLQLNNNEGDPEIDGDESWDWETVNNDPRPNPLQELCTDTTVGMPTNWPRDSIKISSE
FT                   TQRNDGQGDVNLAYRLRNYSVLNGGEKSIGTFEIEGFVTRGDGESDGNYLARTLLTRSL
FT                   YVESKVVAEGDWGVMAGNYMQLGQSKITDSSNNQKNSGLILLEIEDPSDYQSAASCTPG
FT                   NRATAVGSYDDDLGNKVWPIWNRKLPLTSLFTKANLVDQIDGSPRIWSFDDSPEDPDPE
FT                   KNPGSLAFQQKCPNSIVCTRKTNNDIFAVPERVTLDQSDNTNTVIIGSDVLCEGQDGFE
FT                   CHVFIEHLNLSTTTVLIDNKDRPIVIHLERPQGDNVSSNLSGQIKLTGSSKLCGTSDGE
FT                   TCNKQPERFVITANAGQAGMDCDSTTHVLSVEGSNLPHAFIHLPRGTVRTTGNAILHGV
FT                   IWAHSICAQEGGIHLITEENQKTVVRAADELWEWSKNGFPGFGRMVTRGIRGTEFDTFQ
FT                   RW"
FT   CDS_pept        complement(497417..497902)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0561"
FT                   /locus_tag="SynRCC307_0561"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27464"
FT                   /db_xref="GOA:A5GRF5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF5"
FT                   /protein_id="CAK27464.1"
FT                   /translation="MRQQFCQKNKGFTLTELMASVAILGVLTTIAIPNYLGTLQSTRQD
FT                   EAESTLNQLMMHAAAFNDEYSRPAEGWSDLDEIASIMTTTGTASGSNFSSIVLQGGHYA
FT                   ASGSRSGNRYTFEVKPIEIKSQSQNSVGCINVATGESEIISGNKKLAASKSSLVCST"
FT   CDS_pept        complement(497989..498504)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0562"
FT                   /locus_tag="SynRCC307_0562"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27465"
FT                   /db_xref="GOA:A5GRF6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF6"
FT                   /protein_id="CAK27465.1"
FT                   /translation="MTSLNPSLRLALLQKAKGKKNILQKGFTLVELMVVIVIVGILSAV
FT                   ALPNFLSQTSKAQGTECAQKIGNILSQVGAEHLASSTQAAALLESEIATASTNSRNCTF
FT                   EADATQTAPSYGITAVGKTGSDLAGKYAAKACVNGANGRRDVNTKTGASVAIGDVDAAD
FT                   CADDTPAG"
FT   CDS_pept        complement(498658..499380)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0563"
FT                   /locus_tag="SynRCC307_0563"
FT                   /product="Two-component system response regulator"
FT                   /note="Signal transduction mechanisms / Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27466"
FT                   /db_xref="GOA:A5GRF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF7"
FT                   /protein_id="CAK27466.1"
FT                   /translation="MAPEAEQLRLLLVDDEPKLTEFLRMELEVEGYAVQIANDGASGLI
FT                   ALRGEPAPDLVLLDWNLPDFTGLDICRRIRSTGMSVPVLMLTGYDEVKDKVEALDAGVD
FT                   DYLVKPFSIEELLARLRALQRRSNALQPQASEPDVLRIGDLELNQANHDVRRGSRSIQL
FT                   SNKEYQLLVFLMRSPNKVQSRLEILHGVWGESFYGDDNLLDVYIRYLRQKVESPDEPKL
FT                   IHTVRGVGFMMRLEEASS"
FT   CDS_pept        499459..499854
FT                   /transl_table=11
FT                   /gene="SynRCC307_0564"
FT                   /locus_tag="SynRCC307_0564"
FT                   /product="Putative PAS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27467"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF8"
FT                   /protein_id="CAK27467.1"
FT                   /translation="MAEQWTPGAVAALREKENLPFVRADARGNIVEFNARFAEVYGWVE
FT                   GQLVGESISAILPPSFREFHHAGFARFQLTESSKVVGHPLTLATVCSDGSEVQSEHYIV
FT                   AEKYPDGSWSFAATLRPLEGEHASDQE"
FT   CDS_pept        499851..500942
FT                   /transl_table=11
FT                   /gene="SynRCC307_0565"
FT                   /locus_tag="SynRCC307_0565"
FT                   /product="Two-component system sensor histidine kinase"
FT                   /note="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27468"
FT                   /db_xref="GOA:A5GRF9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF9"
FT                   /protein_id="CAK27468.1"
FT                   /translation="MSEEATLAQLRQSLGLLQVAFDAAAEAMVIVEPGGEVRWGNQAAA
FT                   DLWSNGLAILLVGQRLEQLLQPICSSSGVPLALEAAEHPLQLLKRGDGSGVFGIADHLQ
FT                   QLEWRRIQQPGDGYLLLLARDLAPQEQALQQQRQFVNQLAHELNTPLAIVNGSLRQLGK
FT                   KLLNFGDGSRERLRQAQQETSRLVRLLRHLLVLTDLETGRRQLQLQPLALKPWLQEWMA
FT                   QQVLPASAELNLVADVGESAVIAADAEALAEVLEQLLDNSLRYSKGPAQIELQLLELDG
FT                   ASGLRWQDQGLGITAEPRSQVFERFVRLEEHRDFNQADGAGLGLALCEALMQAMGGSTG
FT                   LEPITNESTGTAFLLSWPQAGGK"
FT   CDS_pept        complement(500924..501292)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0566"
FT                   /locus_tag="SynRCC307_0566"
FT                   /product="Two-component system response regulator (signal
FT                   receiver domain)"
FT                   /note="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27469"
FT                   /db_xref="GOA:A5GRG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG0"
FT                   /protein_id="CAK27469.1"
FT                   /translation="MSSALVAIVDDDPRIQELLGAELTDLDQPHCSYCSADALLTDINN
FT                   SQPALIFLDVLMPGMGGMECLQHLRQQGFGGAVVMFSALNDAELQEQAKAAGANGWMLK
FT                   AALFDNVEAVLNRYLPPA"
FT   CDS_pept        501418..502002
FT                   /transl_table=11
FT                   /gene="SynRCC307_0567"
FT                   /locus_tag="SynRCC307_0567"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27470"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG1"
FT                   /protein_id="CAK27470.1"
FT                   /translation="MKRDAGFSLLELLLACSLGLLVFGVAASALLSEQKLGSRMGGLLR
FT                   QRQLLLRANQLIAADVQRGIALAPELVSPCHLAGRKRWLQLLNADGSITTYSIGKAPSG
FT                   IWQGEVLMRCGPAYGLDGRIKAGARSLNRVVLDGLVPSSQAWAGCSLPQAETFSEAPVC
FT                   WEPASGVVQWQLQRTSNRVTTQQDGQALLKG"
FT   CDS_pept        502077..504359
FT                   /transl_table=11
FT                   /gene="pulD"
FT                   /locus_tag="SynRCC307_0568"
FT                   /product="Type II secretory pathway, component PulD"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27471"
FT                   /db_xref="GOA:A5GRG2"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG2"
FT                   /protein_id="CAK27471.1"
FT                   /translation="MHRLFPVALAAAMAMPIVEVRAAARADLKIIRFPGSIQLRLVGMG
FT                   MNPDVRQIKTARGWTIEVNTGQSLAPLGSPKFFTMPDAGMDSITFDGTGTLWRLEVNAL
FT                   QGNTLAPPVITANGRDVEVSFQAQPLPSMEAGSYDLNTPGRVRRNTYVPPLRKRATAPP
FT                   VGDMAIASIAIKGNEVRMPGAGKVERLTLRNAPARDVLMTLGRAGGYNVAFYSKQGEEG
FT                   SATSGGNPISVDFQDEPIESAVNLVLTLGGLQAKRQGNTLIVGEKLPSFARQLMSRTVR
FT                   LNQVSAARATEFLMSQGATLYRTKVLEEKQEGVEAVDVIGSSGNQVNTGPKTELTGKSV
FT                   SIQTVEADGSASGALPLTGLTISPDDRLNSVTLTAEPALVSIAEGYLKTIDLRKRQVAV
FT                   RVQVLDVNLDNVKTMNNSFALRTGNTFLVNREGEMLVNFGDLKPPDTERAGVPSLYDGS
FT                   TGSPLVGAGAFSMPGEDQVFLDQPVRQFPYQGAGSRYPYGFRRTSPPSPVQGSNLRGNL
FT                   YSRPGFGPFSSPGQPGVVEVDKDGLVTFEPPKNFQYPKDQFFDFVKALIRSSSAKVVAD
FT                   PTLLVQESESSSVGVGTTVFVNCSSSTSANGTRNFTPKKETAGLQVDVSVSRIDDNGFV
FT                   SLALNPVLKAPSGLPVPVNCGGIDLPTRDLAVRELRSGEFRVRDGQTLILTGVIQEEVL
FT                   ESVDKWPLLGDVPLIGQFFRKSSNTRQKRELVIVVTPRILDDNQGGNYGYGYQPSTQEA
FT                   KKLIYQP"
FT   CDS_pept        504385..505257
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="SynRCC307_0569"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27472"
FT                   /db_xref="GOA:A5GRG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG3"
FT                   /protein_id="CAK27472.1"
FT                   /translation="MASLWLQRFWTWRPRSLSARLARVGLWVLLFYVLIALISPVLFGI
FT                   GLLPDVNTGLENEINAPPSLEHWCGTNRLGQDVCARTIAGAGVALKVVVLALTLALIVG
FT                   VPLGMLSGYFGGPVDRALVLLMDTVYSLPVVLLAVVMAFLLGQGLLNAAAALCVVYVPQ
FT                   YFRVVRNQTASVKAELFVEAAQSLGAGPVWIMRKYLFRNVITSVPVVLTMNAADSVLML
FT                   GSLGFLGLGLPAVVPEWGAELKQALTALPTGIWWTALYPGVAMFILVLALSFIGEGLDA
FT                   WVSGDEARP"
FT   CDS_pept        complement(505161..507107)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0570"
FT                   /locus_tag="SynRCC307_0570"
FT                   /product="Glycosyltransferase of family GT2; candidate
FT                   processive Glycosyltransferase; possible cellulose
FT                   synthase"
FT                   /EC_number="2.4.1.12"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27473"
FT                   /db_xref="GOA:A5GRG4"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG4"
FT                   /protein_id="CAK27473.1"
FT                   /translation="MSSFAALQRYPMQWRRWAVLTLSLLMARYLFWRVSSTLNFTSPAV
FT                   AGLSLLLLGCELVLLISAFLPLWFSLARRRPLKPQPLGRFPAVDLLLPSCGEPLDVVRR
FT                   SLQGALALDYPTLTVWLLDDTDRPELQRLASQLGCRYQARAEHAHAKAGNLNAALPLLH
FT                   GELVAVLDADVVPQRTFLERTVSLLEQDSSAALVQTPQSYMNADPVLRNLQLERWLLPD
FT                   EESFYRWVEPVRQGVGAVVCAGTSFVVRRRALMAVGGFETGTPSEDLATGIRLAAAGWR
FT                   LHFLAEKLSAGLAPHSAAAMARQRCRWASGTLQILRTGANPFKIAGLSPLQRLAFAEGI
FT                   LHWLNVLPQLLLLLMPLLAVLAGGTPIRLDGGGLVSVALPFYAAQMLLARPISGQARGA
FT                   VLPELYRWIFLVPLVGAVLSTIAKRPKTFRVTPKAPGPTRGAEPGLVIPLAGLLAVQGL
FT                   ALVGLLRWPPPAAPLGLTLFWLSSSTLLLGLSLRCCWDRPGVSAVPWFAVQSKQSWGQV
FT                   TALSEEGLEARLTGKQIPTQHWGLPLELACQKGQRIGMNWKQLNAEQQHWLQQRLYGKS
FT                   GCWPVRRAPFELRALGPVLLRLITPARPETWFNRSLLPLELQGLASSPLTQASRPSPMN
FT                   ESASTRMNMATPG"
FT   CDS_pept        507135..507407
FT                   /transl_table=11
FT                   /gene="SynRCC307_0571"
FT                   /locus_tag="SynRCC307_0571"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27474"
FT                   /db_xref="GOA:A5GRG5"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG5"
FT                   /protein_id="CAK27474.1"
FT                   /translation="MGVSLLLIGLTGLFWFLGMRNADEVIGILEKLMATLLLVLTLCVG
FT                   GGHVAISLLLLAVALSLPRARAFASTRFRSNSKITRESGELFLPF"
FT   CDS_pept        complement(507417..508106)
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="SynRCC307_0572"
FT                   /product="tRNA (Guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27475"
FT                   /db_xref="GOA:A5GRG6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG6"
FT                   /protein_id="CAK27475.1"
FT                   /translation="MPLLPRRFERLRSVLKRRMADLTVLMEAVEKPHNLSAILRTCDAT
FT                   GVFEAHAVSLKGRPRTFNSTAQGSQKWVPIRDHDSVKDAFAELRAKGFRIYGTMLGVNA
FT                   VDYRSCDFTKPSAFVLGAEKWGLTAEAGDAVDQPVFIPMSGMVQSLNVSVAAATLLFEA
FT                   VRQRQAAGLIPTQGEGLSPELFDQTLFEWAYPQVARWCRDTGRPYPGLSEEGELLEELP
FT                   RTVKLRC"
FT   CDS_pept        508110..508460
FT                   /transl_table=11
FT                   /gene="SynRCC307_0573"
FT                   /locus_tag="SynRCC307_0573"
FT                   /product="Predicted methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27476"
FT                   /db_xref="GOA:A5GRG7"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG7"
FT                   /protein_id="CAK27476.1"
FT                   /translation="MASQQSTSFDQRVYALVAQIPPGRLATYGQIAELLGCWGCARQVG
FT                   WALRRLQLPSEVPWQRVVNASGRISFSLAREGSDWIQRQLLIEEGIPVSEQGALPLRRY
FT                   LWTPELPIRIEP"
FT   CDS_pept        508390..509754
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="SynRCC307_0574"
FT                   /product="Ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27477"
FT                   /db_xref="GOA:A5GRG8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG8"
FT                   /protein_id="CAK27477.1"
FT                   /translation="MSKGRCPCGAICGHRSCPFVLSPDSAVGLPPRLVAWRVLEAVGDG
FT                   AYADLALERELKRSKLSPRDRGLATELAYGAIRQRRRLDGWLDLLGKVPAAKQPPRLRW
FT                   LLHVGLQQILLMDRVPASAAVSTAVELAKRERLQRLAPVVNGVLRAAVRAVEAGESLPV
FT                   PSDPQKRLALEHSLPDWLVAELWGQIGPERTEALAAASNRIPPLDLRCNRLRSSREALL
FT                   ENLPAVALAELPDGLTLTSRPGPLPQLAGFSEGQWCVQDRAAQRIAPLLDPKPGQRVLD
FT                   ACAAPGGKTTHIAELMGDQGEVVAVDVAPRRLQQVSANAERLGLSCIRTEAADATDLTD
FT                   WEAESFDRVLLDVPCSGLGTLARHADARWNLKPDGIEELVGLQHQLLEQGARLLKPDGR
FT                   LVYATCTVHPAENTGVVEAFVEENPDWQFSEPPMQLWPDPQGGDGFFAAVLSLRR"
FT   CDS_pept        complement(509738..510343)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0575"
FT                   /locus_tag="SynRCC307_0575"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27478"
FT                   /db_xref="GOA:A5GRG9"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG9"
FT                   /protein_id="CAK27478.1"
FT                   /translation="MSQLTALDWLGLLHPVLAILFVYPVAGATIRLGILAREKRTDYNP
FT                   ALPDTVPTEHWQHGRWLVSSAVVITLWSYLVIAIRNGLGLNPVLWAAGLGTLAALLALW
FT                   RVSTDPLKASFTLLCWGGLIGLGTQLPIGDLPFWSSHFWSGVLLIGLLLFSLAARSGIA
FT                   STTQLRRLHVSAMVLGAVLFAVVGITGCRDLIQFTAGG"
FT   CDS_pept        complement(510340..512439)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0576"
FT                   /locus_tag="SynRCC307_0576"
FT                   /product="Glycosyltransferase of family GT51; modular;
FT                   contains a C-terminal transpeptidase domain; probable
FT                   murein polymerase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27479"
FT                   /db_xref="GOA:A5GRH0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH0"
FT                   /protein_id="CAK27479.1"
FT                   /translation="MAITPELNNEPKDKGTAPRRPVKIPRRRRLILAGVVAAAAGTTAA
FT                   FGSSALLQQIDGLLPDARGISAFSRPGTVTILSADGEVLQKLGPASREKVAVGQMPELV
FT                   KEAFIAAEDRRFYQHNGVDVVGISRAVVTNLQSGSVKQGASTITQQLARVVFLNQDQTL
FT                   IRKAKEAALALKLERQLSKEQILNQYLNNVYLGSSAYGVADAAWIYYSKTVDELTLPQA
FT                   ALIAGLPPAPSAYSPLVNPDLAIQQRNTVLRKMLEAGFITAAQEQEAKTAPLDLKPALP
FT                   KFWNSTAPYFTSWVAQELPRVLSPEQLEVGGLTIRSSLNAGWQKQAKTVIANNTWGGQQ
FT                   GALVALEPGTGLVRAMVGGNDFNKSQFNRATQALRSPGSTFKLFDYTAAVKAGIKPEDI
FT                   FVDKAQCWGGYCPKNFGNKYFGNVSLADALKNSLNTVAVQLLDKVGFDAVISTARSLGI
FT                   TRPLGRYYPLAIGAYEQTVLEMAGAYAAITNRGVYVPPTPFMSISGSNGQVIWSRQSNG
FT                   AKSTRAVDSDTADAMSWMLQRVVSGGTGVAANLEDRPVAGKTGTSEGGRDLWFIGSIPQ
FT                   LTTAVWLGYDDNREQKGSSGDAAWAWRQFMIPVVKDMPVQQFPPKPVLTRNFKAPAGAF
FT                   LPPDPAAIKNFEGLDAPPPIDSGFAPAPAPGPAPDVVPMPLTPGPTVELAPGLEIIEPT
FT                   VNPFE"
FT   CDS_pept        complement(512476..513429)
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /locus_tag="SynRCC307_0577"
FT                   /product="Chlorophyll synthase 33 kD subunit"
FT                   /EC_number="2.5.1.62"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27480"
FT                   /db_xref="GOA:A5GRH1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH1"
FT                   /protein_id="CAK27480.1"
FT                   /translation="MSDARQLLGMKGASGTSSIWKLRLQLMKPVTWIPLIWGVLCGAAA
FT                   SGNFHWQTSDVLASLACMLMSGPLLAGFTQTINDYYDREIDAINEPYRPIPSGAIPLWQ
FT                   VKVQIWVLLIAGIAVSYGLDLWAGHSTPVLLLLALGGSFVSFIYSAPPLKLKQNGWLGN
FT                   YALGASYIALPWWAGQALFGQLSWGIVALTLAYSLAGLGIAVVNDFKSVEGDRKLGLQS
FT                   LPVVFGIERASWISAGMIDVFQIAMVVALVLLGQHFAAVLLTLLIIPQITFQDIWLLRD
FT                   PVAFDVKYQASAQPFLVIGMLVTALALGHSGFSSAG"
FT   CDS_pept        complement(513434..513646)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0578"
FT                   /locus_tag="SynRCC307_0578"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27481"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH2"
FT                   /protein_id="CAK27481.1"
FT                   /translation="MSQPAINVGSKVKITRVRDRIPADLVKLLLGNSEGTVTGFKMTDG
FT                   SGVGVKVKLEGGPETWFFQDEIAPA"
FT   CDS_pept        513652..514488
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="SynRCC307_0579"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27482"
FT                   /db_xref="GOA:A5GRH3"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH3"
FT                   /protein_id="CAK27482.1"
FT                   /translation="MLTGFRGNLTSAISFLCAAGAAVVAKRIIPCLDMAAGRVVKGVNF
FT                   VGLRDAGDPVELACRYDAAGADELVFLDIAATHQGRETLVELVERTASQLFIPFTVGGG
FT                   IRSLEGITALLRAGADKVSLNSSAVKDPELIRAGARQFGAQCIVVAIDARRGAGGGWDV
FT                   YVKGGRENTGLDAIAWAQQVVECGAGELLLTSMDGDGTQKGYDLELTAAIADAVSVPVI
FT                   ASGGAGSLDHIAEVLESTGAAAALLASLLHDGVLTVEQIKADLQRRGVPVRPLVDA"
FT   CDS_pept        514522..514761
FT                   /transl_table=11
FT                   /gene="SynRCC307_0580"
FT                   /locus_tag="SynRCC307_0580"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27483"
FT                   /db_xref="GOA:A5GRH4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH4"
FT                   /protein_id="CAK27483.1"
FT                   /translation="MGFNGLDLLPGLIGLLLVAVVITLVAWALNLMQSASDSNEFSLML
FT                   AGCLVCSAAVGLSTVMVISLTGPNAPLVHIFHAG"
FT   CDS_pept        514751..515443
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="SynRCC307_0581"
FT                   /product="Menaquinone biosynthesis methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27484"
FT                   /db_xref="GOA:A5GRH5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032904"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH5"
FT                   /protein_id="CAK27484.1"
FT                   /translation="MPAEAQAVRQLFDEVAPHYDRLNDLLSLGLHRLWKREMVQRLAPV
FT                   AGEQWLDLCCGTGDLALVLAERLRRGGAVLAVDAAAAPLLQARRRHKRCPWLPVEWLQA
FT                   DALAVPRAAASFDGAVMAYGLRNLPDPAAGLRELRRLLQRDGRAAVLDFNRGGGAASAL
FT                   QTQALRRVVVPVASQLGLKEQYAYLETSIAEFPTGFEQEQMALSAGFSWAQHRPIAGGL
FT                   MGLLELRC"
FT   CDS_pept        complement(515447..516943)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0582"
FT                   /locus_tag="SynRCC307_0582"
FT                   /product="Carbohydrate-selective porin OprB related
FT                   protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27485"
FT                   /db_xref="GOA:A5GRH6"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH6"
FT                   /protein_id="CAK27485.1"
FT                   /translation="MAVLAAQWTLNKLSHFAIAGIRPPLISESLGEAEPMALSSRFSLA
FT                   LLALSLSWLPAPVGAEPADQPKPAKQPKVMETPRGLLEAATFGEMLGLPDWMAMSLSLV
FT                   NQPMGNITGSKQRTFRSIDMQAIDWSLGSGLSKEDSDKDEFDRWSFRSSLATYIGVPPY
FT                   FSEDIGAAFPLQALEDTEGLQQGFWLQGLWLQRDSENLSLKFGNNLSLDPLVESPVYNA
FT                   YVNSTINSTLNLSLPGYPTVPFSSLGASLQWRANDRLTVNYGGYQLSNQRTGFPAGRWK
FT                   GWRFNLDRDDGLVQALRLDWALSETSGEPLLICMSQEHPDVVVRHHQGCKRPMRLENKL
FT                   PDPVLQLGAVSGSWRFPQINNPSRWENRANSIFASATLPVPFALGHGSRLWGSAVIGTE
FT                   PAINPVPLFLEGGWITQGVIRQRPFDSVVLGLTRSSFSPSLGRASGQRMTYEGMIELGY
FT                   ILQLSQELALQPGVQVIVNPEGTGDNETLVVPGLQVSFNW"
FT   CDS_pept        516988..518586
FT                   /transl_table=11
FT                   /gene="SynRCC307_0583"
FT                   /locus_tag="SynRCC307_0583"
FT                   /product="Putative multicopper oxidase"
FT                   /note="Secondary metabolites biosynthesis, transport, and
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27486"
FT                   /db_xref="GOA:A5GRH7"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH7"
FT                   /protein_id="CAK27486.1"
FT                   /translation="MLRRSFLQLGVLGAVIGGASLELFQQAKASARRSWERFIAQPAFQ
FT                   RPRNAATVVLEVATAPITVLGQTVVRGCIRQLNGQRGYTTSQADGINLELINQLPVPTT
FT                   VHWHGLILPNAMDGVPFVTQPPIPPGQRQRIHYSLVQNGTFWMHSHYGLQTQSFVAEPF
FT                   VILDAEQEQWADRTITVMLRDFSFTPASQILSNVVAGERGGGTAMAKRLADFPWHEPRP
FT                   LLTQQWDPTSQRFGWKQADGVLMMAPDVVYDALLANERSLDDPEIIDVEPGETVAIRWI
FT                   AASAFMSFFLDLGELEGELLRTDANPVEPIRGSVFQLALAQRLTLRLTMPDTPGVFPLL
FT                   ALGERSNLRCGVVLRSSRKLKAPALAPQSQQWAGSLDFSQDRQLRAKTPLAVRAADNTI
FT                   PVALTGPAPKYTWGLNHRFYPYRDPYWVDEGQRVEMVFTNPTPMGHPMHLHGHEFQILE
FT                   IDGEPVAGPMRDTVYVPKGGRCRIAFDANNPGIWAFHCHISYHHVRGMFNVVAYRSADL
FT                   SWWDPAGFGHEYLPF"
FT   CDS_pept        518682..519095
FT                   /transl_table=11
FT                   /gene="SynRCC307_0584"
FT                   /locus_tag="SynRCC307_0584"
FT                   /product="Conserved hypothetical protein specific to marine
FT                   picocyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27487"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH8"
FT                   /protein_id="CAK27487.1"
FT                   /translation="MEAPLLFPLPEIEPRIQQLLERTLAMNGLLVVTEARYGVSVESGA
FT                   PPPHEPDPVESIRFVPFAKIEAFNSVLRRRPDGGDLAEQICSLLLDHYGSSAKPVLLLR
FT                   RNGDHWLGMLDYCPESRERQHRITHLHRCLAAS"
FT   CDS_pept        519317..520198
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="SynRCC307_0585"
FT                   /product="Glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27488"
FT                   /db_xref="GOA:A5GRH9"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH9"
FT                   /protein_id="CAK27488.1"
FT                   /translation="MPIAVQFQDIISTLQRFWADQGCLVLQPYDTEKGAGTMSPHTVLR
FT                   AIGPEPWAVAYAEPCRRPTDGRYGDNPNRAQHYFQFQVLIKPSPDGIQETYLRSLEALG
FT                   IKAADHDIRFVEDNWESPTLGAWGVGWEVWLDGMEVTQFTYFQQCGGIDCKPVSIEITY
FT                   GLERLAMYLQDVESLWELQWDSQRSYGDIWLPFEKGQCTYNFEASNPERLFKLFEIYEA
FT                   EAKDLCEQGLAAPALDWVLKCSHTFNLLEARGVISVTERTATIGRIRNLARQVAESWLA
FT                   EREALGFPLLKG"
FT   CDS_pept        520246..522099
FT                   /transl_table=11
FT                   /gene="SynRCC307_0586"
FT                   /locus_tag="SynRCC307_0586"
FT                   /product="Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27489"
FT                   /db_xref="GOA:A5GRI0"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI0"
FT                   /protein_id="CAK27489.1"
FT                   /translation="MARAWRAGLLLVPLALGWCWWRWPRPTPADPVHLAPQSVVLEGRI
FT                   QRPPRRVASGACSAVLQLEGAHQGRSQLWFRQCPKQLDPGWRLRVAGTLRQPKPPLHPV
FT                   LGDRAAQLARQGIFSTLAVQRYELLERQTQPLWQWRQQLAGRLQASAGPRHGALLSALV
FT                   MGRAMAPLPDAITNSFRAAGLSHALAASGFHLSVLLGVVLALTRRAPRLLRVISGAAAL
FT                   GLFVLLAGPMPSVLRAVLMGAIALLIRESGERARPLGLLLVSLLALLLWQPAWLLDLGF
FT                   QFSAVATAGLVLTAPRLQQQLPAALAVPIAACLWTLPLQLLHFGVLPLYAVPANLLAAP
FT                   LLTLLTTGAMAAALAAQLVPPLLPVITALLQWPAELLLLLVQGAAALPLAQLALGQPPL
FT                   VLVLLLSLGLMPWLLGCSGPWRRWGAGLVLISCLWQGQRLIADELLELPVGKGNLVLLR
FT                   HGGRGALVSRDAGPRSCSQAQRLRQALGLPRLDWVVLLDPVPADDFGCWQKLSSQLQVL
FT                   PCGELSSPGLVFRSQVQVPGEALLQLGRRCYCLRQQGVSANMGALAACGQCPTTKGGPP
FT                   KPASSAAARFSGAKNGRPCGTRCVTALSAAAARASVAAPRP"
FT   tRNA            complement(522128..522212)
FT                   /locus_tag="RNA_18"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCG"
FT   CDS_pept        522379..523689
FT                   /transl_table=11
FT                   /gene="SynRCC307_0587"
FT                   /locus_tag="SynRCC307_0587"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27490"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI1"
FT                   /protein_id="CAK27490.1"
FT                   /translation="MLHRPALALCLAVPLLTSIGTQAAPARPDGPWGRSVSSSIDNDAS
FT                   DRYQWRACKAVAGALEAGQSVRCETLVDADNQSNSTVQKIFVTGASYATRIFPLLNSAS
FT                   LSDGIQKMLWMDSKSFIVSFAHDYLNEYVLKQIPFLSQTEFGVGFESDADMTYYLNSLI
FT                   SLAQLGSDDNGYPLGLLFAQGSAKGAYSGSAVTNLGLGLRRRLRDNAMLGANAFWDYRF
FT                   TNYSSSYSRWGAGAELWWDDFKLTNNWYIAGTGIKRITTSGRAYTDTTSLAAGTYDETT
FT                   LLGANTFDERVVPGWDVALNYRLPSYPQLSLGIRGFRWDYMRKSDNSGVEGSVNWQATP
FT                   HTNLSAWISSEIPAYPAQSNAQLSSGDDVYVGVRFNVQLKPVTYKTGSNRIRENLLTQM
FT                   RQPVQRRNDVLLERWKPKQKKTIGGVNGSFINQAAGI"
FT   CDS_pept        523728..524624
FT                   /transl_table=11
FT                   /gene="SynRCC307_0588"
FT                   /locus_tag="SynRCC307_0588"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27491"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI2"
FT                   /protein_id="CAK27491.1"
FT                   /translation="MPYSPNPRSQAAFFRRSFKALLACASAAALSVTAAKAQEDELNVV
FT                   CPPTDTRPNLGVVATSEAYCAGTPEKYQLIIYEMGLCTSNPTSSNVLDQSSCTPTFRSE
FT                   GGTTVNLAGGAVIDLGSSEESDLGRPEDNSYSYAYIIISNRFVLRAKWGNTDGITYYSN
FT                   PGGLNNVSLSPPALDFVEDLSSFDEGFDPVYPPIIVRGGTLAALLLKSDLTPASNGLEV
FT                   GRLVGTFKPQASLVIDEAVKGLKVELTVSNSGLTVGVGENPGDFNGPPSDPRAFNCYQQ
FT                   PCSYGSGPFQPTFTLIK"
FT   CDS_pept        complement(524722..525171)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0589"
FT                   /locus_tag="SynRCC307_0589"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27492"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI3"
FT                   /protein_id="CAK27492.1"
FT                   /translation="MLLLASLSGLLLASGNCEFLQPIGGDGNTTVTKRVDRPKVSPLRM
FT                   ALGRTNWNTDFSVNQPYRSYKLFFTAQSTEQATYPIEAYLKFSDGSNLRVVDESMKPPV
FT                   GTGSMFGPFTVPSGKAVSQVNFKIGASKDPGASGFSYRISVQGCH"
FT   CDS_pept        complement(525202..525444)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0590"
FT                   /locus_tag="SynRCC307_0590"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27493"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI4"
FT                   /protein_id="CAK27493.1"
FT                   /translation="MALRSLLEESLPESLFGNTDRFSWHATPVGIAALWTGKVVPTSPP
FT                   FEQALEEGMTVGLDLSREEREFHQVRQGLVLLFHS"
FT   CDS_pept        525536..526714
FT                   /transl_table=11
FT                   /gene="SynRCC307_0591"
FT                   /locus_tag="SynRCC307_0591"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27494"
FT                   /db_xref="GOA:A5GRI5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI5"
FT                   /protein_id="CAK27494.1"
FT                   /translation="MALFPFPTALVHEWFSPRSVGGAELVVQQLDQLLDPQLFSLVDGE
FT                   SGRPQSWLAGRQIETSFIQKLPWGRSHVQQYLPLLPLAIEQLDLSGYPLVLSSSHLVAK
FT                   GVLTSPEQLHVSYVHTPVRYAWDQMHAYLRSSRLAQSPLGPWIRWQLHQLRQWDVLSAS
FT                   RPDRLIANSRFTAQRIARYWGRSSTVLPPPVDVERFDWQQPREDFYLSVCRLVPYKRVD
FT                   LVVQACRELDLPLVVVGDGPERSRLEAMAGPSTRFLGRSSAHEVEQLLARCRAYVYAGL
FT                   EDFGIAPVEAMASGAPVVGLGRGGLLDSVRCLSQEPAQATGLLFAEQQLGAVKAALESF
FT                   ESNGLWRQLPAERLRLHAKGFSEESFRQRLSSLLIDWVNQHGIGSHSAVPVG"
FT   CDS_pept        526780..527475
FT                   /transl_table=11
FT                   /gene="SynRCC307_0592"
FT                   /locus_tag="SynRCC307_0592"
FT                   /product="Sugar transferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27495"
FT                   /db_xref="GOA:A5GRI6"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI6"
FT                   /protein_id="CAK27495.1"
FT                   /translation="MLSRPASLLNTGDRLGLSGLVQRRVRPLATLKRSGDIAFSLAMLS
FT                   LGSPVLLSVALLVKLTSPGPVFFVQKRIGRRFQRFGCIKFRTMELDADRRLQELLESCP
FT                   QLRAEFEKDHKLRRDPRITPIGQFLRLTSLDELPQFWNILRGEMSVVGPRPIVEQEIPR
FT                   YGPAMEQVLSVRPGLTGLWQVSGRNNVSYQRRVLLDLTYVNRRSLGLDLRILWRTVLVV
FT                   LFPANKGAY"
FT   CDS_pept        complement(527472..528407)
FT                   /transl_table=11
FT                   /gene="cobD/cbiB"
FT                   /locus_tag="SynRCC307_0593"
FT                   /product="Cobalamin biosynthesis protein CobD/CbiB"
FT                   /EC_number="6.3.1.10"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27496"
FT                   /db_xref="GOA:A5GRI7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI7"
FT                   /protein_id="CAK27496.1"
FT                   /translation="MAAACGLDRLIGDPRWCLHPVQVMGAVIAQLRLWVEALGGDRPWA
FT                   LRLGGGLITALLVSGSAAAGWALEQLSLRSPWAMPLLVIALASALAGRSLRLAVEDVIK
FT                   PLSSAPPQLQQARQKLAWIVGRDVDGLPAPELLRALAETASENAVDGLFAPLFWMLIGA
FT                   GLWGLNPALPGPLALAWAFKASSTLDSMLGYRRGRLQWLGTAGARLDDGLTWLPCRLLA
FT                   LSLGQLGPALRDGASDPSPNAGVSQAAYAHALGLRLGGLNRYGGIERAKPLLNEGGRAA
FT                   DEKGVQAILDVSQRSALLWLGLSGVVALLA"
FT   CDS_pept        complement(528422..529417)
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SynRCC307_0594"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="Amino acid transport and metabolism / Coenzyme
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27497"
FT                   /db_xref="GOA:A5GRI8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRI8"
FT                   /protein_id="CAK27497.1"
FT                   /translation="MATLYYDTDADLGLLSGKTVAIIGYGSQGHAHALNLKDSGVDVVV
FT                   GLYEGSRSADKAKADGLEVLSVADAAAKADWIMVLLPDEFQKEVYDKEIAPHLSAGKVL
FT                   SFAHGFNIRFGLIKPPADVDVVMIAPKGPGHTVRWEYQNAQGVPALFAIEQDASGNARG
FT                   LAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLSELVKAGFETLVEAGYQPE
FT                   LAYFECLHEVKLIVDLMVKGGLSAMRDSISNTAEYGDYVSGPRLITAETKAEMKRILGD
FT                   IQDGTFAKNFVAECEAGKPEMNKIRERDSAHKIEEVGKGLRAMFSWLKAA"
FT   CDS_pept        complement(529463..530065)
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SynRCC307_0595"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27498"
FT                   /db_xref="GOA:A5GRI9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI9"
FT                   /protein_id="CAK27498.1"
FT                   /translation="MPIGTPSVPYRLPGSQYERWVDIYTRLGVERILFLGGEVNDGVAN
FT                   ALVAQMLYLDSDDSSKPIYLYINSPGGSVTAGLAIYDTIQYIKSDVVTICVGLAASMGA
FT                   FLLAAGTKGKRVALPHSRIMIHQPLGGTAQRQASDIEIEAREILRMKDQLNKQLADMSG
FT                   QTIEKITKDTDRDYFLSADDAKAYGLIDRVISHPSEA"
FT   CDS_pept        complement(530106..530780)
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SynRCC307_0596"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27499"
FT                   /db_xref="GOA:A5GRJ0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ0"
FT                   /protein_id="CAK27499.1"
FT                   /translation="MDIRSVSAPYGDSGGASFRTPPPDLPSLLLKERIVYLGLPLFSDD
FT                   DAKRQMGVDVTELIIAQLLYLEFDNPDKPIFFYINSTGTSWYSGDAIGFETEAFAICDT
FT                   IRYVKPPVHTICIGQAMGTAAMILSAGAKGQRASLPNASIVLHQPRSGARGQATDIQIR
FT                   AQEVLHNKRTMLSMLSENTGRTVEQLTADSDRMTYLTPDQAMDYGLIDRVLSSRKELPV
FT                   AV"
FT   CDS_pept        complement(530805..531932)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0597"
FT                   /locus_tag="SynRCC307_0597"
FT                   /product="Integral membrane protein (PIN domain
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27500"
FT                   /db_xref="GOA:A5GRJ1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ1"
FT                   /protein_id="CAK27500.1"
FT                   /translation="MAISLANSRRSRSPRPSSLIVEALLLLLFVISGAAAGFLGVDLLP
FT                   PRMLIQVTNLEGLQWVMGGFGAFFGLIAGFLFQRLRAQLMRQVRTMPTDLLISRAVGLI
FT                   LGLLVANLLLAPILLLPLPWEVGFVKPLAAVLSNVFFGVSGYNLAEVHGRTLLRLFNPS
FT                   STEALLVADGVLQPASPKIVDTSLIIDGRLRGLLESEILEGQVIVAQCVIDELQQLADS
FT                   GNSDKRSKGRRGLKLLAELRDSYGRRLIVNSTRYEGDGVDDKLLKLCSDTGGLLLTTDY
FT                   NLAKVAQVQNLRALNLSELVISLRPEVQPGDLLQLKIVREGKEADQGVGYLEDGTMVVV
FT                   ESGRGSIGERREVTVTGALQTPAGRMVFARTADAR"
FT   CDS_pept        531937..533169
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="SynRCC307_0598"
FT                   /product="Oxygen independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27501"
FT                   /db_xref="GOA:A5GRJ2"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ2"
FT                   /protein_id="CAK27501.1"
FT                   /translation="MPLPAGRRPPRSLYLHIPFCHRRCFYCDFPVVPLGDQADGSRSQS
FT                   IADYLHWLLRDLAAAPAGPPLSTVYIGGGTPSMLSPDQLAQLLAAVRSHWGLAPGAELT
FT                   LEMDPASFDRQRLEAVLALGINRVSLGGQSFDDAVLEQLGRRHRANQLREACSWLRQAQ
FT                   QQTLLQSWSLDLIVNLPQQSFEAWDWELSQALAQAPPHLSIYDLIVEPGTVFAWRQGRG
FT                   ELLLPDDDQAADRLQHTHQRLQAAGYGHYEVSSWALPGQASRHNRVYWSGASWWALGLG
FT                   ATSGVGTERLARPRTRDAYSEWVQADAGRQGDGPAAGWPPVEDLLLVGLRRREGVDLAW
FT                   LHQTGLGGLERAWLERVLAGWIERGVVELSAQRLRLVAPEGFSLSNAVLSDLLAALERS
FT                   EPLAPTGARLG"
FT   CDS_pept        complement(533087..533899)
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SynRCC307_0599"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27502"
FT                   /db_xref="GOA:A5GRJ3"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRJ3"
FT                   /protein_id="CAK27502.1"
FT                   /translation="MSLTPRQLGEQLRQRKQRRQPIAVLTAWDALSASWAEAAGVDLVL
FT                   VGDSLAMVALGHATTLPVTLEAMVQHTAAVERGLRHTPIVSDLPFLSYQCGPDQAVAAA
FT                   GRFLKETGCAGVKLEGGEPETIAVIDRLVRSGIPVMGHLGLTPQSVHQLGYRRQATDPV
FT                   AQERLWQRALELQQTGCFALVLEHVPAELATRLSAELSVPVIGIGAGEGCDGQVRVSAD
FT                   LLGLTPQQPPFSPALLDGRELFSQALRQWVQGVQSAPVPPANHSAPHC"
FT   misc_RNA        533937..534034
FT                   /gene="ffs"
FT                   /locus_tag="RNA_19"
FT                   /product="Signal recognition particle RNA (4.5 S RNA)"
FT   CDS_pept        complement(534057..535229)
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SynRCC307_0600"
FT                   /product="Cell division protein FtsZ"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27503"
FT                   /db_xref="GOA:A5GRJ4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ4"
FT                   /protein_id="CAK27503.1"
FT                   /translation="MLQPMNGVGTAMEREANASSGSPDTKFSAAAAGIVPSQNARIQVI
FT                   GVGGGGSNAINRMIASELHGVGFWVLNTDAQALLNSAASQRVQLGMKLTRGLGAGGNPS
FT                   IGQKSAEESRVDLQQSLEGTDLVFITAGMGGGTGTGAAPIVAEVAKESGALTVGIVTKP
FT                   FTFEGRKRMRQAEEGIARLAEHVDTLIVIPNDRLRDAISGAPLQEAFRTADEVLRSGVK
FT                   GISDIITKPGLVNVDFADVRSVMASAGTALLGIGVGSGRSRASEAAMAAMSSPLLESAR
FT                   IDGAKGCVINISGGRDMTLEDMTTASEVIYDVVDPEANIIVGAVVDEALEGEIHVTVIA
FT                   TGFEGGNQYVPQRTLRTELSDTAAQANLEINDNGVRIPAFLQNRQNRDQD"
FT   CDS_pept        complement(535309..536124)
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="SynRCC307_0601"
FT                   /product="Cell division protein FtsQ"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27504"
FT                   /db_xref="GOA:A5GRJ5"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ5"
FT                   /protein_id="CAK27504.1"
FT                   /translation="MSVRSPARPQRPASAELQRRRDLRRRKRVHFAAQLWSLLLLLSAS
FT                   AGLGWLLLRHGWLLRTPEQVQLTSRSPFNREQVISAAGLRFPVALLSLDGASLQQRLGA
FT                   KLPVEDIRLQRQLWPPQLLIDLRLRQAVARAVRHTPQGRETGYVDRTGAWISKAQQEQA
FT                   RGEAVPALRVLGWQPRHAGTIALLLRELPPAAAISQMEFRRNGELWMQSRALGPVRFGS
FT                   LDQRLPRQLEVLSHLAEQQPLAQEPTQALDLSDPERPELMLVPPKSSEN"
FT   CDS_pept        complement(536121..536531)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0602"
FT                   /locus_tag="SynRCC307_0602"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27505"
FT                   /db_xref="GOA:A5GRJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ6"
FT                   /protein_id="CAK27505.1"
FT                   /translation="MSHGLMWLPLLVAFVVLTALGWLERRRQRLFLEWASESELSKLDG
FT                   SGAARLKDGWLEWSSFEAGKLKQEGRFEVCKLELVELLALSSGDAPLTDESHGPCRLRL
FT                   IGSGDQRDLAFADADRARDWIEQLMSRSRCEL"
FT   CDS_pept        complement(536528..537565)
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="SynRCC307_0603"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27506"
FT                   /db_xref="GOA:A5GRJ7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRJ7"
FT                   /protein_id="CAK27506.1"
FT                   /translation="MSSQQSKVVGLIFGGASGEHDVSIRSAATVAEGLSSGANKERYRV
FT                   QHVYIDRQGRWWGDATARQVLSSGQALADDGSRPGFSGFPDGCLEVEIWYPVLHGPNGE
FT                   DGTIQGLFSLMQRPFVGSGVLGSAVGMDKLAMKAAFSAAGLPQGPYRPVLASELVSNSQ
FT                   LLEELETQLGYPCFIKPANLGSSVGISKATNRSELQAGLDLAASHDSRLLVEKGLQVRE
FT                   LECAVLGGQHLKASVLGEVSFDADWYDYETKYSSGLSSTQIPADLPEAISSRAQHLAIE
FT                   AVQAVGASGLSRVDFFYEEASGNLLINEINTLPGFTSQSMYPMLWKASGVPLEELVHQL
FT                   LELAQ"
FT   CDS_pept        complement(537584..538945)
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="SynRCC307_0604"
FT                   /product="2-methylthioadenine synthetase"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27507"
FT                   /db_xref="GOA:A5GRJ8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRJ8"
FT                   /protein_id="CAK27507.1"
FT                   /translation="MADSSRGTYWITTFGCQMNKADSERMAGILESMGYCAGSGEDQAD
FT                   LVLYNTCTIRDNAEQKVYSYLGRQARRKRDNPALTLVVAGCVAQQEGESLLRRVPELDL
FT                   VMGPQHANRLDTLLSQVEAGQQVVATDDHHILEDITTARRDSSLCAWVNVIYGCNERCT
FT                   YCVVPSVRGQEQSRLPQAIRLEMEGLAASGYKEITLLGQNIDAYGRDLPGITPEGRRQN
FT                   TLTDLLHHVHDVKGIERIRFATSHPRYFTERLIEACAELPKVCEHFHVPFQSGDDELLK
FT                   AMARGYTTARYRRIVEQIRKLMPDAAISADAIVGFPGETDAQFRRTLELVDEIGFDLLN
FT                   TAAYSPRPNTPAADWPDQVEEHVKVERLKELNALVERKAKACSQRYLGRVEEVLAEGIN
FT                   PKDNTQLMGRTRTNRLTFFPAGSHRVGDTVPVRIEQVRAFSLSGSAQAQPALVR"
FT   CDS_pept        539017..540072
FT                   /transl_table=11
FT                   /gene="SynRCC307_0605"
FT                   /locus_tag="SynRCC307_0605"
FT                   /product="L-alanine-DL-glutamate epimerase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27508"
FT                   /db_xref="GOA:A5GRJ9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ9"
FT                   /protein_id="CAK27508.1"
FT                   /translation="MGWLAMRWSLRRFTLTKQVPLTISRGTTAAVEHLLLELEHGGLIG
FT                   RGETGGFDTGQRVFSTAQLEQELTGWLPQLEAAGWQEPAHWPALLAPLSAPARCAVDLA
FT                   LHDLWGQLLAQPLWRLWGLDLRGCQPTSVTLGLAPVEKVLERLSRWRQQLPASRVKLKL
FT                   GSPDGLSHDQALVEALLPVLGGAELQVDANGGWSLEGARQMLPWLAERGVVLVEQPLAA
FT                   SDGDEQGFAALQGAAPIPLVADESCWNLEDLLRLAPHVQGVNLKLLKTGGLSEALLMAQ
FT                   LASRLGLKLMLGCYSDSALLNGAAAQLLPLVEWPDLDSHLNLADDPFSGPLAQGDLLQP
FT                   SSGAGLGVRPC"
FT   CDS_pept        540066..541121
FT                   /transl_table=11
FT                   /gene="SynRCC307_0606"
FT                   /locus_tag="SynRCC307_0606"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27509"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK0"
FT                   /protein_id="CAK27509.1"
FT                   /translation="MLSPDAPVLLLQHGGLFDLSGKTGLAFLRYRQGPVVAVLDPGHAG
FT                   ADLPLLTGIPRPVPVVGSVAEAMVYGPQVAVVGLAPSGGVLPEPVRQSVLEALRSGLSV
FT                   ASGLHTQLAADPELQAAVQPGSWIWDLRQEPAGLGVAAARAASLPCRRILAVGTDMSVG
FT                   KMSAALELTAAARQRGLDARFVGTGQAGILIAGGGVPLDAVRVDYAAGAVEQAVLQVAE
FT                   GAGEESIVFVEGQGSFCHPGSTATLPLMRGSQANSLLLVHRAGQRSIRNLPEIALPPLP
FT                   ELIAVVEALARLGRPPGLAPARVKAIALNTAQLDDRQAAAAIEQTAQDTGCCCADPVRG
FT                   GADRLLEALLS"
FT   tRNA            541133..541205
FT                   /locus_tag="RNA_20"
FT                   /product="tRNA-His"
FT                   /note="codon recognized: CAY"
FT   CDS_pept        541268..541633
FT                   /transl_table=11
FT                   /gene="SynRCC307_0607"
FT                   /locus_tag="SynRCC307_0607"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27510"
FT                   /db_xref="InterPro:IPR025578"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK1"
FT                   /protein_id="CAK27510.1"
FT                   /translation="MLLPAAGALLWIGNPGPQDFADFAGRELSERGIQEFCRDGVLPLM
FT                   MNLMVDNCPRLFRDQREALGDLALQLSQRRNFGFFSLYKTEVGASGLLAQLPLPRYSLE
FT                   TLAVAGQFIVLRAESVD"
FT   CDS_pept        541633..542973
FT                   /transl_table=11
FT                   /gene="SynRCC307_0608"
FT                   /locus_tag="SynRCC307_0608"
FT                   /product="FAD/FMN-containing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27511"
FT                   /db_xref="GOA:A5GRK2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK2"
FT                   /protein_id="CAK27511.1"
FT                   /translation="MGLRDLRAELSQLDVIDQGPLLQQLSHDQFSFSPSLVPRLQPCCA
FT                   DLVVRVSSTAEVVQVAGACARHGVPLTPRGAGTGNYGQAVPLEGGVVLDTSAMQQVRQF
FT                   DPLSGVLTAEPGCRLLELDRYLQPQGWALRLAPSTWRTASLGGFIAGGSSGVGSVRWGL
FT                   LRDPGNLLGLEVVTVEPEPRVLQLDAAAARGLNHAYGSNGIFTAITVPTAPWQDWQEVA
FT                   LVAESSAAALALGEQLTAAALEIDGLCFLERRLLERMPALGSSPWPSGDALLLLAAPAA
FT                   LPLIETMASAAGAELCWQRPQWPPRGLLLRELCWNHTTLQVRANAPQFTYQLVLLPDPV
FT                   GPFIEAIAERWPGWVHWHLERVRQGGRLRWVGLLPFQWRGEAALAELNGALKAAGGLVF
FT                   NAHAITVEDGGLGVVDADQVAAKRAYDPAGLCNPGKLRGWSSGAVEA"
FT   CDS_pept        complement(542953..543423)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0609"
FT                   /locus_tag="SynRCC307_0609"
FT                   /product="Secreted pentapeptide repeats protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27512"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK3"
FT                   /protein_id="CAK27512.1"
FT                   /translation="MLRLLVVLLLNLSLLWPLQPAMASGSYLEKTDYTLTNQSDADFSG
FT                   QDLEGSSFAGAVVRNADFSGAKLHGAIFTQGAFAGSNFAGADLSDVLMDRADFTGTNLS
FT                   GTNLSGVVANGSSFAKAEIEGADFTGALLDRDDQITLCRKAKGETRLSLDCP"
FT   CDS_pept        complement(543423..544625)
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SynRCC307_0610"
FT                   /product="FolC bifunctional protein (Folylpolyglutamate
FT                   synthase / Dihydrofolate synthase)"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27513"
FT                   /db_xref="GOA:A5GRK4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK4"
FT                   /protein_id="CAK27513.1"
FT                   /translation="MQLPDPVELGDLLEPFSRRGIDLGLDRLHQALAAGGHPEQRFPAV
FT                   QVAGTNGKGSICTALGAILQAAGLKAGLYRSPHLISWCERIAIGNQWIAAEQLRSLLQR
FT                   WQSLGQQHQLTPFELLTAAAMDHFAAAQVDLAVLEVGLGGRLDATTCHPNRPVLGIANI
FT                   GLDHREHLGSTLEAIATEKAGIFHTGAVAFSAPQPDSVAEVLEQQAQQRGCQLHWVEPL
FT                   AAEVPLGLAGSWQRSNAAVALAMAQELARQGWPISVQAMAQGLAQAQWSGRLQRRQWRG
FT                   QPVLIDGAHNPPAAEGLRRELNQLAPGQPRHWLLGIQRHKDGPAIVRALMAPGDRAWMV
FT                   PIEGCRSWQAAELTIPGVHDSPSAEQALEQLWPAACEPVIAGSLYLLGQLWPTLEPPAE
FT                   G"
FT   CDS_pept        complement(544627..545829)
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="SynRCC307_0611"
FT                   /product="Acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="Amino acid transport and metabolism / Coenzyme
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27514"
FT                   /db_xref="GOA:A5GRK5"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK5"
FT                   /protein_id="CAK27514.1"
FT                   /translation="MPPQDQSTAVMATYGRFPVKLERGQGVWVHDSQGRRYLDCVAGIA
FT                   TCTLGHSDRALRRALTQQLRKLQHVSNLYAIGEQEQLASWIAGNSCCDQVFFCNSGAEA
FT                   NEAAIKLARKYGHSRRGINQPLILTARSSFHGRTLAAVTATGQPKYHRGFEPLPEGFAY
FT                   FDYNDIPSLEAALQQHSDRAVAVLLEPLQGEGGILPGDRAFFSRLRQLCDERQLLLISD
FT                   EVQVGMGRSGTLWGYQQLGIEPDAFTTAKGLGGGFPIGALAVKNHAAVFEPGDHASTFG
FT                   GNPLACRAALTVARELQQRRLLENVQQRGEQLQQGLQQRVQQWPQLLAGERGWGLIRGL
FT                   LLRDDSISAIDLVKAAMAEGLLLVPAGSQVVRFVPPLVINRRQIHQALQRLDQALSKLA
FT                   A"
FT   tRNA            complement(545822..545903)
FT                   /locus_tag="RNA_21"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG"
FT   CDS_pept        complement(545901..547229)
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="SynRCC307_0612"
FT                   /product="UDP-N-glucosamine 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27515"
FT                   /db_xref="GOA:A5GRK6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK6"
FT                   /protein_id="CAK27515.1"
FT                   /translation="MWVQTATLPMNVILAPSQKALTPHLEIRGGRRLAGEIRVSGAKNS
FT                   ALVLMAACLLSSDDLKLRNMPALSDIQGMGEILESLGVTMNRGDGFVELNASGLNQSSP
FT                   PYELVNGLRASFFCIGPLLARTGVARVPLPGGCQIGARPVVEHVKGLKALGAQVTIEHG
FT                   VVSAVVPGRGHRLTGGKIHLDCPSVGATETLMMAAALADGETTIENAAQEPEVVDLAGL
FT                   IIAMGGKVRGAGTPTITIVGMERLHGADYMVIPDRIEAGTLLLAGAITRSKLRITPLIP
FT                   EHLGAVLSKLEEAGCTLESDGIGMTISADRVRAVDLRTQPFPGFPTDLQAPFMSLLATA
FT                   EGTSVITEAIFENRLQHVAELQRMGAAIRTQGNTAFIEGVPFLSGAPVTGSDLRASAAM
FT                   VLAGLAAEGTTLVQGLKHLDRGYDRLEEKLRSVGASIERHDVG"
FT   tRNA            complement(547429..547512)
FT                   /locus_tag="RNA_22"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUG"
FT   CDS_pept        547613..547861
FT                   /transl_table=11
FT                   /gene="SynRCC307_0613"
FT                   /locus_tag="SynRCC307_0613"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27516"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK7"
FT                   /protein_id="CAK27516.1"
FT                   /translation="MIVLKISNASDVVASKVGRFLERLTPDSLDEAKVEEEVIKKLVEN
FT                   LRTEGIEGSVASVKGLDLSPEGIVMKNDIHLRRFEQI"
FT   CDS_pept        547848..548687
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="SynRCC307_0614"
FT                   /product="rRNA methylase"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27517"
FT                   /db_xref="GOA:A5GRK8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK8"
FT                   /protein_id="CAK27517.1"
FT                   /translation="MSRFDGRPADLISSRRNPLVQQVRALQQPRGRREQGLLLLEGTHL
FT                   LQECRRLGLPLDRLIATTRWQEQHPTLLGSEPLQPVSPEVLQAMASTDSPDGVIALLPH
FT                   PAPGLQAPSWPQAKSPLLLALDRVQDPGNLGTILRTALAAGVDRVWLGGGADPWQPKVL
FT                   RASAGAALELSMQRLDDLAPVLAMARERGVACYAALRDGGQPYWQPDWHQPSLLLLGNE
FT                   GSGLDPALVQQGVTALTIPHHAAVESLNVAVAAGVLLLERVRQGHDRRESAATALGA"
FT   CDS_pept        548684..550123
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SynRCC307_0615"
FT                   /product="Dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27518"
FT                   /db_xref="GOA:A5GRK9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK9"
FT                   /protein_id="CAK27518.1"
FT                   /translation="MTAAMDYDLIVIGAGYGGFDAAKHAAEKGLKTAIIESREMGGTCV
FT                   NRGCVPSKALLAASGRVRELSDGEHLSSFGITPGTVQFDRQAIADHATQLVENIRANLT
FT                   KSLERAGVTIVRGTAQLAGPQQVAVRQSNGVERVLSATDVLIATGSDPFVPRGIETDGL
FT                   TVFTSDDAVRLESLPQWLAIIGSGYIGLEFADVYTALGCEVTMIEALDRVMPTFDPDIA
FT                   KLAGRKLIESRDIDTRSGVFASKVIPGSPVKIELIDAGTKELVEVLEVDAVLVATGRVP
FT                   TSADLNLAAVGVESERGFIPVDDGLRVLAGGNPVPHLWAVGDVTGKLMLAHTAAAQGVV
FT                   AVENICGGNRTVDYRSIPAATFTHPEISSVGLSEADAKAIAAEQGFELGSVRSYFKANS
FT                   KALAELESDGLMKLLFRKDTGEVLGAHIFGLHAADLIQEVANAVARRQSVRDLVYEVHT
FT                   HPTLSEVVESAYKQAAHALAA"
FT   CDS_pept        550132..551016
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="SynRCC307_0616"
FT                   /product="Indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27519"
FT                   /db_xref="GOA:A5GRL0"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRL0"
FT                   /protein_id="CAK27519.1"
FT                   /translation="MEIRRRPPNPKVRVAHLEYAVPHDDEAPRHILEEIVWEKDREVAQ
FT                   ARERVPLEKLKSQVAALPAPRDFVAALKASCRKPAVIAEVKKASPSKGVIREDFDPEAI
FT                   AKAYAEGGASCLSVLTDKRFFQGGFEVLVQVRQVVDLPLLCKEFILSPYQLYQARAAGA
FT                   DAVLLIAAILTDQDISYLLKVARSLGLQVLLEVHDAAELERALGFEGVQLIGINNRDLT
FT                   SFDTDLATTETLTATYGEQLRQSGALLVSESGLFSRDDLDRVQSAGADAVLVGEALMRQ
FT                   SDVQQALETLISG"
FT   CDS_pept        complement(551109..552728)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0617"
FT                   /locus_tag="SynRCC307_0617"
FT                   /product="Putative outer membrane protein, contains Hep_Hag
FT                   repeats"
FT                   /note="Possible HGT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27520"
FT                   /db_xref="GOA:A5GRL1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL1"
FT                   /protein_id="CAK27520.1"
FT                   /translation="MPQPGKLISYAYGTNSNAYQINAFAYGTNSEALAINSIASGTEAQ
FT                   AGGINSIAMGTNSLVHGTMSHNHSVNAMAIGTDTYVRGNNSLAFGTNAYANGVNTSAHG
FT                   PNARAIGFNAVAQGTDAVAEGRNVIAIGTGAKAFGYNTNVVSIGTDGFAYGTNVVALGA
FT                   ASRAIGTNGLAIGTGAYAQGSNVIAIGPAALADGIESAAIGSGAIAFGTQAFAVGAFSS
FT                   SYSDYGSAFGPGATARAFGSTAIGMNAVTTRPFEVSLGSAASPYSLPGLHPRGFIGSGY
FT                   QKPGEKRFVTTDQTGTLGTTSYSPDDVVDSIGAVGALSAAMGSIPITTLLPDESVRCGV
FT                   GTGTYGGQYAGSIGCAAKVAKRFFFNGGVAMTATDTVNSGAMGRLGFSFGFGGAPSKAK
FT                   QAELAVIPGMNNIGGNSLFELGNSQGSVTKRGQESVLMAKSSEPSPIPTTSNEQLLKQR
FT                   LSQLEAEIELLRQTAEAAKSSADEIDSAEATALKRLESITKEKEQLELALSANTKKIQQ
FT                   QELQILKLNERLDALMRKLDEK"
FT   CDS_pept        complement(552580..554262)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0618"
FT                   /locus_tag="SynRCC307_0618"
FT                   /product="Putative outer membrane protein, contains Hep_Hag
FT                   repeats"
FT                   /note="Possible HGT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27521"
FT                   /db_xref="GOA:A5GRL2"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL2"
FT                   /protein_id="CAK27521.1"
FT                   /translation="MAIGTRSNAFYDDAFAAGLEAEAIGYNSMALGFQSKALQTNSLAY
FT                   GTRANASAINAMATGTDSQASGVSSIASGTQAQASKTGAIAIGPSSRATGIQTIAMGGE
FT                   AEATGAYAISIGFNSLANQTRSFAAGAQAKATANGAMALAAFSNASGTDSISAGYNSLA
FT                   TGNNAISFGTGTRATARDAFATGLQANASRASAFAIGTNTIASGINSIALGTSSQATNL
FT                   DAYSFGVESIASAENATAIGTMAKATGANSFAVGLEAQASDSNSLAFGVESTSSGLSST
FT                   AIGTRAIASNELTVAIGFNASATAINSMAAGSSAQANGTDGVALGVLSSASGLRTTALG
FT                   TRANAAAVDGVAIGYEACAIAANAYAAGVKALASGSNSMAWGVLAQATNFNSIAVGVCS
FT                   QSTGIDSLALGARSNANDTNAFAIGSFAEADGVNSFAIGPNAKASGINAFAAGPNSYAE
FT                   GNDAFAFGIQAEAIGDSSFAFGDFALTTSAARDSLCYGDSCEALGDNSSATGTNATAWQ
FT                   ADFLCLWNQLQRLPNQRLCLRHQLRGPSHQFDCFRNRGSSRRH"
FT   CDS_pept        complement(553491..557129)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0619"
FT                   /locus_tag="SynRCC307_0619"
FT                   /product="Putative outer membrane protein, contains Hep_Hag
FT                   repeats"
FT                   /note="Possible HGT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27522"
FT                   /db_xref="GOA:A5GRL3"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL3"
FT                   /protein_id="CAK27522.1"
FT                   /translation="MRAPLKLALGTGAFVLIGSSPALAQIGLCTVNPASDLIFAGAGSP
FT                   LIFSGAGATPFTVEGGGSPLVITGNGGAAVEVGGTFTAACEGIYCEGIGDVTIDGAGGF
FT                   EIGGASEYTIMGEGLSSFTMDGEYTFTSEGAFSATACGSEANTGSFASGLGSTANGVEA
FT                   VALGIAAAAGGAQNVVVGTTAGGDGDQITVLGNNITADGDQAIAIGNEAAAGGALSIAI
FT                   GNEAEAGTTAGVAIGANVGGNGLAITVLGANATADGDQGVAVGQGAGAAGAQTVAIGNG
FT                   AQAGGAGTISIGNGVSANGDAIVALGTGVQVTASDTIAIGNGVTSNASQSNVLIGSGIA
FT                   SVATYDNVVIGKDIGSLGAAGNIVIGSGDGDLGTAASIMLGNGVAAAGMSGNILMGNDA
FT                   TAEFSVGSVAIGNSVNIGGNAGGVVIGNGATADGGVNQVVIGNGVVSVANSTVVIGDSA
FT                   MTSDDADGAIAIGSQTRATAVDALAMVSATASGESSIAIGSTAEATQYGSIAFGGDASS
FT                   TKLGAIAIGANTSVSGETGIALGYQSSVSGTNAIAIGANTSATCANSFVLGAGAIANGT
FT                   GAGAIGYLANTQGSDAMAIGVQACALGDNSMALGTSAISKGIDSVAIGYSACSSATNSS
FT                   AIGTNATANGTNSMAFGANSLASGINATAIGANAWADQTNSIVIGPNARACGVNAGAIG
FT                   ASANANGESSLAIGVKSFAKETSSLALGTNASSIGTNSTAIAVNASSTGANSMAIGYFS
FT                   TSNGVNSSALAVKANASGDNSVALGVFANAQGGNSLAFGTCSIASGTNATAISSDASAT
FT                   GNNSIAIGVDSIASQENAQSFGVKARAEGINAVAIAAGSFANGENSMAIGVLANATALN
FT                   TAAIGTFARASQNGALAFGSNASATANYAMALGVNALANSNGAIAIGRYANAVSTETFA
FT                   AGALHKPSTTTPWPLAAMPKQPAPTPWRLAPEATPSTTTPLQLVLRQKRSDTTPWRLVF
FT                   SPKRCKPTAWPTEPEPMPVPSMPWLPAQTHKHLVSHQSPPAPKRKPAKPGLLPSGPAAV
FT                   QQGFKPLPWVVRQKRPAHMPSQLASTVWPIKLARLQLARKPKPPPMGPWHWLLSPMPAA
FT                   QTPSPPVTTHLLQAITPSPLALVPVPQLEMLSPQACKPMRAVPPLLPSAPTPSLAVSIP
FT                   LPSAPHHKPLISMPIPLAWKASPVLKMRPLLAPWPKPQELTHLRLD"
FT   CDS_pept        complement(557273..557566)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0620"
FT                   /locus_tag="SynRCC307_0620"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27523"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL4"
FT                   /protein_id="CAK27523.1"
FT                   /translation="MPKDSSPKDPKKKAQNSAFGIAVNSDSSHLLAQAASSLPETVTIS
FT                   GTEYKTEELSNQTKQLVLIYLADQKILGQQKELLALAELGLKTLVKEIESSI"
FT   CDS_pept        complement(558017..558625)
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="SynRCC307_0621"
FT                   /product="30S ribosomal protein S4"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27524"
FT                   /db_xref="GOA:A5GRL5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRL5"
FT                   /protein_id="CAK27524.1"
FT                   /translation="MSRYRGARLRVTRRLGDLPGLTRKAAKRSYPPGQHGQARRKRSEY
FT                   AIRLEEKQKLRFNYGVSERQLVRYVKKARAQGGSTGTNLLKLLENRLDNVCFRLGFGPT
FT                   IPGSRQLVNHGHVTVNGRVVDIASYQCKAGDVIAIREKKPSKKLAETNLEFPGLANIPP
FT                   HLELEKSKLTAKVVGKCEREWVALEINELLVVEYYSRKV"
FT   CDS_pept        558675..558956
FT                   /transl_table=11
FT                   /gene="SynRCC307_0622"
FT                   /locus_tag="SynRCC307_0622"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27525"
FT                   /db_xref="GOA:A5GRL6"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL6"
FT                   /protein_id="CAK27525.1"
FT                   /translation="MCECKPEQSNNLPAQGEPAAVGPLAAVLLLLLAIYRRLISPLLGP
FT                   RCRYVPTCSSYAVEAVQRHGALRGSWLTLKRLLRCHPFAEGGYDPVPE"
FT   CDS_pept        558953..559240
FT                   /transl_table=11
FT                   /gene="SynRCC307_0623"
FT                   /locus_tag="SynRCC307_0623"
FT                   /product="Thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27526"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL7"
FT                   /protein_id="CAK27526.1"
FT                   /translation="MMAMADLSWPALTLITRQGCCLCEGLQERLEALDPAPPLQCVDVD
FT                   GDAQLQARFGLEVPVLMTASGEVLARVPPRLSGDRLADWLQRSLNSSNSA"
FT   CDS_pept        559270..560754
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SynRCC307_0624"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27527"
FT                   /db_xref="GOA:A5GRL8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL8"
FT                   /protein_id="CAK27527.1"
FT                   /translation="MASEASRLHLLIRDAGLSVPQQLPDPVVTDFSCDSRRIRPGTLFV
FT                   GLPGGRVDGGSFWRAALQQGATAAVIGPDAAQQEPPAPGDPVLVVADPVAAAAGRLAAA
FT                   FWNHPSDQLSLIGVTGTNGKTTTTHLIEHLALACGSPTALMGTLANRWPGHSRNAVHTT
FT                   PFADQLQADLAAAKAAGCSMAAMEVSSHALDQSRVAGCRFSGAVFTNLSQDHLDYHPTL
FT                   EDYFEAKAQLFAAPYLKGQAVVNSDDLHGRQLAQRLGDQCWRSSLEDSSAELFMDGLQF
FT                   SATGVKGVLHGPSGDVPFQSPLVGRFNLMNLLQAVGVLLQHGLPCDGLLQALESFNGVP
FT                   GRMERVPHRSDQPAVLVDYAHTPDGLDNALQAARPFAEGKLICVFGCGGDRDRSKRPQM
FT                   GAIAAQLADELVVTSDNPRTEDPQQILDDVVAGIPAESACVVVADRAAAIAQAIGQAKA
FT                   GDLVLIAGKGHEDYQILGTTKVHFDDREEAAKALQG"
FT   CDS_pept        complement(560767..561921)
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /locus_tag="SynRCC307_0625"
FT                   /product="Selenocysteine lyase"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27528"
FT                   /db_xref="GOA:A5GRL9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL9"
FT                   /protein_id="CAK27528.1"
FT                   /translation="MPAEELRSLLPALGNKHYFNYGGQGPLPTPSLEAMVACWRELQRL
FT                   GPFSRDVWPFVEAETSALRRRLAQLCGVPPHRLSLTENVTSGCVLPLWGLPFEPGDSLL
FT                   LSDAEHPGVVAACQELARRQGLTISWFSARDCRSDAALLESLEAALEPSTRLVVLSHLL
FT                   WNSGLAMPIEAVAARLKQHPRQPWLLVDAAQSMGSLELGGVPAAADIYAFTGHKWCCGP
FT                   EGLGGVALSERVLEQSQPTVIGWRSLRNENSSGSQWHHDGRRFEVATSCIPLGAGLRSS
FT                   LDLLEQLGNAQQRQALICERSARLWNGLQQIPGVQTVVKEAPPASGLVSFTIDHTPAQA
FT                   AVSALADQHFQLRSLEDPLCLRACTHVFSTETEIDQLLEAIGQL"
FT   CDS_pept        561996..564230
FT                   /transl_table=11
FT                   /gene="SynRCC307_0626"
FT                   /locus_tag="SynRCC307_0626"
FT                   /product="Putative soluble pyridine nucleotide
FT                   transhydrogenase"
FT                   /EC_number="1.6.1.1"
FT                   /note="Possible HGT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27529"
FT                   /db_xref="GOA:A5GRM0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM0"
FT                   /protein_id="CAK27529.1"
FT                   /translation="MAQIIFLMAGLQSVLQKVIQKAQRVVQQSSGKSNSNNAQSQRELN
FT                   RPHQQRGANPKPANEPQRLDAVTGLNQANSEHQPELVALRNAARSLLKMPVAFIGFIED
FT                   NTQRLLTVTVAPQGEQACDPLDFKEMLTPRECSICQYTIMESDHLVIPDLKEFLEHGDG
FT                   ASYPAEFLEQAKQVGGYPIPWPDGAGGITLKPAHFYAGATIRTSKGMHVGTFCVVDVVP
FT                   RPDFGVREIDVLENLAAQAADYLEERALLRRPANFQLLQQLSSGDDAASETASWDAVVI
FT                   GGGPAGLTAACRLSFQGLKVALVEPKESFGSPTGVSSKVLREVAMDHGAGTSWDDVLSI
FT                   RQLIAQNDAKRVALQLQRYGVTHFKGTGEISGCNGDGITTVVVRDSTTGVSELLARKVV
FT                   VSTGSKARRLGGIPFEQPGFYDSDSIGSLRSKPSSLFVQGTGIIALEYATIFAEMGVQV
FT                   SVAARGKRDDLLPMLDGSMRDALLSDLEAKGVEILYQACVKGWRADEVGPLVELELSSG
FT                   ISERRFSAVLSAVGRVPTTQDLGMEVLLEADDVSKLKKLPLLENQQLETNAGSVYVIGD
FT                   VSGSGLACKAVMQAQGLVDHVLPSLVLKSKQPAQSNPSHASPSIIWAIPELAFVGSSQS
FT                   EAINTYSEAEVFSVLAPFADTIRGRLKALPASYFLKLVCLRQDGRILGVHVYGEGASEL
FT                   IHLGASLVADGNTVFDLQYKSFPAVTLHEVYRNAAMLAIDTLSGLAQKTG"
FT   CDS_pept        complement(564204..565502)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0627"
FT                   /locus_tag="SynRCC307_0627"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /note="Transcription / DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27530"
FT                   /db_xref="GOA:A5GRM1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM1"
FT                   /protein_id="CAK27530.1"
FT                   /translation="MLVFAGPGAGKTLGALLAFKAMQQEGRLQRFVVLCHRTSILSQWQ
FT                   SAAQRLGLRLEEWPCSDQADGLLITYQGAGRQLEQLGEDLRQWGLAGTLAIADEAHHLG
FT                   MDPDEPDNSAWGGTFLELTQHCRLRLGLTGTPFRADNLAFCAARRIRLRQGNELIEQIV
FT                   PDLAVEPRELIAAGDVRPLEFRFQDGWVEHSREGMPDRDVSPLSAETRESWRARNLRRA
FT                   IELGDDSGISQQLLLRAQRKLKQVRMQHPNAAGLVIARDIDHAQAITTLLEEDGHRVDL
FT                   VHSQESGAAERLNNFQKGSAQWLVSIDMCAEGFDAPRLRVIAYLTTVVTKSRFLQGITR
FT                   AVRMTPELAAQEPTPRHPSFVYAPADPLLMGYARTWSLAEPYVIQPKQEQLVEVPSGGS
FT                   WRGPSLPLEAVDDGASQLIRVRSPQLPGFLRQA"
FT   CDS_pept        complement(565687..566022)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0628"
FT                   /locus_tag="SynRCC307_0628"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27531"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM2"
FT                   /protein_id="CAK27531.1"
FT                   /translation="MLRHLLITAAAASFAAAGPLAVQAQEQDPEQLEQELTEQFVDGFN
FT                   RGCVRGETPGVLDQPAYCSCLAKAYTSRYNGFALAQISNLSGPMGPKGAELVNLMMAPE
FT                   MASCADQ"
FT   CDS_pept        complement(566095..569133)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0629"
FT                   /locus_tag="SynRCC307_0629"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27532"
FT                   /db_xref="GOA:A5GRM3"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM3"
FT                   /protein_id="CAK27532.1"
FT                   /translation="MNSRLLLISAVLRAAGFRRGNQTRRSSRSRRWSRAAQTLFASWAV
FT                   LGQPGSMGLLVAEVIQPQLAKANPPMAGDSSGKATSTGTGAFAIGIGATANGNYSQALG
FT                   YEANAKGDAIAIGSCASSSGWRSIALGVDAQSSGEDSYAIGKSSKASLNYSLALGVGAN
FT                   AAAQDAIAVGRGASALTANSIAIGQSAEVSSQKNAVAIGTKASASGLRSTALGAGSVAS
FT                   GKNSTAVGTGAATTRADQLMLGKAATEVTIANLGYANDNKYHLVTVDTDGTLRQKPFVD
FT                   VGFEIDISGRGALIKPGENIRISSINGANDDGYYGGAVTISAKGVELQAGENVFISEQE
FT                   SGLTTSYTVSGLQTTVSAADDKVIVTKQGGSNEANNYTTDYSIGINISDNAYNALKCEG
FT                   NGVNAVCYGPGANATGIGTTAIGAYANATTTLSTIDLGSTAVGFLATASGVKSAAFGRA
FT                   AQASAQSALALGAGAQATHANAVAIGPGATTTLESRITIGTGTTSYQTPGLTASTTDVA
FT                   VVVTNQTGVLRAATFAAQNLPNSYCLSGGAGATCYGQEADATGAGTTAMGAGALANSGA
FT                   GAANLTAATALGTLSKATGGGSTSLGVQANASGEGSISAGMNSTAAGRGSLAYGFGANA
FT                   SAENTIAIGGFADADGQNSYAIGAGAVANGVGAIAIGPGSKALGYNTNATAIGAGAVAD
FT                   GTSATSIGASSYSSGVNVTALGAGARATHTSSTAVGTGAVTTRDNHTVIGTSTTEVTMP
FT                   NLAGAGTAIVAANEDGTLQRSSVSLGDLDNAVNKRLPKLESAARSLGNAVEAAGAMGAA
FT                   LSSLPEVSLAQDEPVRCGFGAGGWGSQYSVAGGCAARVADRLHVNGAIAYTPSVDYEFG
FT                   STPSVGGRVGFSFPLGKLNKPKPSDPQPEQAADPAPQADPVRGLWKTSPIGSETLYVEK
FT                   IAKLTEQLEQLQQSAGSSEANEQLIALLRERIEELEAEKELASAENQRQDDKIKQLETK
FT                   LSQQQSLMERMMKQMKKLMPNGG"
FT   CDS_pept        569421..570371
FT                   /transl_table=11
FT                   /gene="SynRCC307_0630"
FT                   /locus_tag="SynRCC307_0630"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27533"
FT                   /db_xref="GOA:A5GRM4"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM4"
FT                   /protein_id="CAK27533.1"
FT                   /translation="MSVRRLSGLVDHRFSSASELEALLASIGFEAQVLQLEGGVLQGRF
FT                   QFLADQRVALLRLQSSLGISIGCARKAEMICCGFELEGKPDVVLAHGQPIAPHAVAGVS
FT                   LALSYSFFQFRSGADVVIALLPKQDLIEQLEICGGQQCLRWMQSHNQLLLHQQAHQALV
FT                   GLLRHWLADPGAIPSDPTAAVVRLLNDDTVHGAVPFRWVTRFQLVFDLIALGARGTIDG
FT                   LDLDQLADRLSCSRRSLIQGCKELLGMGPKEVLRIQRLEQVHQALLRHDPKSAVAPQTV
FT                   NAVAERFGFQSRGHFAAAYRRQFGELPAASFRKRA"
FT   CDS_pept        570445..573639
FT                   /transl_table=11
FT                   /gene="SynRCC307_0631"
FT                   /locus_tag="SynRCC307_0631"
FT                   /product="Predicted O-linked N-acetylglucosamine
FT                   transferase with TPR domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27534"
FT                   /db_xref="GOA:A5GRM5"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM5"
FT                   /protein_id="CAK27534.1"
FT                   /translation="MAASISASTLVAVNARLCIAPLPKVASTLLKRVAVLADGREPLST
FT                   TSLGETRPALAIHRAEVHGLPCLAELSQEQQEHWLGDAHALRLVVTRHPAERLLSFWHD
FT                   KLHLAEPAYAPLNASVQAARQRSGADPCRFADFLSFLEEHWELLKSDGHLRPQCDLLGD
FT                   APGFQRLDRDGLVKQLPRLLQPLVPAATLGRIKDELATYDKQYRQRLGKRWEDAYSKDG
FT                   LQLVESLYGDDLKRYGYSMPRRRSDKVRPLAAVDTDALVDPLQQLRERHQQIAGLQQQL
FT                   AEAQQALAKPPLPSIDPPQGQWPDHNSPEAGLSHLYDALNEQRFQEVIEQAASLQGHPH
FT                   AGEIAYIQGLAHGALGEHQAAIDAYVAAQAAGFLTPYVLFNAGNSCRGLGNTAEGLRLY
FT                   QEAIDLFPAFAEARHNLAMALLENQDTAEAERQLRLLLRDQPSYYQASFCLANLLRDLK
FT                   RDPEAVEAFRLCLHYAPNYPDAWNNLGLTYGNLKQMDEAIASYRHALSINADFKPSRQN
FT                   LAQALVQLKHHDEAYQEFGLFRRLDLSPTEQVVGLQGQINCLMELDRYEEGLALADAEP
FT                   DRRLQLMARLHVLPVLYDSSEQVSATRQRWHDDATELYGLLDGISQDDPHWEHLYGHAW
FT                   SLTNFYLAYQMEDDRPLQELYAGILDRILRPKLGAFMQPLPQRHPGDTSPLRVGVISPH
FT                   LVNHNGSIWALGWLEGIANNSGYEIFSYNVADNEDSGTQRFAALGTYRHLPLCAEAPEA
FT                   MLQQILDDRLDLLIYTDIGMHPASKITSVLQLAPVQGQGWGHPITSGSRTIHYYLSGEG
FT                   MEPSGNEEHYSETLWRLPRTGLNYDTPAAIHDGELLFDKFDLPRDRPILNSLQSTFKYV
FT                   PRNDWSFAEIAKRNPEAFIVLVGHMGHGGLCERLVERMRPHFEERGLELENHLRVLPRL
FT                   DYGDFMGLFSISHHTIDTIDWNGGNSSMQSFSLDCPVVTLPTAFMRGRHTVAMLEVLEL
FT                   PELIAQDGNDYVAISSRLLSDEAFYQEMRAKIAERKERLFHDKSVAEAFQLAVETICRQ
FT                   VPAVGQQPAEILPLAA"
FT   CDS_pept        573639..574505
FT                   /transl_table=11
FT                   /gene="SynRCC307_0632"
FT                   /locus_tag="SynRCC307_0632"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27535"
FT                   /db_xref="GOA:A5GRM6"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM6"
FT                   /protein_id="CAK27535.1"
FT                   /translation="MMQLQAHDLLPGCRVDDPACDWAQIQLQMREGVQLSPLLPLGGDA
FT                   GLVWVPKNGCSTLKRVWLQLQGADCQRPGFDPHSAALPFTHWLNPDELRAVSHYRFLVA
FT                   IWRDPIDRFVSACRSHLVELTTAAIYAKLRSSSPDQSGFENALRFHDELFAGHGVHSFA
FT                   DDADPVDVMNQTALQLPAWIACHIDWSHHTIPQVSFLGGDPRCYRTILGMEQIDALMAH
FT                   WSKASGLPLDLTPQHVSREQASNNPWRRLRRDQLSSEALAALERFYAADWAFLELAQQQ
FT                   LGAWQAA"
FT   CDS_pept        574526..575404
FT                   /transl_table=11
FT                   /gene="SynRCC307_0633"
FT                   /locus_tag="SynRCC307_0633"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27536"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM7"
FT                   /protein_id="CAK27536.1"
FT                   /translation="MRGRSEPERQQWARWVLGSHSDLFLPEMAAAVDQLNRHDPIEQGQ
FT                   PVVNPGATPNDLVVIATQRGRHCVVFDQPLACPVVLFDWTGDGLEPGSNPHGFDVISVA
FT                   TECKGHLMEESWKRLPPPAGGHYMGFIDDDVLISASAINRLLAVARIHNLSAAQPAVSF
FT                   GSSLCQEYGWLRQRACTTLHRVPIVEIMAPFIRRDLLELAMPFLKGVRSGYGLDRFALP
FT                   LCAVHLNAWRFGAVDLTPLTHVRVFGSLEKRFSNGLLSKEEEHLIRQRLMQSMGFAVDQ
FT                   ALHQQLEAAVA"
FT   CDS_pept        complement(575442..575615)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0634"
FT                   /locus_tag="SynRCC307_0634"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27537"
FT                   /db_xref="GOA:A5GRM8"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM8"
FT                   /protein_id="CAK27537.1"
FT                   /translation="MQQPPSRRDEITQQLAFAALGAGVITTVAVAQGQNPLTALGITVF
FT                   SAVAAVMVGQVL"
FT   CDS_pept        complement(575721..577187)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0635"
FT                   /locus_tag="SynRCC307_0635"
FT                   /product="ATPase of the AAA+ family"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27538"
FT                   /db_xref="GOA:A5GRM9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM9"
FT                   /protein_id="CAK27538.1"
FT                   /translation="MSRWGEQLDLLIRSRTPILWIHQQEEERLIRLLGNACQRLGQRTM
FT                   LRWDFVGGLQGLPNHQGHGARQPLMALDSLDLLAGEQPAILLLLDFHRYVEDPAICRRL
FT                   RNLASELRQKPHTLVISAPDAKLPRELESSITVLPLPLPSESEIQELLAGIAQAAGSQL
FT                   SGDALELLVSSCRGLSEQRIRQLAARALARHGCLDAADLDDVLEEKRLALGRSDLLEYC
FT                   PTAADPSEIGGLNQLKTWLDRRRLAFSAEAHAYGLPHPRGVLLVGPQGTGKSLTAKAIA
FT                   HSWGMPLLRLDLGRLFAGLVGASEARTRDMIGTAEAMAPCILWIDEIDKGFSLDGRSDG
FT                   GTGQRVLATLLTWMAEKDTPVFVMATANAIDQLPPELLRKGRFDEIFVLDLPDGSERRE
FT                   ILELHLRKRRPQHQLPLDTLVDRTSGFSGAELEQVVLEGMLNAFSESREFGEADLISAA
FT                   ADLVPLSRTAREQLEVLQQWASEGRARPAR"
FT   CDS_pept        complement(577184..577687)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0636"
FT                   /locus_tag="SynRCC307_0636"
FT                   /product="Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27539"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN0"
FT                   /protein_id="CAK27539.1"
FT                   /translation="MRPVALQELKQLGDGKHWNVEQQLSELDSIGPVKGWLKALHRGDD
FT                   LWLEAEATATVELICDRCLKSYPQPLEARVSESIALQSGGPDAELEELDGAEAALETLD
FT                   PHGRFDPEHWLFEQLNLQLPLKRLCSPDCPGLLPEQESSPATSTDVVDPRWAQLQQLKG
FT                   EEQP"
FT   CDS_pept        complement(577687..578823)
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="SynRCC307_0637"
FT                   /product="Preprotein translocase subunit YidC"
FT                   /note="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27540"
FT                   /db_xref="GOA:A5GRN1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN1"
FT                   /protein_id="CAK27540.1"
FT                   /translation="MIGYISDNVLLPILDFFYGLVPSYGLAIIALTVVIRLALFPLSAG
FT                   SIRNARRMRIAQPVMQQRQAEIRSKFANNPSKQQEEMGKLMKEFGSPLAGCLPLLVQMP
FT                   ILFALFATLRGSPFADVPYNINVKVLPADQIAAVETKPFNSASHSIFFTENDHVPVIAS
FT                   LPGGNKLGVGESAQVQLASKTGETIDAIEERIHPSFDLTPQWKLTKGDDVVSVSSDGTI
FT                   QALSPGDATVELKIPGLAARSGFLFIKALGQVGFMADGVINWDIATLVAGFGLSLFLSQ
FT                   ILSGWGMPANPQQATANRITPVMITGMFLFFPLPAGVLLYMVVANIFQALQTFLLIREP
FT                   LPDNLQTILEQQLANQTVAASATAVSAERLPFEPKGKR"
FT   CDS_pept        complement(578863..579291)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0638"
FT                   /locus_tag="SynRCC307_0638"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27541"
FT                   /db_xref="GOA:A5GRN2"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN2"
FT                   /protein_id="CAK27541.1"
FT                   /translation="MSVVTPPAIKEEIHYEGGPARGDLIINLIFGVTLIGLPFAIGAVV
FT                   RALWLRFKVTSRRVSVTGGWLGRDRSQVTYTQIKEVRSVARGFGAYGDMVLVLKDGARL
FT                   EMRAVPRFREMQTYIEERIASKGKPADAPSGFTASSAS"
FT   CDS_pept        complement(579288..579671)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0639"
FT                   /locus_tag="SynRCC307_0639"
FT                   /product="Ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27542"
FT                   /db_xref="GOA:A5GRN3"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRN3"
FT                   /protein_id="CAK27542.1"
FT                   /translation="MVLPQRHRLRGRGVFDYIYQRGQRFQQGLLQLRVADAATNLLREP
FT                   PETLEGELRFGVVISSKVSKRAVKRNRLRRLLHEAFLRQTFRSDLPPTWLLLNLRPGAV
FT                   ELSDDNLLEEWSTLIQRAGLTDS"
FT   CDS_pept        complement(579692..579829)
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SynRCC307_0640"
FT                   /product="50S ribosomal protein L34"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27543"
FT                   /db_xref="GOA:A5GRN4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRN4"
FT                   /protein_id="CAK27543.1"
FT                   /translation="MTKRTLGGTSRKRKRVSGFRVRMRSHTGRRVIRTRRKRGRARLAV
FT                   "
FT   CDS_pept        complement(579875..580456)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0641"
FT                   /locus_tag="SynRCC307_0641"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27544"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN5"
FT                   /protein_id="CAK27544.1"
FT                   /translation="MRFSHGVITACASAAIVAGGLQLPQALAQSSSGAFSILQQRWGNR
FT                   EGFKNLFYWVSETKPNRRSNYFLILGKNDRDKAIMKLDVMVPSYFDSKLKTKNIQLSYC
FT                   QGGEGAMKRTICEETIPAAISLVNDGKTIQIVPETPIPPDRTIGVVFRVANPSNGGMYQ
FT                   FNALAQAPGKVDIAGYLGSWVIEIQPGGAR"
FT   CDS_pept        complement(580544..581185)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0642"
FT                   /locus_tag="SynRCC307_0642"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27545"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN6"
FT                   /protein_id="CAK27545.1"
FT                   /translation="MTTGEGAEPHENQPTDVGHLMALRLRTVLGLGGAAALAGGIALSG
FT                   LSEVKAQSSVGTPGFSFRWNNTKDFKKLYYVISNQERDTWSDYTLILKGKDRKAAIIKL
FT                   DVTVPSYFDTTINPKEVALKYCSVGSALSRTRCKETIPATVELANDGKTLEIFPDSPVP
FT                   PNKAIGVVFPVYNPGSGMYQFNALAQAPGDVPMAGYLGSWVIEITDGIDG"
FT   CDS_pept        complement(581204..581602)
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="SynRCC307_0643"
FT                   /product="Chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27546"
FT                   /db_xref="GOA:A5GRN7"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN7"
FT                   /protein_id="CAK27546.1"
FT                   /translation="MAIPAMSNTSLKMRALRGATTASANTAAAMTEAVDELLDALISNN
FT                   GLQGDQVLSATFSVTADLDAMFPASLARRRPGWDGVALLDCQQMRVQGDLPRCIRVLVQ
FT                   AQMPAEQTLHHPYLRDTQRLRPDRSSHN"
FT   CDS_pept        complement(581584..582369)
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="SynRCC307_0644"
FT                   /product="Periplasmic serine proteases (ClpP class)"
FT                   /EC_number="3.4.21.-"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27547"
FT                   /db_xref="GOA:A5GRN8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN8"
FT                   /protein_id="CAK27547.1"
FT                   /translation="MVWPLRRQRRKRIARISLTGPIAGAARKRVVKALRQVEERKFPVL
FT                   LLRIDSPGGTVGDSQEIHQALLRLRESGCQVVASYGNISASGGVYVGCAADRIVANAGT
FT                   ITGSIGVILRGNNLEKLLERVGIRFETVKSGLYKDILSPDKPLSEGERSILQALIDSSY
FT                   SQFVAAVAQGRKLSEETVRTFADGRVFSGAQALELGMVDLLGDEDTARREAARLAGLDE
FT                   EKSQPVELGKERAGLVQKLRQELQLQLAWGGQPLWLFRP"
FT   CDS_pept        582181..583371
FT                   /transl_table=11
FT                   /gene="SynRCC307_0645"
FT                   /locus_tag="SynRCC307_0645"
FT                   /product="Permease of the drug/metabolite transporter, DMT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27548"
FT                   /db_xref="GOA:A5GRN9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN9"
FT                   /protein_id="CAK27548.1"
FT                   /translation="MDFLAIAHRAAGAVDAQQQHRELAFLHLAERFDHPLAGGSSDRAS
FT                   EADAGDAFTALAAQGPNHGAWCWSADPMQGEVPRLNADLLAPLTLRLTWLAMLLPFALW
FT                   GTAMAAMKPLLQEISPLTLAWLRILPAAVVLLLAAPLLQRPWQVDRRDWLWLLLFALVD
FT                   GALFHGLLAEGLERTGAGLGSVLIDSQPLLVALLARSLLGEAINPIGWFGLLLGLSGIL
FT                   CLGLPAGALQHWWLDGPALDGSLLPGAGELLMLAAAAAMAGGTLLSRWACRHSDPVAIT
FT                   GWHLLLGGVPLLLLSLQGPLAVAGQHWPHLSAAQWGWMAYASLFGTALAYGLFFWFASR
FT                   GDLTGFTSLTFLTPVFALASGLVLLGEQLEPLQWLGVVLALASVILINRRAELWQA"
FT   CDS_pept        583359..584429
FT                   /transl_table=11
FT                   /gene="SynRCC307_0646"
FT                   /locus_tag="SynRCC307_0646"
FT                   /product="Glycosyltransferase"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27549"
FT                   /db_xref="GOA:A5GRP0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP0"
FT                   /protein_id="CAK27549.1"
FT                   /translation="MAGLKLLVVSTPMGPLGQGLGGGVELTLEAVLESLHRRGHALSLV
FT                   AAEGSQLPSTPLQNCWLEPGVPQPSWQHQQRSAPVQIPADGLLPRFWQRAMAEQQPFDV
FT                   VLNLGYDWLPLWLTPQFQTPLCHLVSMGSVGEAMDGVIAAIAKDFPSQLAFHTASQAAD
FT                   FQLSSPPTLLANGFDFSRYSFNPDPQPCLGWVGRIAPEKGLEDAAQVAAAKQWPLRVWG
FT                   LKEDAAYAAAVEASVPAGTIEWRGFLPTEQLQRELGQCAVMLNTPKWNEAFGNVVVEAM
FT                   ACGVPVVAYRRGGPGELIEDGLTGYGVPPDQPEALVQQLPAALALDRLACRAQAERRFG
FT                   LDAFGARLEAWLQQPG"
FT   CDS_pept        584442..586406
FT                   /transl_table=11
FT                   /gene="SynRCC307_0647"
FT                   /locus_tag="SynRCC307_0647"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27550"
FT                   /db_xref="GOA:A5GRP1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP1"
FT                   /protein_id="CAK27550.1"
FT                   /translation="MCWTMDPRSGVILICGLGGLGQACLRTLIGFEAEIHCIDQRQPRW
FT                   VDALLADQYGANLLIGDMRSPQVLRMGRAADARAVLLLSHDSAINLEAALQVRLLNPKA
FT                   QLVVRTNSRRNLERQLQQRLPGLATVDPSLLTAGVFANALRTDGTEAAFALGDELFRVR
FT                   SRTVQHDSARDLFDLLGRRERLVQWVPAEGSPGGAPASQWWDLDDRPRSGDRLLCLELA
FT                   STLETRPPRRHRLRAAMAPWLHRLDNLREMVQRSVRRRDPLLLWGCGLLLLALIAGSSA
FT                   FGSGSAMGGLLLTLALLKGEFLDSVGFLVEDNPMATDNLALAYLSLLYAVVGTFLTAWL
FT                   VAVILDRLLAQRLGRRQPRPLPAGSQYVLLLEGGRLAERLASLLQLQKFKVVRVEPDGT
FT                   GMAYTQLDQAQRALRRSSCQAVGVLGADLVDNLDTALELQERWPGVRLAVQAQSLADGA
FT                   KLSGLFSDMQVINPLQVAADAVVATAFGERVRGVLRLAEDNLLLTDYRIEPGDTLVGLS
FT                   LAAVSGGYGLIPLQVTPLGQRKPIVLPNLERVLQPGDALVVMADLQALLAVENGTLAPP
FT                   RWQLEVRGCRRNCNGFEAQVLLARYLAQAPGEVGRYLETAAGPQRTKPIYQAPGRLLQQ
FT                   GLTRLGVECSLVAAAQTPA"
FT   CDS_pept        586434..588179
FT                   /transl_table=11
FT                   /gene="SynRCC307_0648"
FT                   /locus_tag="SynRCC307_0648"
FT                   /product="Glycosyltransferase related to
FT                   4-amino-4-deoxy-L-arabinose transferase"
FT                   /note="Lacks the UDP-Glycosyltransferase found in ORF1916"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27551"
FT                   /db_xref="GOA:A5GRP2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP2"
FT                   /protein_id="CAK27551.1"
FT                   /translation="MALIRRQRLWLVLAVLAMGALLFVWRLGAVGQWDETPAIFAASGR
FT                   AMAETGDWLTPRVNGHPRFDKPVLIYWLIGGFTALLPAGWDPLGSWASTLPSALAMIAL
FT                   MLGLALTVLPRSGPWVALEAALAFGLSPLVLVWGRVSVSDPLLVACVGLGMLGLWHTYA
FT                   QPRAPFPWWPWLVLGLGVLTKGPVALVIAVPSLLLFGFWQRDLGGLCRAVRLVPGVALA
FT                   VLVALPWYVLELLVEGQPFWDSFFGYHNLQRYTAVVNNHAGPWWFYAPVMVIASLPFTP
FT                   LLLLGVGSQLQGCWWRRPLKPDQSLPRFALAWLLFVVLFFSISATKLPSYMLPALPAAA
FT                   LLIALADAPGRWLTWARWASVLMAAVMAAAFWIAAPLAVQIDSPEIPGLGPALEASGVL
FT                   VISGGVFALAAMAGAVLLWRRGGRWPGSWLLALQLPLVAWQVLALVPTGELVDQRRQQP
FT                   VRQLAEQVRLQQRPGEQLAMVGVNKPSLHYYSRKVVLYAGRPPSGLLDLAEQLPPQAPG
FT                   TVLVVIDATTAELPHWKDMPHEQLGAAGIYRLWRVPLDALQQRGQALAASGVESTWRLP
FT                   NLERY"
FT   CDS_pept        588202..589653
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="SynRCC307_0649"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.22"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27552"
FT                   /db_xref="GOA:A5GRP3"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP3"
FT                   /protein_id="CAK27552.1"
FT                   /translation="MPKTSALLPVILCGGTGTRLWPLSRASYPKQYWALAHNAEDTLLQ
FT                   LTQRRLEGLPGLGSPILICNEDHRFIVAEQMRQLGVEPESILLEPMGRNTAPAVCVAAL
FT                   RATARGEDPLLLVLAADHVIREPEKFRATVEAGIPAAEAGRLVTFGIVPTAPETGYGYI
FT                   ESAEALNASSPVPIARFVEKPDRATAEQFLASGRFTWNSGMFLFRASAMLAELERLAPE
FT                   LVSCCRSALEHDTPDLQFLRLDREAFAQCPSVALDVAVMERTPLGSVLPLDAGWSDVGS
FT                   WSALWETADQDENGNVLRGRVISEGSRNCYLRSEHRLVVGLGVENLVVVETDDAVLIAE
FT                   RSQAQNVKAIVQQLEADGSSEGKAHRRIYRPWGHYTSIVEGSRWQVKRISVKPGASLSL
FT                   QMHHHRAEHWVVVRGTALVEKNGVEELIGENQSTYIPLGAQHRLSNPGKIPVEMIEIQS
FT                   GAYLGEDDIVRLEDVYGRSTAVSRA"
FT   CDS_pept        589646..591478
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="SynRCC307_0650"
FT                   /product="Di/tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27553"
FT                   /db_xref="GOA:A5GRP4"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP4"
FT                   /protein_id="CAK27553.1"
FT                   /translation="MPEAAGFLAAASTPHGLITLLVFAVSLVLFISGWLAPELTGLLAV
FT                   ALLVSFGVLDPQQAVKGFGSPALITLMGLFALSAGLFRSGGVDRLRAILGSESVRTPRR
FT                   MILLLVAVVSPLSGFIPNTPIVATLLPVLENWCHRRGISPSKVMLPMSFAVVIGGTITL
FT                   LGTSTNLLASDVSRQLGYGGIDLFDFTPIGLPIWLLGALYMVVVGDRFLPDRGQDDDLM
FT                   AAMAKQGYFTEVLIPRGSELVGQSLHNSRLQRRFDVDVLELHRGSQSFGAPLADLELQA
FT                   GDRMLLRCRKEDLLRLQQEHTIALAPISPVALSASEKAQQMPSVGRKRLVEVLLPAGSN
FT                   IAGSSVRELRFRQRYNATLLAVRRGQEVIKDLLGKVVLQAGDVLLIQAPTDTIRGLQNS
FT                   NDLVLLDELEKDLPTTSRKGIAIGICIAVILLPMLQVLDLMASVLFGVVLMVATGCLRP
FT                   GELQRAIRWDVILLLGSIVCFSVAMQSTGLARGLAVDLLQSLQGWPNYLVLMVVFLLAQ
FT                   LFTETLTNGATVVLLIPIATELAKGLALPPMAFIYAILFAASLSFLTPIGYQCNLMVMG
FT                   PGRYRFFDMTRYGAPLTIGLTLLTPWLICRHFGL"
FT   CDS_pept        complement(591475..591954)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0651"
FT                   /locus_tag="SynRCC307_0651"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27554"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP5"
FT                   /protein_id="CAK27554.1"
FT                   /translation="MSPIQRPTPRAPAQPLGQCLGQLERQWQSEGSLAALWQAWPEIAG
FT                   AQLAPHCRPLALRGNTLLVGASQPQWLQALRYSRHQLLAVLRSRGYAVNQLQFQQHDVS
FT                   KASEPFSAELARSWSEHPCRITGSSTDCPRCGAPSPSGEIERWGCCALCLHQQSS"
FT   CDS_pept        592000..592767
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="SynRCC307_0652"
FT                   /product="Phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27555"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP6"
FT                   /protein_id="CAK27555.1"
FT                   /translation="MGFFDRVGRLFRANLNDLVSRAEDPVKILEQSVADMQSDLIKLRQ
FT                   AVATAIASQKRIQNQAEQAENQAQTWYQRAELALKKGEEDLAKEALSRRKTYQETATAL
FT                   NGQLNAQGGQVEALKKNLLALESKIAEARTKKDMLKARAQAAQAQAQLQGAVGGLNTNG
FT                   SMAAFERMEEKVQALEAQGQAAAEIAGADLDSRFQALESGDDVDADFEALKASVNPTPL
FT                   ALPDEKAKPQLQPAQQAQVDEELESLKRSIDQL"
FT   CDS_pept        592803..593135
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="SynRCC307_0653"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27556"
FT                   /db_xref="GOA:A5GRP7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP7"
FT                   /protein_id="CAK27556.1"
FT                   /translation="MPPPVTVHSLSDANFQAEVMEYSGLVLVDVWATWCGPCRLMAPLM
FT                   DWAASTYGDGLKVGKLEADPNPTSRDALQVQGLPALVLFRNGQELARHEGAMAQPQLKA
FT                   FLDAHL"
FT   CDS_pept        593122..594312
FT                   /transl_table=11
FT                   /gene="SynRCC307_0654"
FT                   /locus_tag="SynRCC307_0654"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27557"
FT                   /db_xref="GOA:A5GRP8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP8"
FT                   /protein_id="CAK27557.1"
FT                   /translation="MPISERLGQLGSGVFGRVDGEKRSYRLSQQQPQRPLIDLSLGSSD
FT                   LKPPVRLLQVMAEAIAEPPSSRYCLQAATAPFRQAAAAWLEGRFGVAVDPEKEILLLVG
FT                   SQEGTAHLPLAVLNPGDPALVLDPSYPSHAGGVALASGELVRLPLLADQGWRPAFEQLS
FT                   DEQRRQLRLLVLGYPHNPTATTGSQEWLEQAMAIAKRSDAVLAHDNPYVDLALEGEAPA
FT                   LLRCDGWRERGIEFFSFSKGWGLAGFRLAFAVGAPALIEALARVKGVVDFNQSLALQAG
FT                   AIAALQEFPDWPRQLCDRYRQRRDHMAELLTAAGWTVPNSSMALYQWLPIPEPLHDLGS
FT                   EAAAQWLLRSSGVALTPGVGFGPSGEGWLRLALVADEPVLEQASARLRLALEQRTI"
FT   CDS_pept        594381..594626
FT                   /transl_table=11
FT                   /gene="SynRCC307_0655"
FT                   /locus_tag="SynRCC307_0655"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27558"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP9"
FT                   /protein_id="CAK27558.1"
FT                   /translation="MNLWSPWLDPAGDSLRGVAPERYALAAGPDGQYLRLAADDTIETV
FT                   QTLEHAFQFHTHEKAVDTARSVAAVLRRPVDVIKLL"
FT   CDS_pept        594626..595210
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="SynRCC307_0656"
FT                   /product="Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27559"
FT                   /db_xref="GOA:A5GRQ0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ0"
FT                   /protein_id="CAK27559.1"
FT                   /translation="MQPVPLLLPWRLHYVPLCASTERDLSRCLQQGTEPPLAVVARRQR
FT                   YGVGQHGRQWQSPAGGLWLSAAIPWQRPLSPAAAEQLPRRMAAALAAELAPWTAEASPP
FT                   LTIKSPNDLMVGQRKLAGVLSSVTWRGGQPRLLRFGIGLNGRHPIAPPGITLEQWLNGR
FT                   CPRFDQLLLIGLGAIERLAREAGNWDTEPCL"
FT   CDS_pept        595217..596014
FT                   /transl_table=11
FT                   /gene="SynRCC307_0657"
FT                   /locus_tag="SynRCC307_0657"
FT                   /product="Putative metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27560"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ1"
FT                   /protein_id="CAK27560.1"
FT                   /translation="MLVLLPLLAQLPTPSLQQLEQQQVITPAERRRLESGSLRAAPTPA
FT                   VQRLCQQEGGAVSRQECTAAVAPNPLQVPVSALLGGLDGSFSLQQVLRVTPRPAPLGGN
FT                   GNQALLFPLIGSAFTSSGFGWRQHPVLGGLMLHAGRDLAAPQGTPVVAALGGTVRSAGL
FT                   AGGYGVAIELDHQEPQRQRTLYGHLSELYVEPGDAVQQGEVIGRVGSTGLSTGPHLHFE
FT                   LRRPQAGGWVAVDPGRLLPDGMEVDPASAVAALLNQMLRGLER"
FT   CDS_pept        complement(596018..596695)
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="SynRCC307_0658"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27561"
FT                   /db_xref="GOA:A5GRQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ2"
FT                   /protein_id="CAK27561.1"
FT                   /translation="MGSNPVAELRHIHKVYGSGDTEVRAVNDLNLTVEAGDYIAVMGAS
FT                   GSGKSTAMNILGCLDRPSSGSYLLQGQQVDGLSDDALAILRNRCLGFVFQQFHLLGHLS
FT                   AQENVELPMVYANVPAEERQQRAVEALQRVGLGQRLRNKPNQLSGGQQQRVAIARAIIN
FT                   RPALLLADEPTGALDSETTADVLEIFDQLNGDGMTVVLVTHEHDVAERAKQRVLFRDGR
FT                   IAN"
FT   CDS_pept        complement(596697..598223)
FT                   /transl_table=11
FT                   /gene="ndhB"
FT                   /locus_tag="SynRCC307_0659"
FT                   /product="NAD(P)H-quinone oxidoreductase chain 2"
FT                   /EC_number="1.6.5.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27562"
FT                   /db_xref="GOA:A5GRQ3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ3"
FT                   /protein_id="CAK27562.1"
FT                   /translation="MESLAQSLNAGAIAPEAAILIALLACLLADLAGERTAARLVPPFC
FT                   YVGLGTSLVLLALQWSEPTADAFFSSFITDNLGVAFRAVVATSTLLSLLISWRYVERAG
FT                   TPVGEYAAILMAATVGAMLLCGATDLVSIFVALETLSVSSYLLSGYMKRDARSSEAALK
FT                   YLLVGSAAAAVFLYGTSLLYGVSGGSTNLDAITISLQGAGVTPLSALALVFVLATVAFK
FT                   ISAVPFHQWTPDVYEGSPTPVVAFLSVGSKAAGFALALRLLVGCFESFQTQWQLLFTVL
FT                   AVLSMTLGNVVALAQTSMKRMLAYSSIGQAGFVMIGLVCGTEEGFAAMVLYMAAYLFMN
FT                   LGAFACVILFSLRTGSDRISDYAGLYQKDPLITLGLSLCLLSLGGIPPMLGFFSKIYLF
FT                   FAGWADGQYLLVVVGLVTSVVSIYYYISVIKMMVVKEPQEASDVIKDYPAPTWNLPGLQ
FT                   PLRAALVFCVAVTAIGGVLSNPLFTWANAAVEGTPLLQQVISNGGHLPTG"
FT   CDS_pept        598331..601024
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="SynRCC307_0660"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27563"
FT                   /db_xref="GOA:A5GRQ4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ4"
FT                   /protein_id="CAK27563.1"
FT                   /translation="MPNTLVIVESPTKARTIRGFLPRTFRVEASMGHVRDLPNNASEIP
FT                   ASHKAEKWAKTGVNTEKDFEPLYVVPKDKKKIVKELKDALKVADELLLATDEDREGESI
FT                   SWHLLQLLNPKVPVKRMVFHEITEEAIKRALGQTRELNMELVHAQETRRILDRLVGYTV
FT                   SPLLWKKVAWGLSAGRVQSVAVRLLVQRERARRAFRSGSYWDLKAQLKHEGISFEAKLS
FT                   HLAGERIATGGDFDESTGAIKAGTKVKLLSEADAQGLLKAIDGKTWSVAEVEEKPTTRR
FT                   PAPPFTTSTLQQEANRKLRLSAREAMRTAQGLYERGYITYMRTDSVHLSEQAITAARSC
FT                   VSDKYGADHLSPQPRQYTTKSRNAQEAHEAIRPAGSSFRTPAESGLKGLDLSLYELIWK
FT                   RTVASQMADARLTMVSAQIEVENARFRASGKRIDFAGFFRAYVEGSDDPDAALEGQEVL
FT                   LPTLRSGDHPSCQSCEPHGHQTQPPARFSEAALVKMLEKEGIGRPSTYASIIGTICDRG
FT                   YATLQNNSLTPSFTAFAVTALLEEHFPDLVDPSFTARMENTLDEISNGSAEWLPYLDHF
FT                   FRGDKGLEQQVAKREGDIDPVASRTIELDGLPCVVRIGRFGAYLEAKRPGEDGEEELIK
FT                   ATLPQDLTPADLDSDQAELLLKQKADGPESLGEDPATGEGIYLLFGQYGPYVQRGQASE
FT                   ETPKPKRASLPRGTKPEDVTLEMASGLLQLPRLLGEHPEGGKVQAGLGRFGSYVVHDKG
FT                   KGEKDYRSLKADDDVLEVGFERAMELLSMPKRGRGGRTALKSLGTPDGSDEAIQLFDGP
FT                   YGLYVKQGKVNASLPEGTTAETITLEQAIELLEAKAATKKSSRKSTAKKKPAAKKPAAK
FT                   KPAAPRTTKTGRLRASAVRVIKAADS"
FT   CDS_pept        601024..601440
FT                   /transl_table=11
FT                   /gene="SynRCC307_0661"
FT                   /locus_tag="SynRCC307_0661"
FT                   /product="Uncharacterized conserved secreted protein,
FT                   specific to cyanobacteria"
FT                   /note="Contains a Proline-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27564"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ5"
FT                   /protein_id="CAK27564.1"
FT                   /translation="MARPLLVGLLPLLLVGCSSTPLGQQLGASFDAPPPAEPTPAAKLE
FT                   PAIKPVPPQQPKAKEPQADPEPATEATPVPEPEPKAEPEQTAEPRDPQPYRVILRLPSA
FT                   DPSAPAEAVTKALRAAGLPFEVETIERLQPAKQP"
FT   CDS_pept        601437..602060
FT                   /transl_table=11
FT                   /gene="SynRCC307_0662"
FT                   /locus_tag="SynRCC307_0662"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27565"
FT                   /db_xref="GOA:A5GRQ6"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ6"
FT                   /protein_id="CAK27565.1"
FT                   /translation="MSPRQMTETAYMAASTGLLWVAIYYLPIGDALFRLAIPLPLVLLQ
FT                   LRHGGRTALEGVAVTVLLLTVLMGPVRGPLMLFPYGLLSLWLGWCWRRQCSWWFSMAVG
FT                   VLIGAAGFLVRVALVSLLLGENLWVVITAAASGLLNGLADRLQLPVAPTLDQVQVAALL
FT                   LVVAQNIVYLLALHAVAWWVLPRLRQAIPDPPRLLRPLLALDPS"
FT   CDS_pept        602047..603171
FT                   /transl_table=11
FT                   /gene="SynRCC307_0663"
FT                   /locus_tag="SynRCC307_0663"
FT                   /product="Putative Phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27566"
FT                   /db_xref="GOA:A5GRQ7"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ7"
FT                   /protein_id="CAK27566.1"
FT                   /translation="MTLPDLWRARAQAALQSNQSQLLLVLAGTQTAAVPGISAAGATPD
FT                   SRRFTAAADAELLWGGPDGPRPHALPPLPAGVSPALISWVAQQQLRLPLVVADAGAFVA
FT                   PAVPHVQLGLPPAACLSSGAAMAPAVVERLLQRGRQLGLGFRQRFPEGLLVLAECVPGG
FT                   TSTAEALLRGLGVDAAGLVSGSLRQPPHSLRGALVQQGLDAMTARGISSEEPLEVVAAV
FT                   GDPFQAMALGVLQGLLLPAEGPGPQALLAGGSQMLALAGLWMASLSEAERAACHQQLAV
FT                   VTTSWVMQEPGSNLELLAQRLAAVWGVQPPLFSSALRFDGCQQQALLDYECGYVKEGVG
FT                   AGGLAWLTQLAGLDPQALAAACDQACGQLLKVEP"
FT   CDS_pept        603168..604070
FT                   /transl_table=11
FT                   /gene="SynRCC307_0664"
FT                   /locus_tag="SynRCC307_0664"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27567"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ8"
FT                   /protein_id="CAK27567.1"
FT                   /translation="MRQRLTRRHWMLLAGSGLLAACSGTSQKLVVQQGLVPSAWLRRLP
FT                   RSWRAESLDWRQSLPAWPSGSRCLALTDGWAMANQPLAAQAWPQEALDGLLPLAQPLLP
FT                   FGLPVGFGPWLLVLRNRRDLLAGGGAERGWSLLLDPSLRQQVVLPASARVVEEIARRIG
FT                   DPAESLARLRQQALGFGDHDALTLLLHGDAQAAVLPSRAVIPQLSRDTRLQALLPESGA
FT                   PLWWALLQQTAQGEAPPVEWLLNPRRSPLLDQLLRAGFTPPLDRPRLQAALARQPHAEL
FT                   LLPPAEVLQRCTSLLPLAP"
FT   CDS_pept        complement(604059..605189)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0665"
FT                   /locus_tag="SynRCC307_0665"
FT                   /product="Aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27568"
FT                   /db_xref="GOA:A5GRQ9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ9"
FT                   /protein_id="CAK27568.1"
FT                   /translation="MTTGSIEPQRRPFGSGKPVSLFTLGTMRALQSPGQLQAVVEAAIA
FT                   AGINHLETAPAYGPSQRYVGQAIRRLGLRPEQLVITSKVLPGQSLVSAQDELRRSLEQL
FT                   GLNRLDNLAVHGINRPQHLDWALQGPGQELLSWALDEGLVDQVGFSSHGSHALIAAAIR
FT                   SGRFSFASLHLHLFDPGRLPLAEEALAKGLGVMAISPADKGGRLFDPPELLRQACSPLD
FT                   PLPLAYRFLLARGISTLTLGAAEPSELHWAGLTGGPLSELEQAALERLHQQRQQRLGPE
FT                   ACGQCQACLPCPQQVPIPELLRLRNLAVGHGMESFAKERYGLIGQAGHWFEEINAEACL
FT                   ECGDCLPRCPHHLAIPELLADTHQRLASPPRRRLWG"
FT   CDS_pept        complement(605170..605706)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0666"
FT                   /locus_tag="SynRCC307_0666"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27569"
FT                   /db_xref="GOA:A5GRR0"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR0"
FT                   /protein_id="CAK27569.1"
FT                   /translation="MVEMSVAGIALDAASRSPIVLLRDPSGRRQVPIWIDQAQAQNILA
FT                   GLHIKEPPRPLSHDLMATLLALGGLELNKVVIHAIEDSTFLAVLKLNDEDGEEHAIDCR
FT                   PSDAIALALRTGSSLWMLEEVVGDASIPVDAEADAEEVEDFHRFVEGLSPAELIRQQGL
FT                   AQPDPEPPLDDDGLD"
FT   CDS_pept        605765..606412
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="SynRCC307_0667"
FT                   /product="Riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27570"
FT                   /db_xref="GOA:A5GRR1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR1"
FT                   /protein_id="CAK27570.1"
FT                   /translation="MFTGLVQAVGRLQSLPDAVRVSWSPQHWMAEGLAVGDSVAVDGVC
FT                   LTARKLLEHGFEADVSPETLSRTTLGERARSGAAVNLEPALRLADRLGGHLVSGHIDGL
FT                   GRVEAISRQGHSWDLQLAWDDPRLGRYICEKGSVAVNGISLTVASCHPDGVSFSLAVIP
FT                   HTWEQTTLQELRCGDAVNLEADLLAKYVERLLPGSASADLTSQWMAENGWNV"
FT   CDS_pept        606437..607009
FT                   /transl_table=11
FT                   /gene="SynRCC307_0668"
FT                   /locus_tag="SynRCC307_0668"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27571"
FT                   /db_xref="GOA:A5GRR2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR2"
FT                   /protein_id="CAK27571.1"
FT                   /translation="MFKSFTIAEGILLIVLGVLALIAPIKASFIVTAVLGVVFLVGGII
FT                   GWINNLSRSRGMKGWLVFWRLVVSTLFLVAGWTILDQFSTGAIDAAAQVATLSLAVGIV
FT                   FLVEGIVAIIASLGHQEVEGWRWGLANGIITLILGLIILSMKAFGLLSVLGILVGISFI
FT                   FSGIDLIAFASSFHGPDDNDGPQASAA"
FT   CDS_pept        complement(606991..607404)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0669"
FT                   /locus_tag="SynRCC307_0669"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27572"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR3"
FT                   /protein_id="CAK27572.1"
FT                   /translation="MESTQPLVGDALLKRAGELSDRAPDQIARACGYTGNSGRVLKKAF
FT                   LRALVEAKGFVFPGKESSGSRGRQAEYRTKVHGNGNLLVGNVYTRKLGLVPGQECTIEL
FT                   HEETGTIWLRLPDDLVVDDAALEDEPSNQAADA"
FT   CDS_pept        complement(607443..608066)
FT                   /transl_table=11
FT                   /gene="ctaE, coxC"
FT                   /locus_tag="SynRCC307_0670"
FT                   /product="Cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27573"
FT                   /db_xref="GOA:A5GRR4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR4"
FT                   /protein_id="CAK27573.1"
FT                   /translation="MTTTTPIDTDLQQQDDNENHGHGHGHGEHPDLRMFGLATFLVADG
FT                   MTFAGFFAAYLTYRAVNPLPPGAIYELELVLPVINTAILIASSFTFHRASKELMRGAMG
FT                   ACRGWLLLTAVMGLSFLGGQMVEYFELPFGLTDNLYASTFYALTGFHGLHVTLGALMIL
FT                   IVWFQAREPGRFTPSDHFGLAAAELYWHFVDVIWVVLFGLLYLL"
FT   CDS_pept        complement(608063..609733)
FT                   /transl_table=11
FT                   /gene="ctaD, coxA"
FT                   /locus_tag="SynRCC307_0671"
FT                   /product="Cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27574"
FT                   /db_xref="GOA:A5GRR5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR5"
FT                   /protein_id="CAK27574.1"
FT                   /translation="MTIASPPSPSPQPLRLQPTGWLRYFSFSLDHKVIGLQYIVCGFLF
FT                   YFVGGALAGVIRTELATPISDFVSRDTYNQVLTLHGTVMIFLWIVPVVNGGFGNYLIPF
FT                   YVGARDMAFPRLNAVAFWMIPPSGLLLISSYFIGGAAQSGWTAYPPLSLTTPAMGQILW
FT                   IVSVLLLGGSSIFGGINFIATILKFRQPGLKLMMLPMYCWAMLGTSILVVLATPVLAGT
FT                   LILLSLDIVAHTGFFNPAAGGNAVVYQHLFWFYSHPAVYIMVLPAFGLVSEILPVHARK
FT                   PLFGYVTMVYSIMAIVILGLVVWAHHMFTSGTPPWMRLFFTIATAFIAVPTGIKFFNWI
FT                   ATLWQGRLALNSAMLFSCAFILQFVFGGITGVALAQVPFDVHVHDTYFVVAHFHYIVYG
FT                   GTVFVIFASIYHWFPKFSGRMLNEHLGRLHLALTFIGFNLCFAPQHWLGLNGMPRRVAE
FT                   YDPQFTLINQLSSVGALLMAISTLPFLINVVMSLLQGPAAGPNPWRALTPEWLTSSPPP
FT                   VENWIGAAPLVKEPYGYGSTEGRIDVNQARGQDLWRQQP"
FT   CDS_pept        complement(609730..610560)
FT                   /transl_table=11
FT                   /gene="ctaC, coxB"
FT                   /locus_tag="SynRCC307_0672"
FT                   /product="Cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27575"
FT                   /db_xref="GOA:A5GRR6"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR6"
FT                   /protein_id="CAK27575.1"
FT                   /translation="MRIPSAILTLIAGMALVLLGQWVANDVNWLPVSASTNAPVYDELF
FT                   RVLLAIGTMLLVGMTGVVVYSLIRFRRRDGDQQDGPPVEGNLSLELFWTAIPAVVVLFL
FT                   GIYSYDIYDRMGGMTDLNAHGMDHHVAELASVRQSQPGDEERIWGGIAPASGNETVLPV
FT                   EVTALQFAFVFHYPEQNITSGELHVPTGQAVELRLKANDVIHAFWVPEFRIKQDVIPGQ
FT                   PTVLTFTANRIGDYPIVCAELCGPYHGGMRSHVVVDEPESFATWVETNTPATLS"
FT   CDS_pept        610760..611662
FT                   /transl_table=11
FT                   /gene="SynRCC307_0673"
FT                   /locus_tag="SynRCC307_0673"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27576"
FT                   /db_xref="GOA:A5GRR7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR7"
FT                   /protein_id="CAK27576.1"
FT                   /translation="MGLGVLSIPNSRSPFTALSLSRQLVVALIALVAIGGATRVMEAGL
FT                   ACPDWPLCYGSLLPAKQMSLQVFLEWFHRLDAFFVGIGLIVLLAMALIDRDQLPRWLPW
FT                   VSGLALLLVALQGALGALTVTQLLRFDIVSAHLATALLLVALLSGTAQMLQPLAVAPRP
FT                   PLAQPLCAAAGVVLYGQCIAGALMATQWASGRCLRLAEGCAWLSAHRSLATPAAALALL
FT                   SVLLVLALPSPKPARRLLTLAGVLVAAQVLLGVLTLRLSLSEPLVTVGHQLVAALLIAT
FT                   FSAAAVALRPAPSPALRHG"
FT   CDS_pept        611655..612644
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="SynRCC307_0674"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27577"
FT                   /db_xref="GOA:A5GRR8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRR8"
FT                   /protein_id="CAK27577.1"
FT                   /translation="MAEVPIAVPVSIRDEVVPSRKRVKLPPWLEIAKPRLIPLLLATTL
FT                   GGMALSESWPLPLPRLACTLGGGALAAAAAGVLNCLWEEQLDGQMQRTSGRALPSGRLS
FT                   GSQAFLIAVALACGASLLLVAGVNCLAAGLSLLGLCSYVLLYTIVLKPRTTRNIVIGGV
FT                   AGAIPPLVGAAAATGHVGLGGWWLFGLVMLWTPAHFWALALLLTDDYRSVGIPMLPVVK
FT                   GPEVTGRAINRYAYATVAASLLGVLTLPSGGLFYGLMVLPFNGRLLQMAQRLGELPDDK
FT                   QRAKGLFRWSILYLFGICLLLLLARTTMAADFSNQLISLLTLPPASAF"
FT   CDS_pept        612657..613682
FT                   /transl_table=11
FT                   /gene="SynRCC307_0675"
FT                   /locus_tag="SynRCC307_0675"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27578"
FT                   /db_xref="GOA:A5GRR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR9"
FT                   /protein_id="CAK27578.1"
FT                   /translation="MTAAVIQLDQLSKRYGALQALDGVSLNVPAGCLYGLLGPNGAGKT
FT                   TCLRILCTLLAPDAGSVQIAGIDALADPRAAREQLGYVAQEVAIDKILSGRELLQLQAS
FT                   LYHLDAATSRRRIAELTELLGMGEWLDRRCGTYSGGMRRRLDLASGLLHSPAVLVLDEP
FT                   TVGLDIESRAALWQVLQQLRDDGTTILLSSHYLEEVDALADRLAILDGGRVIAEGSPES
FT                   LKRDLGGDRVTLRVREFATPQEAQQAQSVLQQLDGVRQVVINRAQGHAINLVVEGEGAA
FT                   LLDRLRQQLEEASVPVFSLAQSRPSLDDVYLQATGRTLMDAELASVSSRDPKAEKKQAM
FT                   R"
FT   CDS_pept        613710..614528
FT                   /transl_table=11
FT                   /gene="SynRCC307_0676"
FT                   /locus_tag="SynRCC307_0676"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27579"
FT                   /db_xref="GOA:A5GRS0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS0"
FT                   /protein_id="CAK27579.1"
FT                   /translation="MTVAPAAQLSQETLALTKRLFVQLQRRPSTLVAGVLQPLIWLVLF
FT                   GALFANAPDGLIPGGVSYGRFLGAGVIVFTAFSAALNAGLPVMFDREFGFLNRLLVAPL
FT                   RSRYSIVLASVLYITSLSLVQSLAIMAAAWGLGYGWPGGAGLLVVLLTLLLLVAAVTAL
FT                   SLGLAFALPGHIELIAVIFVANLPLLFASTALAPISFMPSWLGWLAALNPLTFAIEPIR
FT                   AAYLGQFSLNAVVLEAPYGSLTAAQCLSALLILSAALFVSIRPLLDRKLS"
FT   CDS_pept        614533..614943
FT                   /transl_table=11
FT                   /gene="SynRCC307_0677"
FT                   /locus_tag="SynRCC307_0677"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27580"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS1"
FT                   /protein_id="CAK27580.1"
FT                   /translation="MPAVFVSPRLRERQLREALQEALQQQDAQALRQLSDRLVHRHGPV
FT                   QLQRWIQALASDPQQLFWRQALAQPSKPVPQPSIALEEPPVVEEHPIAEESAPPVEETL
FT                   EQPPVPAPAPIKTALQGWLPQWDGPQIDRLAS"
FT   CDS_pept        614907..615644
FT                   /transl_table=11
FT                   /gene="nanE"
FT                   /locus_tag="SynRCC307_0678"
FT                   /product="Putative N-acetylmannosamine-6-phosphate
FT                   2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27581"
FT                   /db_xref="GOA:A5GRS2"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS2"
FT                   /protein_id="CAK27581.1"
FT                   /translation="MGWPPNRPPRLVNQGAALALPKGLIVSVQAPAGSPMRDPDVIAAM
FT                   AEASLRNGAVGVRLESPEHIGAVRQRCPKALIIGLWKRTFPGSSVYITPGWQEVSAVWS
FT                   AGADVVAIDATERPRPDGEPLASLVERVQRELGAPLMADVDSLANGLEAARLGCQWVGT
FT                   TLFGYTEATAAAQPPAWDLLGPLRQQLPAGVGLICEGGIASAEAAAQALRLGADAVVVG
FT                   TAITGVDLQVQRYTRELQKPVTN"
FT   CDS_pept        615693..615893
FT                   /transl_table=11
FT                   /gene="SynRCC307_0679"
FT                   /locus_tag="SynRCC307_0679"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0679"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27582"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS3"
FT                   /protein_id="CAK27582.1"
FT                   /translation="MGALGVLMAYALLPVLLASLAGLPMSGLDMGKLQQLNQELGRLCS
FT                   STPPQEAQRVCQIHARLVNGA"
FT   CDS_pept        615951..616127
FT                   /transl_table=11
FT                   /gene="SynRCC307_0680"
FT                   /locus_tag="SynRCC307_0680"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27583"
FT                   /db_xref="GOA:A5GRS4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS4"
FT                   /protein_id="CAK27583.1"
FT                   /translation="MTFLLLAALGVLMALIYLPLRIYLTLTARGRRLRLLQRIRLLRQQ
FT                   LGEELTSRSQVSS"
FT   CDS_pept        complement(616124..616876)
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SynRCC307_0681"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27584"
FT                   /db_xref="GOA:A5GRS5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS5"
FT                   /protein_id="CAK27584.1"
FT                   /translation="MSSLAPLAGQIALVTGASRGIGRAIALQLAEAGAEVVVNYASSAD
FT                   AAEQVVSAITAAGGSAYALKADVSQEDQVEQLMAAVLEKSGRIDVLINNAGITRDGLLM
FT                   RMKTPDWQAVLDLNLSGVFLCTRAVTRTMLKQKQGRIINITSVVGLMGNAGQANYAAAK
FT                   AGVIGFTKSTARELASRGITVNAVAPGFIATDMTKDLAAEALLNAIPLGRYGEVDEVAG
FT                   AVRFLAADPAAAYITGQVLQVDGGMVMA"
FT   CDS_pept        complement(616914..617969)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0682"
FT                   /locus_tag="SynRCC307_0682"
FT                   /product="Putative potassium channel"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27585"
FT                   /db_xref="GOA:A5GRS6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS6"
FT                   /protein_id="CAK27585.1"
FT                   /translation="MRRRIRRWRKRLRPLTSTPLFPLLSVFTAGAIGYRWTENWDWGDC
FT                   FWGVLVTLTTVGYGDQVPNTDAGRWVTAAILVGGLVVVQQTLQWMLSLQETGYFQLRRR
FT                   QRQLREIQRMRQHVILCGYGRIGREIADQLIAEGVRLLVIENSPEDARAARERQLEVLE
FT                   GDATLDETLQEAGVFDCRALVAALPNNAANLYVVLSARGLSSGCRLIARADSKEAERKL
FT                   RLAGADAVVSPYISGGRQMAAIALRPLAINFLDLLAGSNCEVEEFQLRSDAARCGAIDG
FT                   RSLTELDLGRRTDGALVLAIQSRSGLIANPNGSTQLQAGQRLIVMGSPSQLQSMERLLG
FT                   EALEDASVLKA"
FT   CDS_pept        complement(617969..618745)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0683"
FT                   /locus_tag="SynRCC307_0683"
FT                   /product="Distantly related to Glycosyltransferase of
FT                   family GT9"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27586"
FT                   /db_xref="GOA:A5GRS7"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS7"
FT                   /protein_id="CAK27586.1"
FT                   /translation="MRVLFLSPGDLEAQLERLPLAAAIGRDLNASIQVACPLAAAPLWK
FT                   LLAVVEKQLPFEFEGVTLADWANLLGCVREPDFQACLNFASGSNLDLMLSLSHIPVRVA
FT                   RGGFSCTATVAADAPASAFLTPLGLQNDPDQVCISLPQKALEQARSKQPAGEGPLLLLA
FT                   PSQRAQDWADEHWKALEEAVCSRISGGRCQRLQSGSIVQQTAQLASADGVVSSSAVASG
FT                   LAKCCGVSVVELQQLAAGQALAELPLDSVLKALGIA"
FT   CDS_pept        618779..619480
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="SynRCC307_0684"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27587"
FT                   /db_xref="GOA:A5GRS8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS8"
FT                   /protein_id="CAK27587.1"
FT                   /translation="MDLNRGRLHLLIVAAGSGRRMGAEGNKLLLPLQGRPLLAWTLESA
FT                   LASDAIAWLGVVGQACDRQAIEALLQSLQPRQPWCWIQGGATRQQSVACGLAALPAEAE
FT                   HVLIHDGARCLAEPALFDRCAEALQRNGQALIAATPVVDTIKQVDGQGRIVATPPRSEL
FT                   WAAQTPQGFPVAQLHQAHQQAEQAGWEVTDDAALFERLGWPVQVLEASSANLKITTPLD
FT                   LELAAALLRAR"
FT   CDS_pept        complement(619467..620315)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0685"
FT                   /locus_tag="SynRCC307_0685"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0685"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27588"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS9"
FT                   /protein_id="CAK27588.1"
FT                   /translation="MTGLNTTIVAPSSALGESERLQQGIELLRSWGHTIRSAPDPERHW
FT                   GYYAGRDAERLADFDGKAELWACARGGWGAARLLEQGWQPPEGWLLGFSDVTSLLWAQQ
FT                   AAGLSGAIHGPLVTTLAGEPPWSQSRLRDLLAGKALLPLQGEGWQGGVAEGPLLVGNLT
FT                   VATHLLGTRHCPDLAGRVLLLEDIGEAPYRIDRLLTHWRLSGALQQLAGLGFGRFEGCE
FT                   AAEDETRPGFSLEQVLRERSLDLGIPVVGGLPFGHGQPNAALPLGRTVRLDGRSGSLSV
FT                   L"
FT   CDS_pept        complement(620312..621211)
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="SynRCC307_0686"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27589"
FT                   /db_xref="GOA:A5GRT0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT0"
FT                   /protein_id="CAK27589.1"
FT                   /translation="MARSPSLSYRWPAWLELLRWHKPTGRLILLLPAAWSLWLQSPRPD
FT                   GNLVMLIIIGGLAVSGAGCIANDLWDHRIDASVARTSDRPLARGALTFTFAWTLLVLCL
FT                   LTALLVVMELPAAGRELSLKLAVLALPPILLYPSAKRWFPFPQAVLALCWGFAVLITWA
FT                   AAAGSLEGGWPLWGCWLATLLWTFGFDTVYAMADRRDDARIGVRSSALSLGDHALQVVG
FT                   WCYLLAWLLLSSAAAFAGVGVVYWLAALGALWAGWRDLRELRHQEREGQPKIGQHFQRQ
FT                   VWLATLLWAGLVVGRGMG"
FT   CDS_pept        621237..622922
FT                   /transl_table=11
FT                   /gene="ppX"
FT                   /locus_tag="SynRCC307_0687"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="Nucleotide transport and metabolism / Inorganic ion
FT                   transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27590"
FT                   /db_xref="GOA:A5GRT1"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT1"
FT                   /protein_id="CAK27590.1"
FT                   /translation="MCHGHLDPLVSAARRPTAEAELEKLASVMPVGEGLRRVAAIDLGT
FT                   NSTHLLIASVDPQLRTFQVLLAEKSTTRLGERDPDTGDLSPEAMERARLALRHCRELAS
FT                   SHDVEEIVCVATSAMREAPNGLAFLEEVERDFGLKTEVISGPEEARLIYLGVLSGMDFA
FT                   EQPHYILDIGGGSTELILADAGDARALTSSRVGAVRLQRDFIRQEPLDRKRVQFLRAFI
FT                   QGSMEPAVEKVRRRLEPDETPVLVATSGTAMAAAALLAVDRPELNGRLHGAEFSRAELD
FT                   ALVQRVLSLTPEERRALPGINARRAEIIVPGLLVLQQAMEMLGASYFVISDRALREGLI
FT                   IDWMLRHDLIVDRFVYQGEIRRRTVMHHASKYGVSITRAERIAAFALDLWDQTRGSLHQ
FT                   APESSRQLLWAAAMVHRCGLRINTSAYHKHSWYLVQNGELLGYSHSEQRVIASLARYHR
FT                   KSLPKKRHESWNLLSQEEKTLVERLSLLLRLAVAMDRRPGGAVKKVVASCTSKQLKLQL
FT                   EPIDVGDDLSLELWSLQTCAPMIQSAAGLSLRSELLRSRQPLAV"
FT   CDS_pept        complement(622873..623700)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0688"
FT                   /locus_tag="SynRCC307_0688"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27591"
FT                   /db_xref="GOA:A5GRT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT2"
FT                   /protein_id="CAK27591.1"
FT                   /translation="MLQARTALGLSREQLAERLHMRPHQIEALECHQQERWPEAVFTIA
FT                   QVRRLAAALGLDAEPVVEAFRADLSQQTNEASPAAKAVFQLGRSEPTAQAKREEGQRDW
FT                   LHESKKDNKTKAKASPVRFQRPNWLVPSIGVVALLAIGGVAISRNLPALQGQLAAIPKL
FT                   WPKTPAKPSADAAVAATPKPQPKTLELSLSEPVWMSVRQLAGQKQLFEGLMQPGPHSFP
FT                   LGTGVQVLAGRPDLVMAHIGDQPAKALGSIETIQWVTFKPPVAAASATAPNAG"
FT   CDS_pept        623692..623862
FT                   /transl_table=11
FT                   /gene="SynRCC307_0689"
FT                   /locus_tag="SynRCC307_0689"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27592"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT3"
FT                   /protein_id="CAK27592.1"
FT                   /translation="MEQNCSWIGGGSSVQRLVLIAHSKATQQWANCGPGSPTLLEALST
FT                   TTTNSWLGMLL"
FT   CDS_pept        623841..624011
FT                   /transl_table=11
FT                   /gene="SynRCC307_0690"
FT                   /locus_tag="SynRCC307_0690"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27593"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT4"
FT                   /protein_id="CAK27593.1"
FT                   /translation="MAWNVALNGFFDGRYWIRTSDPFRVKEFFGHFGVSGQDCFFAKIH
FT                   LVEMVYEELTA"
FT   CDS_pept        624088..625419
FT                   /transl_table=11
FT                   /gene="SynRCC307_0691"
FT                   /locus_tag="SynRCC307_0691"
FT                   /product="Phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27594"
FT                   /db_xref="GOA:A5GRT5"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT5"
FT                   /protein_id="CAK27594.1"
FT                   /translation="MRPSVWEPSTLCLMVSAESWGKALRRDIKNEYGPGWSVSAQSGKT
FT                   KLTRRYADGTRSSVMIEIPFSSGHKRELLIAIGTHAEQMAEQQISLKESRKRTAVTAAN
FT                   PEGVFVWDEAAKAFYETRKDLGPVTQRNTVTRIEKALDSLNRKPRPKDGLELLAAFERQ
FT                   HLQHLQPGSEGRKKSIQEVGKFLRFCVERRGLAGRWMPPVGEQRQELVGAAEGRDAKLT
FT                   PPLKTDDFIALLSELERRRQHGLRLAVGLVGLYGLRPAELAVLSFEDGQLRVGQVKRNM
FT                   AAIRKGAKQQARENLRLALPLDLPGHEGLGAQLALQWQSGLVKLPLPIRTAIKTAEKTG
FT                   SYKPVGDAFRQLLDRHRFWKSLVAGNPGLTPYSLRHSFAWRAHKQYDRPLSVRDAAALM
FT                   GHDPETHYKHYGRWTDEAGLLDAVSRLTAQPAKPASQAFGAIGA"
FT   CDS_pept        625455..625997
FT                   /transl_table=11
FT                   /gene="SynRCC307_0692"
FT                   /locus_tag="SynRCC307_0692"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27595"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT6"
FT                   /protein_id="CAK27595.1"
FT                   /translation="MRLKVLLGAVVASAAGLAGIKADAGIPAKWEKWMMVDNAFVVDTE
FT                   DVKIQGDHIRLWVERAAAGVEKANPSLKYETWDGKVRISCKDFHYQAERYVNNAGYKLL
FT                   TLGLSPDWKKSDWLKIKPNVIAYPLADQLCFLTGSPGFTKEVTPPAWAQKIIDKFEGNN
FT                   LPESTDVEVDFLEPEDS"
FT   CDS_pept        626365..626922
FT                   /transl_table=11
FT                   /gene="SynRCC307_0693"
FT                   /locus_tag="SynRCC307_0693"
FT                   /product="DnaJ domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27596"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT7"
FT                   /protein_id="CAK27596.1"
FT                   /translation="MAARKKKLKKPEVLDLILALQASGNITVEMLLNFAEQINGGPFTE
FT                   PSATKPKAITMAKMRKAVLAKFGCKTVTELRKNRTFEMAFTGEKVSLKSTEDWRVQYRK
FT                   WVAVPNDERNQSGQTCINGVDVLENFRPWHIFGLDSATATESDVKGSFRDLAKKHHPDV
FT                   GGDARVFERLQKMRDSLLALMN"
FT   CDS_pept        626938..627969
FT                   /transl_table=11
FT                   /gene="SynRCC307_0694"
FT                   /locus_tag="SynRCC307_0694"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27597"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT8"
FT                   /protein_id="CAK27597.1"
FT                   /translation="MRDFLTDRETAKILGKRIDTLYKTVDFFDLYDDDEWDLVEGEHFE
FT                   FVQRSGEIRERRFTEEGVEALARYFESQMPGLLDGVLELLTHRRRKRKRMLVSRRITQE
FT                   LLDHGGMVAMKDGLAFVNKRTTIKILQTNGRGINNSIRRLAASGSLDGQEGIEIDKHFV
FT                   VDENGKKAWSQKGIASIAVDMRNNAKITKARKAWMDAVGDVVEVCFDREIKRLESSELR
FT                   ISKAIESAKRAANKTCQVTGSKRARGQYLELDGHHLFDRHTRPDLDDFHDNILVLETSL
FT                   HREFHSWRGGGPCMPKDFSDYLHNVRSDLLDGVNSRSAQRQASLFARLHRLQKNYEDFK
FT                   LRY"
FT   CDS_pept        complement(627966..628187)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0695"
FT                   /locus_tag="SynRCC307_0695"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27598"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT9"
FT                   /protein_id="CAK27598.1"
FT                   /translation="MATDWGMSERQAYRYLKEARAVIIEDIDKDRRDVVAEAIATCRMV
FT                   IREASKAGQYNNVIGAVNALSRLGKLDA"
FT   CDS_pept        complement(628311..630518)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0696"
FT                   /locus_tag="SynRCC307_0696"
FT                   /product="Uncharacterized protein with a Hexameric
FT                   Replicative Helicase RepA-like domain"
FT                   /note="RepA is a 5'-3' DNA helicase which can utilize ATP,
FT                   GTP and CTP, Strong similarity of the N-terminus with
FT                   PMT0921"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27599"
FT                   /db_xref="GOA:A5GRU0"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU0"
FT                   /protein_id="CAK27599.1"
FT                   /translation="MALHPDHLVYLKQRGLNPTRLSRYSSRGNTLCIHYCDPTGKPYKD
FT                   SANEDYIVKRLFPTRQPKFKAPAQSGSRPYFSELMPNGYLENVSIPLVFIEGPVKVDAC
FT                   YQHIPTGYCFIGLTGTWNTKDRRDENGNWDANNKTSTIPELKAIPMRGRQVIILFDSDI
FT                   EDNISVDEAAADIANWTRKRGARPHRCTLPSEPDGSKNGADDFLVRHGFDALQGHLEAS
FT                   EVEGWPLPAPLLQHNGDLKCSYTPSERKRLTRALAEINDIETIDCTCRVLATKLRIPFA
FT                   QLLAEIDDARSGTTSHGFLGTEEDLEGDDDIDNSWVIPFLLPKGETIVISGDPGVSKSL
FT                   LCYSIAHAVATGSEFLGFPVAKGVPLILQLEEGGTASRRLKAIGLKRSEFADGLPLNQD
FT                   WFFSKTFDLAKTRQVEQFKLLIRNNVDLVIIDSARAVARSLSIDENHADFGKRVIRKLA
FT                   KLVNDCGKSGIITHHNSKGSGKAAGTGDILAGVWGGFNLKPVEGDEELRTLQTDKKRET
FT                   SILWQLRIKRTELINGLPNGWTWSLESDLSHMAPDQKWRTRFQNLLKQQDRPIGLRDAA
FT                   ALMDLTADEEKVLRNTVGRDTACRRWLTQKPRQGVPGLYFMSYEFRDETKHFKQTNKNA
FT                   DGVQTRETHPCKEREEMLEAEKEGSQGLEDSPPTDLQHPTDSKIHLQQNTPDLYGVSLS
FT                   EAKSTSTKQADLFEVESQPFLTPIAPCDDPHWGPPPTPRAC"
FT   CDS_pept        complement(630518..630760)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0697"
FT                   /locus_tag="SynRCC307_0697"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27600"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU1"
FT                   /protein_id="CAK27600.1"
FT                   /translation="MTKWLRTPDAVEALGVSADFLKRHRDSHGGFFEEGKHYVLGASLN
FT                   ASIRWNVDECRDRIHHHGRLAREAHRQLNQLKEGN"
FT   CDS_pept        complement(630735..631052)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0698"
FT                   /locus_tag="SynRCC307_0698"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27601"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU2"
FT                   /protein_id="CAK27601.1"
FT                   /translation="MVGHRIEGEAVFVHVSAMAKKQNRFANRAGQTRRINGRHVHAKKD
FT                   ENLRIAFAVIEKALRDHPDADLEWFEKVCGDCEGLEDVLKLVRAGALNNFRTNDQMASH
FT                   T"
FT   CDS_pept        complement(631351..632388)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0699"
FT                   /locus_tag="SynRCC307_0699"
FT                   /product="Uncharacterized protein wiht hemolysin-type
FT                   calcium-binding regions"
FT                   /note="Possible secreted protein, possibly specific to
FT                   RCC307 (compositional bias, mask the G residues in protein
FT                   sequence before blast search)"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27602"
FT                   /db_xref="GOA:A5GRU3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU3"
FT                   /protein_id="CAK27602.1"
FT                   /translation="MAIFDYQWCLVSVEHNAKIGFAAAPYVEIVESSFISGSTYWQFTA
FT                   DTDGVREYWRIIGKNMTGQNLVINKIQVDSEEMGYYEVKGVNWTYQNIMNLTDSEFLTL
FT                   ATRGNDVIIGSRYNDSLAGEIGNDKIKGGNGNDRLSGGRGIDSLYGGSGQDVVNGGVGN
FT                   DSINGGSGRDTAVFSSRKNRINLKTTKWQNTGDGRDRLISIENVNAGSGNDVVTGNRSA
FT                   NTLNGQNGNDVLNGAAGNDYLLGGRGNDRLKGGSGNDKLVGGQGNDKLWGGSGRDTFVL
FT                   SEGSGYDRIMDFRNGQDRIQMGSGVDNLKIQNRNGHAFVYEGRDLMAVVNGAAGDLQER
FT                   GNFLV"
FT   CDS_pept        complement(632532..633746)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0700"
FT                   /locus_tag="SynRCC307_0700"
FT                   /product="Uncharacterized protein wiht hemolysin-type
FT                   calcium-binding regions"
FT                   /note="Possible secreted protein, possibly specific to
FT                   RCC307 (compositional bias, mask the G residues in protein
FT                   sequence before blast search)"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27603"
FT                   /db_xref="GOA:A5GRU4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU4"
FT                   /protein_id="CAK27603.1"
FT                   /translation="MGITTNQLINAGGVSQYFVDIVKGELQGETVHWQFQDDSDHYGAE
FT                   YKNYMVQTVARLDNIIDLDFEYTGNYSQSVIDVRLNDSGPFCGQAAAMDGYIELDIWTN
FT                   GSNSNDRKNTFIHELGHALGLGEPGWNRRWDQDDTAMSYNKGNVGGYATWYRSSDINAL
FT                   ISIWGRENDHKNQTQRGKANLANNLYGGKGNDKLFGGNKSDILSGGNGADSLFASLGND
FT                   TINGGSGRDTAQFSSRSNRINLNTTSWQNTGDGRDRLISIENVNAGSGNDVVTGNRGAN
FT                   TLKGQNGHDVLNGAAGRDYLIGGRGNDRLKGGSGNDKLLGGQGNDKLWGQGGRDTFVLS
FT                   EGAGYDRIMDFRNGQDRIQLGSGVDNLRINNHRNGHAYVYEGRDLMAVVNGAAGDLQEK
FT                   DNFLV"
FT   tRNA            634345..634416
FT                   /locus_tag="RNA_23"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUG"
FT   CDS_pept        complement(634453..635223)
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="SynRCC307_0701"
FT                   /product="Precorrin-4 methylase"
FT                   /EC_number="2.1.1.133"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27604"
FT                   /db_xref="GOA:A5GRU5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU5"
FT                   /protein_id="CAK27604.1"
FT                   /translation="MSKGTVQIVGAGPGAPDLMTVRAQRAVEQAELLIWADSLVAPEIA
FT                   ALAPESCERLRSGNLTLESVMEAMLDGIRRGKRVVRLHDGDPCLYGALQEQIARLADAD
FT                   VAVEVIPGISAYQATAAALNAELTIPGLVQTIVLSRASGRTGTPERESLERLAALQASL
FT                   CLYLSARHVEEVQQVLLKHYPADTLVAVGYRVSWPDQQLELVPLSELAAYSQAKGLERT
FT                   TLYVVSTALAASGQARSRLYSPDHDHLFRPKRSS"
FT   CDS_pept        complement(635220..636089)
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="SynRCC307_0702"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27605"
FT                   /db_xref="GOA:A5GRU6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU6"
FT                   /protein_id="CAK27605.1"
FT                   /translation="MLNAVLLTPAVFQSPGPMVFEFGPLAVRWYGLLIALAVLLGLWIS
FT                   TQLAKSRGLDGGLIADLLPILVLCAVLGARIYYVLFEWRQYQINWLEAVQIWRGGIAIH
FT                   GALLGGLLAVIGFTRWKRLSFWQLMDVLVPSVALGQAIGRWGNFFNSEAFGLPTDLPWK
FT                   LFIPAMSRPEQYLSEQYFHPTFLYESIWDLALFVLLVVLFTRRNSQGEPLLANGAITCL
FT                   YALIYSLGRFWIEGLRLDPLCLFGTLADGNCIRIAQVVSILLAAAGVAGLAWLYAVGRE
FT                   LPDPGRPQ"
FT   CDS_pept        complement(636094..637023)
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="SynRCC307_0703"
FT                   /product="Apocytochrome F"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0703"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27606"
FT                   /db_xref="GOA:A5GRU7"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRU7"
FT                   /protein_id="CAK27606.1"
FT                   /translation="MRRSLSLLLGSLLLTVGLLVGAQPSWAYPFWAQQNYDSPREATGK
FT                   IVCANCHLAKKLTQVEVPQSVMPDTVFKAVVKVPYDTDVQQVGADGNRTALNVGAVVML
FT                   PDGYTLAPQDRLSDELKEETEGIYYTQYSDDQPNILLVGPLPGDEHQELVFPILAPDPK
FT                   TDSSISYGKTQIHVGGNRGRGQVYPTGEKSNNTVYTASVAGDITAITGGDAGASVVTIA
FT                   GDDGNVEETIPAGPALVVAVGDSVDAGEALTDDPNVGGFGQMDAEVVLQNPVRLYGLLG
FT                   FLAAVAIAQIMLVLKKKQIEKVQAAEGV"
FT   CDS_pept        complement(637070..637606)
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="SynRCC307_0704"
FT                   /product="Cytochrome B6-F complex iron-sulfur subunit"
FT                   /EC_number="1.10.99.1"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27607"
FT                   /db_xref="GOA:A5GRU8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRU8"
FT                   /protein_id="CAK27607.1"
FT                   /translation="MTQISAKDVPGMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPK
FT                   ASGAGGGTTAKDELGNDVTASGWLADHKEGDRSLVQGLKGDPTYLIVDGPDSIGDYGIN
FT                   AICTHLGCVVPWNAGANKFMCPCHGSQYDATGKVVRGPAPLSLALAHVNVENDNVFVSQ
FT                   WSETDFRTDEKPWWA"
FT   CDS_pept        637697..638041
FT                   /transl_table=11
FT                   /gene="SynRCC307_0705"
FT                   /locus_tag="SynRCC307_0705"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27608"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU9"
FT                   /protein_id="CAK27608.1"
FT                   /translation="MLWAPLQPLAMPLTAAELLSILRERWGASYDLQLHRRAGRLYLQV
FT                   MWAYLEQQSFPLSEEDYLLRLQQLVEQLNGIGQAEAVRNWLQTTRDKPRLGKALSFPLP
FT                   DQGRLSEFLL"
FT   CDS_pept        complement(637992..638771)
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="SynRCC307_0706"
FT                   /product="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /note="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27609"
FT                   /db_xref="GOA:A5GRV0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV0"
FT                   /protein_id="CAK27609.1"
FT                   /translation="MSAIEPTPERDPDFPGEVEMSFADHLEELRWRLLRSLASVVIAAA
FT                   GCLVLVRPLVRLLEQPAEGMRFMQLAPGEFLFVSIKVAGYAGLTLALPYVLFEGLGFVL
FT                   PGLSRRERRLIAPAVAGSAVLFLLGLAFAWWALVPAALRFLMGYGADVVEPIWSIERYL
FT                   DFVLLLMLATGLSFQLPVLQLVLGSLGILNSKAMLSGWRLVVLLSALAGAVLTPSTDPV
FT                   TMLLLSGAITGLYLVGVGLVAFTEGIRSNAPGPATES"
FT   CDS_pept        complement(638768..640501)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0707"
FT                   /locus_tag="SynRCC307_0707"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27610"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV1"
FT                   /protein_id="CAK27610.1"
FT                   /translation="MQPQDTTTLRGVVHELNAELVPSRFEKAQQAESGGVQLAFRTLKQ
FT                   RLWLTLNWQADCPRFHAIEPPPRLGEGSTLAQQLQHGLKGLALVRLEQLPWERVVHLGF
FT                   APRPDAPEQRQLVLELMGRHSNLFLLDERQQVISSGRQVREHQSRLRPISTGDSYSAPP
FT                   PLQGAEPQVQESLERWRQRLLLLPESIGRALMGSYRGISPALRDQLLQTAGLDRHTPAA
FT                   DLSSAQWQQLFDSWQQWLSQLDSQALQFASSGSGYRCWGEPSPCQSNTPLALNLSLARY
FT                   YGQGLRQAQCQQQRQRLEQHLQQLVQREQRELQRQELLLARSGDEHLLQRQADLLLCRS
FT                   DVSSSGHHQLELQDPESNQTLVVRLNPQQTLVSQAQKLYQRARKLRRSVAAIEPRLRRH
FT                   QQRLELLEASQVQLQLADPGDADVLEALADDLEPFLKTKASQSKSSRRQQGTPSPLMLQ
FT                   SPSGMPLLVGRNHRQNDWISFRQARRGDLWFHAQEQPGSHVVLKGSEGEISDADLQTAA
FT                   DLAAHFSRSRGNKKVPVVMVPTEQLQRIPGMGPGLVRHGNGRVLWGEPDRALGLLPTLQ
FT                   P"
FT   CDS_pept        640554..641120
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SynRCC307_0708"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0708"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27611"
FT                   /db_xref="GOA:A5GRV2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV2"
FT                   /protein_id="CAK27611.1"
FT                   /translation="MSPAPHQPRLTVLSGPSGVGKGTLVGLLRQRHPELWLSVSATTRA
FT                   PRPGEENGIHYFFHSQDSFQQLVDQSGLLEWASFAGNCYGTPRQPVEERLAAGVPVLLE
FT                   IELEGARQVRQSSPDAFQIFLRPPSFEELERRIRGRGTDSDEAIQRRLERARLELQAES
FT                   EFDAVVENGELDVALQELERLMGLA"
FT   CDS_pept        complement(641192..641308)
FT                   /transl_table=11
FT                   /gene="psaJ"
FT                   /locus_tag="SynRCC307_0709"
FT                   /product="Photosystem I reaction centre subunit IX"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0709"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27612"
FT                   /db_xref="GOA:A5GRV3"
FT                   /db_xref="InterPro:IPR002615"
FT                   /db_xref="InterPro:IPR036062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRV3"
FT                   /protein_id="CAK27612.1"
FT                   /translation="MKKFLTTAPVFAAIWFTVTAGIMIEFNRFFPDLLFHPL"
FT   CDS_pept        complement(641322..641798)
FT                   /transl_table=11
FT                   /gene="psaF"
FT                   /locus_tag="SynRCC307_0710"
FT                   /product="Photosystem I reaction centre PsaF protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0710"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27613"
FT                   /db_xref="GOA:A5GRV4"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV4"
FT                   /protein_id="CAK27613.1"
FT                   /translation="MRRLFAVLLSGFLLFGFAPMAHADVAGLTPCSENARFQARAKTAS
FT                   TPQAQARFERYSQAVCGTDGLPHLIVDGRWNHAGDFMIPGVMFLYIAGCIGWAGREYLK
FT                   ATRGKGANMKEIQIDLSVAFKATLASATWPLAAFAELGSKKLTEIDSNVTVSPR"
FT   CDS_pept        641838..642908
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="SynRCC307_0711"
FT                   /product="o-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27614"
FT                   /db_xref="GOA:A5GRV5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV5"
FT                   /protein_id="CAK27614.1"
FT                   /translation="MRSPCHMPTVLALETSCDESAAAVVRDNVVLSSEVASQVAEHAQF
FT                   GGVVPELASRRHVEALPWLVERALLQAQLPLSAMDAVAATVAPGLSGALLVGSVTGRSL
FT                   ARLAGVPFVGIHHLEGHLCSALSGDLAPQLPLLVLLVSGGHTELIAMRAEGDYERLGGS
FT                   RDDAAGEAFDKVARLLGLGYPGGPAIEAAARGGDPDRFAFPPGRISLPGGGFHPYDFSF
FT                   SGLKTAVLREVERWRQQGEELPVADLAASFQAVVCRVLVERSVRCAEDHGLNGVVVVGG
FT                   VSANAALRERLQRVSQERGLALHLAPLAWCTDNAAMIGLAACRRFGAQQQSSLQLGVAP
FT                   RWPLGETDALYGPPPF"
FT   CDS_pept        642935..643108
FT                   /transl_table=11
FT                   /gene="hli"
FT                   /locus_tag="SynRCC307_0712"
FT                   /product="High light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0712"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27615"
FT                   /db_xref="GOA:A5GRV6"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV6"
FT                   /protein_id="CAK27615.1"
FT                   /translation="MTEQSTVDAPEQVDASELNSWRRGFTPQAEIWNGRLAMLGLSLGV
FT                   VTLVLWRLLATA"
FT   CDS_pept        complement(643091..644296)
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="SynRCC307_0713"
FT                   /product="Twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27616"
FT                   /db_xref="GOA:A5GRV7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV7"
FT                   /protein_id="CAK27616.1"
FT                   /translation="MRVGPTGFGNPANFKDPKPVCPCQAAGICTCGMSDLPPLPPPPQA
FT                   SSAAPETLAEIVELARRQNYSDIHLGVGEQPRFRERGEIISSGWPVTEAVQFDRWLSEV
FT                   LSSAERERFRSEHDFDGSFAFERVRVRINLMESLRGPAMVLRLIPQTILSLEELQLPEV
FT                   LKTLANRPKGLVLVTGPTGSGKSTTLAAMVDWINRNKPAHILTIEDPIEFVHTSRKALV
FT                   RQREVGHHTLRFKAALRAALREDPDVILIGEIRDGETLTTALEAAQTGHLVFGTLHTNS
FT                   AVRTVERVLGMVPPADQASLRRSLSESLLGVIAQGLIRTTTGGRRAYHDILINTEACRD
FT                   YIERGELDSVEQIMERSGFDGMQTSNQALLHLVQAGEIEGDAALAVSLKSSELAQALRG
FT                   RQ"
FT   CDS_pept        644281..645396
FT                   /transl_table=11
FT                   /gene="nfrC"
FT                   /locus_tag="SynRCC307_0714"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0714"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27617"
FT                   /db_xref="GOA:A5GRV8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV8"
FT                   /protein_id="CAK27617.1"
FT                   /translation="MAQPARVTLVLGTRPEAIKMAPVIRAFQQSERFEARVVLTGQHRE
FT                   MVAQVMALFALEAQRDLALMAPKQTLTHVTCAALEGLRHEFAEHRPDLVLVQGDTTTAF
FT                   AAALAAFYDQIPVGHVEAGLRTDNIYDPFPEEANRRLISQLAQLHFAPTEQAAANLQAS
FT                   GVVGAVHVTGNTVIDALLQMAAAAPSCPIPGLDWESQRVILATVHRRENWGEPLQSIAD
FT                   GFLRVLDSHPDTALLLPLHKNPTVREPLQQLLGSHPRVFLCEPLDYDSLVAAIRGSTLL
FT                   LTDSGGLQEEAPSLGKPVLVLRRTTERPEAVQAGTAKLIGTESDAIATEASVLLDQPEA
FT                   YEAMARAHNPFGDGKASERIEAISAEFLASR"
FT   CDS_pept        complement(645393..646592)
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="SynRCC307_0715"
FT                   /product="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0715"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27618"
FT                   /db_xref="GOA:A5GRV9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV9"
FT                   /protein_id="CAK27618.1"
FT                   /translation="MVADPAKAIAPLSAPDKPLAAVVMDPLKRSRLRHLNRRQWAAAGL
FT                   AVLIAVSGLVIWRRSSAPGRDISAYTTTVETGQLDGVITASGEIAAQRQVNLSPKQAGQ
FT                   LEELLVQEGDAVRKGQAIARMDPDDIDNKIAETQAGLDSARVNMSRARLEFERRESLHA
FT                   AGALTTDEFLSFKAKYETARAELNAAEQRLEQKLQDRRDLLIKAPFAGVITNRFADPGS
FT                   YVTPTTAASASAGASSASIVQLASGLQVKAKVPESDIGRIKVGQRAKIRVDAYPERSFT
FT                   ARVSAISPRAEKNNDVTTFEVKLELQDPPAGLLRIGMTTDVDFDSGKLAAEPLVPTVAI
FT                   VTEEGKPGVLIPGAGNEPKFQEVTLGNSSGRQTQVLKGLEPGEKVFIDLPPWASKREGD
FT                   "
FT   CDS_pept        646658..647749
FT                   /transl_table=11
FT                   /gene="engD"
FT                   /locus_tag="SynRCC307_0716"
FT                   /product="GTP-dependent nucleic acid-binding protein EngD
FT                   (probable translation factor)"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0716"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27619"
FT                   /db_xref="GOA:A5GRW0"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW0"
FT                   /protein_id="CAK27619.1"
FT                   /translation="MLKAGIVGLPNVGKSTLFNALVANAQAQAANFPFCTIEPNVGTVS
FT                   VPDERLQQLAELSSSQEIVPTRVEFVDIAGLVAGASQGEGLGNKFLANIREVDAIVHVV
FT                   RCFEDDDVIHVSGSVDPGRDAEVINLELALADASQIEKRRDRLKKQMRTSKEAQIEDAA
FT                   LERIAAVLDGGGAARSVEISEEEAALIKPLGLLTAKPIIYAANVSEDDLAGGNGFSEAV
FT                   QAMAAKESAETVRVSAQVEAELVELGDEERGDYLEGLGVSEGGLQSLIRATYNLLGLRT
FT                   YFTTGEKETRAWTIKAGMTAPQAAGVIHTDFERGFIRAQTIGCQELLAAGSFNEAKSKG
FT                   QLRSEGKDYVVAEGDVMEFLFNV"
FT   CDS_pept        complement(647753..647944)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0717"
FT                   /locus_tag="SynRCC307_0717"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27620"
FT                   /db_xref="GOA:A5GRW1"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW1"
FT                   /protein_id="CAK27620.1"
FT                   /translation="MGQRLGSVLPIVVIGIVADLAVQILLDVEVVLALWGVGSGVRHRI
FT                   DPSQVMLLGVPQLSGAAS"
FT   CDS_pept        complement(647961..649190)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0718"
FT                   /locus_tag="SynRCC307_0718"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0718"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27621"
FT                   /db_xref="GOA:A5GRW2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW2"
FT                   /protein_id="CAK27621.1"
FT                   /translation="MPATGTTVQLAKWWLQFPWNLRLVAMFRALAMLGAGGILFLGPLV
FT                   FNRLGLASTTIGLGLALASGVGLISRFLSGYILDRGVALAVPLRIGAVLSISADLLLLQ
FT                   ASDSSGFLIGQLLLGLGMGFYWPAAEFASASLSAPLPSSQGFALARTADALGIAAGTAL
FT                   GTSLAALFGADQLRWVYGIDISCMVLLLVLVGWLPRHSAMPNASEAPSTGPAAPRSWLR
FT                   PLLPLLMLSLLGTGLINLQQSALPLDLANGGLARAGLPEVGGGLLMGVQLVLILLLQWP
FT                   VGHRLGQQPVGVGLRLSLRSFAAACGLMALSALHPQGVVLLLAAQPLLALAITAFLPTI
FT                   TEAVIEAVEPAHQGLALGLYSQAWAVSGISLPPIAGWMLQSEQHGLGLWLLMGGFSLLA
FT                   LPLTPHRLSH"
FT   CDS_pept        649172..650710
FT                   /transl_table=11
FT                   /gene="SynRCC307_0719"
FT                   /locus_tag="SynRCC307_0719"
FT                   /product="Predicted dienelactone hydrolase fused to a
FT                   uncharacterized N-terminal domain specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0719"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27622"
FT                   /db_xref="GOA:A5GRW3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW3"
FT                   /protein_id="CAK27622.1"
FT                   /translation="MSLSQALRTLTHGLLALAISLGSVPRAPAAEQLLVRFSGLELPLD
FT                   LNELESWALRPKVNAELGPWLNLLDPATRQDLQRILRQPLNLESSTIALLLDSWAGRQL
FT                   VLQLGSLLRSADGDGGPLLLDLLQRRGRSTVVSLLKEAPTSHLELDLDALSALGFRLRG
FT                   QLEQQKNLLKQLNDLRLMPLPVFRSTRGPVRHQQRSLAVEHREAPLALDLWWPAGGAPA
FT                   KRWLLFSHGLGGSTAQMEWLASELAAQGWPVLAVQHPGSDDTAVRGLLEGRQTLPGLET
FT                   LPARLQDLQALQRAVRDGRLGFGPHGSPPRLVLLGHSLGALSSLLWAGADVEPGLAERC
FT                   SQNLQQIPVLDSSFLLQCQLTELSLPALEPPVGLDAVVVLNSFGSLLWGERGLASIAGP
FT                   VLSIGGSMDLITPPLNEQVRPFQQLQHSGSRLALVEGGSHFSAVGLRRDQALMRLGSDL
FT                   VGEDPRLVQQALVELHVRFLDSLDEGETPPSGVQSVAGVRTYVLDGPMAKSLLP"
FT   CDS_pept        complement(650707..651726)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0720"
FT                   /locus_tag="SynRCC307_0720"
FT                   /product="Putative ABC transporter, oligopeptides, permease
FT                   component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27623"
FT                   /db_xref="GOA:A5GRW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW4"
FT                   /protein_id="CAK27623.1"
FT                   /translation="MSNSSSLVRYLGSRLLLAPVMLWLIASLVFLLLRVAPGDPVDALL
FT                   GNRASAAARDQLRAQLGLDQSLWDQYREFLGALLQGDLGTSLRNSTPVGEIVRDALPAS
FT                   LELGITALLVALVVGLAVGFSGVARPEGKLDLSGRLYGIGTYALPVFWAAMVMQLIFAV
FT                   GLGWFPVGGRFPPTALPPQGTGFYLLDGILQANPQVIWGTLQHLALPAITLGLLLSGIF
FT                   ERALRLNLRRALRSDYVEAARSRGISERRVVLRHALPNALLPVLTITGITVASLIGGAL
FT                   LIELIFSWPGIAYRLQEAIAQRDYPLVQGIVVVIAALVVMVNLAVDVVVALLDPRLKF"
FT   CDS_pept        complement(651723..653324)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0721"
FT                   /locus_tag="SynRCC307_0721"
FT                   /product="ABC-type oligopeptide transport system
FT                   periplasmic component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27624"
FT                   /db_xref="GOA:A5GRW5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW5"
FT                   /protein_id="CAK27624.1"
FT                   /translation="MLLARANLKQRGKRAAGLLLASLMLLAGCRPPTASDRAPLVIAAY
FT                   GSIDSVDPAQATTVIALQLISALGDPLYAIDGQGAIQPKLARALPRLSDDGLTATIPLR
FT                   QGVLFHDGTPFDADAMAFSLRRFLAIGKLSYVVGDRISAVRVTGPYELQLDLRRPFSPL
FT                   AKLLSFASLTPISPTAYANYEAGFRPNAFVGTGPYELRLQSPQLQRLEPFAQYWGEAPR
FT                   NDGIALVGMSTSTSLYGAISSGNVDVLLSTSLEPEQQSALHQQANQGQLREGAGPALGI
FT                   GYITLLTDRPPLDNQTLRRALAFSLDRELLTKRVTDKLRPPLRGLVPPKLPGALAAWPR
FT                   ADASRARQLLQQEGYCSGEVLPLQLTYRSNVPTDRLLALSWQEWLRSRLGDCVRLDLTG
FT                   MESTTAYRQLGDGAFQMILLDWMGDYPDADNYLTPLLGCTQSEGNRCLEGDSASGGSFW
FT                   TAPGLEEKLRLSNERRGQARLDLLDAVQREAANGVPYLPMWQTRPRAWARNSITAPQFD
FT                   GSGRLNFASLSRRSLP"
FT   CDS_pept        complement(653329..653550)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0722"
FT                   /locus_tag="SynRCC307_0722"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0722"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27625"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW6"
FT                   /protein_id="CAK27625.1"
FT                   /translation="MRNHANNRVGFMRVHQGDCIRLLSDKDVYQVIAIDDHHDRCWVRR
FT                   WPLQRHGSPVFEVSLSSVESPGQPMPAA"
FT   CDS_pept        complement(653643..654953)
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="SynRCC307_0723"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0723"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27626"
FT                   /db_xref="GOA:A5GRW7"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW7"
FT                   /protein_id="CAK27626.1"
FT                   /translation="MPIGIGLLGLGTVGAGVAEILLSPQGRHPLVADLELRQVAVRDLN
FT                   RPRPIPLSNSLLTTDPAAVVANPDVDLVVEVMGGLEPARSLILAAIEAGKAVVTANKAV
FT                   IARHGAEIAAAAAEKGVYVLMEAAVGGGIPILEPLKQSLGANRIARVSGIINGTTNYIL
FT                   TRMSEEGASYGDVLADAQALGYAEADPAADVEGGDAADKIAILTGLAFGGLVDREAIPT
FT                   EGINTLQTRDIDYAKELGFVVKLLAIAERHGSDPDGSEVVDVRVHPTLVPKEHPLAGVN
FT                   GVNNAIVVEGEPVGRVMFYGPGAGAGPTASAVVADILNIAAIRQVGAGGPHDALDPLLA
FT                   ASSWRNCRLVDQGSTCHRNYVRFQAADRPGVIGHIGSCFGSAGVSLQSIVQFETEGSGA
FT                   EIVVVTHAVEESLFQQALSAILERPEVEDVRCCLRTL"
FT   CDS_pept        complement(654986..655408)
FT                   /transl_table=11
FT                   /gene="sufE"
FT                   /locus_tag="SynRCC307_0724"
FT                   /product="SufE-like protein, probably involved in Fe-S
FT                   center assembly"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0724"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27627"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW8"
FT                   /protein_id="CAK27627.1"
FT                   /translation="MASGSAALDTIVAKLKGSSDPKRRYEYVLWLAKKLPAPPAELSSD
FT                   ANRVRGCVSQVFVQPVVDGAVLHWQGDSDAQITKGLLALLIQGLDGLTPQQVMAVDPGF
FT                   IAETGLAASLTPSRANGFLNILRHMQAQAAALAGEG"
FT   CDS_pept        complement(655383..655823)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0725"
FT                   /locus_tag="SynRCC307_0725"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0725"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27628"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW9"
FT                   /protein_id="CAK27628.1"
FT                   /translation="MLRTFSFTALVAIALMNPARGLAHAVQTDVSSLLPSGSIKLRTSF
FT                   SSGEPLAHAPVRLESHDGDRSIELGATDADGRFTGELPALDSDAWDVVIDGGIGHRDYL
FT                   GLDERWPSSEALMGWLRNGGLLGATLALTGISLCHGQRQRRP"
FT   CDS_pept        complement(655878..656105)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0726"
FT                   /locus_tag="SynRCC307_0726"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0726"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27629"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRX0"
FT                   /protein_id="CAK27629.1"
FT                   /translation="MGRIVKQGFASRCQRVFFDRMIPSLLQSVSTTPSARTQPAKTLQR
FT                   GERPQQALELMIGSLVGMVQAGRTDQVSSR"
FT   CDS_pept        complement(656089..656640)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0727"
FT                   /locus_tag="SynRCC307_0727"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0727"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27630"
FT                   /db_xref="GOA:A5GRX1"
FT                   /db_xref="InterPro:IPR002698"
FT