(data stored in ACNUC7421 zone)

EMBL: CU234118

ID   CU234118; SV 1; circular; genomic DNA; STD; PRO; 7456587 BP.
XX
AC   CU234118;
XX
PR   Project:PRJNA19575;
XX
DT   01-MAY-2007 (Rel. 91, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Bradyrhizobium sp. ORS278,complete sequence.
XX
KW   complete genome; PRO.
XX
OS   Bradyrhizobium sp. ORS 278
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Bradyrhizobium.
XX
RN   [1]
RP   1-7456587
RG   1:Genoscope, UMR 8030, France 2:LSTM, France 3:Dep SWC ; and BioTechnology
RG   Institute, USA 4:CEA/Cadarache,DEVM,UMR 6191, France 5:NCSB , USA 6:DOE ,
RG   USA 7:DOE , USA 8:Universite Lyon1, France; UMR5557, France; IFR 41,
RG   France.
RA   Genoscope;
RT   ;
RL   Submitted (21-NOV-2006) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [3]
RP   1-7456587
RX   DOI; 10.1126/science.1139548.
RX   PUBMED; 17540897.
RA   Giraud E., Moulin L., Vallenet D., Barbe V., Cytryn E., Avarre J.C.,
RA   Jaubert M., Simon D., Cartieaux F., Prin Y., Bena G., Hannibal L.,
RA   Fardoux J., Kojadinovic M., Vuillet L., Lajus A., Cruveiller S., Rouy Z.,
RA   Mangenot S., Segurens B., Dossat C., Franck W.L., Chang W.S., Saunders E.,
RA   Bruce D., Richardson P., Normand P., Dreyfus B., Pignol D., Stacey G.,
RA   Emerich D., Vermeglio A., Medigue C., Sadowsky M.;
RT   "Legumes symbioses: absence of Nod genes in photosynthetic bradyrhizobia";
RL   Science, e1252229 316(5829):1307-1312(2007).
XX
DR   MD5; c68b5b3c67ad4439b06b91c7ff47aa3b.
DR   BioSample; SAMEA3138227.
DR   EnsemblGenomes-Gn; BRADO0296.
DR   EnsemblGenomes-Gn; BRADO0297.
DR   EnsemblGenomes-Gn; BRADO0315.
DR   EnsemblGenomes-Gn; BRADO0316.
DR   EnsemblGenomes-Gn; BRADO0459.
DR   EnsemblGenomes-Gn; BRADO0460.
DR   EnsemblGenomes-Gn; BRADO0461.
DR   EnsemblGenomes-Gn; BRADO0593.
DR   EnsemblGenomes-Gn; BRADO0594.
DR   EnsemblGenomes-Gn; BRADO0595.
DR   EnsemblGenomes-Gn; BRADO0744.
DR   EnsemblGenomes-Gn; BRADO0745.
DR   EnsemblGenomes-Gn; BRADO0789.
DR   EnsemblGenomes-Gn; BRADO3114.
DR   EnsemblGenomes-Gn; BRADO3115.
DR   EnsemblGenomes-Gn; BRADO3208.
DR   EnsemblGenomes-Gn; BRADO3219.
DR   EnsemblGenomes-Gn; BRADO3237.
DR   EnsemblGenomes-Gn; BRADO3260.
DR   EnsemblGenomes-Gn; BRADO3354.
DR   EnsemblGenomes-Gn; BRADO3411.
DR   EnsemblGenomes-Gn; BRADO3412.
DR   EnsemblGenomes-Gn; BRADO3413.
DR   EnsemblGenomes-Gn; BRADO3467.
DR   EnsemblGenomes-Gn; BRADO3772.
DR   EnsemblGenomes-Gn; BRADO4295.
DR   EnsemblGenomes-Gn; BRADO4358.
DR   EnsemblGenomes-Gn; BRADO4413.
DR   EnsemblGenomes-Gn; BRADO4414.
DR   EnsemblGenomes-Gn; BRADO4484.
DR   EnsemblGenomes-Gn; BRADO4605.
DR   EnsemblGenomes-Gn; BRADO4628.
DR   EnsemblGenomes-Gn; BRADO4660.
DR   EnsemblGenomes-Gn; BRADO5889.
DR   EnsemblGenomes-Gn; BRADO5890.
DR   EnsemblGenomes-Gn; BRADO_16S_1.
DR   EnsemblGenomes-Gn; BRADO_16S_2.
DR   EnsemblGenomes-Gn; BRADO_23S_1.
DR   EnsemblGenomes-Gn; BRADO_23S_2.
DR   EnsemblGenomes-Gn; BRADO_5S_1.
DR   EnsemblGenomes-Gn; BRADO_5S_2.
DR   EnsemblGenomes-Gn; BRADOtRNA1.
DR   EnsemblGenomes-Gn; BRADOtRNA10.
DR   EnsemblGenomes-Gn; BRADOtRNA11.
DR   EnsemblGenomes-Gn; BRADOtRNA12.
DR   EnsemblGenomes-Gn; BRADOtRNA13.
DR   EnsemblGenomes-Gn; BRADOtRNA14.
DR   EnsemblGenomes-Gn; BRADOtRNA15.
DR   EnsemblGenomes-Gn; BRADOtRNA16.
DR   EnsemblGenomes-Gn; BRADOtRNA17.
DR   EnsemblGenomes-Gn; BRADOtRNA18.
DR   EnsemblGenomes-Gn; BRADOtRNA19.
DR   EnsemblGenomes-Gn; BRADOtRNA2.
DR   EnsemblGenomes-Gn; BRADOtRNA20.
DR   EnsemblGenomes-Gn; BRADOtRNA21.
DR   EnsemblGenomes-Gn; BRADOtRNA22.
DR   EnsemblGenomes-Gn; BRADOtRNA23.
DR   EnsemblGenomes-Gn; BRADOtRNA24.
DR   EnsemblGenomes-Gn; BRADOtRNA25.
DR   EnsemblGenomes-Gn; BRADOtRNA26.
DR   EnsemblGenomes-Gn; BRADOtRNA27.
DR   EnsemblGenomes-Gn; BRADOtRNA28.
DR   EnsemblGenomes-Gn; BRADOtRNA29.
DR   EnsemblGenomes-Gn; BRADOtRNA3.
DR   EnsemblGenomes-Gn; BRADOtRNA30.
DR   EnsemblGenomes-Gn; BRADOtRNA31.
DR   EnsemblGenomes-Gn; BRADOtRNA32.
DR   EnsemblGenomes-Gn; BRADOtRNA33.
DR   EnsemblGenomes-Gn; BRADOtRNA34.
DR   EnsemblGenomes-Gn; BRADOtRNA35.
DR   EnsemblGenomes-Gn; BRADOtRNA36.
DR   EnsemblGenomes-Gn; BRADOtRNA37.
DR   EnsemblGenomes-Gn; BRADOtRNA38.
DR   EnsemblGenomes-Gn; BRADOtRNA39.
DR   EnsemblGenomes-Gn; BRADOtRNA4.
DR   EnsemblGenomes-Gn; BRADOtRNA40.
DR   EnsemblGenomes-Gn; BRADOtRNA41.
DR   EnsemblGenomes-Gn; BRADOtRNA42.
DR   EnsemblGenomes-Gn; BRADOtRNA43.
DR   EnsemblGenomes-Gn; BRADOtRNA44.
DR   EnsemblGenomes-Gn; BRADOtRNA45.
DR   EnsemblGenomes-Gn; BRADOtRNA46.
DR   EnsemblGenomes-Gn; BRADOtRNA47.
DR   EnsemblGenomes-Gn; BRADOtRNA48.
DR   EnsemblGenomes-Gn; BRADOtRNA49.
DR   EnsemblGenomes-Gn; BRADOtRNA5.
DR   EnsemblGenomes-Gn; BRADOtRNA50.
DR   EnsemblGenomes-Gn; BRADOtRNA6.
DR   EnsemblGenomes-Gn; BRADOtRNA7.
DR   EnsemblGenomes-Gn; BRADOtRNA8.
DR   EnsemblGenomes-Gn; BRADOtRNA9.
DR   EnsemblGenomes-Gn; EBG00001208608.
DR   EnsemblGenomes-Gn; EBG00001208609.
DR   EnsemblGenomes-Gn; EBG00001208610.
DR   EnsemblGenomes-Gn; EBG00001208611.
DR   EnsemblGenomes-Gn; EBG00001208612.
DR   EnsemblGenomes-Gn; EBG00001208613.
DR   EnsemblGenomes-Gn; EBG00001208614.
DR   EnsemblGenomes-Gn; EBG00001208615.
DR   EnsemblGenomes-Gn; EBG00001208616.
DR   EnsemblGenomes-Gn; EBG00001208617.
DR   EnsemblGenomes-Gn; EBG00001208618.
DR   EnsemblGenomes-Gn; EBG00001208619.
DR   EnsemblGenomes-Gn; EBG00001208620.
DR   EnsemblGenomes-Gn; EBG00001208621.
DR   EnsemblGenomes-Gn; EBG00001208622.
DR   EnsemblGenomes-Gn; EBG00001208623.
DR   EnsemblGenomes-Gn; EBG00001208624.
DR   EnsemblGenomes-Gn; EBG00001208625.
DR   EnsemblGenomes-Gn; EBG00001208626.
DR   EnsemblGenomes-Gn; EBG00001208627.
DR   EnsemblGenomes-Gn; EBG00001208628.
DR   EnsemblGenomes-Gn; EBG00001208629.
DR   EnsemblGenomes-Gn; EBG00001208630.
DR   EnsemblGenomes-Gn; EBG00001208631.
DR   EnsemblGenomes-Gn; EBG00001208632.
DR   EnsemblGenomes-Gn; EBG00001208633.
DR   EnsemblGenomes-Gn; EBG00001208634.
DR   EnsemblGenomes-Gn; EBG00001208635.
DR   EnsemblGenomes-Gn; EBG00001208636.
DR   EnsemblGenomes-Gn; EBG00001208637.
DR   EnsemblGenomes-Gn; EBG00001208638.
DR   EnsemblGenomes-Gn; EBG00001208639.
DR   EnsemblGenomes-Gn; EBG00001208640.
DR   EnsemblGenomes-Gn; EBG00001208641.
DR   EnsemblGenomes-Gn; EBG00001208642.
DR   EnsemblGenomes-Gn; EBG00001208643.
DR   EnsemblGenomes-Gn; EBG00001208644.
DR   EnsemblGenomes-Gn; EBG00001208645.
DR   EnsemblGenomes-Gn; EBG00001208646.
DR   EnsemblGenomes-Gn; EBG00001208647.
DR   EnsemblGenomes-Gn; EBG00001208648.
DR   EnsemblGenomes-Gn; EBG00001208649.
DR   EnsemblGenomes-Gn; EBG00001208650.
DR   EnsemblGenomes-Gn; EBG00001208651.
DR   EnsemblGenomes-Gn; EBG00001208652.
DR   EnsemblGenomes-Gn; EBG00001208653.
DR   EnsemblGenomes-Gn; EBG00001208654.
DR   EnsemblGenomes-Gn; EBG00001208655.
DR   EnsemblGenomes-Gn; EBG00001208656.
DR   EnsemblGenomes-Gn; EBG00001208657.
DR   EnsemblGenomes-Gn; EBG00001208658.
DR   EnsemblGenomes-Gn; EBG00001208659.
DR   EnsemblGenomes-Gn; EBG00001208660.
DR   EnsemblGenomes-Gn; EBG00001208661.
DR   EnsemblGenomes-Gn; EBG00001208662.
DR   EnsemblGenomes-Gn; EBG00001208663.
DR   EnsemblGenomes-Gn; EBG00001208664.
DR   EnsemblGenomes-Gn; EBG00001208665.
DR   EnsemblGenomes-Gn; EBG00001208666.
DR   EnsemblGenomes-Gn; EBG00001208667.
DR   EnsemblGenomes-Gn; EBG00001208668.
DR   EnsemblGenomes-Gn; EBG00001208669.
DR   EnsemblGenomes-Gn; EBG00001208670.
DR   EnsemblGenomes-Gn; EBG00001208671.
DR   EnsemblGenomes-Gn; EBG00001208672.
DR   EnsemblGenomes-Gn; EBG00001208673.
DR   EnsemblGenomes-Gn; EBG00001208674.
DR   EnsemblGenomes-Gn; EBG00001208675.
DR   EnsemblGenomes-Gn; EBG00001208676.
DR   EnsemblGenomes-Gn; EBG00001208677.
DR   EnsemblGenomes-Gn; EBG00001208678.
DR   EnsemblGenomes-Tr; BRADO0296.
DR   EnsemblGenomes-Tr; BRADO0297.
DR   EnsemblGenomes-Tr; BRADO0315.
DR   EnsemblGenomes-Tr; BRADO0316.
DR   EnsemblGenomes-Tr; BRADO0459.
DR   EnsemblGenomes-Tr; BRADO0460.
DR   EnsemblGenomes-Tr; BRADO0461.
DR   EnsemblGenomes-Tr; BRADO0593.
DR   EnsemblGenomes-Tr; BRADO0594.
DR   EnsemblGenomes-Tr; BRADO0595.
DR   EnsemblGenomes-Tr; BRADO0744.
DR   EnsemblGenomes-Tr; BRADO0745.
DR   EnsemblGenomes-Tr; BRADO0789.
DR   EnsemblGenomes-Tr; BRADO3114.
DR   EnsemblGenomes-Tr; BRADO3115.
DR   EnsemblGenomes-Tr; BRADO3208.
DR   EnsemblGenomes-Tr; BRADO3219.
DR   EnsemblGenomes-Tr; BRADO3237.
DR   EnsemblGenomes-Tr; BRADO3260.
DR   EnsemblGenomes-Tr; BRADO3354.
DR   EnsemblGenomes-Tr; BRADO3411.
DR   EnsemblGenomes-Tr; BRADO3412.
DR   EnsemblGenomes-Tr; BRADO3413.
DR   EnsemblGenomes-Tr; BRADO3467.
DR   EnsemblGenomes-Tr; BRADO3772.
DR   EnsemblGenomes-Tr; BRADO4295.
DR   EnsemblGenomes-Tr; BRADO4358.
DR   EnsemblGenomes-Tr; BRADO4413.
DR   EnsemblGenomes-Tr; BRADO4414.
DR   EnsemblGenomes-Tr; BRADO4484.
DR   EnsemblGenomes-Tr; BRADO4605.
DR   EnsemblGenomes-Tr; BRADO4628.
DR   EnsemblGenomes-Tr; BRADO4660.
DR   EnsemblGenomes-Tr; BRADO5889.
DR   EnsemblGenomes-Tr; BRADO5890.
DR   EnsemblGenomes-Tr; BRADO_16S_1-1.
DR   EnsemblGenomes-Tr; BRADO_16S_2-1.
DR   EnsemblGenomes-Tr; BRADO_23S_1-1.
DR   EnsemblGenomes-Tr; BRADO_23S_2-1.
DR   EnsemblGenomes-Tr; BRADO_5S_1-1.
DR   EnsemblGenomes-Tr; BRADO_5S_2-1.
DR   EnsemblGenomes-Tr; BRADOtRNA1-1.
DR   EnsemblGenomes-Tr; BRADOtRNA10-1.
DR   EnsemblGenomes-Tr; BRADOtRNA11-1.
DR   EnsemblGenomes-Tr; BRADOtRNA12-1.
DR   EnsemblGenomes-Tr; BRADOtRNA13-1.
DR   EnsemblGenomes-Tr; BRADOtRNA14-1.
DR   EnsemblGenomes-Tr; BRADOtRNA15-1.
DR   EnsemblGenomes-Tr; BRADOtRNA16-1.
DR   EnsemblGenomes-Tr; BRADOtRNA17-1.
DR   EnsemblGenomes-Tr; BRADOtRNA18-1.
DR   EnsemblGenomes-Tr; BRADOtRNA19-1.
DR   EnsemblGenomes-Tr; BRADOtRNA2-1.
DR   EnsemblGenomes-Tr; BRADOtRNA20-1.
DR   EnsemblGenomes-Tr; BRADOtRNA21-1.
DR   EnsemblGenomes-Tr; BRADOtRNA22-1.
DR   EnsemblGenomes-Tr; BRADOtRNA23-1.
DR   EnsemblGenomes-Tr; BRADOtRNA24-1.
DR   EnsemblGenomes-Tr; BRADOtRNA25-1.
DR   EnsemblGenomes-Tr; BRADOtRNA26-1.
DR   EnsemblGenomes-Tr; BRADOtRNA27-1.
DR   EnsemblGenomes-Tr; BRADOtRNA28-1.
DR   EnsemblGenomes-Tr; BRADOtRNA29-1.
DR   EnsemblGenomes-Tr; BRADOtRNA3-1.
DR   EnsemblGenomes-Tr; BRADOtRNA30-1.
DR   EnsemblGenomes-Tr; BRADOtRNA31-1.
DR   EnsemblGenomes-Tr; BRADOtRNA32-1.
DR   EnsemblGenomes-Tr; BRADOtRNA33-1.
DR   EnsemblGenomes-Tr; BRADOtRNA34-1.
DR   EnsemblGenomes-Tr; BRADOtRNA35-1.
DR   EnsemblGenomes-Tr; BRADOtRNA36-1.
DR   EnsemblGenomes-Tr; BRADOtRNA37-1.
DR   EnsemblGenomes-Tr; BRADOtRNA38-1.
DR   EnsemblGenomes-Tr; BRADOtRNA39-1.
DR   EnsemblGenomes-Tr; BRADOtRNA4-1.
DR   EnsemblGenomes-Tr; BRADOtRNA40-1.
DR   EnsemblGenomes-Tr; BRADOtRNA41-1.
DR   EnsemblGenomes-Tr; BRADOtRNA42-1.
DR   EnsemblGenomes-Tr; BRADOtRNA43-1.
DR   EnsemblGenomes-Tr; BRADOtRNA44-1.
DR   EnsemblGenomes-Tr; BRADOtRNA45-1.
DR   EnsemblGenomes-Tr; BRADOtRNA46-1.
DR   EnsemblGenomes-Tr; BRADOtRNA47-1.
DR   EnsemblGenomes-Tr; BRADOtRNA48-1.
DR   EnsemblGenomes-Tr; BRADOtRNA49-1.
DR   EnsemblGenomes-Tr; BRADOtRNA5-1.
DR   EnsemblGenomes-Tr; BRADOtRNA50-1.
DR   EnsemblGenomes-Tr; BRADOtRNA6-1.
DR   EnsemblGenomes-Tr; BRADOtRNA7-1.
DR   EnsemblGenomes-Tr; BRADOtRNA8-1.
DR   EnsemblGenomes-Tr; BRADOtRNA9-1.
DR   EnsemblGenomes-Tr; EBT00001777845.
DR   EnsemblGenomes-Tr; EBT00001777846.
DR   EnsemblGenomes-Tr; EBT00001777847.
DR   EnsemblGenomes-Tr; EBT00001777848.
DR   EnsemblGenomes-Tr; EBT00001777849.
DR   EnsemblGenomes-Tr; EBT00001777850.
DR   EnsemblGenomes-Tr; EBT00001777851.
DR   EnsemblGenomes-Tr; EBT00001777852.
DR   EnsemblGenomes-Tr; EBT00001777853.
DR   EnsemblGenomes-Tr; EBT00001777854.
DR   EnsemblGenomes-Tr; EBT00001777855.
DR   EnsemblGenomes-Tr; EBT00001777856.
DR   EnsemblGenomes-Tr; EBT00001777857.
DR   EnsemblGenomes-Tr; EBT00001777858.
DR   EnsemblGenomes-Tr; EBT00001777859.
DR   EnsemblGenomes-Tr; EBT00001777860.
DR   EnsemblGenomes-Tr; EBT00001777861.
DR   EnsemblGenomes-Tr; EBT00001777862.
DR   EnsemblGenomes-Tr; EBT00001777863.
DR   EnsemblGenomes-Tr; EBT00001777864.
DR   EnsemblGenomes-Tr; EBT00001777865.
DR   EnsemblGenomes-Tr; EBT00001777866.
DR   EnsemblGenomes-Tr; EBT00001777867.
DR   EnsemblGenomes-Tr; EBT00001777868.
DR   EnsemblGenomes-Tr; EBT00001777869.
DR   EnsemblGenomes-Tr; EBT00001777870.
DR   EnsemblGenomes-Tr; EBT00001777871.
DR   EnsemblGenomes-Tr; EBT00001777872.
DR   EnsemblGenomes-Tr; EBT00001777873.
DR   EnsemblGenomes-Tr; EBT00001777874.
DR   EnsemblGenomes-Tr; EBT00001777875.
DR   EnsemblGenomes-Tr; EBT00001777876.
DR   EnsemblGenomes-Tr; EBT00001777877.
DR   EnsemblGenomes-Tr; EBT00001777878.
DR   EnsemblGenomes-Tr; EBT00001777879.
DR   EnsemblGenomes-Tr; EBT00001777880.
DR   EnsemblGenomes-Tr; EBT00001777881.
DR   EnsemblGenomes-Tr; EBT00001777882.
DR   EnsemblGenomes-Tr; EBT00001777883.
DR   EnsemblGenomes-Tr; EBT00001777884.
DR   EnsemblGenomes-Tr; EBT00001777885.
DR   EnsemblGenomes-Tr; EBT00001777886.
DR   EnsemblGenomes-Tr; EBT00001777887.
DR   EnsemblGenomes-Tr; EBT00001777888.
DR   EnsemblGenomes-Tr; EBT00001777889.
DR   EnsemblGenomes-Tr; EBT00001777890.
DR   EnsemblGenomes-Tr; EBT00001777891.
DR   EnsemblGenomes-Tr; EBT00001777892.
DR   EnsemblGenomes-Tr; EBT00001777893.
DR   EnsemblGenomes-Tr; EBT00001777894.
DR   EnsemblGenomes-Tr; EBT00001777895.
DR   EnsemblGenomes-Tr; EBT00001777896.
DR   EnsemblGenomes-Tr; EBT00001777897.
DR   EnsemblGenomes-Tr; EBT00001777898.
DR   EnsemblGenomes-Tr; EBT00001777899.
DR   EnsemblGenomes-Tr; EBT00001777900.
DR   EnsemblGenomes-Tr; EBT00001777901.
DR   EnsemblGenomes-Tr; EBT00001777902.
DR   EnsemblGenomes-Tr; EBT00001777903.
DR   EnsemblGenomes-Tr; EBT00001777904.
DR   EnsemblGenomes-Tr; EBT00001777905.
DR   EnsemblGenomes-Tr; EBT00001777906.
DR   EnsemblGenomes-Tr; EBT00001777907.
DR   EnsemblGenomes-Tr; EBT00001777908.
DR   EnsemblGenomes-Tr; EBT00001777909.
DR   EnsemblGenomes-Tr; EBT00001777910.
DR   EnsemblGenomes-Tr; EBT00001777911.
DR   EnsemblGenomes-Tr; EBT00001777912.
DR   EnsemblGenomes-Tr; EBT00001777913.
DR   EnsemblGenomes-Tr; EBT00001777914.
DR   EnsemblGenomes-Tr; EBT00001777915.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC2620714; 19011059.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CU234118.
DR   SILVA-SSU; CU234118.
DR   StrainInfo; 299985; 0.
XX
CC   Annotation data relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny results (Syntonizer software) are available in
CC   RhizoScope database via the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage/rhizoscope
CC   Each annotation includes a confidence level as follow:
CC   1 : Function experimentally demonstrated in the studied organism
CC   2a : Function of homologous gene experimentally demonstrated in an other
CC   organism
CC   2b : Function of strongly homologous gene
CC   3 : Function proposed based on presence of conserved amino acid motif,
CC   structural feature or limited homology
CC   4 : Homologs of previously reported genes of unknown function
CC   5 : No homology to any previously reported sequences
CC   6 : Doubtful CDS
CC   7 : Gene remnant
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7456587
FT                   /organism="Bradyrhizobium sp. ORS 278"
FT                   /strain="ORS278"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:114615"
FT   gene            936..2366
FT                   /gene="dnaA"
FT                   /locus_tag="BRADO0001"
FT   CDS_pept        936..2366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BRADO0001"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.3.7 : Nucleoproteins, basic proteins"
FT                   /function="3.1.2.5 : Action unknown"
FT                   /function="3.3.2 : Regulon (a network of operons encoding
FT                   related functions)"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9140960, 7615570, 10545126; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73974"
FT                   /db_xref="GOA:A4YJ98"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJ98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73974.1"
FT                   /translation="MTNSEQERWSRVKGRLRSTVGEDVYTSWFARMDLEAVQDESVHLS
FT                   VPTRFLKSWIQAHYAERVLSAWQAEMPEVHRIDLSVRTAMRCATPAKEAPAAVEARRPE
FT                   RSDAKPVSDARAPVMTPVAASHDALGGSPLDPRLTFASFVVGRANTLAHAAARQVADGR
FT                   RGDPVMFNPLYIHAGVGLGKTHLLQAVTWAGNAGGERKVLYLTAEKFMYGFVAALKSQT
FT                   ALAFKEALRGIDVLVIDDLQFLQGKSTQAEFCHTLNALIDAGRQVVIAADRPPSDLESL
FT                   DDRVRSRLAGGLVVEMATLGEDLRLGILKSRVAAARAHHASFDVPEAVLDYLARSITHN
FT                   GRDLEGAINRLLAHSKLNNQPVTLDMAEREVRDLVRPQEPKRIKIEDIQRVVARQYNVS
FT                   RSDLLSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEALVG
FT                   KDVALNDEVESLKRQLQD"
FT   gene            2659..3777
FT                   /gene="dnaN"
FT                   /locus_tag="BRADO0002"
FT   CDS_pept        2659..3777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BRADO0002"
FT                   /product="DNA polymerase III, beta-subunit"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1349852, 6234204, 3527871, 2841344, 14592985; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73975"
FT                   /db_xref="GOA:A4YJ99"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJ99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73975.1"
FT                   /translation="MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLR
FT                   ATDLDLEVTETLAAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGERAVLAIRAGR
FT                   SKFTLQTLPESDFPDLAAGEMTHAFGVPAKDIKSLIDRTQFAISTEETRYYLNGIYLHA
FT                   GGTAKQPTLRAVATDGHRLAQVDLPQPSGAAEMPGVIVPRKTVGEVQRLIEDNDSEIKI
FT                   ELSQGKIRFTLGQVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKADFAAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEGE
FT                   VAVLRLADPGSPTLIQDRDNRNALYVLMPMRV"
FT   gene            3998..5134
FT                   /gene="recF"
FT                   /locus_tag="BRADO0003"
FT   CDS_pept        3998..5134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BRADO0003"
FT                   /product="DNA replication and repair protein recF"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12511510, 11459953, 10585965; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73976"
FT                   /db_xref="GOA:A4YJA0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73976.1"
FT                   /translation="MTPSRINRLSLTHFRSYRAAGVSVQADMVALVGANGAGKTNCLEA
FT                   ISFFAPGRGLRRATLEDVADNQGDGSWAISAEIEGALGLATFGTGIEPPRGDASTTRRC
FT                   RIDREPVGSAAAFGDHIRMVWLTPSMDGLFMGAASERRRFFDRLVLAIDSEHSSRVSAL
FT                   ERSLRSRNRLLEVRNFDDHWCDAIERETAELAVAVAASRGQTAVKLAAMLRQRGAASAF
FT                   PSAEIALDGWMENALLTEPALAVEDRYRALLRDNRARDAAAGRTLDGPHLTDLHVIYAP
FT                   KNMPARDASTGEQKALLIGLILAHATLVAETTGIVPMLLLDEIVAHLDPGRRTALFAEL
FT                   GTLGAQVWLTGADPAAFAELRELGEIFDVEGGRITARR"
FT   gene            5434..7872
FT                   /gene="gyrB"
FT                   /locus_tag="BRADO0004"
FT   CDS_pept        5434..7872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BRADO0004"
FT                   /product="DNA gyrase subunit B"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.1.1 : DNA bending, supercoiling, inversion"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1646964, 8982450, 10223925; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73977"
FT                   /db_xref="GOA:A4YJA1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73977.1"
FT                   /translation="MTEPARQTIADNEPATANEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGYATRVEVVLNADNSVTVRDDGRGIPVGIHKDEGVS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLELRIWREDKEHLIEFAHG
FT                   DAVAPLRVVGESKGKRGTEVTFLASTETFKMVEYDYATLEHRLRELAFLNSGVHIILSD
FT                   MRHAVEKREEMFYSGGVEEFVKYLDRNKKAIVPNPIMVRSEANGITVEAALWWNDSYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRGALTRQVNGYAEANAKKEKIALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVINEALSAWFEEHPSEAKTVVGKVIQAAAAREA
FT                   ARKARELTRKNPLNNIASLPGKLADCQEKDPAKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERVRPDKMLSSEQIGTLITALGTGISDDFSIDKLRYHKIIVMTDADVDG
FT                   AHIRTLLLTFFYRQMRQIIDRGHLYIAQPPLYKVTRGKSEQYLKDERALEDYLIGTGLD
FT                   DCVFRTADGEERKGRDLLALVEEARLVRNILRNLHSRYDRKVVEQAAIAGVLRGDITRD
FT                   IATADAAAEYIAKRLDVLAEEVERGWIGHFVEGQGFTFERTVRGVKDVAVIDDALLASA
FT                   DARKLDDYAARLQDAYAKPGALRRGDTQTVIHGPVDLFEAVTDSGRKGIAMQRYKGLGE
FT                   MNPQQLWETTLDTEARTLLQVKVKEVDEADDIFTKLMGDVVEPRREFIQDNSLSANVDV
FT                   "
FT   gene            8037..9332
FT                   /gene="murA"
FT                   /locus_tag="BRADO0005"
FT   CDS_pept        8037..9332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BRADO0005"
FT                   /product="UDP-N-acetylglucosamine 1-carboxyvinyltransferase
FT                   (Enoylpyruvate transferase) (UDP-N-acetylglucosamine
FT                   enolpyruvyl transferase) (EPT)"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /function="5.1 : Cell division"
FT                   /function="5.2 : Cell cycle physiology"
FT                   /EC_number="2.5.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10694381, 15531591, 14763982, 12492849, 15787194; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73978"
FT                   /db_xref="GOA:A4YJA2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73978.1"
FT                   /translation="MAPIQYIVEGGHRLKGAIEPSGNKNAALPIIAAALLTDHPVTLDN
FT                   VPRIRDTETLVELVRSVGASAEWRGRNRLAIHAKEIRAADLDPDLCARIRASILLAGPL
FT                   LARCGEVALPPPGGDVIGRRRLDTHFLAFEQLGATVTATDKIELRASGLKGADVFLDEP
FT                   SVTATENALVAAVAAHGTTYLRNAASEPHVQDLAHFLVALGANIEGIGTNTMVIHGAST
FT                   LGQASYAIQPDHIEVGSLIGLAAVTRSPLRIVRAGTEHLRSIRMGFERLGIVCEVAGDD
FT                   LIVPSDQTMKIKDDFGGHVPKLEDQPWPAFPADVMSIAIVTATQCEGVILMFEKMFESR
FT                   MFFVDKLISMGARIVLCDPHRAIVAGPSRLRGARVVSPDIRAGMAMLLAALCAEGTSYI
FT                   DNADQIERGYERIDERLNALGAKITRVPERGR"
FT   gene            9479..9958
FT                   /locus_tag="BRADO0006"
FT   CDS_pept        9479..9958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73979"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73979.1"
FT                   /translation="MTISEITPDVDRDRWLAGADFADAFRITIDGATLNARSAAERMLG
FT                   HTPWWMAALLKLRNALVRPFGLKTSGADARRPRPMIGIFPVINETPRQLVLGFDDKHLD
FT                   FRVLVDVATVGASSQVTATTLVQTHNALGRIYLTVITPFHRLVVKATLRQVAVTT"
FT   gene            complement(10145..10891)
FT                   /locus_tag="BRADO0007"
FT   CDS_pept        complement(10145..10891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0007"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73980"
FT                   /db_xref="GOA:A4YJA4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73980.1"
FT                   /translation="MTSLIVPPLLTVASAAAFMILERIAPGRELPNSPGWYGRVLAVIL
FT                   LQVGVTLATGRFWMQLFDGASLLELRALPSPALQGFLAWLIGTFFFYWWHRIRHLNGWW
FT                   QLFHQIHHSPRRIETLTSFYKHPVEMLADSGLSALILFPLLGCSSAGALWFNLCAATSE
FT                   FFYHANYRSPRWLKYLIQTPELHSLHHELDVHSGNYGDLPIWDRLFGTYRDADEFAARC
FT                   GFPADSERHLVRMLMFRDVYGESQGG"
FT   gene            complement(11087..11854)
FT                   /locus_tag="BRADO0008"
FT   CDS_pept        complement(11087..11854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0008"
FT                   /product="Putative transcriptional regulatory protein,luxR
FT                   family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73981"
FT                   /db_xref="GOA:A4YJA5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73981.1"
FT                   /translation="MRGGKDDKVGSADSVQAVSPAPDLQAWVEVLGAVPGGTVTERQIL
FT                   TWVEVQLRRFLPFNRFLGAYGRLIGGRIRMRTLVTSGYPDDFVAGLEESFDLGARGCFA
FT                   WWVQNRTAFILDPADPPPFATARELDEIKQLSLGVVAGHGVIDPFASAGTYLSFAGVAA
FT                   DQPQHVRMCLNLIAPVLHALFLATEQVAAPRLDLGKLTERQRELVDLALMGLPDKTIAS
FT                   RLGISEHTVGNHFRVIYERLGIKKRSQLIAALK"
FT   gene            12876..14252
FT                   /locus_tag="BRADO0009"
FT   CDS_pept        12876..14252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0009"
FT                   /product="putative MATE efflux family protein; putative
FT                   multidrug resistance protein norM (Multidrug-efflux
FT                   transporter)"
FT                   /function="4.2.A.66 : The Multi Antimicrobial Extrusion
FT                   (MATE) Family"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12533487, 11709306, 12183269; Product
FT                   type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73982"
FT                   /db_xref="GOA:A4YJA6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73982.1"
FT                   /translation="MTSSTATGHAPPTPPSLALELWDTIRLAAPMALTQLSQIAMMSTD
FT                   LAFIGRLGGDAVAAAALAGTVYFVGSTFGMGLMSAVAPLAAQAFGADDAGLVRRALRVG
FT                   LWAGLFVALPIMLIALNGETILLALCQAPGVAHLAQHYLSGLAWGVAPMLWFLALRSFM
FT                   GAVNRPEPVLWITLAAIPLNALLVYPLLYGHWGLPQLGLTGVGLATSSVNLGTFLAGLW
FT                   FAAFRPPFRNYHVLAQLGRIDWRLLRQLLVIGAPISLSFLLEYGLFSAAAILMGLISTT
FT                   ALAAHQIALQITAILFMVPFGISMAATVRVGHAAGRQDPHAVRRAGLMAMLLGLGLAVL
FT                   FTLGIIAARVEIVQLFLGSAVADAEATVALAATLLLVGTTFFITDALQTITVGALRGIK
FT                   DTRIPLLLAVLGYWLIGFPLSYVLGLHTAFGAIGIWIGLSIGTGLYAALLVLRFLRLSR
FT                   "
FT   gene            complement(14255..15397)
FT                   /locus_tag="BRADO0010"
FT   CDS_pept        complement(14255..15397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0010"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73983"
FT                   /db_xref="GOA:A4YJA7"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73983.1"
FT                   /translation="MASLKELFGRVRARKAQMSLAVRGTVAATLAFAIATAFQLKLPLW
FT                   AVLTSLIVTQGSVGRSLKATRDYMFGTIGGAIYGGAITVFIPHSGELQLLGMLILAVTP
FT                   LAFIAAVNPSLNAATVTAVIVLLVPTMGHLDPLGSAIDRVFEVAVGALTGLAVSFVVLP
FT                   SRAHAQMRSAAGRLLELIAAAFTELLAGLSHGRDNDALHRIQDGIGAALTELNATGAEA
FT                   ERERSARLSSGADTGPMLRTILRLRHDVVMIGRASVVPLPSELQARLSGPVTRVSDAIA
FT                   GYLRGCAGAIRNGSGPPAIWPVHVAVKAYAEAVAAVRSDGLTRGLPGDAAERFFALGFS
FT                   LDQMRQNLIDLERVVAEWAGASSGKPHRPEPEETSDTAGA"
FT   gene            15509..16879
FT                   /locus_tag="BRADO0011"
FT   CDS_pept        15509..16879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0011"
FT                   /product="Conserved hypothetical protein; Putative
FT                   MmgE/PrpD family protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73984"
FT                   /db_xref="GOA:A4YJA8"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73984.1"
FT                   /translation="MAQETATLAAYVAELKYDDIPPEVLDRAKVLTLDFLGSAIRARRE
FT                   AESTPSVVKMLAALKLDAAGEATVFGDGRTWTPAVAALLNGTMGHSLDFDDTHADSSLH
FT                   PSAPVVPAAFAVGEMVGASGREVLTAIVAGYEVCCRLGNALDPTSHYARGFHPTATAGT
FT                   YGAAAAAGKLFGLSEQQLVYAFGVSGSQAAGSLQFLVNGAWNKRYQVGASAMNGVIAAT
FT                   LAKNDFVGAIESVEGKHGLLVGYSDTPHREKAVAGLGTSYETMKIGVKPYPSCRYTHAA
FT                   IDAIIALRREHNLTPDQVKRVEVGLHRNGITLTGDAATKRHPTSIVGGQFSMFFTGALA
FT                   LDQGRFGWDDYTRLGDAAINALADKFDVVQDDKLEIGRSHPFGARVTITTEDGVHERLH
FT                   DDPSGEPTSFPSAQAMSDKFITLARPVLSTRAQGFADAILSLERFDRVAQATALGRA"
FT   gene            complement(16888..18294)
FT                   /locus_tag="BRADO0012"
FT   CDS_pept        complement(16888..18294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0012"
FT                   /product="putative Beta-lactamase family protein; putative
FT                   6-aminohexanoate-dimer hydrolase"
FT                   /EC_number="3.5.1.46"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 16162506; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73985"
FT                   /db_xref="GOA:A4YJA9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73985.1"
FT                   /translation="MTRRLLLLVVLATTTLTALAVGAACARDVPEVATGFIASVVCSET
FT                   FVSGLDPDRVVSETRDAMPGAGLLTWAMDIRVDRAARDVNVTLLGLGRSHAVFRDGLGC
FT                   HLEHGEIQDWPTIRPAAPQPALLPDIAPPRVLESATPALAAALDRAFAEPAAPPFRRTH
FT                   AVVVLKDGKLIAERYGPGITLDTPLLGFSATKSMIATLIGILVRQNKLTLHAPARVAAW
FT                   QNETDPRHAITVDHLLRHTAGLALGSSLQASLLSALEPVNRMKFVETDRAAFAETMPIE
FT                   TTPGAVSNYHDGNTVILSQLIRDAAGGSAADVLRFAHRELFDPLGMRNVTIEFDAAGTP
FT                   EGSSQMLASARDWARLGQLYLDDGVVGGRRILPAGWAEYVSSPTPGAFVGLGAGFWTNR
FT                   GDSFGANYRVSHGWPRDAFFAKGSIGQYVIIIPSERLVIARFGRTVNWPPEADGVAELV
FT                   SDVIAATRGE"
FT   gene            complement(18436..19512)
FT                   /locus_tag="BRADO0013"
FT   CDS_pept        complement(18436..19512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0013"
FT                   /product="putative transcriptional regulatory protein, AraC
FT                   family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9409145; Product type pr : putative
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73986"
FT                   /db_xref="GOA:A4YJB0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016981"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73986.1"
FT                   /translation="MPLDSLDLALRAAAIALLAVLAVALGRELGQRPIGRLAIALALGS
FT                   AAHAATFNIGGAAAPSLAFAPLIAVATADIVVLWLFCRALFDDGFRLRWQHGLIWLAVF
FT                   GFSLMSCLVLGPAGHIRPVIVANNLMALSFVGLTLAQTIRSWSADLVEGRRRVRAVVVI
FT                   AALVYGGVNALLQMFAAARGPSELGNVINAAMFLTVAGAVALLLLRVGAGDLFAPEAPK
FT                   DAAVRAAAPAAIALAAETAANRKLVDALRRLMADERIYRQENVTIGVLATKLAIPEYRL
FT                   RRLINGELGFRNFNTFLNNHRIEEAKTALADPAQAEVPVITIAMDAGFQSLGPFNRAFK
FT                   AATGMTPTEFRRLRQSAA"
FT   gene            19653..20570
FT                   /locus_tag="BRADO0014"
FT   CDS_pept        19653..20570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0014"
FT                   /product="putative Pirin family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73987"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73987.1"
FT                   /translation="MSWQPSIDPEFGDPASCDALEHVIVPRTRDLGDGFAVRRALPHGR
FT                   RQMVGPFIFFDHFGPVQFVSGKGMDVRPHPHIGLATVTYLFDGAIMHRDSEGNVQEIQP
FT                   GAMNLMTAGRGIAHSERTPDLQRQNGQQMLGLQSWIALPVESEEIAPSFQHYAAGALPT
FT                   VSDTGFSARVIAGKAFGKASPVTMVSPWFYVEVTAQAGTVVPLDPDHEERAIYIVDGEI
FT                   EIARERHEGPRLLIFRPGDAISVRTVKPTRMMFLGGDALEGPRHVWWNFVSSSKERIEQ
FT                   AKQDWKTGRFAAVPHEHEFIPLPE"
FT   gene            20610..21524
FT                   /locus_tag="BRADO0015"
FT   CDS_pept        20610..21524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0015"
FT                   /product="Putative
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (SAICAR synthetase), purC-like protein"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15301532, 15301530; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73988"
FT                   /db_xref="GOA:A4YJB2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73988.1"
FT                   /translation="MTTLLASNLPLPIIGRGKVRDIYAVGDDRVLLLTTDRISAFDVVM
FT                   NETIPMKGAVLTQISAYWFNALEGVVHHHMISADTDEIITAVPELKPHRDEILGRAMLC
FT                   KRTTVFPIECVIRGYLSGSAWKEYAAHGTLAGEQLPAGLVESQKLEPAIFSPATKAETG
FT                   HDENITIARMREVVGDETAYTLESMTRAVYTLGEKLAREQGIIIADTKFEFGRDKDGHI
FT                   ILIDEVMTPDSSRFWAVDAYKPGQPQPSFDKQPLRDYLDAERRAGRWNGDAPPPPLPQS
FT                   VVDATSQRYLEAFRRVTERELKV"
FT   gene            complement(22286..23206)
FT                   /locus_tag="BRADO0017"
FT   CDS_pept        complement(22286..23206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0017"
FT                   /product="putative transcriptional regulatory protein, LysR
FT                   family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73989"
FT                   /db_xref="GOA:A4YJB3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73989.1"
FT                   /translation="MSSTRLPDFEGLALLARVAEERSFAGAARALNLSVATVSRAITRL
FT                   EDRLGARVLNRTSRKVALTDFGRTLAERGARMLREAEEAESAARELSSRPRGTVNLAVP
FT                   MSFGLREVSPLLPAFVREYPEITLNLHLSDATVDLIGDGFDAALRIAALPDSSLIARRL
FT                   RPMGRFLVASPDYIARYGRPQTPAELNVHHCLGYAYRARTATWHLTHTDGREAAVTPTG
FT                   PLSVTNIDALLPALLDGIGIAELPCFVADPHVAEGRLEILLPDWKLPGGGLYFITPAAH
FT                   VRPARIEVLSEFLARHLSRSREERC"
FT   gene            23302..24057
FT                   /locus_tag="BRADO0018"
FT   CDS_pept        23302..24057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0018"
FT                   /product="putative short-chain dehydrogenases/reductases
FT                   (SDR) family protein"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73990"
FT                   /db_xref="GOA:A4YJB4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73990.1"
FT                   /translation="MAQKLSEKIAVVTGGTSGIGLASAKRFAAEGAHVYVTGRRRPELE
FT                   AAVTAIGRSATGVQADATKLSDLDALYQKVKQDVGRIDVLFVNAGGGSMLPLGQITEQQ
FT                   YDDTFDRNVKGVLFTVQKALPLLRDGASVILTGSTAGTEGTPAFSVYGASKAAVRAFAR
FT                   NWILDLKDRRIRVNTLSPGATKTPGLVELAGPDAAQQQGLLDYLASRIPLGRVGDPDEI
FT                   AKAAVFLASDDSSFVNGAELFVDGGQAQV"
FT   gene            24176..24550
FT                   /locus_tag="BRADO0019"
FT   CDS_pept        24176..24550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73991"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73991.1"
FT                   /translation="MSHSSDNYDHLLRSNLNRVFNERDPAKRAEAIAELFVEVPVMFEP
FT                   TNVVNGRAEISRVAGDLLQQFGPDFVFVPVGTAVGHHGLAHLSWQAGPKDGPIAVTGAD
FT                   VAEIVDGRIARLWVLLNAAA"
FT   gene            complement(24761..25438)
FT                   /locus_tag="BRADO0020"
FT   CDS_pept        complement(24761..25438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0020"
FT                   /product="Conserved hypothetical protein; putative
FT                   nitroreductase family protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73992"
FT                   /db_xref="GOA:A4YJB6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73992.1"
FT                   /translation="MEFDDVILGRRSIRGYKPDPVPRALIEEILTLAMRAPSSMNTQPW
FT                   NFYVITGEPLNRIRAGNTERMLAGVPQSREFRIGQPFDGQHRERQIGVAKQLFSAMGIA
FT                   RDDKEKRQDWVLRGFRQFDAPVCIIVTYDRVLAGSDDTPFDCGAVTTALVNAAWSRGLG
FT                   AVINSQGIMQSPVVREHAGIAADQVIMKSIALGWPDHDFPANAVVSERKSVKDATVFVG
FT                   FEE"
FT   gene            complement(25530..26207)
FT                   /locus_tag="BRADO0021"
FT   CDS_pept        complement(25530..26207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0021"
FT                   /product="putative haloacid dehalogenase-like hydrolase
FT                   family protein; putative Phosphoglycolate phosphatase"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="3.1.3.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7826004, 7966317; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73993"
FT                   /db_xref="GOA:A4YJB7"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73993.1"
FT                   /translation="MSHVHAVLLDLDGTLIDSRPGIAASALAALRSLGHAPDQALDITA
FT                   FIGPPLQDMMRELLQAHGDRVGGDRVDEAVLVYRRHYGDIGLFDCSLYPGIREALQEMH
FT                   RAGLRIYLATSKRELFARRILEHLDLASYFQAIHGSVPSGELDHKPELLAHILMKRSIT
FT                   AAHGVMVGDRRHDIAGAHAVGMRSLGVLWGYGGREELETSGAGRLVESPSDLAAAVVTM
FT                   LKR"
FT   gene            complement(26298..27095)
FT                   /locus_tag="BRADO0022"
FT   CDS_pept        complement(26298..27095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0022"
FT                   /product="putative Aspartate/ornithine carbamoyltransferase
FT                   family protein"
FT                   /function="1.5.1.3 : Arginine"
FT                   /function="1.5.2.2 : Pyrimidine biosynthesis"
FT                   /function="1.1.3.3 : Arginine catabolism"
FT                   /EC_number="2.1.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73994"
FT                   /db_xref="GOA:A4YJB8"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73994.1"
FT                   /translation="MRAQELAVCWRARTMPQALADRRIALVVDDGGWRNTTAFDLGVQA
FT                   MGGLCVHAPIRLNATEAVEDLAAYLDNWFDAVVCRTPELELLYALSHWAQAPVVNARTR
FT                   QNHPCETLGDLAFLWHRRGAIDGLKIAVVAPAANILGSWIEAAQILPIDVVQVYPARWH
FT                   AQGESPRFHVTTDLDALQAADVIITDCWPIEEEASVLQDYQITAALLDGLRPDLEFLPC
FT                   PPVTRGHEVSDDAMRHRACRAVQSKAFVLHAQNAALEWVFGRP"
FT   gene            27293..28381
FT                   /locus_tag="BRADO0023"
FT   CDS_pept        27293..28381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0023"
FT                   /product="putative Mandelate racemase/muconate lactonizing
FT                   enzyme family protein"
FT                   /function="1.1.3.8 : Tryptophan utilization"
FT                   /EC_number="5.1.2.2"
FT                   /EC_number="5.5.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 2831968, 2215699, 2271624; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73995"
FT                   /db_xref="GOA:A4YJB9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034382"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73995.1"
FT                   /translation="MAQIAAIETGLYRIPLSVTLTDSTHGEMTAFELITCRVRDADGAE
FT                   GTGYTYTVGRNGYAVADICRREIPDLVAGHEADDTEAIWHRVWWGLHYGGRGGPVVLAL
FT                   SALDIALWDLKARRAGLPLFRLLGGYDRSVPCYAGGIDLDLSVDALLKQTDDNLARGFR
FT                   AIKMKVGRPDLGGDVARVRAMRQHLGDGFPLMADANMKWTIEEAIRAARALQPFDLTWL
FT                   EEPTIPDDVAGHARILAAGGVPIAAGENLRSLWDFKTYIAAGAVSYPEPDVTNCGGVTS
FT                   FMKIARLAEAFNLPVTSHGAHDVTVHLLAACPNRSFLEAHGFGLDRYIEHPLVLENGMA
FT                   LAPARPGHGMTFDWKGLATLAG"
FT   gene            complement(28410..29039)
FT                   /locus_tag="BRADO0024"
FT   CDS_pept        complement(28410..29039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0024"
FT                   /product="Putative Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73996"
FT                   /db_xref="GOA:A4YJC0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034345"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73996.1"
FT                   /translation="MKLYDSPTAPSPRRVRIFLAEKGITIPTVQVDLRAGEQFRPEFRA
FT                   LNPQCTVPVLQLDSGAAITDIIAICRYIEELHPDPALMGRNAEERAVIECWVRRIEWDG
FT                   IYAIQEAFRNNLPGLEQRALPGPLPLAQIPALAERGRLRAAHYFAWLDARLADHPFVCG
FT                   TAFTIADISAMVTVDFAIRAKLDPPDHLRHLGRWYDDVSRRPSAKA"
FT   gene            complement(29163..29783)
FT                   /locus_tag="BRADO0025"
FT   CDS_pept        complement(29163..29783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0025"
FT                   /product="hypothetical protein; putative dioxygenase, PhyH
FT                   family"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73997"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73997.1"
FT                   /translation="MIPSSTRTCIAELPEAEARRLDAEGYLLLRGAIPAGWLRPLRAAF
FT                   EAGTVPSEQWPVPRGRDWRHAMVDLDASVQRVCRLPSLLAAVHHILREPFFLGQVEGRE
FT                   PLADGGQQPLHRDGVDRPRSEAVSALAFLDPFGSDNGATQVAPGTHRHDADDAQAAPFV
FT                   TTGDAGDILLFDINLLHGATRNRSGARRRSLLITYAVATQQEE"
FT   gene            29960..32164
FT                   /locus_tag="BRADO0026"
FT   CDS_pept        29960..32164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0026"
FT                   /product="Putative sulfate transporter conatining a
FT                   cAMP-binding domain-like"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /function="4.S.174 : sulfate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73998"
FT                   /db_xref="GOA:A4YJC2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73998.1"
FT                   /translation="MNKTLTAGRADPILRRGMDDILGGSAASVLTVTYGLSYSLLIFAG
FT                   PLAPYLGQGIGITFMVSAVMALVLGLGSSLPFAIGAPDSSTAAVTAILASSLAERIITA
FT                   DPGASPFMPVVITLGLTSLVTGLVLWICGINRLGRTIRYVPYPVVGGFLGATGALIVIG
FT                   AIGVITGHRLQLSTLPAFGNAQTSYELAAAAAMAMLLYLTWHRSRNPFGLPVILVSGTI
FT                   AAHLGFWLCGITPAEAQATGWTFQPPPQVALVWPWTADALGAYPWAALSDLSGNIVAVI
FT                   FVTAASTLFNTAGIEVATHREADVERELAVTGVANALAGVLGGYTGCISISRSVLNVKA
FT                   GGTGRISGLTVAAISALMLALSQPLLGYMPKFVLGGLLLYLGADTLHKWAVQSRRRLSK
FT                   TDYASLLLIIAIILQWGFIAGILIGVVIGCAAFALSASRISAVKYGFDGSEYRSSLDRS
FT                   RDHQALLMAQGREIQGLSLQSYLFFGSANRLYQQVKLLLSRRAECRFLVFDFKLVTGID
FT                   SSAAYSFAQIKRLALERDVKLVLVHLPRAVERTLRASEFISKDVLIAPELDHALEWCEN
FT                   TIIQSHHEHAQDEASLRDWFARILGSDDEADELMSRCIRLDVGAGTTVVRAGEPAASMH
FT                   FILDGRVGIMVPAEHGGTTRVRSLGRYTTIGEMGLIAQTPRSATIQAETDSVLYELTIA
FT                   QFDAISREHPALAQKLLTYFMTIMAERLSFANRTIAVLRR"
FT   gene            32262..32903
FT                   /locus_tag="BRADO0027"
FT   CDS_pept        32262..32903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL73999"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL73999.1"
FT                   /translation="MKKGGVRAPVTPMAVVSSTSYISPASERMYRQSNLLGEWKGTWTA
FT                   SGQAVSFKVVNIRGAAATVEYTHNGRTERGIGQVNGSTIDFGAVTLGTKNGKTAVLLFS
FT                   AGGGKATAVLDKQAPPAEQNNLVGSWAGYSGDNGMAASFRVLSVSGKEAQVSVTNNGVT
FT                   RTGTGLVFNNVVMFEQSQISTTDGKTGTVIYQLGNKSYSVPVSKLTPITA"
FT   gene            complement(32922..34415)
FT                   /gene="gabD"
FT                   /locus_tag="BRADO0028"
FT   CDS_pept        complement(32922..34415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BRADO0028"
FT                   /product="Succinate-semialdehyde dehydrogenase [NADP+]
FT                   (SSDH)"
FT                   /function="1.7.31 : Aminobutyrate catabolism"
FT                   /function="1.7.32 : Putrescine catabolism"
FT                   /EC_number="1.2.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8297211; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74000"
FT                   /db_xref="GOA:A4YJC4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74000.1"
FT                   /translation="MTPPAAARASDAASSLRDRLKDPSLLREQCYIDGAWVGTPEFAVN
FT                   NPATGAELARIAQLGAAETTQAVEAAARAFPLWAKQTAKQRSNILRKWFELIIANREDL
FT                   ALILTSEQGKPLAEALGEVDIGAAYIEFFAEEARRVYGETIPTQKPDARLLALKQPIGV
FT                   CGAITPWNFPNSMITRKVSPALAAGCTVVLKPANETPLSALALAVLAERAGIPKGALNI
FT                   VTGDAPPIGKVLCEHPAVRFVGFTGSTEVGKILYRQSAGTVKKLGLELGGNAPFVVFDD
FT                   ADVDAAVEGAIVSKYRNMGQTCVCANRLYAQDGIYDAFVDKLAAKVAAMKIGEGTEAGV
FT                   TQGPLINEDAVEKVERHIADAVKGGAKIVTGGKRHALGRTFFEPTVLRDVKADALVAHE
FT                   ETFGPLAPVIRFKDEADVIAMCNASPFGLASYFYARDLGRVWRVAEALESGMVGVNTGL
FT                   ITTEVAPFGGVKESGLGREGSHHGIEEYLEIKYVMMAGV"
FT   gene            complement(34575..34895)
FT                   /locus_tag="BRADO0029"
FT   CDS_pept        complement(34575..34895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74001"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74001.1"
FT                   /translation="MISKWSEWKRYPRPGRGDNIEAPITPGIYEVRIAATGALYSFGAV
FT                   DNVAQALALLPVGQKSWFGRRDPASLPDLEYRTCATSTKADAKAAAERMIGRRETYMSG
FT                   AA"
FT   gene            35238..36431
FT                   /locus_tag="BRADO0030"
FT   CDS_pept        35238..36431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0030"
FT                   /product="putative beta-lactamase"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8491712; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74002"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74002.1"
FT                   /translation="MHNKTDIDGVLRQKADAREIPGVVAIAADSKGVIYEGAFGKRDLG
FT                   RDDAMTTDSVFWIASMTKAITCAAGMQLVEQGTLSLDAPIGDVLPDLAAPKVLDGFDAN
FT                   GEPILRPAKTAITLRHLMTHTAGFCYDMWNGDMAAYVQKAGTPGIITCKNDALKLPLAS
FT                   DPGTRWEYGINIDFVGKAVEAASGQKLDTYLRDNLFAPLGMDDTGFKLGASQRARLVGM
FT                   HARGEDGSLAPIPFEIEQEPEFHMGGGGLYGTAGDYIRFTRMILNNGRGNGHQVLKPET
FT                   VAAMRDNHIGELEMTKMAAAVPGVTNDVDLYPDIVKKWGLSFMITTAQTAEGRSAGSLA
FT                   WAGLANTYYWIDPARDVTGVILMQLLPFADRLCLETFAGFERGVYAGLDAAGGKKAA"
FT   gene            complement(36744..37745)
FT                   /locus_tag="BRADO0031"
FT   CDS_pept        complement(36744..37745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0031"
FT                   /product="putative pfkB family carbohydrate kinase;
FT                   putative Adenosine kinase"
FT                   /function="1.5.2 : Nucleotide"
FT                   /EC_number="2.7.1.20"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 14558146; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74003"
FT                   /db_xref="GOA:A4YJC7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74003.1"
FT                   /translation="MTDAKYDVLGIGNAIFDVLVQADEAFLAKHGMTKGGMALIDEARA
FT                   AAIYADMGPATEMSGGSGANTIVGLASLGARAAYVGKVKGDQIGKMYTHDIRAAGVAFE
FT                   TAPATDGPATGCSYIIVTPDGERTMNTYLGAAQNLTVADIDPAQIAAARIVYLEGYLWD
FT                   PKDAKDAFVKAATIAHDAGREVALTLSDAFCVDRYREEFLDLMRGGTVDLVFANEAELH
FT                   SLYQTSDFDGALKQLREDATLGIVTRSDKGCVVVSNDGVIAVPAHPIKTLVDTTGAGDL
FT                   FAAGFLFGLVRKTGYEIAGKLGGLAAAEVIQHIGARPQVSLKELAAQNRLKV"
FT   gene            37816..39390
FT                   /locus_tag="BRADO0032"
FT   CDS_pept        37816..39390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0032"
FT                   /product="putative Virulence factor MviN-like protein"
FT                   /function="5.13 : Virulence associated"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11274131, 9782510; Product type pf :
FT                   putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74004"
FT                   /db_xref="GOA:A4YJC8"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74004.1"
FT                   /translation="MIRSFVTVLSGTLSSRLLGFGRDALIAALLGAGPVADAFLAAFQL
FT                   VNVIRRLLTEGALNAALVPAWLRIYQSAGPNGAAAFAGRVLGTVSAGLCAASLALAVLM
FT                   PFTMTVLAPGFSGDETLTMAVNDARLMLPYLAFAGPSTVLLALSSARGRFALAAFAPLL
FT                   FNVALIAVTMVLLLQQPDPARAAVLLAATIGAAGLVQLMMLAQRGDRSRVASPVRISMD
FT                   AAMRGFFARALPGMVASAGPQLLAVGAAIIASATPSAVSWLYFANRLIELPLGLVGVAM
FT                   GTVLVPELTRALHAGNDAALSEVQSRGLELTMGLALPATLGLMILNAPIVGLLFEHGAF
FT                   GADDAAATAQVLTWLAAALPAQVLTKALQPAFFAREDTTTPLRATLIGCGVAIALAFLL
FT                   GQIFSASGIAAGLALGAWANAIVLLRRGAASFGFAISSATRRRLPRIALAAIVMAAALW
FT                   VVAAGTVRVTVGSHAGTALLLAGLIGGAIILYAALLVALGVVDWRQSLRAIRQRSARDL
FT                   PAGDLHV"
FT   gene            39398..40492
FT                   /gene="trpS"
FT                   /locus_tag="BRADO0033"
FT   CDS_pept        39398..40492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="BRADO0033"
FT                   /product="Tryptophanyl-tRNA synthetase (Tryptophan--tRNA
FT                   ligase) (TrpRS)"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.1.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8950174, 12482597; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74005"
FT                   /db_xref="GOA:A4YJC9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74005.1"
FT                   /translation="MPNDAANPSSGTATMAFVERVFSGVQPTGNLHLGNYLGAIVNFVK
FT                   MQETHNCIYCVVDMHAITMPIDVWGGPAELARNTREVTAAFIAAGIDPKKHIVFNQSQV
FT                   SGHAELAWIFNCVARIGWLNRMTQFKEKAGKDRENASVGLYDYPVLMAADILLYRATHV
FT                   PVGEDQKQHLELSRDIAQKFNNDFGDSIRAQGFGDGLFFPLPEPFITGPATRVMSLRDG
FT                   TKKMSKSDASDYSRINLTDDADTIAQKVRKAKTDPEPLPSEEKGLDTRPEADNLVGIYA
FT                   ALSDRSKADVLREFGGGQFSSFKNALVELCVTKLGPIAAEMKRLTADPGYVDSVLVDGG
FT                   ERAQAIAAETMKTAKDIVGFIRKA"
FT   gene            40714..41208
FT                   /locus_tag="BRADO0034"
FT   CDS_pept        40714..41208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0034"
FT                   /product="conserved hypothetical protein; putative
FT                   Universal stress protein family, UspA-like"
FT                   /function="5.5 : Adaptation to stress"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74006"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74006.1"
FT                   /translation="MAAQRQSYQTGHAPKCLVVVDESAEWDRAIRYAGRWAVRGGGHIV
FT                   MLHIIETEDQNQQWLGVADLMRAEAQDEANAALDEAAAMLANIGAATPERVIREGEPTT
FT                   QILATIEHDNDIALLVLAAHAGPEGPGPLVTHVIKTVGAFPIPLVIVPGDLSDADIDAL
FT                   S"
FT   gene            41317..41886
FT                   /locus_tag="BRADO0035"
FT   CDS_pept        41317..41886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0035"
FT                   /product="putative nifU protein (C-terminal fragment)"
FT                   /function="1.8.2 : Sulfur metabolism"
FT                   /function="1.8.3 : Nitrogen metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74007"
FT                   /db_xref="GOA:A4YJD1"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74007.1"
FT                   /translation="MFIQTEATPNPATLKFIPGRVVLPAGTMEFASRDAAARSPLAERL
FT                   FAVDGVTGVFYGADFITVTKSDGEWQHLKPAILGAIMEHYMSGAPLLADGSAANDASAD
FT                   EDDEFFDEADTETVGMIKDLIESRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPS
FT                   STATLQHGIQNLLKHFVPEVVEVRPM"
FT   gene            complement(42160..43842)
FT                   /locus_tag="BRADO0036"
FT   CDS_pept        complement(42160..43842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0036"
FT                   /product="Putative Methyl-accepting chemotaxis protein with
FT                   multiple PAS domains"
FT                   /function="5.3 : Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74008"
FT                   /db_xref="GOA:A4YJD2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74008.1"
FT                   /translation="MSFWSGSSASRDALAQVEAINRSQAVIEFGIDGTIITANKNFLDA
FT                   MGYALDEIKGRHHRMFVAPQLRESAEYKAFWSDLKRGKFRSGEYKRFGKGERPVWIQAS
FT                   YNPVLDGGTPVKIIKFASDITAQKMRSIEDAGKIAAIGRVQAVIEFNLDGTIIDANDQF
FT                   LGAMGYTLGEIKGRHHSMFVLPHERDSVAYKEFWASLNRGEPRSGEYKRCGKDNREVWI
FT                   LASYNPILDDTGRPFKVVKYASDVTQQKLMAADFAGQIAAIRKSQAVIEFDMNGHVLDA
FT                   NDNFLKTLGYTLADIKGRHHRMFMPPGAGESSEYREFWAALARGEFQSGEYERAGKGGR
FT                   QVWIQATYNPIKDLNGKPFKIVKFASDVTAQVITRMKGDKVRGMMEHVAAGAEQLNSSV
FT                   QQIADAMAKSKETATAAVTRVDDADQQAKRLSSAAGAMSSIVELIGSITGQINLLALNA
FT                   TIESARAGEAGRGFAVVAGEVKNLANQAKQATDRIGSEIGNLNGISSDVVGALDAIKAA
FT                   IQSVDAYVSSTAQAVGEQSAVTSEMSSNMRQAAAEAATIGKAA"
FT   gene            44094..44795
FT                   /locus_tag="BRADO0037"
FT   CDS_pept        44094..44795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0037"
FT                   /product="putative Glycoprotease family protein"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.24.57"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74009"
FT                   /db_xref="GOA:A4YJD3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74009.1"
FT                   /translation="MLILAIDTALDHCAAGVLNTDSAEMIAQDTLPMKRGHAEALMPLL
FT                   ARVMQQSGIGFPELDRIAVTTGPGSFTGLRVGLSAARGIGLAAHKPVVGVTTLSAYAAP
FT                   VVGEDRDHPVISAIDARHDHVYYQVVSGSGEALVAPQVAAIDDVLVAARFGAPHLVGNA
FT                   ASVLAERWRASDPAPVAVDVSAGPDIMWVAWLGAAADPALAPARPFYLRAPDVKPPAQA
FT                   ALDPVKTASSQ"
FT   gene            44792..45274
FT                   /locus_tag="BRADO0038"
FT   CDS_pept        44792..45274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0038"
FT                   /product="putative Ribosomal-protein-alanine
FT                   acetyltransferase, RimI-like protein"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /function="6.6 : Ribosome"
FT                   /EC_number="2.3.1.128"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74010"
FT                   /db_xref="GOA:A4YJD4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74010.1"
FT                   /translation="MNMFFRWLGRTKPSIEAATARDADRLASIHAASFHRGWGEGEFEV
FT                   MLAERNTVIHRLQLGRKLIGFIVSRIGADEAEILSVALDPNQRGRGLSRDLLLTHLGHL
FT                   AGRGVRTVFLEVEENNQPARRLYERAGFAIVGRRERYYLQPGGEQLNALLMRRDLS"
FT   gene            45318..45770
FT                   /locus_tag="BRADO0039"
FT   CDS_pept        45318..45770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0039"
FT                   /product="Ferric uptake regulation protein (Ferric uptake
FT                   regulator, Fur family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14973020, 8559079; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74011"
FT                   /db_xref="GOA:A4YJD5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74011.1"
FT                   /translation="MTSLKTTPAPNSTGIEARCAATGMRMTEQRRVIARVLAEASDHPD
FT                   VEELYRRCVAVDDKISISTVYRTVKLFEDAGIIERHDFREGRARYEQMRDSHHDHLINL
FT                   RDGKVIEFTSEEIEKLQAEIARRLGYKLVDHRLELYCVPLDEETNG"
FT   gene            45763..46482
FT                   /locus_tag="BRADO0040"
FT   CDS_pept        45763..46482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0040"
FT                   /product="putative Haloacid dehalogenase-like hydrolase;
FT                   putative Phosphatase"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7826004, 7966317; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74012"
FT                   /db_xref="GOA:A4YJD6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74012.1"
FT                   /translation="MADAAPPSPLDLVIFDCDGVLVDSEVISCQAHADVLSSCGYPITA
FT                   NQVFDRFLGRSSKQATLEVEAELGRSLPADFNARLQDRLFRAFEQDLHPVPGIVETLDA
FT                   LQLPVCVASSGSHQRMRVSLGATRLYDRLAPHIFSSSQVENGKPAPDLFLFAAAQMRAR
FT                   PAACVVVEDSLAGIRGGVAAGMTVLGFHGGSHCRPGHAESLRAAGAELVFDDMRQLPMI
FT                   LSRLAEKTGPLAGFSAV"
FT   gene            46538..47941
FT                   /locus_tag="BRADO0041"
FT   CDS_pept        46538..47941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0041"
FT                   /product="Conserved hypothetical protein; putative
FT                   MiaB-like tRNA modifying enzyme"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74013"
FT                   /db_xref="GOA:A4YJD7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74013.1"
FT                   /translation="MTPPRKLHIKSYGCQMNVYDAQRMVDTLGAEGFVETADAGDADLV
FT                   ILNTCHIREKASEKVYSELGRLRVAKEEAARSGRAMQIAVAGCVAQAEGVEIISRAPTV
FT                   DVVVGPQSYHHLPQLLAQASRGERAIETEFPAEDKFGFLAKPSREAIRARGVSAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEMSRPVARIVDDVMQLTDSGVREITLIGQNVNAYHGEGPDG
FT                   RTWTLGRLLYRIAEIPGVARIRYSTSHPNDVDDGLIAAHRDLTAVMPFVHLPVQSGSDR
FT                   ILAAMNRKHSAADYRRVVDRFRGARDDIAFSSDFIVGFPGETEEDFRATLALIDQIGYA
FT                   AAYSFKYSPRPGTPAADMQEMVSATEMDERLERLQSLIDSQQAAFNKAAIGSVVDVLFE
FT                   REARKPGQLVGRTAYLQPAHVMASSDIIGQVLPVRIDSLERYSLLGELVATTAAPIPEA
FT                   AMPLASIGG"
FT   gene            47946..48983
FT                   /locus_tag="BRADO0042"
FT   CDS_pept        47946..48983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0042"
FT                   /product="putative phosphate starvation-inducible protein,
FT                   PhoH-like protein"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8444794; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74014"
FT                   /db_xref="GOA:A4YJD8"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74014.1"
FT                   /translation="MPKSASDSSSLAPSRKFDRDMSMPPETQVVIDFDDNRAASALVGP
FT                   YGQNLALVERRLGVVVDSRGNHITIGGSRDGCDAARRVLESLYAQAIKGQDLSQGDVDG
FT                   AIRAVVAQGSLFEFDAKNGKNAFESINLRKRPVRARTAAQDSYIRALKRHELVFGIGPA
FT                   GTGKTWLAVAHAAQLFERKEVDRIILSRPAVEAGERLGFLPGDLREKVDPYLRPIYDAL
FT                   YDLMDARVVERALQANEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGEN
FT                   SRMIITGDPSQVDLPNGQTSGLAEAARLLDGVEGIAQVRFTGEDVIRHELVARIVAAYE
FT                   GPQAR"
FT   gene            49011..49553
FT                   /locus_tag="BRADO0043"
FT   CDS_pept        49011..49553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0043"
FT                   /product="conserved hypothetical protein; putative
FT                   metal-dependent hydrolase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74015"
FT                   /db_xref="GOA:A4YJD9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74015.1"
FT                   /translation="MPAPFAQNSTRMPQSPIPITEVIVAADCWQDQPDAEDVIQRAIIA
FT                   AAEMVDADVGDAEIAVMLTDDGGIRTLNSNWRGIDKPTNVLSFPALQPTGPRGDEDAPR
FT                   MLGDIAIAYETMRREADEEQKPFAHHLSHLTVHGFLHLIGYDHETDDEAEEMEALETEI
FT                   LAHLGIPDPYADRERMH"
FT   gene            49550..50749
FT                   /locus_tag="BRADO0044"
FT   CDS_pept        49550..50749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0044"
FT                   /product="putative transporter with CBS domain; putative
FT                   Magnesium and cobalt efflux protein corC"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74016"
FT                   /db_xref="GOA:A4YJE0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74016.1"
FT                   /translation="MTMADSEPIHDNPRQTRNLPAVVPPSELGRSPSENWLLRALRNLF
FT                   GWKGGGSVRDDLQVVLDASTPDDIGFSAVERTLLRNILDLHERRIADVMVHRADIVAVR
FT                   RDITLGELMSLFESASHSRLVVYNDTLDDPEGMVHIRDLLAYMTAQARVSDDAKARRKK
FT                   PLPAGLDLKSVELSMPLFEANIIRKLLYVPPSMRAIDLLAQMQASRIHLALVVDEYGGT
FT                   DGLVSIEDIVEQIVGEIDDEHDSDEPPAIMRQADNAFIADARASLEDVRRVIGEEFVTG
FT                   EAGEGVETLGGYLVNHVGRLPVRGELISGPGNFEVEVLDADPRRVKRLRIAPRKERPTP
FT                   RPPRESRRREAAPETAPETTPETTSESGTAAEPPRPVETGPASGHDDSSPPQGDGASSQ
FT                   "
FT   gene            50746..52356
FT                   /gene="cutE"
FT                   /locus_tag="BRADO0045"
FT   CDS_pept        50746..52356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="BRADO0045"
FT                   /product="Apolipoprotein N-acyltransferase (ALP
FT                   N-acyltransferase)"
FT                   /function="1.6.10 : Lipoprotein"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8344936; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74017"
FT                   /db_xref="GOA:A4YJE1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74017.1"
FT                   /translation="MIRLSMIRGLVLGIVLAWGWKRAAIALAAGAVSSLAMAPFNAWPV
FT                   LAVTFPVLVWLIDGAAAGRRRGIPAAALTGFCFGMGYFVPGLYWIGNAFLVDADTFAWL
FT                   MPFAVLGLPAYLALFPALGFALARLLWTRDATRILALAVCLTASEWLRGHALTGFPWNT
FT                   FGYALSQPLALAQAASLVGIWGMTFVTIAVFASPAVLIDGKTWREGWRAPAAAAAGLVL
FT                   LGVFGAVRLGQHPTAFVPDLKLRIMQPNLQQDVKFNYGAKADVMRRYLALSDRASGPKS
FT                   TGVRDTDVLIWPESAFPFFLTREADAMGQIADLLPAGTVLITGSVRAPDGPRTGPITRA
FT                   YNSIYVIDHDGTVLSVYDKLHLVPFGEFLPFQNLLERIGLEQLTRVQGGFIPGTIRRNL
FT                   DVPHAPRVLPLICYEAIFPTDSAANDDRPGWIVNLTNDGWFGVSTGPHQHLQQAQWRAI
FT                   EQGLPLVRSANTGISAVIDPVGRIISQLSLGTEGVLDAMLPVALQPTIYARFGDIPAAI
FT                   LLVLALSTVVRRRVAQKLP"
FT   gene            52589..53011
FT                   /locus_tag="BRADO0046"
FT   CDS_pept        52589..53011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0046"
FT                   /product="conserved hypothetical protein; putative
FT                   transcriptional regulatory protein HTH type"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74018"
FT                   /db_xref="GOA:A4YJE2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74018.1"
FT                   /translation="MSTKAPNPVDKHVGSRVRMRRIMLGMSQEKLGEALGLTFQQIQKY
FT                   EKGTNRVGASRIQQISEVLQVPVSFLFEGVPSGGTNGEAFGEGASPAYVSDFLATSEGL
FT                   ALTRAFTRIHDSKLRRSIVDLVEQIADREAPEEGEG"
FT   gene            53336..54466
FT                   /locus_tag="BRADO0047"
FT   CDS_pept        53336..54466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0047"
FT                   /product="putative peptidase M20 family; putative
FT                   carboxypeptidase G2 (Glutamate carboxypeptidase)"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 3838935; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74019"
FT                   /db_xref="GOA:A4YJE3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74019.1"
FT                   /translation="MTAINNTFDSRTILEGIRQWVEIETPTEAPDKVNELASVVAAGYR
FT                   GLDAKVERIPGRNGCGDHLVARSSWGQEEPGILVLSHLDTVHPIGFIQRLPFSIDGDVA
FT                   YGPGIYDMKGGAYLAYHAFRQICADGQRSPLGITHLFVSDEEIGSPTSRALIEEEGRKA
FT                   KYVLVTEPARDGGKIVTGRKGVARFDVSIRGVPAHAGARPQDGRSAIRELANVIHALEA
FT                   LNDPARGITVNVGVVRGGTRPNVIAEEAHAEVDARLPTPGDADEIVPKILGLKSRSEGV
FT                   TVEVKGEVNRPPYVKGNAGAALFEHARTLAEELGFDLVDTYTGGGSDGNFTAPFTATLD
FT                   GLGVDGKGAHTHYEQMYISSIEPRARLLHRLYQTLR"
FT   gene            54463..55194
FT                   /gene="trmB"
FT                   /locus_tag="BRADO0048"
FT   CDS_pept        54463..55194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="BRADO0048"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase
FT                   (tRNA(m7G46)-methyltransferase)"
FT                   /EC_number="2.1.1.33"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15789416; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74020"
FT                   /db_xref="GOA:A4YJE4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74020.1"
FT                   /translation="MSLAMMPIDDDHTGDGALHGQGSFFGRRKGHKLRTHQADLVENLL
FT                   PHLALDLSAPADVVLPTLYDPPVDALRLEIGFGGGEHLAAEAKAYPTTGFIGCEPYVNG
FT                   MAKILSAIEADDIGNIRLLAGDAAELLAWLPPQSLQRIDLIHPDPWPKRRHWKRRFVQG
FT                   ATIAAMARVLKPGGEFRFVSDIADYCAWTLWHMLRAPDFVWTAERADDWRLPWPGYTMT
FT                   RYGRKATREGRVANYLIFSRR"
FT   gene            complement(55212..56288)
FT                   /locus_tag="BRADO0049"
FT   CDS_pept        complement(55212..56288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74021"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74021.1"
FT                   /translation="MTPATALIPGLDGIVKHGDEERCVEATRRIADLLFEDVTRLRPEH
FT                   INLFDGLLTDLLPFADVSTRVDLAERLSYLAKAPRVVVGRLAHDDEVAVASPLLRRSPV
FT                   LDDRVLIEIAQSKSQGHLLAMAERPALSVEMTDVLVRRGDRDVVRRAAANDGATFSDRG
FT                   YSELINRAGFDGVLTLTVGKRNDLSDDHLKQLLAGSLDVIRRRLFDVVRPEKQARIRQA
FT                   LAELDDTQGATASKRNFVPAQRTILALYEDGALDEAALIGFASAHKYEETVAALAAMTG
FT                   LKIATLDRLISGDRHDPLLILGRTIGLDWRTVQALIQLRLGPRRVPAQRDLDALRVNYA
FT                   RLLSSTAERVVAFWKTRH"
FT   gene            56773..57474
FT                   /locus_tag="BRADO0050"
FT   CDS_pept        56773..57474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0050"
FT                   /product="conserved hypothetical protein; putative
FT                   YhbC-like protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74022"
FT                   /db_xref="GOA:A4YJE6"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74022.1"
FT                   /translation="MEPGVAARVAAVADPVLQGMGYRLVRIRISGESGCTVQVMAERPD
FT                   GTMQIEDCEAVSRALSPVLDIADPIDRAYRLEISSPGIDRPLVRRSDFERHVGHLVKIE
FT                   MAVAYQNRKRFRGIIKGVEGDGVRITRDDVAKDADPDVVLPMADIGDAKMVLTDELIAE
FT                   SMRRGKAAEREKKRDLGLAPPLAPHAKPAAQAKPKPKAKDGKPAKKPLPTDTKKHRLAA
FT                   DRARRGEIDPD"
FT   gene            57489..59096
FT                   /gene="nusA"
FT                   /locus_tag="BRADO0051"
FT   CDS_pept        57489..59096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BRADO0051"
FT                   /product="Transcription elongation protein nusA (N
FT                   utilization substance protein A) (L factor)"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6326058, 15720542, 12213659, 16193062; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74023"
FT                   /db_xref="GOA:A4YJE7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74023.1"
FT                   /translation="MAVSANRLELLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYG
FT                   SETDVHAEIDPRKGELRLSRHMLVVEKVENPSNQISLDDARRANPGAQIGDTIADTLPP
FT                   LEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVILDLGRGE
FT                   AIIRRDEMLPREVFRNGDRVRAYVFDVRRETRGPQIFLSRTHPQFMAKLFAQEVPEIYD
FT                   GIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWS
FT                   PDIATFVVNALAPAEVAKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGW
FT                   DIDILTEQEESERRQADFENSTRVFMESLNVDEVVGQLLASEGFTSVEELALVDLKDLA
FT                   SIEGFDEETATELQTRAREFLEQQEAELEAKRKELGVEDALKDVPGVTSKMLVKFGEND
FT                   IKTVDDLAGCATDDLVGWVERKDGGEQTKFAGILDGLDVSRDDAEAMVMQARVKAGWIT
FT                   EADLAKGEAEDEAEGQPA"
FT   gene            59166..59909
FT                   /locus_tag="BRADO0052"
FT   CDS_pept        59166..59909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0052"
FT                   /product="conserved hypothetical protein; putative
FT                   RNA-binding protein; putative nucleic-acid-binding protein
FT                   implicated in transcription termination"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11679764, 8491709"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74024"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74024.1"
FT                   /translation="MLALADPELDNGPRTDKSATMRMCVVSREVRPIGELIRFVVGPSG
FT                   DVVPDIKRKLPGRGLWIAASKPAVAEAVRRHHFSRGFKTNVRVHPTLADDLEALLARSA
FT                   IEALGIAAKAGQVISGFSKVEAALSQRQTRVGLAALIHAADGAADGIRKLDALVRPTDG
FT                   DQRQAPPIPIICCLTSAELDLALGRSNVIHAAVLAGPASRTFLSRSQTLVRYRSADADK
FT                   IAGTAATTSASTSTSSTSPVATSKT"
FT   gene            59989..62754
FT                   /gene="infB"
FT                   /locus_tag="BRADO0053"
FT   CDS_pept        59989..62754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="BRADO0053"
FT                   /product="Translation initiation factor IF-2"
FT                   /function="2.3.2 : Translation"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12559921, 11114918, 10555334, 9428651; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74025"
FT                   /db_xref="GOA:A4YJE9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74025.1"
FT                   /translation="MADQNTPGDKKLGVPSKTLTLKPRVETGTVRQSFPHGRSKQVVVE
FT                   KRGTKRRVGDGAPDAPHAPEPTVAKAPPPPPPSNRPSGPRPSGGQQRGGSGVVLRTLTE
FT                   DERSARASALADARVRDLEERRQAEEEARRRAEREAAERAEREAAEARRKAEEERHRHE
FT                   EEAKRKAELEAKKRFGEGEAPRPAAAAPQPTVSAPARPAQAPGRPQGAPGSRPQQIGGP
FT                   SSRPGGSQPGGARPAGPRPAGGGPLGRAPAAVAAGPDEDEGPRQIRRGPGGAARPAPPP
FT                   KTTHKPGPQKQRGRLTVVTALNADDVRERSIASFRRRTQRLKGHAANEQKEKLVREVTI
FT                   PEAITIQELANRMSERAVDVIRLLMRQGAMHKITDVIDADTAQLIAEELGHTVKRVAAS
FT                   DVEEGLFDVVDDSTDTEPRSPVVTVMGHVDHGKTSLLDALRHANVVSGEAGGITQHIGA
FT                   YQVTAPDSGKKITFIDTPGHAAFTAMRARGAKVTDIVVLVVAADDGVMPQTIEAINHAK
FT                   AAKVPMIVAINKIDKPDARPERVRTELLQHEVQVESLGGDVVDVEVSAKNKTNLDRLLE
FT                   MIALQADILDLKTNSDRPAEGTVIEAKLDRGRGPVATVLVQRGTLRVGDIIVAGAEMGR
FT                   VRALISDQGETLQEAGPSVPVEVLGFNGPPEAGDRLAVVENEARARQVTSYRAHQKREN
FT                   AAASISGMRGSLEQMMSQLKTAGRKEFPLVIKADVQGSLEAILGSLEKLGTEEVAARIL
FT                   HAGVGGISESDVTLAEGFNAAIIGFSVRANKEAAALAKRNGIEIRYYNIIYDLVDDVKK
FT                   AMSGLLAPTLRETMLGNAQILEVFNISKVGKVAGCRVTDGTVERGANVRLIRDNVVVHE
FT                   GKLSTLKRFKDEVKDVQAGQECGMAFENYGDMRVGDVIECYRVETIQRSL"
FT   gene            62918..63334
FT                   /gene="rbfA"
FT                   /locus_tag="BRADO0054"
FT   CDS_pept        62918..63334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BRADO0054"
FT                   /product="Ribosome-binding factor A"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15692745, 12963368, 9422595; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74026"
FT                   /db_xref="GOA:A4YJF0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74026.1"
FT                   /translation="MPRHHQRGSAASGGSQRQLRVAETVRHAVADILSQGSAHDPDLEG
FT                   HIITVPEVRMSPDLKLATIYIMPLGGRDTDVVLAALERNKKFLRGEVARRVNLKFAPDI
FT                   RFRVDERFDEAERIEKLLRTPAVQRDLNSDLEES"
FT   gene            63334..64431
FT                   /gene="truB"
FT                   /locus_tag="BRADO0055"
FT   CDS_pept        63334..64431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="BRADO0055"
FT                   /product="tRNA pseudouridine synthase B (tRNA pseudouridine
FT                   55 synthase) (Psi55 synthase) (tRNA-uridine isomerase)
FT                   (tRNA pseudouridylate synthase)"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="7.1 : Cytoplasm"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="5.4.99.-"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12499554, 14566049; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74027"
FT                   /db_xref="GOA:A4YJF1"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74027.1"
FT                   /translation="MTIPPETGAVDALSIVPKAVNVQKNSSDARPPRDNNDPRNKQQRG
FT                   NQPRRDRRDVHGWVVLDKPIGMTSTQAVAVAKRLFQAKRAGHAGTLDPLASGGLPIALG
FT                   EATKTVPFVMDGRKRYRFTVTWGAERDTDDTEGRVVETSENRPDVAAIRALLPQFTGRI
FT                   EQTPPRYSAIKIQGERAYDLARDGEVVELQPRPVEIHELTLVDQPDADHSVFEAECGKG
FT                   TYVRALARDMGRLLGCYGHISALRRTLVGPFTENDMIPLEQLEALCNRAASGEGSLADA
FT                   LLPVETALDDIPALAVTRADAARLHRGQAVLLRGRDAPQSSGTVYVTVAGRLLALAEIG
FT                   NGELIPKRVFNLTGLTASSGRNERD"
FT   gene            64434..64703
FT                   /gene="rpsO"
FT                   /locus_tag="BRADO0056"
FT   CDS_pept        64434..64703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BRADO0056"
FT                   /product="30S ribosomal subunit protein S15"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1764513, 6806564; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74028"
FT                   /db_xref="GOA:A4YJF2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74028.1"
FT                   /translation="MSITAERKAEIIKANATKAGDTGSPEVQVAILSERINNLTGHFKT
FT                   HGKDNHSRRGLLKLVSTRRSLLDYLKKNDEARYKALLEKHNIRR"
FT   gene            65060..67219
FT                   /gene="pnp"
FT                   /locus_tag="BRADO0057"
FT   CDS_pept        65060..67219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="BRADO0057"
FT                   /product="Polyribonucleotide nucleotidyltransferase
FT                   (Polynucleotide phosphorylase) (PNPase)"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.4 : RNA degradation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.7.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2432069, 8825779; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74029"
FT                   /db_xref="GOA:A4YJF3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74029.1"
FT                   /translation="MFTKHSVEIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVV
FT                   AAKAPRDGVDFLPLTVDYQEKAYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFV
FT                   DSWRNETQVIVTVLSHDMENDPDIVALVAASAALTLSGVPFKGPIGAARVGFANDEYIL
FT                   NPTLDEMADTQLDLVVAGTSDAVLMVESEAKELNEDIMLGAVMFGHRHFQPVINAIIEL
FT                   AEKAAKDPRDVAIIDNSAIEKEMLGIAEQDLRKAYAIAIKQERYAAVGAVKEKVMAYFF
FT                   PEGQEPKYDKLRVAAVFKELEAKIVRWNILDTGKRIDGRDAKTVRNIVCEVGVLPRAHG
FT                   SALFTRGETQALVVTTLGTGEDEQYIDALSGTYKETFLLHYNFPPYSVGETGRLGGTKR
FT                   REIGHGKLAWRAIHPVLPPHHEFPYTTRVVSEVTESNGSSSMATVCGSSLALMDAGVPL
FT                   KRPTAGIAMGLILEGSRFAVLSDILGDEDHLGDMDFKVAGTESGITSLQMDIKIEGITE
FT                   EIMRVALGQAREGRIHILGEMSKALTAARAELGEYAPRIETFKIATDKIREVIGTGGKV
FT                   IREIVEKTGAKVNIEDDGTVKVASSDGEAMKAAIKWIKSIASDPEVGQIYDGTVVKVME
FT                   FGAFVNFFGTRDGLVHISQLADKRVQKTTDVVKEGDKVKVKLLGFDDRGKTRLSMKVVD
FT                   QTTGEDLEAKQKDAPAEAPREAAGE"
FT   gene            67425..67892
FT                   /locus_tag="BRADO0058"
FT   CDS_pept        67425..67892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0058"
FT                   /product="conserved hypothetical protein; Putative
FT                   Acetyltransferase, GNAT family"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74030"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74030.1"
FT                   /translation="MLEPIIRPAHPDEYDAIAKLWMESWCSTGLESPSETLLGILQARV
FT                   PREVAGGWSLYVADDSGTLAAMLAINLPKLYLDQLMIAPAYQGRSLGRRLLAFTRGALP
FT                   DEIWLRCAEGNERAWRWYEREGFVPEKTEADPVHGRMMKYYRWKRESQTQS"
FT   gene            68024..68848
FT                   /locus_tag="BRADO0059"
FT   CDS_pept        68024..68848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0059"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74031"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74031.1"
FT                   /translation="MPIRRLAVTALALALFQLSVTPTNVLAQSAPSTAATKAAPRAGAA
FT                   TAKSGRPATTTRESGPCDTGLISAVGDVFAVQDSGIASLGGDFKQVPVAWGFDDLIYAR
FT                   AKAAGGDNVRRIAVPKGAFDPLYQSQSAPEANDIFPAIVKKVAGSAGCARYLVVLRASG
FT                   REPSTYDTVSGIGVVSRVAGLVRYTHVFVMIGLQLFDGTTFEKLKPPPSSKTFMSRLTS
FT                   GMGPPSHAGDVDNSAFPAKPEDAASNTVLRDMARSMLRFRLDQALPDYFARE"
FT   gene            complement(68882..70864)
FT                   /locus_tag="BRADO0060"
FT   CDS_pept        complement(68882..70864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0060"
FT                   /product="conserved hypothetical protein; putative Outer
FT                   membrane protein; Putative autotransporter domain protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74032"
FT                   /db_xref="GOA:A4YJF6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74032.1"
FT                   /translation="MMLRSRTCIVALCATSAVWCVGAAPVRAQSTVWDATISNTNWYVP
FT                   TAQLLAYMSPKTGFTNPIPIGDQTLWTLGTATNGSFTGTSVAQLRIGPALLTDTSTIQG
FT                   FVTTSGQITMLFTPTGGGTVTVGLGTMRLVNGVTSMEMQMITGDTLLVTHWAYMLPYDP
FT                   ATFTPPPSAPVPANSVPQWAWTAGTPWRIVSPALFGTQAPGRFVITNYQNGYFWGAGIA
FT                   PAGSAAGGFTLLGSVTPEGRVLFNTLSRGSLTSLYGTASGSASGAQMIASMYDLAGNMT
FT                   GDLATMSLVQPYGDTLRAAGGRVGLEAADALYRLSMTSAGCSGGMASGFAALDNLSGPS
FT                   LGNAIKQTLPVLTGAASQATYVTQRDFRQTMTNRLDDMASMRIAAGQHVWMQPLGGTAQ
FT                   QSARDGVPGYNASGGGLAFGADAPLSPGAVIGGVAAYSRQTISGSDDAVPNRLTVSSYQ
FT                   LGLYGAYAVSPGLLLDYQLDGGTSDNGESRSLGFMSATAAGSYRSYAGHVGVGVKTRIA
FT                   LQDKLSLIPSLRLDYGAVRSNAYRENGADGFSLNVETQRYQELTATAGLKAVYAIAKQV
FT                   RLSGEVGVGYNALNQRLQIGAAFSGGGDSFTTNGLALSPWIYSAGLGLIAARSDRLDLS
FT                   IRYGVSATSSGLVEQSGHAVLKVRL"
FT   gene            complement(71097..71903)
FT                   /gene="fabI"
FT                   /locus_tag="BRADO0061"
FT   CDS_pept        complement(71097..71903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="BRADO0061"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase [NADH]
FT                   (NADH-dependent enoyl-ACP reductase)"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="1.3.1.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10464225, 10094701; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74033"
FT                   /db_xref="GOA:A4YJF7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74033.1"
FT                   /translation="MSMQGLMAGKRGLVMGIANDHSIAWGIAKTLAAHGAEMAFTYQGD
FT                   ALGKRVRPLADELGVKHVLPCDVEDIASVDGVFTSLREAWGGLDFIVHAVAFSDKNELK
FT                   GRYADTSRENFSRTMLISCFSFTEIAKRAAELMPESGGSMITLTFDGSNRVMPNYNVMG
FT                   VAKAALEASVRYLAADYGRRAIRVNAISAGPVRTLAGSGIGDARFMFAFQQKHSPLGRG
FT                   ITLEELGGSALYLLSDLSGGVTGEIHYVDSGYNVISMPRPEDLKAE"
FT   gene            complement(72036..73259)
FT                   /gene="fabB"
FT                   /locus_tag="BRADO0062"
FT   CDS_pept        complement(72036..73259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="BRADO0062"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I
FT                   (Beta-ketoacyl-ACP synthase I) (KAS I)"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.3.1.41"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3076377, 10571059; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74034"
FT                   /db_xref="GOA:A4YJF8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74034.1"
FT                   /translation="MRRVVITGMGIVSSIGNNTQEVLASLYEAKSGISRAEKYAELGFR
FT                   SQVQGAPTLNPAEVVDRRAMRFLGEGAAWNHVAMEQAILDSGLEPTDVSNVRTGIIMGS
FT                   GGPSTRTLVEAADITRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYEMIQYGKQDVMFAGGCEELDWTLSVLFDAMGAMSSKHNETPATASRPYDV
FT                   SRDGFVIAGGAGVLVLEELERAKARGAKIYGEIVGYGATSDGYDMVAPSGEGAERCMQM
FT                   ALSTVKTRIDYINPHATSTPAGDPPEIEAIRKVFGSGEKCPPIAATKALTGHSLGATGV
FT                   QEAIYSLLMMKNGFICESANITELDPVFADMPIVRRRIDNAKLGTVLSNSFGFGGTNAT
FT                   LVFKHLDA"
FT   gene            complement(73336..73857)
FT                   /gene="fabA"
FT                   /locus_tag="BRADO0063"
FT   CDS_pept        complement(73336..73857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="BRADO0063"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase (Beta-hydroxydecanoyl thioester dehydrase)"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="4.2.1.60"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7881463, 2832401; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74035"
FT                   /db_xref="GOA:A4YJF9"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74035.1"
FT                   /translation="MLDRRGSYEYEDLLACGRGELFGPGNAQLPLPPMLMFDRIVEISE
FT                   TGGEFGKGVVRAELDVKPDLWFFGCHFKNDPVMPGCLGLDAMWQMVGFFLGWTGGAGRG
FT                   RALGLGDLKFSGQVLPTASKVVYNVDIKRVMRSKLVLGIADGWLSMDGDIIYRAKDLKV
FT                   GLFKQGAAPS"
FT   gene            74366..74749
FT                   /locus_tag="BRADO0064"
FT   CDS_pept        74366..74749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0064"
FT                   /product="putative ferric uptake regulation protein, FUR
FT                   family."
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74036"
FT                   /db_xref="GOA:A4YJG0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74036.1"
FT                   /translation="MLQTAGLRPTRQRMALGWLLFGKGARHLTAEMLYEEATLAKVPVS
FT                   LATVYNTLNQLTDAGLLRQVSVDGTKTYFDTNVTAHHHFYLENNHELVDIPDQHLALSK
FT                   LPEAPEGYEIARIDMVVRLRKKR"
FT   gene            complement(74857..75378)
FT                   /locus_tag="BRADO0065"
FT   CDS_pept        complement(74857..75378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0065"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74037"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74037.1"
FT                   /translation="MALGRFGAVAVLVVCLLDMIGSAAAKDSVLTTSGLPVPRYVSLKS
FT                   DHVNVRAGPTKDNDVAWVYTRSGLPVEITAEYENWRRVRDSEGSEGWVYHSLLSGRRTA
FT                   VVTMKNKDDLAPIYESADATSAVTARLQAGVVAQVKKCGNGWCRVLGNGFEGWIQQQRL
FT                   WGVYADEQVN"
FT   gene            75734..76735
FT                   /locus_tag="BRADO0066"
FT   CDS_pept        75734..76735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0066"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenases family protein; putative Glyoxylate
FT                   reductase (Glycolate reductase)"
FT                   /function="1.1.1.2 : 2,5-ketogluconate metabolism"
FT                   /function="1.7.21 : Glyoxylate degradation"
FT                   /EC_number="1.1.1.26"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11532010; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74038"
FT                   /db_xref="GOA:A4YJG2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74038.1"
FT                   /translation="MSGRKKPLVVVTRKLPDSVETRMRELFDARLNLDDEPMSQEQLAD
FT                   AVRTAEVLVPTVTDHISADILNQPDCKLRMIANFGNGVDNIDVAAAVARGITVTNTPKV
FT                   LTEDTADMTMALILAVPRRLIEGASVLTEGKNWAGWSPTWMLGHRIGGKRLGIIGMGRI
FT                   GQAVARRARAFGLQIHYHNRRPVAPVIADELGATYWESLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLIRKDAYIVNTARGEVIDEETMTRLIEAGDIAGAGLDVFEHEPAVNPRL
FT                   VRLAKAGKVTLLPHMGSATIEGRVEMGEKVIINIKTFLDNHRPPDRVLPSML"
FT   gene            complement(76847..77791)
FT                   /locus_tag="BRADO0067"
FT   CDS_pept        complement(76847..77791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0067"
FT                   /product="putative transcriptional regulatory protein, LysR
FT                   family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74039"
FT                   /db_xref="GOA:A4YJG3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74039.1"
FT                   /translation="MSDPDLRDLQAFVAVARTGNFRRAAREQGVAVSSLSQRLKELEQR
FT                   LGLRLLNRTTRSLGLTQAGEALLARLEPALLEIEAAIDQVRGQQQVAAGRLRINAPPPA
FT                   VDLVLAPMVAPFLAAYPRVELEIAAESGFVDIVQAGFDAGVRYGEHLAQDMIAVPLGEP
FT                   QRYAIVASPEHVERHGRPSHPRDLLQHACIRARLSSGAMLDWEFEKDGQVIRIAPPPKL
FT                   IAVQLGLAFRAACDGVGYWMAFEGHVRQALADGRLVSVLDDWCPPFRGPYLYYPSRRQP
FT                   PPALAAFVAFVGEWRRRAGASQSAVVPASSRDP"
FT   gene            77907..78911
FT                   /locus_tag="BRADO0068"
FT   CDS_pept        77907..78911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0068"
FT                   /product="putative oxidoreductase, aldo/keto reductase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74040"
FT                   /db_xref="GOA:A4YJG4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74040.1"
FT                   /translation="METRQLGKAGPMVSALGLGCMGMSDFYGPNDRAESIATIHAALDA
FT                   GIMLIDTGDFYGMGHNEMLIREALASAGPRNVQISVKFGALRGPDKSWLGYDSRPEAVR
FT                   TFLSYSLQRLGVDAIDIYRPARLDPNVPIEDTIGAMAELKQAGFIRHIGLSEVGSETIR
FT                   RAHKVHPISDLQIEYSLISRGIESDILKTCRELGIGITAYGVLSRGLISGHWSKDRGGV
FT                   SDFRGHSPRFQGDNLDRNLGLVETLRSIAADVGATPAQVAIAWVAAQGNDIVPLVGARR
FT                   RDRLDEALGALCVKLTEVQLAALDKAFPPGVAAGERYPESQLVHMDSERAKGE"
FT   gene            complement(79118..79921)
FT                   /locus_tag="BRADO0069"
FT   CDS_pept        complement(79118..79921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0069"
FT                   /product="putative Molybdopterin biosynthesis protein moeB"
FT                   /function="1.5.3.4 : Molybdenum (molybdopterin)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74041"
FT                   /db_xref="GOA:A4YJG5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74041.1"
FT                   /translation="MLSDEELERYARHIVLRDVGGPGQAALKRASVLVIGAGGLGAPAL
FT                   MYLAAAGVGTIGVVDDDVVSLSNLQRQVIHATPDIGRPKVDSAAERINALNPHVGVVAH
FT                   RTWLNADNALDLIGGYDLVLDGSDNFDTRYLVSDACFLAGKPLITGALGTFDASLTTIR
FT                   AHERNDKGAFNPTYRCLFPEPPPPGTVPACAEAGVMGALAGMLGSMMALEAIREIVGFG
FT                   EGLVGRLLMLDARTMRFETLRYGRDPANPLNGDGPVIADLSAHRK"
FT   gene            80061..81428
FT                   /locus_tag="BRADO0070"
FT   CDS_pept        80061..81428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0070"
FT                   /product="conserved hypothetical protein; Putative signal
FT                   peptide; putative Peptidoglycan binding domain protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74042"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74042.1"
FT                   /translation="MRRLATATFICAIAASVPSHAQTPPTQGVLPGAKPKPVTTQPVRP
FT                   GVQAPADTANEMSQTERLALQSDLAWVGQYNGAITGDVSERMVNAIKEYQKLKGGKPTG
FT                   VLNPQERAVLADTARRKQEGVGWKLVTEPTSGARLGIPTKLMPQQTTDANGSKWTSPTG
FT                   TVQVVLSRRKEANPTTAALADREKKEPGRTVDYSVVKPDFFVLSGLQNLKKFYIRGTFK
FT                   GDEVRILTILYDQATENTVEPVVIAMSSAFTAFPAATLAAQPAPRRSVDYGTGIIVSAD
FT                   GAIVADREVTEACVAITIPGFGPAERIADDKERGLALLRIYGGRGLKPLALSGGTARSS
FT                   VDIVGIADPQSQGGGAAISMVKAQLAGNGSGDMSLAPAPGLGFSGAATLDGDGRFVGVT
FT                   LLKPGVLAGSAFVPSSQVVMVSADTTRAFLAANGVKPDGTSTDAKAATVRVICVRK"
FT   gene            81858..82661
FT                   /locus_tag="BRADO0071"
FT   CDS_pept        81858..82661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0071"
FT                   /product="conserved hypothetical protein; putative ATPase;
FT                   putative ParA family partition protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74043"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74043.1"
FT                   /translation="MYTIVLATQKGGSGKSTLAIGLAVAAQQAGHKVRVIETDRQGTLT
FT                   KWQARRAAGEPIVEAVYDAKMIEPRLEALQRDGVTVCVIDTGAGITASTTAAIRYCDLC
FT                   LIPARPSVADIEATAPTLSVIRAWRKPFAFVLNQAPIRGGHRITDATTALDADAPRDIA
FT                   EVLAQPFIMMRNDHQDALAAGLGVSEFDASGKSAQEIKSLWRWTYGKLAGDHVMHEAGE
FT                   LKEASEHAEVEFPIMLTPQPEEPKLPVTRAYPTWADNGINWKAGL"
FT   gene            complement(82971..83453)
FT                   /locus_tag="BRADO0073"
FT   CDS_pept        complement(82971..83453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0073"
FT                   /product="Conserved Hypothetical protein; putative
FT                   cAMP-binding protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74044"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74044.1"
FT                   /translation="MAVSSPDLKAFLLATPFFGGLSDASLDLLISMLGVREFERGAVIV
FT                   AEGEAGRSMFVVHSGTLEVSERLESGGAIHMSSLQPGDFFGEMTLLEMQNRSATVIAET
FT                   PALLYELTAQQLYAFYKADIRAYVIVMQNINRELCRRLRRADARIKMLEMREAGAR"
FT   gene            complement(83514..84395)
FT                   /gene="mutM"
FT                   /locus_tag="BRADO0074"
FT   CDS_pept        complement(83514..84395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="BRADO0074"
FT                   /product="Bifunctional mutM protein:Formamidopyrimidine-DNA
FT                   glycosylase (Fapy-DNA glycosylase); (DNA-(apurinic or
FT                   apyrimidinic site) lyase mutM) (AP lyase mutM)"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11892789, 15102448, 10921868, 12065399; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74045"
FT                   /db_xref="GOA:A4YJG9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74045.1"
FT                   /translation="MPELPEVETVRRGLQPVMEGAKIVTAEARRGDLRFPFQPDFVKRL
FT                   QGQTVRGLGRRAKYLLADLGSGDVLLMHLGMSGSFRVIKPEHEETPGEFHYPRGKDSVH
FT                   DHVVFHMSSGADIVFNDPRRFGFMKIIGRGEIETEPHLKDLGPEPLGNEFDAAMLARAC
FT                   AGKKTSLKAALLDQRVVAGLGNIYVCEALFRAHLSPRRLAATLATRKGEPTDHAKRLVE
FT                   AIHTVLNEAIRAGGSSLRDHRQTTGELGYFQHSFQVYDREGEPCRTDGCEGVVKRFVQN
FT                   GRSTFWCPKCQR"
FT   gene            84502..85263
FT                   /gene="ubiE"
FT                   /locus_tag="BRADO0075"
FT   CDS_pept        84502..85263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="BRADO0075"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase ubiE"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9045837, 365223; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74046"
FT                   /db_xref="GOA:A4YJH0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74046.1"
FT                   /translation="MDQTDQTTHFGFRDVPLGEKQTLVNDVFHSVASRYDLMNDLMSGG
FT                   LHRVWKDIMINTLNPPKSDAPFALLDVAGGTGDISFRAAKKAGAGFHATVCDINGDMLE
FT                   VGRQRALKQYLDDRVSFVEGNAESLAFPDRSFDAYTIAFGIRNVPQIDLALAEAYRVLK
FT                   HGGRFLCLEFSTVEVPGLDKLYDLFSFNVIPQLGRAVTGDAESYRYLVESIRQFPRPNA
FT                   FAEMISAAGFSRVSWQTLSGGIVALHSGWRL"
FT   gene            85260..86834
FT                   /gene="ubiB"
FT                   /locus_tag="BRADO0076"
FT   CDS_pept        85260..86834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="BRADO0076"
FT                   /product="Ubiquinone biosynthesis protein ubiB"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10960098, 10802164, 365223; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74047"
FT                   /db_xref="GOA:A4YJH1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74047.1"
FT                   /translation="MISALTHITRLARAALVFAREGVFGVVDPSLAPPPGQIALKLARL
FT                   VERPGAKSGPRLSRALERMGPAYLKLGQFLATRPDVVGVVMARDLESLQDRLPPFPQAE
FT                   AEAVIATALERPISQLYTSLGPPVAAASIAQVHRGEVERDGIRHAVAVKVLRPNVAARF
FT                   RRDLADFFFVAEKAEAHSAEARRLRLVEVINTMSRSVAMEMDLRLEAAALSEMAENIKD
FT                   DPDFRVPAVDWDRTANNVLTMEWIDGIALNDHARLAQANVDLPDVGRKVIQSFLRHALR
FT                   DGFFHADMHPGNLFLDKQGRLVAVDFGIMGRLGMKERRFLAEILLGFITRDYRRVAEVH
FT                   FEAGYVPPHHSVENFAQAIRAIGEPIHNRTAEEISMAKLLTLLLEVTGLFDMRTRPELI
FT                   LLQKTMVVVEGVARGFDPRLDIWKVADPVVREWIERNLGSLGRIEGAVTGIGELARITS
FT                   TLPVLAARAAAVLENLETMTRDGLRLSPETIAAMGRTEGKKSRWRAIALWVIALTFIGI
FT                   LFAVLRL"
FT   gene            87140..88567
FT                   /gene="coaBC"
FT                   /locus_tag="BRADO0077"
FT   CDS_pept        87140..88567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="BRADO0077"
FT                   /product="Coenzyme A biosynthesis bifunctional protein
FT                   coaBC (DNA/pantothenate metabolism flavoprotein) [Includes:
FT                   Phosphopantothenoylcysteine decarboxylase (CoaC);
FT                   Phosphopantothenate--cysteine ligase
FT                   (Phosphopantothenoylcysteine synthase) (CoaB)]"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.3.2.5"
FT                   /EC_number="4.1.1.36"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11278255; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74048"
FT                   /db_xref="GOA:A4YJH2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74048.1"
FT                   /translation="MASLTIRKLDDSLKTYLRLRSAQNGRSVEEEVRVILRALIEPVDP
FT                   SEPPAAAPSPAALPDPGLPQPGLAREARVTLIIGGGIAAYKSLDLIRRLRERYIQVRCV
FT                   MTRAATQFVTELAASALSGDRVFTDLFDARSEFDVGHIRLARDCDLIVVAPATADLMSK
FT                   MAQGAADDLASAILLAASRPILLAPAMNPMMWSNPATRRNAATLQRDGIHMIGPNAGEM
FT                   AEKGEAGVGRMAEPTEIADAVVAMLKPPAPRPLAGRRVLITAGPTHEPIDPVRYIANRS
FT                   SGKQGFAIAAAAQAAGADVRLIAGPVELADPKGVKVTHVESARQMLEAVEAELPADVAI
FT                   FAAAVADWRVASEGGQKLKKTDQAIPPLQLVENPDILATISKLKEKRPGLVIGFAAETE
FT                   HLIDNAKAKFARKGCDWIVANDVSPATGVMGGDRNTVHLLTKDADGVHVASWPIMTKDE
FT                   VANALVAEIARTVGQSA"
FT   gene            88564..89022
FT                   /gene="dut"
FT                   /locus_tag="BRADO0078"
FT   CDS_pept        88564..89022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="BRADO0078"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   (dUTPase) (dUTP pyrophosphatase)"
FT                   /function="1.7.15 : 2'-deoxyribonucleotide/ribonucleoside
FT                   metabolism"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="3.6.1.23"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12369928, 15276840, 14982624; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74049"
FT                   /db_xref="GOA:A4YJH3"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74049.1"
FT                   /translation="MTQTIAIDVRILPHGAGLPLPAYQTAHAAGMDLLAAVAPDAPVVL
FT                   APGSHAMVPTGLSIALPDGFEAQVRPRSGLAARHGVTVLNSPGTIDADYRGEVCVLLIN
FT                   HGKEPFTIQRGERIAQMVIASVVRAELAITTTLSETARGSGGFGSTGR"
FT   gene            89215..91722
FT                   /locus_tag="BRADO0079"
FT   CDS_pept        89215..91722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0079"
FT                   /product="Putative sensor histidine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74050"
FT                   /db_xref="GOA:A4YJH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74050.1"
FT                   /translation="MSGVIVVMRQTLLSCTSLARKGLMGLAATALAPASQGFAGDGVPA
FT                   DAISSLFELSRSDVAEVTAMLALLGFSVVAAIALVRTRLAAARKEARLRADVAELQLQA
FT                   DRYRALLFAEPQILIAWPAGGHRPQISGDTSMLVPSDQPQRILAFGSWLPPEPALQLDH
FT                   AVEALREAGEGFMLHLTTSHGHAIEAMGRAIGGQAIVRIRELSGLRRELAETQLRFKAL
FT                   GEETESLRALASALPWPIWARHANGALAYVNAAYARAADARDIPDAISRNLELLDSADR
FT                   SDLQRALGAGGHFEGRLPIVMGGERRMHDVRAFTLGGGSAGVAIDASEAAALTDALVRM
FT                   HEAHRRTLDQLSSGVAVFDGQRRLAFYNDSYRRLWDLDTAFLDSQPDDSSVLDRLRASR
FT                   KLPEQADFRAWKAKLHEAYRAVEAAKDTWFLPDGRALSVVTTPNPEGGVTYLFDDVTES
FT                   FALARRYDGLIRVQRETLDSLAEGVAVFGSNGRVELFNPAFAKMWRLSPDSLREHPHID
FT                   TVESWCRSIYDDSVAWRTIREAITSIENRLDVALKLERKDGSVLDCMSRPLPDGATMLT
FT                   FQDITDTENVERALRESNEALEAAGQMKIDFVHHVSYELRAPLTTIIGFAHFLSDPSTG
FT                   PLTPKQAEYLDYVTKSTNALLALTNNILDLATIDAGAMKLELGPVDAAKAIEAAAEGVQ
FT                   DRLATDRIRLRVEVAPDVGSFVGDERRVVQVLYNLLANAVGFSPQDSTVIVSARRTDHS
FT                   VAFAVTDCGPGIPADIKDQMFDWFVSRSQGSRHRGAGLGLSLVRSFVELHGGKVRMDSV
FT                   VGKGTTVTCDFPTDHIAQRNAAE"
FT   gene            91719..93248
FT                   /locus_tag="BRADO0080"
FT   CDS_pept        91719..93248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0080"
FT                   /product="Conserved Hypothetical protein; Putative
FT                   Bifunctional ATPase/phosphotransferase, cell wall
FT                   biosynthesis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74051"
FT                   /db_xref="GOA:A4YJH5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74051.1"
FT                   /translation="MTDRQTFTTALADETATAALMADLALLIGPGVLITLTGDLGAGKT
FT                   AAARAMIRYLADDAELEVPSPTFTLAQSYDLPSFPLVHADLYRISDASELEEIGLSPLP
FT                   EATVVLIEWPERAGDALPQDRIDIALRHDAAQGDCARNLEITGTGKAAAIVARLKALRE
FT                   FLAEAGHGKSRRERMAGDASTRSYARLYKGERVFILMNSPRRPDGPAIYNGKPYSGAVH
FT                   LAEDVRPFVAMAGALRGRGISAPKINDADLDHGFLITEDLGREGVIEGDPPRPIVARYE
FT                   AATDLLAALHAQDVPWVLPLAPQVTYNVPTFDVDAMLIEIGLMLEWYLPDRGVEPSQVL
FT                   RAEFLEMWRDLLEAPLATNKTWVIRDYHSPNLLWLPAREGIARVGVIDFQDAVMGPPAY
FT                   DVVSLAQDARIDVPAEIERALRERYIAARQTASAEFDADAFSADYAILSAQRNTRLLGT
FT                   FARLNRRDGKPHYLKHQPRIWDYLHRALAHATLDPVRDWYAANVPPPAGVS"
FT   gene            93554..93859
FT                   /locus_tag="BRADO0081"
FT   CDS_pept        93554..93859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74052"
FT                   /db_xref="GOA:A4YJH6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74052.1"
FT                   /translation="MAERMKGERVVFERGIPAFMMGIDGTWRRNCTIEDVSETGAKLTV
FT                   EGSVEGLHLKEFFLLLSSTGLAYRRCELAWVNGDQIGVTFLKQGKKKTNKRATAEA"
FT   gene            94016..94738
FT                   /locus_tag="BRADO0082"
FT   CDS_pept        94016..94738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0082"
FT                   /product="Putative Nucleotidyl transferase family protein;
FT                   putative Mannose-1-phosphate guanyltransferase"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /EC_number="2.7.7.13"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74053"
FT                   /db_xref="GOA:A4YJH7"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74053.1"
FT                   /translation="MPVHPHKAMVLAAGLGLRMRPLTEKMPKPLVRVAGRPLLDHVLDR
FT                   LAEAGVTEAVVNVHYLADQIIEHTATRSAPRVIISDERDQVLGTGGGVVKALPLLGHEP
FT                   FFHVNSDTMWIEGVRQNLSRLADAFDPARMDIMLLMAPTATSIGYAGQGDYAMLADGTL
FT                   RKRREHQVVPFVYAGAAIISPAIFDGAPEGEFSLTKMFDKANEQDRLYGLRLEGVWMHV
FT                   GTPAAVTEAEEALLESAA"
FT   gene            95216..98362
FT                   /locus_tag="BRADO0083"
FT   CDS_pept        95216..98362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0083"
FT                   /product="putative helicase-exonuclease type V protein
FT                   family, addB subunit"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.5 : DNA degradation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15547262, 16132081; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74054"
FT                   /db_xref="GOA:A4YJH8"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74054.1"
FT                   /translation="MRVFTVPISAPFLRSVIAALVDGRLVDGFEARSDPARLATATLYL
FT                   PTRRSLRVAREMFLDELRTDAAVLPRLVALGDIDEDELAFAEDRDAFLGPAPLELPERL
FT                   DDLQRRLTLARLVAAWAKTPVSAPLVIGGPASTLALAGDLARLIDDIVTRGVSWDALDQ
FT                   LVPDQLDKYWQFSLEFLRIARTAWPAYLQEIERIEPAARRDLLIAAEAARLSAHPDGPV
FT                   IAAGSTGSMPATAKFLLAVAKLPHGAVVLPGLDTDLDEAAWSSIGGAKDRSGRVITPPA
FT                   VNHPQYAMHLLLRRFGLERRDVLRLAPPGRGGREVLISEAMRPSEATAIWHERLRQFDI
FT                   AANIAEAMDNLSVVAAPNPEMEALAIAIAMREARHLGKSAALVTPDRALARRVMAALTR
FT                   WHLTFDDSGGDALLETPAGIFARLAAEAAARGLEPPTLLALLKHPLCRLGRNAYGWKHA
FT                   IETLELALLRGTRPQAGTGGLARDFARFRDEHAKLHQGEASSLHRAEPRARLKPDQLDQ
FT                   AAALIAQLQTALAPLENLASPRPQDFAELAARHREVLIALSTDDVGLGTAFTDRDGAAL
FT                   ARCFDDLLASGERCGLMAPLSDYPDLFHTAFSDRAVRRPERHGAQLQIYGPLEARLMQT
FT                   DRMIIGGLVEGIWPPAPRIDPWLSRPMRHQLGLDLPERRIGLSAHDFAQLLGAPEVILT
FT                   HAAKSGGAPAVASRFLHRLQAVAGDAQWKAATARGETYVRYAEVLDQPREVKPIPQPAP
FT                   KPPLEARPLRMSVTAIEDWLRDPYTIFARYILRLDPLDPVDMPLSAADRGSAIHEAIGE
FT                   FTQTFAKELPLHPAHALRVIGEKHFAPLMERPEARALWWPRFQRIAGWFAAWETARREH
FT                   IGAITAEIRGEIGIPLGKDRTFMLSARADRIEQRAEGTYAILDYKTGQPPTAKQVRMGL
FT                   SPQLTLEAAILREGGFDGIPAGSLISQLVYVRLSGNNPPGEERILELKINKSDTPQHPD
FT                   QAAQEARNKLEELIRSFEDVNQGYTSLNLSMWANRYGSYDDLARIKEWSAAGGLGVEEW
FT                   "
FT   gene            98359..101829
FT                   /locus_tag="BRADO0084"
FT   CDS_pept        98359..101829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0084"
FT                   /product="putative helicase-exonuclease type V protein
FT                   family, addA subunit"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.5 : DNA degradation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15547262, 16132081; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74055"
FT                   /db_xref="GOA:A4YJH9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74055.1"
FT                   /translation="MKAPRPIPQAVRDAQTRASNPAASAFVSANAGSGKTHVLVQRVIR
FT                   LLLDGVPPEKILCITFTKAAAANMAERVFSTLGHWVTLDDGALDSAIKSTGILTSDKKL
FT                   RASARKLFASALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDERDQTEMMERA
FT                   NLKVLLNAARAPDSPIGRALQIAMANAADSTFKEVVREACLSRDHFMAWTDGAGRVEVA
FT                   AQHLGEVLGIGAGETLDAIERDILDGPNLPRANWTEIAARLDGGAKTDQKQADQLRAAL
FT                   AFSGSDRVDEYLRVFLTDDKEPRRSVLTKKFAESNPGLAGLFDAEARRLDHLIEKRRAA
FT                   VVRDRTEALLQIATAAAANYRREKDERGLLDYDDLIDKTLVMLNRVSAGWVHYKLDRGV
FT                   DHVLIDEAQDTSPRQWDIVAHIIEEFTSGAGARDGLTRTIFAVGDEKQSIFSFQGADPH
FT                   EFDARRRQLQKRFTDAGLLFDPVSFTYSFRSGPTVLHAVDHVFREREVYSSIHSPDIGY
FT                   PIHNALTDAGPSLVELWSLCERDDRKEIEGWRAPFDGVSVTSPEVKLSRRIQAEIKRLI
FT                   RVGTMTGHDGARRRLSYGDMLILVRRRGTAFDAVIQALKHAGIPVAGADRLKLTEHIAI
FT                   IDLMNLADALLLPQDDLALATALKSPLFGLDDDDLFKLAWQRRGSLREALSAHAADDPR
FT                   LQAVVRRLQQCERRAAEDTPFAFYAWLLGGDGGRRRILARLGHEANDALDEFLELALSY
FT                   ERKAPASLQGFVAWLRAADTEVKRDMEISRDEVRVMTVHGAKGLEASVVFLVDTTSSPA
FT                   DSQRLRLIHVPHGDREIVVWAGRKADDPQAVVAARAAMLKETEDEYRRLLYVAMTRAAD
FT                   RLVIGGCMPGNMNNVRGGSWYDLMARGLDAAGLQVEVIETEDGPVKRYARPEDIAETAK
FT                   DEARQMAESAVELPAWLRTAAVEAPGDVAVLRPSDPSSDERPVRTGESLAARSLAMQRG
FT                   TLVHRLLQSLPDVPPERRRDAALRYLLRNAPDWPEDERDKLTARVLTVIADPRFAAVFA
FT                   PGSRAEVSIVGRLAHPGQPRTLVSGQIDRLVVTEAEVLIVDFKTNQQPPSELADVPEAY
FT                   LRQLALYRAVLGQLYPGRAVRAALLWTEVPDFMELPPSALDAVLPSQHD"
FT   gene            101929..102252
FT                   /gene="trxA"
FT                   /locus_tag="BRADO0085"
FT   CDS_pept        101929..102252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="BRADO0085"
FT                   /product="thioredoxin 1, redox factor"
FT                   /function="1.6.15.2 : Thioredoxin, glutaredoxin"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74056"
FT                   /db_xref="GOA:A4YJI0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74056.1"
FT                   /translation="MAAVAKVSDADFESEVLKADGPVVVDFWAEWCGPCRMIAPALDEI
FT                   ASAMGDKVKIVKLNVDESPKTASKYGVMSIPTLMVFKGGELASRQVGAAPKAKLQQWIS
FT                   SAV"
FT   gene            102527..103540
FT                   /locus_tag="BRADO0086"
FT   CDS_pept        102527..103540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0086"
FT                   /product="putative ATP-dependent DNA ligase"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="2.1.3 : DNA recombination"
FT                   /EC_number="6.5.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74057"
FT                   /db_xref="GOA:A4YJI1"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74057.1"
FT                   /translation="MEARSVDAIPRGEAWQYEPKWDGFRCLLARDGAHVTMQSKAGEDL
FT                   ARYFPEVVAAARALRTNNFILDGELVVPHAASFSFDALLQRIHPAASRVKKLSVETPAL
FT                   FLAFDLLATAKDRDLMAQTLHERRPALEAFAKAHFAKHPTFRLSPATTRYATAQDWLAQ
FT                   SGGGSDGVIAKRVDLPYQAGSRDGMQKIKRYRSADCVIGGFRYATNKGTNGRKLVGSLL
FT                   LGLYDKDGLLHHVGFTSALKKDEKPALTDKLEPLIAPPGFTGNAPGGPSRWSTERSAEW
FT                   CPLKPKLVIEVCYDHFSGERFRHGTSILRWRPDKAPKQCTFDQLAQKVADPMKLLA"
FT   gene            complement(103541..104281)
FT                   /locus_tag="BRADO0087"
FT   CDS_pept        complement(103541..104281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0087"
FT                   /product="Conserved hypothetical protein; Putative
FT                   phosphoesterase, MJ0912 type"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74058"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74058.1"
FT                   /translation="MRFAAIADVHGNHLALEAVLADIRAQGVTDIVDLGDMASGPLDAR
FT                   KAMDRLMALDAVHVRGNHDRWLIDRPFETMGAWERPAYPQLESSHLDWLRTIPATAVYQ
FT                   DQVFLCHATPEDDNVYWLESVAPDGTITCASLDEIERLAGGISQSLILCGHTHTTRAVR
FT                   LPDGRLIVNPGSVGSPGYSYNVPYPHIVQAGSPDARYAILELTPAGWSVSFRHVPYDHR
FT                   AMAELARANGDTEFASALATGWIR"
FT   gene            complement(104295..105638)
FT                   /locus_tag="BRADO0088"
FT   CDS_pept        complement(104295..105638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0088"
FT                   /product="putative folC bifunctional protein [Includes:
FT                   Folylpolyglutamate synthase (Folylpoly-gamma-glutamate
FT                   synthetase) (FPGS) (Tetrahydrofolate synthase)
FT                   (Tetrahydrofolylpolyglutamate synthase); Dihydrofolate
FT                   synthase]"
FT                   /function="1.5.3.2 : Folic acid"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 3040739, 7798151; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74059"
FT                   /db_xref="GOA:A4YJI3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74059.1"
FT                   /translation="MNDPASQPKPSLDELITRLSALHPSKISLGLERMHRLLAQLDHPE
FT                   RKLPPVIHVAGTNGKGSTVAYLRAMLEAAGLSVHVFTSPWLVRINESYRLGRVGGGVLV
FT                   DDDELIDALLQCERVNAGAPITFFEVKTVAAFVLFAKHPADVVLLEVGLGGRLDSTNVV
FT                   EQVAASVLTPISMDHMEFLGDTRALIAAEKAAIIKRGCPVISAAQEPDAMAVIEREAKR
FT                   QRAPLFAAGESWHVNVERNRLVYQDDRGLLDLPAPKLFGRHQFDNAGLAIATLRALDQF
FT                   KLTTKAFEDGIVQAEWPARMQRLSNGALTAIAPQGAEIWLDGGHNAEGGRVVAAAIGDL
FT                   EERVSRQLVVIVGMMGNKDAAAFLANFAGLTRHIIVVPIPNESKAMAPADLASAARTLG
FT                   MRIEIADGVVSALAGVARLAYEVPPRILITGSLYLAGHVLDLNGTPPT"
FT   gene            complement(105635..106573)
FT                   /gene="accD"
FT                   /locus_tag="BRADO0089"
FT   CDS_pept        complement(105635..106573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="BRADO0089"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta (ACCase beta chain)"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.4.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7678242, 15066985, 14594796; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74060"
FT                   /db_xref="GOA:A4YJI4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74060.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDSGQLVFYKDVEANQF
FT                   VIPGSNYHMRMGASARLKSMFDNETWFDVALPEVTPDPLKFRDERRYADRIKDARARTG
FT                   MNDAVKVGFGKLEGMGVVIAVQDFDFMGGSLGMAAGEAIVRGLELAVEKKSPFIVFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQMLREARLPYIVVQTNPTTGGVTASYAMLGDVHIAEP
FT                   GALIGFAGARVIEQTIREKLPEGFQRAEYLLDHGMVDMVVHRHDLRPTLARLCRLLTKA
FT                   PAVEHAKPAPQLPPPAKPAETAEAPAVATSA"
FT   gene            complement(106668..107504)
FT                   /gene="trpA"
FT                   /locus_tag="BRADO0090"
FT   CDS_pept        complement(106668..107504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="BRADO0090"
FT                   /product="tryptophan synthase alpha chain"
FT                   /function="1.5.1.15 : Tryptophan"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.2.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10511537, 2828322; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74061"
FT                   /db_xref="GOA:A4YJI5"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74061.1"
FT                   /translation="MTSRMDARFAQLKSEGRSAFVTFVMGGDPDPETSLAIVKALPQAG
FT                   ADIIEIGMPFTDPMADGPSIQAAGLRALKAGMTLRKTLQLVRSFREGDAATPIVLMGYY
FT                   NPIYIYGVDKFLDDAKSAGVDGLIIVDLPPEEDDELCIPALKAGLNFIRLATPTTDDKR
FT                   LPAVLANTSGFVYYVSITGITGAAAADSSAVGSAVARIKRHTALPVCVGFGIRTPETAR
FT                   AIAAHADGAVVGTALVDALKASLDAEGRATAKTVNAVADLAAALAQGVRGAQQAAE"
FT   gene            complement(107501..108724)
FT                   /gene="trpB"
FT                   /locus_tag="BRADO0091"
FT   CDS_pept        complement(107501..108724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="BRADO0091"
FT                   /product="Tryptophan synthase beta chain"
FT                   /function="1.5.1.15 : Tryptophan"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.2.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10511537, 2828322; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74062"
FT                   /db_xref="GOA:A4YJI6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74062.1"
FT                   /translation="MTTAIPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYADA
FT                   KADPAFQGEMNSYRTHYVGRPSPLYYAERLTEHLGGAKIYFKRDELNHTGSHKVNNVLG
FT                   QIMLARRMGKKRIIAETGAGQHGVATATLCARFGLDCVVYMGAVDVERQQPNVLRMEML
FT                   GAKVIPVQSGARTLKDAMNEALRDWVTNVHNTFYCIGTVAGPHPYPMMVRDFQSVIGQE
FT                   TRTQMQEAEGRLPDSLVACIGGGSNAMGLFHPFLDDPSVEIFGVEAAGHGLTQLHAASI
FT                   AGGRPGVLHGNRTYLLMDDDGQIAEAHSISAGLDYPGIGPEHSWLHEAKRVTYLSATDD
FT                   EALDAFLLLSRLEGIIPALEPAHAVAKVMQLAPNKPKDHLMVVNLCGRGDKDVPQVGEI
FT                   LRKRAKQS"
FT   gene            complement(108721..109380)
FT                   /gene="trpF"
FT                   /locus_tag="BRADO0092"
FT   CDS_pept        complement(108721..109380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="BRADO0092"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /function="1.5.1.15 : Tryptophan"
FT                   /EC_number="5.3.1.24"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2184433, 2828322; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74063"
FT                   /db_xref="GOA:A4YJI7"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74063.1"
FT                   /translation="MSLLVKICGLTTPETLDAALDAGAEMVGFVFFPPSPRHVGLTAAR
FT                   ELGQQAKGRALKVALTVDADDATFENIVETLRPDLLQLHGRESIARIRDLKQRFGLPVM
FT                   KAVAVATSADLAPLAGYADVCDRILFDARAPKDATRPGGLGATFDWHVLEALKLDRPFM
FT                   VSGGLSADNVAEAVRITRAGGVDVSSGVERTPGVKDCDMIRNFIRAARAAEELSVQ"
FT   gene            complement(109459..109851)
FT                   /locus_tag="BRADO0093"
FT   CDS_pept        complement(109459..109851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0093"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74064"
FT                   /db_xref="GOA:A4YJI8"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74064.1"
FT                   /translation="MRKFLTVVFVLPLLVLLVIFGVANRHFVTVSFDPFNAADPALSVS
FT                   VPLFALLIAVAIIGVIAGGCATWIGQRHWRRAARRHQADAEAARAQVAQLAAAARAGQG
FT                   STQSLVPAGPARLFAPYGRDKQGAAL"
FT   gene            complement(109930..110247)
FT                   /gene="ihfB"
FT                   /locus_tag="BRADO0094"
FT   CDS_pept        complement(109930..110247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="BRADO0094"
FT                   /product="Integration host factor beta-subunit (IHF-beta)"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.3.7 : Nucleoproteins, basic proteins"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15659673, 9171434, 8892836; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74065"
FT                   /db_xref="GOA:A4YJI9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74065.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDNPEGAAADDAD
FT                   D"
FT   gene            complement(110415..111395)
FT                   /locus_tag="BRADO0095"
FT   CDS_pept        complement(110415..111395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0095"
FT                   /product="Putative peptidase S49 family; putative signal
FT                   peptide peptidase SppA"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74066"
FT                   /db_xref="GOA:A4YJJ0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74066.1"
FT                   /translation="MSLDSDVIVDRRRLRRKLTFWRVVAVVIAIGALSAIGLAMSPRGR
FT                   TALSTSGSIARVNIEGLIRSDQERVEALERLENSSAEAVIVHINSPGGTTAGSEQLYDS
FT                   LVRLKAKKPLVVVVEGLAASGGYIGAIASDHIVAQQSSLVGSIGVLFQYPNVSELLKTV
FT                   GVKIEEVKSSPLKAAPNGYEPTSPEARAALDDLVKDSYAWFRGLVKTRRNMDDALLEKV
FT                   ADGRVFTGRQAVELKLIDELGDEKTAVAWLVANKNVKKDLPVRDYKLVPRFGDLTFLRT
FT                   ATSIALDAVGLSGIARQIERTGVVQAVDRVGLDGMLALWTPAAGN"
FT   gene            complement(111819..113528)
FT                   /gene="rpsA"
FT                   /locus_tag="BRADO0096"
FT   CDS_pept        complement(111819..113528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BRADO0096"
FT                   /product="30S ribosomal subunit protein S1"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3368316; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74067"
FT                   /db_xref="GOA:A4YJJ1"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74067.1"
FT                   /translation="MASSISANSYNPSRDDFAAMLDESFTKGNLQESSVVKGKVVAIEK
FT                   DMAVIDVGLKTEGRVALREFSGPGRDSELKVGDEVEVFLDRIENALGEAVLSRDKARRE
FT                   ESWGKLEKAFQNNEKVNGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNS
FT                   QPFQILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVD
FT                   LGGIDGLLHVTDIAWRRVNHPTEVLSIGQTVKVKIIKINHETHRISLGMKQLLDDPWQG
FT                   IEAKYPLQARFHGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEV
FT                   EVQVLEVDSVKRRISLGLKQTMRNPWEVFVEKHPTGSVVEGEVKNKTEFGLFLGLEGDV
FT                   DGMVHLSDLDWKLPGEQVIDNYKKGDMVKAVVLDVDVEKERISLGIKQLEGDPFAEPGD
FT                   VKKGAVVTCEVLDVKDGGIDVKITGTDFTTFIKRSELARDRNDQRTERFAVGEKVDARV
FT                   IQFDKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKNRDSK"
FT   gene            complement(113798..114436)
FT                   /gene="cmk"
FT                   /locus_tag="BRADO0097"
FT   CDS_pept        complement(113798..114436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BRADO0097"
FT                   /product="Cytidylate kinase (CK) (Cytidine monophosphate
FT                   kinase) (CMP kinase)"
FT                   /function="1.5.2.4 : Pyrimidine
FT                   ribonucleotide/ribonucleoside biosynthesis"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.4.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74068"
FT                   /db_xref="GOA:A4YJJ2"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74068.1"
FT                   /translation="MIIAIDGPAASGKGTMAKRLAAHYGLRHLDTGVIYRAVAHALLTA
FT                   GLDLKDEARAAEVAMTLDPSTFDNPAFRSHEVGSAASVVSALPKVREALLAFQRQFASQ
FT                   PPGAVLDGRDIGTVICPDAEVKIYVVADPKIRAHRRTLEARSRGEPADEAAILADILAR
FT                   DERDQNRAVAPLKQAADAYLLDNSHLDIESGVRAAIDIVEAVRAGRQRV"
FT   gene            complement(114433..115770)
FT                   /gene="aroA"
FT                   /locus_tag="BRADO0098"
FT   CDS_pept        complement(114433..115770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="BRADO0098"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase
FT                   (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
FT                   synthase) (EPSPS)"
FT                   /function="1.5.1.20 : Chorismate"
FT                   /EC_number="2.5.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12835912; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74069"
FT                   /db_xref="GOA:A4YJJ3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74069.1"
FT                   /translation="MSTSAAPTPLESRASGPLSGTIRVPGDKSISHRALILGALSVGGT
FT                   RISGLLEGEDVLNTAKSMRTLGAKVERTGEFAWTVNGVGVGGFAQPAATLDFGNSGTGC
FT                   RLVMGAVAGCPISAVFDGDASLRSRPMRRILDPLALMGAKVTASAEGGKLPLTLQGASN
FT                   PVPIEYRTPVASAQIKSAVLLAGLAAPGVTTVIEQEASRDHTELMLKHFGAEIVTTPEG
FT                   SHGRRIALTGQPELRGAPVIVPADPSSAAFPLVAALIVDGSDLVLSDVMTNPLRTGLFT
FT                   TLREMGASIEEDDVRGDAGEPMARLRVRASKLKGVEVPPERAPSMIDEYLVLAVAAAYA
FT                   EGTTIMRGLHELRVKESDRLEATAAMLRVNGVKVEITGDDLIVEGRGHVPGGGLVATHM
FT                   DHRIAMSALVMGLASDKPVTVDDTAFIATSFPDFIPLMRKAGADFA"
FT   gene            115920..116324
FT                   /locus_tag="BRADO0099"
FT   CDS_pept        115920..116324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0099"
FT                   /product="conserved hypothetical protein; conserved FYDLN
FT                   motif"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74070"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74070.1"
FT                   /translation="MAKSELGTKRICPTTGKKFYDLNKNPVISPYTGEVVPIAPVAPTR
FT                   AMRGEAARAAAQETVNEPAEAEELVSLEEADAEENSGKVKAVVPESEDDIEIDETLDDD
FT                   EDDDSTFIADEEEGDEDVTDIIGDVGGDEE"
FT   gene            116406..116481
FT                   /locus_tag="BRADOtRNA1"
FT   tRNA            116406..116481
FT                   /locus_tag="BRADOtRNA1"
FT                   /product="tRNA-Ala"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            116707..116958
FT                   /locus_tag="BRADO0100"
FT   CDS_pept        116707..116958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0100"
FT                   /product="hypothetical protein; putative Excinuclease ABC,
FT                   C subunit, N-terminal (fragment)"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74071"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74071.1"
FT                   /translation="MWYVYIIRSVAYPEQEYIGATADIRQRLKDHNAGRSAHTSKFTPW
FT                   TLVWYCAFPDKHRAMAFEAYLKSHSGRAFSKKRLLGPA"
FT   gene            complement(116966..117421)
FT                   /gene="ohrR"
FT                   /locus_tag="BRADO0101"
FT   CDS_pept        complement(116966..117421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="BRADO0101"
FT                   /product="Organic hydroperoxide resistance transcriptional
FT                   regulator, MarR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11418552, 11983871, 11443074, 11418552; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74072"
FT                   /db_xref="GOA:A4YJJ6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74072.1"
FT                   /translation="MRKKSAADLPLQLGNQLCFAVYSTAHAFNRVYKPLLDCLGLTYPQ
FT                   YLVMLVLWERDGLSVKEIGERLFLDSGTLTPLLKRMEAAHLVKRTRSAEDERQVLVALT
FT                   GQGAALREKARAIVPPAILDATGCSIAELADLHGKLVKLRERLDAAV"
FT   gene            117594..118019
FT                   /gene="ohr"
FT                   /locus_tag="BRADO0102"
FT   CDS_pept        117594..118019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="BRADO0102"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9573147, 11418552, 11983871, 11443074; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74073"
FT                   /db_xref="GOA:A4YJJ7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74073.1"
FT                   /translation="MSVNVLYKTSAKATGGRDGEAATLDGSLSVKLSTPKELGGGGGAG
FT                   NNPEQLFAAGYAACFIGAMKFVASQGGPKVPADASVTSTVGIGPRSEGGFGITAELAVS
FT                   LPGLAKADAEALVAKAHEVCPYSNATRGNVDVKLTVV"
FT   gene            118176..119378
FT                   /locus_tag="BRADO0103"
FT   CDS_pept        118176..119378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0103"
FT                   /product="Putative caiB/baiF CoA-transferase family
FT                   protein; Putative Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74074"
FT                   /db_xref="GOA:A4YJJ8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74074.1"
FT                   /translation="MTPQFAPGAMAGLRVIDLTRVLGGPYCTQILADHGADVIKVEPPA
FT                   GDEVRDWGPPFHDEDAAYFVGINRNKRSIGLDLASEGGRVVLLKMLETADVLIENFKPG
FT                   TLEKWGIGSDVLREKFPKLVHCRICGFGADGPRGGNPGYDAIIQAMTGMIAATGSPESG
FT                   PMRIGVPLVDITTGLYAAIGILMALSERQRSGQGQFLEVTLYETGLAIMHPHTANYFMH
FT                   GKPPSLTGNEHPNLVPYAIFPTKTDDIFIGVGNDGTFRKLAREIGRPELGTDPRFARNK
FT                   DRVANREALRAELAAVFSQFEAEPLCDRLLAAGLPAGPVQKIDQALTNPHTFHRGDVIE
FT                   KDWYKGVASPIRLERTKPSLRSTPPKFSQHARDVLGEFGYSDSDIDALVAQGTVCTERK
FT                   R"
FT   gene            119646..120887
FT                   /locus_tag="BRADO0104"
FT   CDS_pept        119646..120887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0104"
FT                   /product="Putative sugar ABC transporter (substrate binding
FT                   protein); putative glycerol 3-phosphate transport protein,
FT                   ugpB-like protein"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /function="1.6.1 : Phospholipid"
FT                   /function="1.7.6 : Glycerol metabolism"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /function="7.2 : Periplasmic space"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 3062310; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74075"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74075.1"
FT                   /translation="MTEIQWWHAMTGGNNDIVNKLAEDFNASQSDYKVVPTFKGSYPDT
FT                   MNAGIAAFRAGTAPHILQVFEVGTATMMSAKGAIKPVYELMKDAGEPFDPKAYLPAITG
FT                   YYSTSKGDMLSFPFNSSSMVMWINKDELKKAGIAEIPKTWPEVFDAAKKLKAAGHETCG
FT                   FSNAWATWAHIEQFSAWHNVPIGTKANGLDGFDTVLEFNSPLAVKHLQNLIDLQKDKTY
FT                   DYSGRGNQSESRFGTGECAIFLTSSGYYATAKSTAKFDFTSAPMPYYPDVQGAPQNSII
FT                   GGASLWVMGGKSADEYKGVAKFFTFLSDTNRQAKLHQESGYLPITKAAYEKTKADGFYE
FT                   KNPTLQTPLKELTNKEPTENSRGLRFGNMVQMRDVWAEEIEAALAGKKTAKDALDAAVA
FT                   RGNAMLRSFEKTAK"
FT   gene            120959..121840
FT                   /locus_tag="BRADO0105"
FT   CDS_pept        120959..121840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0105"
FT                   /product="Putative sugar ABC transporter (permease
FT                   protein); putative glycerol 3-phosphate transport protein,
FT                   ugpA-like protein"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /function="1.6.1 : Phospholipid"
FT                   /function="1.7.6 : Glycerol metabolism"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 3062310; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74076"
FT                   /db_xref="GOA:A4YJK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74076.1"
FT                   /translation="MEKSVVFKGKLLPYLLLAPQLAITLIFFYWPASQAIRQSFLQEDA
FT                   FGLNSEFVGLENYQALLAQPEYYTAIGTTVVFSSLVTVLSLGVALLFATQADKNLKGGS
FT                   VYKTLMVWPYAVAPAVAGVLWFFIFHPTLGTLARPLRVLGIDWNPLLNGTHAMILIIMA
FT                   AVWKQVAYNFLFFLAGLQAIPKSVIEAGAIDGAGPLRRFWTIIFPLLSPTTFFLLVVNI
FT                   VYVFFETFGIIDAVTSGGPAGSTTTMVYKVFADGRLGGDLGGSAAQSVVLMVIVIALTA
FT                   IQFRYVERKVQY"
FT   gene            121840..122688
FT                   /locus_tag="BRADO0106"
FT   CDS_pept        121840..122688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0106"
FT                   /product="Putative sugar ABC transporter (permease
FT                   protein); putative glycerol 3-phosphate transport protein,
FT                   ugpE-like protein"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /function="1.6.1 : Phospholipid"
FT                   /function="1.7.6 : Glycerol metabolism"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 3062310; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74077"
FT                   /db_xref="GOA:A4YJK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74077.1"
FT                   /translation="MVEHRPLRDLVAYLVLALGIVIFAFPVYVAFIASTYDAATVVSGN
FT                   LPLTPGHNLLQNYYRAVFVGGSRFMNQPVGVLLANSFITAIGIALGKIFISILSAFAIV
FT                   YFRFPFRKTAFWIIFITLMLPVEVRIYPTYKIVADLRLLDTYAGLILPLIASATGTLLF
FT                   RQFFMTVPDELLEASRIDGAGPLRFFWDTLLPLSMTTVAALFVIQFIYGWNQYLWPLLI
FT                   TTKDSMQTIVIGIKKMLSTTDELAEWQLAMATAVLAMLPPVAVVVFMQRLFVKGLVETE
FT                   K"
FT   gene            122800..123879
FT                   /locus_tag="BRADO0107"
FT   CDS_pept        122800..123879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0107"
FT                   /product="Putative sugar ABC transporter (ATP binding
FT                   protein); putative glycerol 3-phosphate transport protein,
FT                   ugpC-like protein"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /function="1.6.1 : Phospholipid"
FT                   /function="1.7.6 : Glycerol metabolism"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 3062310; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74078"
FT                   /db_xref="GOA:A4YJK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74078.1"
FT                   /translation="MANVTLRNVRKIYPGGFEAIKGIDVEVGDGQFCVLVGPSGCGKST
FT                   LLRMVAGLETISSGEIDIGGRVVNAIEPADRDIAMVFQNYALYPHMSVYNNMAYGLRNR
FT                   GVPEAEIKTRVEDAARILELGAMLQRKPRQLSGGQRQRVAMGRAIVRQPKVFLFDEPLS
FT                   NLDAKLRIAMRVEIRKLQRRLNTTAIYVTHDQLEAMTLADILVVMNGGQVEQIGNPLEI
FT                   YQKPATTFVASFIGAPPMNLMAVDGVRAQIHGGDAIAANAGQLGIRPEDFELGDTVPAG
FT                   GIGLDLRVDAIEHVGAETYVYGSRQDVGHNDSLTATANDVIVRLPGTTAPAIGTRIRAV
FT                   AQRAKLHLFSADGKLRLTI"
FT   gene            124014..124439
FT                   /locus_tag="BRADO0108"
FT   CDS_pept        124014..124439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0108"
FT                   /product="putative small heat shock protein; putative
FT                   HSP20-like chaperone"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74079"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74079.1"
FT                   /translation="MSRVPSLSSPFLLGFDEIERVLDRVVKGADGYPPYNIERFERTNG
FT                   QPERLRITLAVAGFTRDQLDVTIEENQLVIRGRQQDDKTRQYIHRGIAARHFQRTFVLA
FT                   EGMHVLGADLKNGLLSVDLARPEPERIVKTIAINEHE"
FT   gene            124498..124761
FT                   /locus_tag="BRADO0109"
FT   CDS_pept        124498..124761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74080"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74080.1"
FT                   /translation="MTEGNVASESGVSLESLATLGEGHIAYVKQIRSEDVPGLFPQAPR
FT                   IAPGLKLFALHAADGTPIMLTDSREAAIANAWSHELQAVSVH"
FT   gene            124912..125421
FT                   /locus_tag="BRADO0110"
FT   CDS_pept        124912..125421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0110"
FT                   /product="putative Acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74081"
FT                   /db_xref="GOA:A4YJK5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016890"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74081.1"
FT                   /translation="MTVLITPTTATELRSNASLAAGLLALNNAHAAELSWLTPESLLHL
FT                   LTQSWRSWRIGTADALLIALDETADYDNPNHRWFRARYDRFVYVDRIVVAEDARGRGLA
FT                   RRLYEELIREVTAAGHDRVVCEVNLDPPNPQSDAFHAALGFTTLGTASIHDGAKTVRYI
FT                   GRSVRS"
FT   gene            complement(125439..125900)
FT                   /gene="ptsN"
FT                   /locus_tag="BRADO0111"
FT   CDS_pept        complement(125439..125900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="BRADO0111"
FT                   /product="Nitrogen regulatory protein (Enzyme IIA-NTR)
FT                   [Includes: Phosphotransferase enzyme IIA component (PTS
FT                   system EIIA component)]"
FT                   /function="3 : Regulation"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9636714, 1991712; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74082"
FT                   /db_xref="GOA:A4YJK6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74082.1"
FT                   /translation="MPITDLVAPEAILPALKVISKKQALQELAARAAALTGQNERSVFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLEKLFGLFARLERPIDFEAMDGQPVDLVFLLLA
FT                   PEGAGADHLKALARIARLLRDQDVAKKLRASRDAQAIYSVLALPPASAA"
FT   gene            complement(126231..126833)
FT                   /locus_tag="BRADO0112"
FT   CDS_pept        complement(126231..126833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0112"
FT                   /product="putative sigma (54) modulation protein"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1991712; Product type pf : putative
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74083"
FT                   /db_xref="GOA:A4YJK7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74083.1"
FT                   /translation="MTLRISGKSISVSEALRGRVSERTDEVLRKYFDGNYSGHVTLSKD
FT                   GFGFKTDCALHLDSGITLEAESNAPDAYASADQALLMIEKRLRRYKSRLKDRSARKSHA
FT                   ANAALAGLEGAVLDAPSYVIEAPAEGDEEITGYNPVIIAENTTALKRLSVSEAVLELDL
FT                   SGAPCMVFQHGSSGRVNIIYRRADGNIGWVDPPAVKP"
FT   gene            complement(126924..128564)
FT                   /gene="rpoN"
FT                   /locus_tag="BRADO0113"
FT   CDS_pept        complement(126924..128564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="BRADO0113"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /function="1.8.3 : Nitrogen metabolism"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /function="3.3.3 : Stimulon (ie. environmental stimulus)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1991712; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74084"
FT                   /db_xref="GOA:A4YJK8"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74084.1"
FT                   /translation="MALTQRLEFRQSQSLVMTPQLMQAIKLLQLSNLDLSTFVEEELER
FT                   NPLLERANDGPEAPVAGEQQMAERGEFSEGGEASGDDFGDGAGSSGGESYESAPEDWMS
FT                   RDLGSRTEIEQTLDTGLDNVFSEEPAEAAARNAQDAAPTTYTEWGGGASGDEDYNLEAF
FT                   VAAETTLSDHLAEQAAVAFVSPADRMIGQYLIDLVDEAGYLPVDLGQAADRLGAEQADV
FT                   DAVLGVLQTFDPPGICARNLSECLAIQLRELDRYDPAMQALIEHLDLLAKRDFAALRRL
FT                   CGVDDEDLVDMIGEIRRLDPKPGLKFGTTRTQTMVPDVYVRPGPDGGWLVELNSDTLPR
FT                   VLVNQVYYSELSKTIRKDGDKSYFTDCLQNATWLVRALDQRARTILKVATEIVRQQDGF
FT                   FTHGVAHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIASADGG
FT                   EAHSAEAVRHHIKQLIDAEDPSAILSDDTIVEKLRAAGIDIARRTVAKYREAMRIPSSV
FT                   QRRRDKQSMLAHALSSPASADRTRDTASV"
FT   gene            complement(128776..129825)
FT                   /locus_tag="BRADO0114"
FT   CDS_pept        complement(128776..129825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0114"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74085"
FT                   /db_xref="GOA:A4YJK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74085.1"
FT                   /translation="MVDLLGMFRGRPAKRGQRGSARRRDDITAIDDPFAGSMSDDPLAA
FT                   LAESVRSESVRNESARGEQQPAPRINPRSPQNTEQIQRKRPASQPMPAKPRSNGAGAGP
FT                   QLLRRPGFLAVHSIEKSFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIK
FT                   ADRGAIELDGHDVTRLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEVVEPSRKKR
FT                   ERELDALLEEFTITRLRKSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAV
FT                   GDIQQLVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGQILTEGSPEEIVADPDVRR
FT                   LYLGEEFRL"
FT   gene            complement(130189..130887)
FT                   /locus_tag="BRADO0115"
FT   CDS_pept        complement(130189..130887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0115"
FT                   /product="conserved hypothetical protein; putative
FT                   OstA-like protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2703463, 2547691"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74086"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74086.1"
FT                   /translation="MTYRFVPALCRAAGFAALALVAFADSLQAQSATTGVPNALQGFSQ
FT                   NRDQPIQIEAASLEMRDKKKEATFTGNVKVVQGDTTMTSKSLVVFYDGGAQQGGAKATK
FT                   ATPAATPGPDGSSAIRRLEARGDVKVTQKDQVVTGETAVYDTKTNMITMQGGVVLTQCK
FT                   NVMRGDRLTVDMTTGVSRVESDGGRGVQVLLPQAGSGSGGNGGCGSSPGGTGSPVSVGA
FT                   PLSLGANKPK"
FT   gene            complement(130892..131602)
FT                   /locus_tag="BRADO0116"
FT   CDS_pept        complement(130892..131602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74087"
FT                   /db_xref="GOA:A4YJL1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74087.1"
FT                   /translation="MNSVQNPAYDPSLQARFAVAARHSRFVRALRIAVPAVVGVAMTVV
FT                   IYVAFFNDFRVAVDTGNLTGNVVISGRKITMETPHLTGFTPDQRPYDLVAHSAVQDLTD
FT                   PDHVELNILRAKVLMEDQSTVTLKAATGLFDTKQQQLELKKDILLTTSTGYEARLSRAS
FT                   VDMAKGTVSSDERVDVKLTNGTLSADRLRITDNGEVIRFEGNVVMNLDNMNAAPAAPAT
FT                   TASADPGRSARNVK"
FT   gene            complement(131761..132375)
FT                   /locus_tag="BRADO0117"
FT   CDS_pept        complement(131761..132375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0117"
FT                   /product="putative 3'-5' exonuclease family protein"
FT                   /function="2 : Information transfer"
FT                   /EC_number="3.1.13.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74088"
FT                   /db_xref="GOA:A4YJL2"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74088.1"
FT                   /translation="MTVRLHRGDLPDLSRYTSSVAIDTETMGLNPHRDRLCVVQLSPGD
FT                   GSADVVQIPKGHTDAPNLKTLLGNTAITKIFHFARFDVATLFHTFGVMPQPVYCTKIAS
FT                   RLARTYTDRHGLKDLVRELLNIDLSKQQQSSDWGADSLSEPQLAYAASDVLHLHALREK
FT                   LDVMLAREGRLALAQACFAFLPHRATLDLGGFEADDIFAHS"
FT   gene            132868..133839
FT                   /locus_tag="BRADO0118"
FT   CDS_pept        132868..133839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0118"
FT                   /product="putative TRAP-type C4-dicarboxylate transport
FT                   system, binding periplasmic protein (DctP subunit)"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /function="7.2 : Periplasmic space"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1809844, 9287004; Product type pt :
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74089"
FT                   /db_xref="GOA:A4YJL3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74089.1"
FT                   /translation="MKTITGIIAAAVLAVTSPLAMARDFRSADVHPADYPTVEAVKFMG
FT                   KQLAAASGGKLGVKVFPNGALGSEKDTIEQLKIGALDMMRINSSPLNNFVPETVALCLP
FT                   FVFRDTQHMRTVLDGPIGDEILAAMEPAGLIGLAYYDSGARSIYTVKAPVKSLADLKGL
FT                   KIRVQQSDLWVGMIQSLGANPTPMPYGEVYTALKTGLVDAAENNWPSYESSRHFEAAKF
FT                   YNITEHSLAPEVLVMSKKVWDTLSKDDQAMIRKAAKESVPVMRKLWDEREEASRKAVEA
FT                   AGVQVITVANKQEFVDAMKPVYQKFAGDEKLSSLVKRIQDTK"
FT   gene            133948..134493
FT                   /locus_tag="BRADO0119"
FT   CDS_pept        133948..134493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0119"
FT                   /product="Putative TRAP-type C4-dicarboxylate transport
FT                   system, small permease component (dctQ subunit)"
FT                   /function="4.9.A : Transporters of Unknown Classification"
FT                   /function="4.S.34 : citrate/succinate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1809844, 9287004; Product type pt :
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74090"
FT                   /db_xref="GOA:A4YJL4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74090.1"
FT                   /translation="MTDPHVGDHEHGEGRPSSGPLTRINAVVARLGMYLSVAGLLVIVT
FT                   IVFYQVFGRYVLNSSPTWTENLALVLILYVTLIGGAVGVRDAGHIGMDSLLVMLPDSTR
FT                   EKIELVIHVLVALFGVAMAYNGWILGASVGTVKIPNLGLPEVVRYIPLIASGILIVSFS
FT                   IEHIIALLRGEEVVPSWN"
FT   gene            134484..135776
FT                   /locus_tag="BRADO0120"
FT   CDS_pept        134484..135776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0120"
FT                   /product="putative TRAP-type C4-dicarboxylate transport
FT                   system, large permease component (dctM subunit)"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /function="4.S.34 : citrate/succinate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1809844, 9287004; Product type pt :
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74091"
FT                   /db_xref="GOA:A4YJL5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74091.1"
FT                   /translation="MELIILGATFFGFLILGVPVAFAIGLSAICTILYEGLPVAVIFQQ
FT                   MMSGMNIFSFLAIPFFVFSGELMLHGGVADKIVQLAKNLVGHIRGGLGMSNVVACTLFG
FT                   GVSGSPVADVSAMGAVMIPMMKKEGFDTDYAVNVTTHASLVGALMPTSHNMIIYALAAG
FT                   GKVSIGALIAAGLLPALVLMVCMLVAAYAVAVKRGYPAGKFPGWAEVARSFAAALPGLL
FT                   IVGIILAGILSGVFTATESAAVAVTYTIVLTFFIYRTMTLKNFLRAAAKAVKTTGVVLL
FT                   LIGVSTMFQYLMGLYEVADFAGDLMSKVSSQPWMIFLLINIILFLLGTFMDMAATILIC
FT                   TPIFLPIAMKAGMDPVQFGMLMLINCALGLNTPPVGTTQFVGCAIGGISVGAVMRTILP
FT                   FYAALIAALMFVTYVPAFSLWLPRLLMGYKG"
FT   gene            complement(136094..136858)
FT                   /locus_tag="BRADO0121"
FT   CDS_pept        complement(136094..136858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0121"
FT                   /product="conserved hypothetical protein; putative
FT                   transporter (Bacterial extracellular solute-binding
FT                   protein, family 3)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74092"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74092.1"
FT                   /translation="MTRLLALLAAISVLIGSAEARSLDAIRSLGQIGLCAHPNSLPFAS
FT                   KAGDPPGFQVEMGQALARELGVSLRLDWIITMFQMRAAGCDLVMDVIADPEALGEIRLK
FT                   TTKPYYHTGVALAVPQDSRLTSISGLDQTTKVGVQVGSIAAMLISQRHVPISTFGFEID
FT                   SLDALANHEIAAAAVTPANAAYYNQTHPDKTLRIIALDDSEPSLNWNVAIGMVRPDDAL
FT                   REAMETALARLRADGTVERIYARYGVTLQEPK"
FT   gene            complement(136941..137084)
FT                   /locus_tag="BRADO0122"
FT   CDS_pept        complement(136941..137084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0122"
FT                   /product="conserved hypothetical protein; putative
FT                   cytochrome c precursor"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74093"
FT                   /db_xref="GOA:A4YJL7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74093.1"
FT                   /translation="MDTQRSDDFIRNRIKVGKPGAMPAFGEAFTDVQIDAIIAYIRALK
FT                   PD"
FT   gene            complement(137689..139410)
FT                   /locus_tag="BRADO0123"
FT   CDS_pept        complement(137689..139410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0123"
FT                   /product="putative Quinoprotein ethanol dehydrogenase
FT                   family protein"
FT                   /function="1.1.5.2 : Ethanol degradation"
FT                   /function="4 : Transport"
FT                   /EC_number="1.1.99.8"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9826187, 15926796, 15608378; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74094"
FT                   /db_xref="GOA:A4YJL8"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74094.1"
FT                   /translation="MMKQRRRLAAPIALAITTTLAASVAAAQTVDTARIEAGGQNDWLT
FT                   YHGSYKSYHYSPLAQINASNVGNLGVAWIHIPGRSTRGLQSMPLAADGVLYYTGSYSRV
FT                   FALNGATGEVIWSYFPELDEALVARQTHSPYNRGVAIGEGKVFVGTMDGRLIALDMKTG
FT                   KLAWETKLLDSQKLTVGFTGAPLYANGNVVIGAQGGEWPGRGPIFGVNAATGAKKWEFL
FT                   TVAGTDEAQKSWGNDSWRTGGGGGWMPGTYDSETSTVWWGTANPAPLYDWSGGDWKTQG
FT                   ARPGDNLYTSSVIGLDIDSGKLKFHHQELPHDAWDFDSAVGEFVMLDRDGKKLTVHPNK
FT                   SGYIFVYDREAKVQNVWRITENSNFVKNIDPKTGELIGRRDFTAGKVSEPLCPHISGGV
FT                   SWNAGSYNPKTGLYYKLGQEWCMTLDIVKTTPVVAPQAQLNIGANFAIAKPPGGEIYGH
FT                   LDARDPVTGAKKWEVRFPEPPLASVLSTGGNLVFVPDSRGTVHAYDAESGTELWNHSDG
FT                   TGHQGGIISYAVNGKQYIAITAGFGGMAADDYAPTFGGVYKSMPRDDGALIVYSLK"
FT   gene            140245..141123
FT                   /locus_tag="BRADO0124"
FT   CDS_pept        140245..141123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0124"
FT                   /product="putative oxidoreductase; putative
FT                   3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 14646099, 12729017, 1339433; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74095"
FT                   /db_xref="GOA:A4YJL9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74095.1"
FT                   /translation="MAAIGFIGLGVMGEPICRNLARKSGATVLGFDRADAPLQRLAAVG
FT                   VIRAASLAELAREAELIFMALPSGKHVQSVCDGDDGLLRHAEARHTIVDLGTSPVQATR
FT                   ELATHFAAKGAAFADAPIARTRQAAEDGTLSVMVGADAATFERLRPLIAMFATDITHCG
FT                   GVGAGQVVKILNNMVLMQTVVALGEALETGKRAGLDPKLLFETLAKGSADSFALRNHGM
FT                   KAMLPDTYPERAFSTEYARKDIGYALDLARSVQIDLPGAELADRRLGEAIEAGYGDLYW
FT                   PVLARVIGASG"
FT   gene            complement(141449..141880)
FT                   /locus_tag="BRADO0125"
FT   CDS_pept        complement(141449..141880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0125"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74096"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74096.1"
FT                   /translation="MPEEPVWFDEHAVPRYCDFHPSRVANIYANEAALVEVTCQSCSRL
FT                   FHVAFAGCSRVLSAEEWPSGSIGQAIREKKLDYGDPPNVWCCPAGPSMNSLPRRVIQYW
FT                   RQGNPAFTVSDGHRRVVTDTRAYFTWTRHPEFEVDIDPD"
FT   gene            complement(143183..143269)
FT                   /locus_tag="BRADOtRNA50"
FT   tRNA            complement(143183..143269)
FT                   /locus_tag="BRADOtRNA50"
FT                   /product="tRNA-Leu"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            143495..144463
FT                   /locus_tag="BRADO0128"
FT   CDS_pept        143495..144463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0128"
FT                   /product="Conserved hypothetical protein; putative NAD
FT                   dependent epimerase/dehydratase family protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74097"
FT                   /db_xref="GOA:A4YJM1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74097.1"
FT                   /translation="MASNLDTLVTVFGGSGFVGRNVVRALAKRDYRIRVAVRRPELAGH
FT                   LQPLGRVGQIHTVQANLRYPDSVAAALRDSHVAINLVGILTESGAQTFDAVQAEGAATV
FT                   AKAAAAAGARMVQVSAIGADAESASAYARAKAAGEAAVLAAVPEAVIMRPSVVFGPEDQ
FT                   FTNRFAGLARIAPFLPLVGGGETKMQPVYVGDVATAVADAVDGKAQPGATYELGGPEVL
FT                   SFREILKIILDITDRDRALLPLPFGLAKLQATFLQFAPGPLKLTPDQVELLRHDNVVSE
FT                   AAKAAGLTLQGLGITPDSLEAVGPQYLWRFRPAGQFQRKNA"
FT   gene            complement(144576..145382)
FT                   /gene="uppP"
FT                   /locus_tag="BRADO0129"
FT   CDS_pept        complement(144576..145382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="BRADO0129"
FT                   /product="Undecaprenyl-diphosphatase (Undecaprenyl
FT                   pyrophosphate phosphatase) (Bacitracin resistance protein)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /EC_number="3.6.1.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15778224, 15138271; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74098"
FT                   /db_xref="GOA:A4YJM2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74098.1"
FT                   /translation="MMSDTLRAVLLGIVEGVTEFLPVSSTGHLLLAERFFGLGEDGFWK
FT                   SFAILIQLGAILAIVALYFFKLSRVAIGALTNPDDRRFIIGVLIAFLPAVIIGLIAGKY
FT                   IKALLFDPWVVCFSLIVGGAILLWVDQIDLKPREHDATRYPLMMYLWIGVAQCLAMIPG
FT                   VSRSGSTIVAAMLLGGDKRSAAEFSFFLAIPTMVGAFVYDFYKSRAEMTSDHLGLIAIG
FT                   FVVSFITAMIVVKAFLGYVTRHGFVLFAWWRVIVGTLGLIALALGK"
FT   gene            145741..146433
FT                   /locus_tag="BRADO0130"
FT   CDS_pept        145741..146433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0130"
FT                   /product="putative Glutathione S-transferase family
FT                   protein"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74099"
FT                   /db_xref="GOA:A4YJM3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74099.1"
FT                   /translation="MYTLYHHPFCPHSRFVRLVLGEYGLDLRLVEERAWERREAFLVLN
FT                   PAATTPVLAVEDMPPVPGVGVIAEFLDETCGVEAGDRRLMPATPAERIEVRRLMDWFNT
FT                   KFFEEASNLLVTERIYKRFMSEEDGGGPPSTDVIRAAKTNVRYHLAYIGWLAQRRNFLA
FT                   GDRLTYADLAAAAHLSAIDYLGDVPWIEDDAAKAWYARVKSRPSFRPLLSDWLAGVPAS
FT                   RTYVDLDF"
FT   gene            146583..147560
FT                   /locus_tag="BRADO0131"
FT   CDS_pept        146583..147560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0131"
FT                   /product="conserved hypothetical protein; putative
FT                   iron-sulfur cluster binding protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74100"
FT                   /db_xref="GOA:A4YJM4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74100.1"
FT                   /translation="MDWLAREPSRRTDPRTLWSEVRSVIMLGVNYGPDEDPRTILTQRS
FT                   GAAISVYARGDDYHDVIKKSLKTLARWLVANTGGDVKVFVDTAAVMEKPLAEAAGLGWQ
FT                   GKHTNLVSRGFGSWLFLGAIYTTLELPADAPERDHCGSCRACLDSCPTAAFPAPYTLDA
FT                   RRCISYLTIENKGPIPREFRKAMGNRIYGCDDCLAACPWNKFALEGREAKLAAREALRA
FT                   PSLAKLAELDDAAFRALFTKSAIKRIGRDRFVRNVLIAIGNSGDAGLAPAAKRLTSDPS
FT                   PLVRGAAAWALEQLLNRHAFAQAADAALAIEADDGVRAEWEAGC"
FT   gene            complement(147572..148357)
FT                   /locus_tag="BRADO0132"
FT   CDS_pept        complement(147572..148357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0132"
FT                   /product="conserved hypothetical protein, putative
FT                   alpha/beta hydrolase superfamily"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74101"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74101.1"
FT                   /translation="MNQAAETTDLPAFITVGIAESARQIAVRARSGTAPGLFWLGGFNS
FT                   DMKGTKAVALEAWAAERGRACVRFDYSGHGESGGRFVDGTIGRWLEESVAVFRQFCRGP
FT                   QVVIGSSMGGWMALLLARELSKHPGEATLAGMVLIAPAPDFTEELMWRGFSLEVRREIE
FT                   TNGVWMRPSEYGEPYPITRALIEDGRHHLLLGSAINVGCPVRILQGAQDPDVPWQHAFA
FT                   LAQRLPAEDVVLTMIQDGDHRLSRPQDIARMLAAVGEMG"
FT   gene            148620..149222
FT                   /gene="infC"
FT                   /locus_tag="BRADO0134"
FT   CDS_pept        148620..149222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="BRADO0134"
FT                   /product="Translation initiation factor IF-3"
FT                   /function="2.3.2 : Translation"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74102"
FT                   /db_xref="GOA:A4YJM6"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74102.1"
FT                   /translation="MPAKASSFKLAAFFHNLGELPIRRPNRAPPAAVKDGPRTNDEIRN
FT                   AQIQLIDAEGTNRGVVETVVAIKMAAEAGMDLVEISPNNSPPVCKIMDYGKYKYSAQKK
FT                   AAEARKKQKVVEIKEIKLRPMIDDHDYDVKMRAMQRFFEEGDKVKITLRYRGREMAHQE
FT                   IGTKLLDKVKSDVAAFAKVEQDAKFEGRQVVMVLAPR"
FT   gene            complement(149315..149680)
FT                   /locus_tag="BRADO0135"
FT   CDS_pept        complement(149315..149680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0135"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74103"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74103.1"
FT                   /translation="MVRITRSAPAAILAAAAIWSSAPARAAGFDGAWTVLIITEAGNCD
FT                   QGYSFPIQISGGRVTSASSANITGTVGRGGAVTVRVSQGGSSASGNGRLGSTSGFGRWS
FT                   GKGSAGSCSGRWQATRS"
FT   gene            149944..150144
FT                   /gene="rpmI"
FT                   /locus_tag="BRADO0137"
FT   CDS_pept        149944..150144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="BRADO0137"
FT                   /product="50S ribosomal protein L35"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74104"
FT                   /db_xref="GOA:A4YJM8"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74104.1"
FT                   /translation="MPKLKTKSGAKKRFKVTGTGKVMHAQRGKRHGMIKRTKKQIRQLR
FT                   GTRVLFKTDGDNVKKYFLPNA"
FT   gene            150217..150576
FT                   /gene="rplT"
FT                   /locus_tag="BRADO0138"
FT   CDS_pept        150217..150576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="BRADO0138"
FT                   /product="50S ribosomal subunit protein L20"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74105"
FT                   /db_xref="GOA:A4YJM9"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74105.1"
FT                   /translation="MSRVKRGVTAHAKHKKVYKAAKGFYGRRKNTIRAAKAAVEKAGQY
FT                   AFRDRKRKKRTFRALWIQRLNAAVRPFELTYSRFIDGLSKSGITVDRKVLSDLAINEPA
FT                   AFEAIVVKAKAALAA"
FT   gene            150720..151802
FT                   /gene="pheS"
FT                   /locus_tag="BRADO0139"
FT   CDS_pept        150720..151802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="BRADO0139"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain
FT                   (Phenylalanine--tRNA ligase alpha chain)"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.1.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1451792, 2127701; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74106"
FT                   /db_xref="GOA:A4YJN0"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74106.1"
FT                   /translation="MSDLASLETSILDQIAAAGDEAALEAVRVAALGKKGSISALLATL
FT                   GKMSPDERKTQGAAINLAKDKVTQALSARRDVLKAAALDARLAAETIDVTLPLQDTPAD
FT                   TGRIHPLSQVMDELTTIFADMGFSIAEGPDVETDDYNFTKLNFPEGHPAREMHDTFFFN
FT                   PKEDGSRMLLRTHTSPVQVRTMLSQKPPIRVICPGRTYRIDSDATHTPQFHQVEGLVID
FT                   KGSHLGHLKWILHEFCKAFFEVDHINMKFRPSFFPFTEPSLEVDIQCRRDKGEIRFGEG
FT                   EDWLEILGCGMVHPNVLRACGIDPDEYQGFAWGMGIDRIAMLKYGMSDLRQLFEGDVRW
FT                   LSHYGFKPLEVPTLAGGLST"
FT   gene            151799..152215
FT                   /locus_tag="BRADO0140"
FT   CDS_pept        151799..152215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74107"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74107.1"
FT                   /translation="MSVEIVPAAYRGLRSFAFGDGPELADKLLDLVIKGVKTATCSTED
FT                   EPNTSKPGERWIVLDGQGRPRCVIESTEISYRRFDEVDAAFAFDEGEGDRSLNYWREAH
FT                   RTYFTRLGKFSDTMMLMCERFRLVEVFADRRIAS"
FT   gene            152212..154620
FT                   /gene="pheT"
FT                   /locus_tag="BRADO0141"
FT   CDS_pept        152212..154620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BRADO0141"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain
FT                   (Phenylalanine--tRNA ligase beta chain)"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.1.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1451792, 2127701; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74108"
FT                   /db_xref="GOA:A4YJN2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74108.1"
FT                   /translation="MKFTLSWLKDHLDTDEPVEKLADKLTMIGLEVEHLEDKAKLLAPY
FT                   KIARVVSAEQHPNADRLRVCMVDTGDGGAPVQVVCGAPNARAGLVSVFSPPGTYIPGKN
FT                   ITLSVGTIRGVESRGMLCSEAELELSENHDGIMELPADAPIGKPYAEWAGLGDPLFEIN
FT                   LTPNRQDCTGVHGIARDLAAADMGKLKDPGIKPIKGEFPCPVKVAVEDEKLCPGFALRL
FT                   VRGVKNGPSPKWLQQRLASIGLRPINALVDVTNYMTFDRARPLHVFDARKVKGNLVVRR
FT                   ARDGETLLALDGRTYTLDHSMCVIADDAGVESLAGIMGGEASGCDEGTTDVLIESALWN
FT                   EINIAQTGRKLGINSDARYRFERGVDPAFMVPGLEMATKLVIDLCGGSPSENVVVGNAY
FT                   GDDRIIDFPVAEVKRLAGIEVPFAEMRHILTHLGFTLAGSGPVVKVAVPSWRSDVHGKA
FT                   DLVEEIVRMVGVDKVPMTPFERGDAPRKPVLTQLQLRTRRAKRALAARGMVEAVTWSFI
FT                   SKPAAKLFGGGKPELALANPIASDLSDMRPSLLPGLIATVQANADRGFGDAAIFEVGQT
FT                   FRGDRPEDQFVAASGIRRGIASSKGHGRHWTGSQPANAYDAKADAFAVLAAAGAPMSSL
FT                   QIVAGGPAWMHPGRSGTIQMGPQNVLGHFGELHPRTLEALKADGPLVAFEVILDRIPAA
FT                   KAKPTRAKPVLELSAFQPVSRDFAFIVDRKVKAGDIVKAAQGVDKKLISDVTVFDVYEG
FT                   KGIEDGKKSVAIAVTLQPRDKTMTDEEIDAVAAKVTADVAKKTGGTLRG"
FT   gene            154617..155408
FT                   /locus_tag="BRADO0142"
FT   CDS_pept        154617..155408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0142"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74109"
FT                   /db_xref="GOA:A4YJN3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74109.1"
FT                   /translation="MSLQELIRTELIPADLSLFATVALAIVALIAATARGFSGFGAALI
FT                   FMPLASSFATPRLVAPLLLVIDFVSMAPTVPGAWREADRKATAVIVTGALIGVPLGTYF
FT                   LTRLDPVTVRWIITGFVAALLALLISGWRYRGKDYAGLSVAVGAVSGFCSGVAQTGGPP
FT                   IVGYWLGRPIEAKIARANIVLFFGASDCFAMVSYATSGLITWDSLKLSLLIGPVYALGV
FT                   AFGATLFGRASERLFRVICYALIAIAVIFGLPALDGVLGRG"
FT   gene            155442..156386
FT                   /locus_tag="BRADO0143"
FT   CDS_pept        155442..156386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0143"
FT                   /product="putative hydrolase; putative Metal-dependent
FT                   hydrolase of the beta-lactamase superfamily III"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8535517; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74110"
FT                   /db_xref="GOA:A4YJN4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74110.1"
FT                   /translation="MINRRTMLSLAMGTAGAMVAPSVFAQGPKTGTRIIFLGTKGGPRV
FT                   GIGASNPANLVVVNGTPFVIDCGMGVSRQLVSAGVPIPSVKYILISHHHSDHNLEYGNL
FT                   FYNAWAAGLSTPIQSFGPKGLEAMTRSFWETNKFDVDTRIDDEGRPDPRPMLIAKDIDA
FT                   DGVVVKTADVTVTAFRTPHPPITDNFAYKFETPDGTIVFSSDTAYNPKLADFAKGADVL
FT                   VHECLYVPAVDRLVIKTKNGSTLKKHLLESHTTTEDVGRIAAAAGVKTLVLSHFVPGDD
FT                   PEVTDEDWTRDVKKNYTGRILVAKDLMELKLPV"
FT   gene            complement(156542..157951)
FT                   /locus_tag="BRADO0144"
FT   CDS_pept        complement(156542..157951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0144"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide; putative Flavin containing amine oxidoreductase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74111"
FT                   /db_xref="GOA:A4YJN5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74111.1"
FT                   /translation="MSFTRRGFLSASAALAATSMFGRTLAAAPPRDADIVVIGAGAAGI
FT                   AAARRIVAANRKVVLLEASSQIGGRCSTDLTTFSVPFDRGARWLFGADSNPIGKLARGV
FT                   GLDVVAAPVGQKIRVGRRNARPGETEQFLAGLVRANRAIDEASRGKLDTSCAAALPKDL
FT                   GDWTSTTAFVLGAGATGKDLADLSVMDKARAQDRSAPLACRQGLGTLVAKLGDGLPVSL
FT                   STPATRIVWSNREVAVETPAGRIAARAVILTVSTNVLTSGAIKFTPELPKRQLDAAAKL
FT                   SLGSTDHIALMLTGNPLGLSRDDVIVEQSSSNRTGLLLANIGGSSLCTIDVAGGFGREL
FT                   SAQGEAAMTAFGKEWIGKLFGSEAAAAVKSSAATRWNQVPGVLGAMSAAAPGSQGARKI
FT                   LSEPLGPLFLAGEATHETLWGTVDGAWDTGERTAEAALRRIGALKDPEPEQASERKRLG
FT                   RRKVRSASPED"
FT   gene            158146..159123
FT                   /locus_tag="BRADO0145"
FT   CDS_pept        158146..159123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74112"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74112.1"
FT                   /translation="MGIVLDQIGKLIAAYLQKEIPGYEPFTPSDPDYLRKDIQPGDVLL
FT                   VEGNSRISGIIKYLTQSTWSHAALYVGPIDGAVEPDGEPHVLVEAYVGDGVISAPLSKY
FT                   FAYHTRVCRPVGLTFEDRHTVCRYAINRIGFGYDTKNIIDLMRYLIPMPIPQRWRRRMI
FT                   ALGSGDPTKMICSALIAQAFDAVRYPILPKITRAPSRRAKREILHIRDSSLYMPRDFDI
FT                   SPYFEIVKPTIVNGFDYTMLHWADKQKPLAEVAGEFAVFPGSVKAPPLVPETVDEEAAQ
FT                   PAAAEEVVEVLGERLVVSEHFLVSEPVRKLAPRPAARRRNRVAV"
FT   gene            complement(159126..159401)
FT                   /locus_tag="BRADO0146"
FT   CDS_pept        complement(159126..159401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74113"
FT                   /db_xref="GOA:A4YJN7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74113.1"
FT                   /translation="MRDDIKTSCQKRLSRIEGQVRGLSKMVEDNRYCIDIVTQISAVRA
FT                   ALRRVEEEILRDHVSHCVEHAIASGDKADQRQKIAELMDVISRSDR"
FT   gene            159669..162137
FT                   /gene="actP"
FT                   /locus_tag="BRADO0147"
FT   CDS_pept        159669..162137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="BRADO0147"
FT                   /product="copper-transporting P-type ATPase"
FT                   /function="4.3.A.3 : The P-type ATPase (P-ATPase)
FT                   Superfamily"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /function="4.S.36 : Cu"
FT                   /EC_number="3.6.3.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11936079; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74114"
FT                   /db_xref="GOA:A4YJN8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74114.1"
FT                   /translation="MSVDPATSTHRFEHDGRTFHFCCAGCRTKFAADPAKYLAPAAASA
FT                   TTGACCGGHEHHAHDAAKVMDPVCGMSVDPATSKHRFDHQGHTFHFCSAGCRTKFAADP
FT                   ATYLETRAPPPEMPAGTIYTCPMHPQIRQEGPGTCPICGMALEPDVISLDDAPNPELAD
FT                   MTKRFWIGAVLAAPVVVLEMGGHIVGGHGLIDPVLSTWIQFALATPVVLWAGWPFFVRG
FT                   WQSVQTRNLNMFTLIAMGTGVAYVYSVIATLMPQAFPPAFRGHGGTVAVYFEAASVITI
FT                   LVLLGQVLELRAREATSGAIKALLQLAPKTARRLDADGNDHEVEIAELAAGDRLRVRPG
FT                   EKVPVDGIILEGRSSLDESLVTGESMPVTKDEGERVIAGTLNQTGSFVMRADKVGRETL
FT                   LSQIVQMVADAQRSRAPIQRLADQVAGWFVPTVIAAAITAFIAWYAFGPEPRFAFGLVA
FT                   AVSVLIIACPCALGLATPMSIMVGVGRGAEAGVLIKSAEALERLEKVDTLVVDKTGTLT
FT                   EGKPKVTGIVTAQGVDEAEAIRLAASVERASEHPLAEAIVRHATERKIKLDDVKNFDAP
FT                   TGKGASGEVDGKAVVLGNPTYLASLGIITDTLGVASKRLREDGATVITMAVDGKPAALF
FT                   AIADPVKASTPDALKALAADGIKVIMLTGDNRTTATAVARKIGITEVEAEVLPEQKSAV
FT                   VARLRASGKVVAMAGDGVNDAPALAAADVGIAMGTGTDVAMESAGVTLLQGDLGGIARA
FT                   RKLSAAVMSNIRQNLFFAFIYNAAGIPIAAGILYPVFGILLSPIIAAAAMSLSSVSVVG
FT                   NALRLRAARL"
FT   gene            162348..163100
FT                   /locus_tag="BRADO0148"
FT   CDS_pept        162348..163100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0148"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74115"
FT                   /db_xref="GOA:A4YJN9"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74115.1"
FT                   /translation="MIDAAFKALSQILSPPMRSILYRSIGLALVLVTVLAIGLQRLLSW
FT                   LATAGEGWAEAMLGPGSHGALEVLTWIISIAAGFGVVFGGIMLMPAITSLIASLFVDDV
FT                   ADLVEREHYPAERPGVALPFGIAIAEGLKAAGLTILVYLIALPFVFLAGAGFVIFFIAT
FT                   AWLLGREYFELAAMRFRPPAEAKAMRRDNAVTVFTAGLIIAAFVTIPIVNLATPLFGMA
FT                   FMVHLHKRLSGPRPELIEPSPERRLRSL"
FT   gene            complement(163038..164657)
FT                   /locus_tag="BRADO0149"
FT   CDS_pept        complement(163038..164657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0149"
FT                   /product="putative Multidrug resistance protein (drug
FT                   efflux transporter, EmrB-like) (MFS superfamily)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /function="4 : Transport"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1409590; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74116"
FT                   /db_xref="GOA:A4YJP0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74116.1"
FT                   /translation="MSAAAEPEDRPSLATWLGFVLMCVGMFMAILDIQVVATSLPTIQE
FT                   ALGITPDAMSWIQTAYLIAEIIAIPLTGLLTRVFTLRWLFTGAVSVFTAASLGCALSGS
FT                   FHMLLAFRVLQGFFGGLLIPVVFSAVFLLFPSRLHAVATTIAGVVAVLAPTIGPVVGGF
FT                   ITNTWSWPWLFLINIVPGLIAAAATPALLPKQGMDLEELDKLDLLALLLLAVSLAGLEL
FT                   GLKAAPKSGWLSSNCLALLVLSASCLTLLIQRLLAAADPILRIGSFQRRAFTLGCVSSF
FT                   CLGIGLFGSVYLMPVFLAFVRGHDAFEIGKIMLVTGVAQLVAAPLVTALDGKVDARLLT
FT                   AFGFVLFSAGLAASAFQPPSADYQEMFWPQVVRGVGIMFCLLPPTRIALGDLPPAEVAD
FT                   ASGLFNLMRNLGGAIGIALIDTIIYGRVTLHAQAFRDRLMAGDTAAAKAIGLAPELLRN
FT                   RPRNISEEQAIAYVRPLVEKASLALCVNEAWSLLAGIALLGFLLIPFARNKPVSATPQR
FT                   MALEAAQPSLRRRLDQLGSRSG"
FT   gene            complement(164654..165136)
FT                   /locus_tag="BRADO0150"
FT   CDS_pept        complement(164654..165136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0150"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide; putative Isoprenylcysteine carboxyl
FT                   methyltransferase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74117"
FT                   /db_xref="GOA:A4YJP1"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74117.1"
FT                   /translation="MQRLGELVLARHNTKRLRAMGAVEVGADHYPLMISMHAAWLVSLW
FT                   LLGVDQEVDPWLLSAFVALQGLRWWVLATLGPRWTTRIIVLPGAPLVNDGPYRYISHPN
FT                   YLVVTAEIALLPLALHLPLLALIFSGLNAAVLFIRIRAESEALSGVAGDGIGGQTA"
FT   gene            complement(165169..166221)
FT                   /locus_tag="BRADO0151"
FT   CDS_pept        complement(165169..166221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0151"
FT                   /product="putative Type III polyketide synthase; putative
FT                   chalcone synthase"
FT                   /EC_number="2.3.1.74"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12636085, 12502351; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74118"
FT                   /db_xref="GOA:A4YJP2"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74118.1"
FT                   /translation="MDHTAALVSLATAVPPHQFRQNEVMEAARVVLAPRFPQFDTMASL
FT                   FANTGIRARYGVKPIEWYMERRGWPERTEAYLAGAEALFVEATNKALAQADLRADEIDT
FT                   IVSVSSTGIATPTLEARVAGRMGFRSDVSRVPVFGLGCAGGVSGLSIAARLAQARPGTN
FT                   VLFVTFELCTLAVRHDELSKANIVALSLFGDGAAAAILRAGDGGATRVEATGEKLWPDT
FT                   LDIMGWSVDPEGFGVIFQRTIPDFVTENMGPAVNEILGNMKLSATDVDRFVCHPGGAKV
FT                   ITALERALSIGQGTLDHEREIIADYGNMSAPTVLFVLERARARGLPPRSVLTALGPGFT
FT                   AACVSLRHAA"
FT   gene            complement(166604..167437)
FT                   /gene="nth"
FT                   /locus_tag="BRADO0152"
FT   CDS_pept        complement(166604..167437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="BRADO0152"
FT                   /product="endonuclease III DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.5 : DNA degradation"
FT                   /function="5.6.1 : Radiation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.2.99.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2669955, 1411536, 7664751, 8092678; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74119"
FT                   /db_xref="GOA:A4YJP3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74119.1"
FT                   /translation="MAKITRPQRAKPAPVRTPARKAAKAAPGAASKSASKTVKKAAKIS
FT                   PAAKLKAGSVKPVKKAFKATKPWTPMEIREAFSRFAQANPEPKGELEHLNPYTLLVAVV
FT                   LSAQATDAGVNKATRPLFAVADTPQKMLALGEDTVRDYIKTVGLFRTKAKNVIALSQKL
FT                   IAEFGGEVPRTRAELESLPGAGRKTANVVLNMAFGEHTMAVDTHVFRVGNRTGLAPGKT
FT                   PLEVELGLEKVIPAEFMLHAHHWLILHGRYTCLARKPRCELCLIKDLCRWPEKTA"
FT   gene            167460..167993
FT                   /locus_tag="BRADO0153"
FT   CDS_pept        167460..167993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0153"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74120"
FT                   /db_xref="GOA:A4YJP4"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74120.1"
FT                   /translation="MTPGNAFAYQETGTDAADPELFSARLRPHRSLGRTGFLALMAVVC
FT                   AISFIGGIASVMMGAWPVLGFFGLDALAIYWAFRVNFRRANAYEDVTITLTELRLRRVS
FT                   HKGHVMEWRFNPLWVRLDQETHEEFGIERLYLVARGQRVSIASFLGPEEKASFAKALTA
FT                   GLQAAKRGPVLNPL"
FT   gene            168384..169283
FT                   /locus_tag="BRADO0154"
FT   CDS_pept        168384..169283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0154"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase (O-6-methylguanine-DNA alkyltransferase);
FT                   putative ADA regulatory protein"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.2 : Activator"
FT                   /function="3.1.2.3 : Repressor"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 2987251, 2982792, 8156986, 3529081;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74121"
FT                   /db_xref="GOA:A4YJP5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74121.1"
FT                   /translation="MMTLAIHDSALAKPGPQQSAALRDYDAVRRAIAFISEHWRRQPTI
FT                   EDMADAASLTPDELHHLFRRWAGLTPKAFMQALTLDHAKGLLKGSASVLDAALDSGLSG
FT                   PGRLHDLFVTHEAMSPGEWKTGGAGTTLRYGFHPCPFGMALVMATPRGLAGLAFADPGE
FT                   EAGALADMKSRWPRATYVEDVPGTAALAQRIFDKNHWRPEQPLRVVLIGTDFEVRVWEA
FT                   LLKIPMGRAVCYSDIATRLESPKASRAVGAAVGKNPISFVVPCHRALGKTGALTGYHWG
FT                   LTRKQAMIGWEAGQVGMG"
FT   gene            complement(169380..169721)
FT                   /locus_tag="BRADO0155"
FT   CDS_pept        complement(169380..169721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0155"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74122"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74122.1"
FT                   /translation="MGAKERVSDAYRRDDVTAVLLVHVEQAIYTGEQFSDAHPWQATAT
FT                   KKSLLRGAYSGSQVTLYGGQGSAACDLGYVIPRVGDEWVVYISKTSGLAQVALPKRVAL
FT                   EADPSIRER"
FT   gene            complement(170071..170355)
FT                   /locus_tag="BRADO0156"
FT   CDS_pept        complement(170071..170355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0156"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74123"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74123.1"
FT                   /translation="MARLQTKKQAAVTTGSAENNRHSLRDGLHAYTQSPWCAGLVGHNA
FT                   ATMLAHCAGDTSIGVSGRCDFTSTVQPFVGAPEDTLRQTAAIASPPRVS"
FT   gene            complement(170819..171442)
FT                   /gene="gpmA"
FT                   /locus_tag="BRADO0157"
FT   CDS_pept        complement(170819..171442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="BRADO0157"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase (Phosphoglyceromutase) (PGAM)
FT                   (BPG-dependent PGAM) (dPGM)"
FT                   /function="1.1.1.23 : Galactose degradation"
FT                   /function="1.3.1 : Glycolysis"
FT                   /function="1.7.8 : Gluconeogenesis"
FT                   /EC_number="5.4.2.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11983902, 8765231; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74124"
FT                   /db_xref="GOA:A4YJP8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74124.1"
FT                   /translation="MSERLLVLVRHGQSEWNLKNLFTGWKDPDLTAQGVSEAKDAGRKL
FT                   KAHGLSFDVAFTSELTRAQHTLKLILDELGQPGLPTSKNLALNERDYGDLSGLNKDDAR
FT                   AKWGEEQVHVWRRSYDVPPPGGESLKDTLARALPYYVQEILPGVLNGQRTLVAAHGNSL
FT                   RALIMVLEKLTPEGILKRELATGVPIIYRLKADSTVESKLDLAG"
FT   gene            complement(171467..172285)
FT                   /gene="dapB"
FT                   /locus_tag="BRADO0158"
FT   CDS_pept        complement(171467..172285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="BRADO0158"
FT                   /product="Dihydrodipicolinate reductase (DHPR)"
FT                   /function="1.5.1.7 : Lysine, diaminopimelate"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.3.1.26"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12962488, 8990304, 7893644; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74125"
FT                   /db_xref="GOA:A4YJP9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74125.1"
FT                   /translation="MSRMRLIVAGAGGRMGRALVRAIADSDGAELAGALEAPGSELIGK
FT                   DSGLLAGLPANNIKLSADLWAMSAEADGILDFTVPAATIANVAIAAERGIVHVVGTTGL
FT                   SASDDAVIKSVTKRAIVVQSGNMSLGVNLLSALVKQVAKSLDANFDIEILEMHHKHKVD
FT                   APSGTALMLGRAAAEGRGITLDGHSARGRDGITGARRSGDIGFASLRGGTAAGDHSVIF
FT                   AGPSERLVLSHQAEDRMIFAHGALKAALWAHGKPPGYYTMDDVLGLKDLF"
FT   gene            complement(172367..172669)
FT                   /locus_tag="BRADO0159"
FT   CDS_pept        complement(172367..172669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0159"
FT                   /product="conserved hypothetical protein; putative Dimeric
FT                   alpha-beta barrel domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74126"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74126.1"
FT                   /translation="MPKAYWIARIDVHNMDGYKEYVAQNGAVFHQYGAKFLVRGGQYET
FT                   REGTSRSRNVVIEFKDYETALACYNSPEYQRLVAMRAPHSEGDLVIIEGYDGPQP"
FT   gene            complement(172703..173434)
FT                   /gene="pyrF"
FT                   /locus_tag="BRADO0160"
FT   CDS_pept        complement(172703..173434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="BRADO0160"
FT                   /product="Orotidine 5'-phosphate decarboxylase (OMP
FT                   decarboxylase) (OMPDCase) (OMPdecase)"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /function="1.5.2.2 : Pyrimidine biosynthesis"
FT                   /EC_number="4.1.1.23"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11251836, 10972799; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74127"
FT                   /db_xref="GOA:A4YJQ1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74127.1"
FT                   /translation="MPTEIAPCDRLIVALDVPSVADAEVMIATLGDAVTFYKIGMELTY
FT                   AGGLGLAERLAADGKQVFMDLKLHDIPNTVERATRQIAKLGVRFLTVHGFSQSMKAALA
FT                   GAAGSPLELLAVTVMTSYDDADLATAGYAMTVKELVAHRAVQARDIGIHGLILSPEETQ
FT                   LVRPLVGPDMQLVTPGIRPAGSDVGDQKRIMTPALAIAGGADRLVVGRPVTGAADPAAA
FT                   AEAIVADIATAVALVGKTNRS"
FT   gene            complement(173441..174052)
FT                   /locus_tag="BRADO0161"
FT   CDS_pept        complement(173441..174052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0161"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /EC_number="1.5.1.29"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9108282, 11251836; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74128"
FT                   /db_xref="GOA:A4YJQ2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74128.1"
FT                   /translation="MCAAGRRPVRPMSALKILIIPGSTRSGSHNVRLAAFAAHQFVQAG
FT                   ADVTRISLADFPLPLYEADVEAAAGVPREAVNLKRMISAHHGVLLVPPEYNASVPPLVS
FT                   NAIAWLSRVDEPPEGRGAVFRNRPFAIASASENRFGGVRGLSALRLMLTACNALVIPSQ
FT                   LALAFADKAYNDMDRLRLPADIAALDALVKQLIHSAQHTN"
FT   gene            complement(174065..174667)
FT                   /gene="pmtA"
FT                   /locus_tag="BRADO0162"
FT   CDS_pept        complement(174065..174667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /locus_tag="BRADO0162"
FT                   /product="phospholipid N-methyltransferase"
FT                   /function="1.6.1 : Phospholipid"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11251836, 10613857, 9108282; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74129"
FT                   /db_xref="GOA:A4YJQ3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74129.1"
FT                   /translation="MPLQTSVRASKKPLRLDDEVRFLRSWIEKPLHMGAVMPSGRLLAR
FT                   TMAQYVDPHGTGPVIELGPGTGAITAALVEHGIDQKRLVLVEYNPSFCALLRDRYPHAK
FT                   VVQGDAYRLRDTLWNVLGAPASAVVSGLPLVTKPMLTRMKLVRDAFAAMSPNAPFVQFT
FT                   YSVVPPIPKSLPGVTTQASERIWMNLPPARVWVYRKP"
FT   gene            complement(174885..176015)
FT                   /gene="dnaJ"
FT                   /locus_tag="BRADO0163"
FT   CDS_pept        complement(174885..176015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="BRADO0163"
FT                   /product="Chaperone protein dnaJ, heat shock protein
FT                   (Hsp40), co-chaperone with dnaK"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="7.1 : Cytoplasm"
FT                   /function="5.5.1 : Osmotic pressure"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9061015; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74130"
FT                   /db_xref="GOA:A4YJQ4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74130.1"
FT                   /translation="MSTKRCYYETLEVERDADETKLKSAFRKLAMKWHPDKNPGDASSE
FT                   VKFKEINEAYEVLRDADKRAAYDRYGHAAFEQGAGGGPHGFGAGFASSFSDIFEDLFGM
FT                   AGQRRGGTGRERGADLRYNMEITLEEAFLGKTAQIEIPVSVTCEPCSGTGAKAGTKPKT
FT                   CAMCGGAGRVRQAQGFFTLERTCPGCHGRGQMIEDPCPSCSGSGRVTRDRTLSVNIPQG
FT                   VEDGTRIRLAGEGEAGLRGGPPGDLYIFLSLTPHEFFQRDGADLHCRVPISMVTAALGG
FT                   EFEVPTIDNGKTKVKIPAGAQSGRRFRIAAKGMPVLRSRQTGDMYVQIVVETPQNLTKK
FT                   QQELLAEFEKLSSGATQPEAAGFFTKVKDFFGKAAS"
FT   gene            complement(176158..178053)
FT                   /gene="dnaK"
FT                   /locus_tag="BRADO0164"
FT   CDS_pept        complement(176158..178053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BRADO0164"
FT                   /product="Chaperone protein dnaK (Heat shock protein 70)
FT                   (Heat shock 70 kDa protein) (HSP70)"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="5.5.1 : Osmotic pressure"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9108282, 10613857; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74131"
FT                   /db_xref="GOA:A4YJQ5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74131.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKSSKVIENAEGMRTTPSIVAFSDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKKLVPYKIVKAGNGDAWVE
FT                   ADGKTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKSKSGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVSYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVADLVEKTIEPCRKALKDAGLTAGEIGEVVLVGGMTR
FT                   MPKIQEMVKQFFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIDKMVKDAEAN
FT                   AAADKKRREAVDAKNHADALVHSTEKALAEHGSKVADTERRAIEDAVSDLKEALKGDDA
FT                   EAIKTKTNTLAQASMKLGEAMYKQQAESDAARDAAKDDVVDAEFTEVDDDKKKSA"
FT   gene            178591..179526
FT                   /locus_tag="BRADO0165"
FT   CDS_pept        178591..179526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0165"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74132"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74132.1"
FT                   /translation="MMFSRLVAVALASIALLEPALAADAIYPSGVRIGLAPLVGLAKAK
FT                   NFPGFETEDGSVKVLLTELPAKAYGEVKTAFTANPGGTGGIKPESIETSAGTAYYTVEN
FT                   GRDGATPVRRYSMILPGAGFSGYVAVQVPETAGKIYTDDAVRQMFASAVVRKEVPVDEQ
FT                   LSTMPFNVTELSGFKTVRTLGPGALILADGDEEKGFEAAPFVVIGLVAGAAPEAGDRGR
FT                   VAQQAATTIPGVREARITMSEPIRIDGLPAYETRVEAVSGKDNTPVTVVQWLRFGGPST
FT                   LRIIGSAPRDQWSAAFPRFRAVRDGIQPKG"
FT   gene            complement(179537..180232)
FT                   /locus_tag="BRADO0166"
FT   CDS_pept        complement(179537..180232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0166"
FT                   /product="conserved hypothetical protein; putative
FT                   S-adenosyl-L-methionine (SAM)-dependent methyltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74133"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74133.1"
FT                   /translation="MDKAEFDRFADAYEDQHRANIAVTGEGPEYFAEYKIRMLRQIADL
FT                   RGLDVAQICDFGAGIGNSIPFFRRYFPQAALTNADVSERSLALARQRHPGGGESLLIEQ
FT                   DHIPSEAGRFDLVFSACVFHHIPHDQHVGWLRELHRITRSGGLIAVFEHNPLNPLTVHA
FT                   VNTCPFDENAQLISARALAQRLRDAGWDAPRIHYSLFFPRALAWLRPIEELLGWLPLGA
FT                   QYVALARKA"
FT   gene            180504..181550
FT                   /locus_tag="BRADO0168"
FT   CDS_pept        180504..181550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0168"
FT                   /product="putative glycosyl transferase, family 2"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74134"
FT                   /db_xref="GOA:A4YJQ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74134.1"
FT                   /translation="MFVSIVVPCYNEADGLREFHRRTTAAARALCGNRFELILVDDGST
FT                   DQTWPIINELLAEDRNVVAVKLARNHGHQLALTAGLSTVRGDLVLVIDADLQDPPELLK
FT                   PMYETMAREGADVVYGQRRSRAGETRFKTWSAEAFYRLLARITRVQIPVDTGDFRLMSR
FT                   RISDQLVQMPEHDRFIRGMVAWLGYKQVAFEYDREPRFAGSTKYPLLKMISFAADALIS
FT                   FSMVPLRIATYVGALLTTVLSFVGVAAVISWIFSGTVPGWTSLTLLVVMISSVQLLVLG
FT                   LIGEYVGRIYIQSKNRPLFMISQIHRRGRVPQLSTDRLPETESPPLNTLLAQSGPELRR
FT                   SLREETSS"
FT   gene            181547..182146
FT                   /locus_tag="BRADO0169"
FT   CDS_pept        181547..182146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0169"
FT                   /product="hypothetical protein; putative methyl
FT                   transferase"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74135"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74135.1"
FT                   /translation="MKELLKHPALYQAYQNAGGFFGARIKAIRDYLTLRPGMRIIDIGC
FT                   GPGYILRHLPEGIDYTGFDVDAAYIAHAQRAFGHLGAFHCRHFDADAARELAGADVVMM
FT                   NGVLHHIGDDELKTTLANIRDVLAADGALFTLDGCYREGQSRIAKWLLDNDRGDFVRDR
FT                   AGYYDLLRSAFSRVRLEIHDDYSRVPYTFAIGVARK"
FT   gene            complement(182147..183664)
FT                   /locus_tag="BRADO0170"
FT   CDS_pept        complement(182147..183664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0170"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74136"
FT                   /db_xref="GOA:A4YJR0"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74136.1"
FT                   /translation="MSTPIDAVTRQTLAPPARERLAVAPWLLIGVVFVAAVLLRQVVPL
FT                   NTDVSWLLVVGERMLDGQKLYRDIIEINPPMAAFAYLPGVALGRLLHVDPRHVIDAQLL
FT                   VLAAVSLYATSRIVRLSPRMAALSWGPFAVWAAAVVTILPMHVFGQREHFATLTFLPGL
FT                   AVYALRSNREEVPAWAILAAGIGVGITLAFKPFFTFPAAFCILAGAIRARSWRQLFVPE
FT                   NIIAGVIVCIVSVGTYLLYPEYFTVTYPLVRDTYLSWSMSASVIFVNAATLLLVVALAS
FT                   IALTRRSGRLEGPLLVLVLASLGFAISFYLQRRGWSYHSYPMVAMAMLTMGNAMLVHAD
FT                   PSAAVRRSGTASMLILTAAFALGLQWFNARVHVGPLPEALAKLKPQPRLLVLSGEAAIG
FT                   HPMVRDLGGTWVSRQENLWIREFVRLTRERTAVDAATEAKLNGYLALERNWLIADFKAA
FT                   APDIVLVDNLRDGWGDWARADAELVELLKPYRLVGTVEGVDILERTK"
FT   gene            complement(183959..184579)
FT                   /gene="grpE"
FT                   /locus_tag="BRADO0171"
FT   CDS_pept        complement(183959..184579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BRADO0171"
FT                   /product="Protein grpE (HSP-70 cofactor)"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="5.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8890154; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74137"
FT                   /db_xref="GOA:A4YJR1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74137.1"
FT                   /translation="MTDPDLHQNDPENPAQASEPVVSKPYIMPDDPETGSAEAYAKEAA
FT                   EARDKMLRTLAEMENLRKRTAREVADARMYGITGFARDVLDIADNLQRALDAVPAETRA
FT                   NADAGLKSLIEGVELTERSLLNTLEKNGVKKFDPTGQKFDPNFQQAMYEVPDPSVPSGT
FT                   VVQVVQAGFMIGERVLRPALVGVSKGGAKAAPAASNDQSNSAA"
FT   gene            complement(184710..185798)
FT                   /gene="hrcA"
FT                   /locus_tag="BRADO0172"
FT   CDS_pept        complement(184710..185798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="BRADO0172"
FT                   /product="Heat-inducible transcription repressor"
FT                   /function="3.1.2.4 : Complex regulation"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10613857; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74138"
FT                   /db_xref="GOA:A4YJR2"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74138.1"
FT                   /translation="MAHHDPINLMTPPAGLAQLNERSREIFRQIVESYLATGEPVGSRN
FT                   ISRLIAVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTEAGLRFFVDALMQVGDMTEA
FT                   ERQSIQSQLAAVGRAQSVEAALDEALTRLSGLTRAAAVVLTAKSNTRLKHIEFVRLEPE
FT                   QALVVLVGEDGQVENRVLTLPPGVPSSALTEASNFLNARIRGRTLAEARLELETALAQD
FT                   RAELDQLTQKVIAAGVASWSGGDSDDRQLIVRGHANLLEDLHALDDLERVRRLFDDLET
FT                   KRGVVDLLGRAESAEGVRIFIGSENKLFSLSGSSTIVSPYSDATGRIVGVLGVIGPTRL
FT                   NYARVIPTVDYAARLLSRLMGG"
FT   gene            185987..186700
FT                   /gene="rph"
FT                   /locus_tag="BRADO0173"
FT   CDS_pept        185987..186700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="BRADO0173"
FT                   /product="RNase PH"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.4 : RNA degradation"
FT                   /EC_number="2.7.7.56"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1512253; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74139"
FT                   /db_xref="GOA:A4YJR3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74139.1"
FT                   /translation="MRPSRRAPDEMRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLED
FT                   RLPPWLKGQGRGWITAEYGMLPRATLERTRREASAGKQTGRTVEIQRLIGRSLRTAIDL
FT                   EALGERQITVDCDVLQADGGTRTASITGAWVALADCIRWMKARNMIKTEVLRTNVAAVS
FT                   CGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRIIEVQGTAEKTPFSEAEFLALMALAR
FT                   KGVGRLVDLQKMAVA"
FT   gene            186733..187341
FT                   /locus_tag="BRADO0174"
FT   CDS_pept        186733..187341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0174"
FT                   /product="putative HAM1 protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74140"
FT                   /db_xref="GOA:A4YJR4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74140.1"
FT                   /translation="MIATHNAGKLVEMRELLAPHGVEAVSAGELGLGEPEETGDTFQAN
FT                   ARIKAVAAAEAAQLPAFADDSGIVVHALDGAPGIYSARWAGPGKDFGAAMAQIERLLQE
FT                   RGAVTADKRTAHFVSALCVAWPDGHIEEVEARVDGTLVWPPRGTAGFGYDPMFLPDGHD
FT                   RTFGEMTSIEKHGLPPLGLGLSHRARAFVKLAEICLEQR"
FT   gene            187328..188485
FT                   /locus_tag="BRADO0175"
FT   CDS_pept        187328..188485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0175"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase (yggW)"
FT                   /EC_number="1.3.99.22"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74141"
FT                   /db_xref="GOA:A4YJR5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74141.1"
FT                   /translation="MSSAESEAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDQDRFARAF
FT                   AQEIANTAARTGPRTVSSIFLGGGTPSLMQPQTVGAILDAIGKHWHVAPDVEVSLEANP
FT                   TSVEATRFAGYRAAGVNRVSLGVQAMDDASLKMLGRLHTAEEAMKAVAIARGAFERYSF
FT                   DLIYARPDQTAAMWTEELTRAIGEAAEHLSLYQLTIEEGTPFFGLHAAGKLKTLDEGLA
FT                   RTLYDVTQEICARHGLPAYEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIEGI
FT                   RHATATDKRPEAWLMRVETNGHGVMTDDLLNSEERADEFLLMGLRLSEGIDPRRYAAIA
FT                   GRTLDPRRIALLREEGAIAVEPDGRLRVTQDGFPVLDAVVADLAA"
FT   gene            complement(188799..190058)
FT                   /locus_tag="BRADO0177"
FT   CDS_pept        complement(188799..190058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74142"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74142.1"
FT                   /translation="MRMGNFWPVTAERRDAMTGPRHPKPDAKPGAPMVARRTALGLILG
FT                   APLVSACSNVQQGFNPFEQPTAPSGPPQQPAVAGNGQVKVGLILPLSASGNAGVAAQSM
FT                   KNAAEMALAEFQNPNIQLLIKDDAGSPQGAQQGAQQACDEGAEILLGPLFAGSVPATSQ
FT                   VARTRNISVIAFSTDSSVAGRGVYLLSFLPESDASRIVDYSASVGKRSFAALLPDNPYG
FT                   TVVEGAFKTAVSRRGGRIVAFEKYAGDRTAAARAVAQSLGGADALLLADDGESVVATAD
FT                   ALTAAGANLRNIQLLGTGLWDNPRVYNSASLQGGLYAAPDPSGFRAFAGRYRTRFGGDP
FT                   VRTATLAYDAVALVAALARTQGAQRFAPDVLTNASGFAGIDGLFRFRSDGTNERGLAVM
FT                   RVGSGGGQAVAGAPKSFSAT"
FT   gene            190381..191268
FT                   /locus_tag="BRADO0178"
FT   CDS_pept        190381..191268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0178"
FT                   /product="putative methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74143"
FT                   /db_xref="GOA:A4YJR7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74143.1"
FT                   /translation="MAGHCIAAQRTRPGLHLVATPIGNLGDITLRALETLAGADIIFCE
FT                   DTRITRRLTERYGLGAELAAYHEHNAEAVRPKILQRLAEGAAIALVSDAGTPLISDPGY
FT                   KLVRAACEAGHAVTALPGPSAVLAALSVAALPTDRFFFEGFLPAKQQARRTRLAELSRI
FT                   DATLVLFEAGSRVLETLADLAEAMTGRQGAICRELTKLHEEVLRGPLTELAAQADGLET
FT                   RGEFVLVIGPPPRDAELMTDGAVDALLTELLQRSSVKDAVMHAVELSRRPRREVYARAL
FT                   ALAKETRGEGDGGD"
FT   gene            191255..191680
FT                   /locus_tag="BRADO0179"
FT   CDS_pept        191255..191680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74144"
FT                   /db_xref="GOA:A4YJR8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74144.1"
FT                   /translation="MAETDRATDKPAGAPKPAKTASPERVAAFRTGLSAEARAAALLIA
FT                   KGYRILAKRFRTPHGEIDLIARKRGLVAFVEVKARASLDDAAYAVTPRQQQRIIDAAQA
FT                   WLMAHPDHAELELRFDAILVAPRSLPRHLMAAFDASP"
FT   gene            191714..192655
FT                   /gene="gshB"
FT                   /locus_tag="BRADO0180"
FT   CDS_pept        191714..192655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="BRADO0180"
FT                   /product="glutathione synthetase"
FT                   /function="1.5.3.10 : Glutathione"
FT                   /EC_number="6.3.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1540581, 8241129; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74145"
FT                   /db_xref="GOA:A4YJR9"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74145.1"
FT                   /translation="MKLNVAVQMDPIARINIRGDSTFAMLLEAQRRGHGLCYYTPDKLS
FT                   LRGEELYAPVQALTVRDEVGDHFTLGEPKPTALTSFDVVLLRQDPPFDLAYITSTHFLE
FT                   RIHPKTLVVNDPASVRNAPEKLFVMNFPQLMPPTLISRDLDEINAFRDQHGAVVMKPLH
FT                   GHGGAAVFRVMPQDMNFGSLFDMFSVTFKEPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAADDLRSNMVRGGAAQATDLSAREREICDTLGPELRKRGLLLVGIDVIDGNLTEI
FT                   NVTSPTGIRAISRLGGPDIAARVWDVIEAKRR"
FT   gene            193090..193905
FT                   /locus_tag="BRADO0181"
FT   CDS_pept        193090..193905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0181"
FT                   /product="putative exodeoxyribonuclease III (xthA)"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="3.1.11.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7885481; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74146"
FT                   /db_xref="GOA:A4YJS0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74146.1"
FT                   /translation="MRLVLTTWNINSVRLRIDLVAKFIKQVRPDVLCLQETKCIDDAFP
FT                   LKRFKRLGYEHVALNGQKGYHGVAVISKWPFESTHVRTFCDKVDSRHITVAFGEKAQLA
FT                   QPLVLHNFYVPAGGDIPDPALNPKFEHKLQFLDEMKACEPLHPRGDDRHILVGDLNVAP
FT                   HEHDVWSHKQLLKVVSHTPIETEKLLAAQSHGEWVDVARERIPMSEKVYTWWSYRAADW
FT                   TVGDRGRRLDHIWVSRALKDRVSDFDILRDARSWERPSDHVPVTVTLDV"
FT   gene            complement(194022..194438)
FT                   /locus_tag="BRADO0182"
FT   CDS_pept        complement(194022..194438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0182"
FT                   /product="Putative cyclic nucleotide binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74147"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74147.1"
FT                   /translation="MERVPTLRLLGSDSLRMIAIGSEQRNIQSGETLFREGDTADCGYV
FT                   VQRGALRISDEVGAEIIAKPSMLIGELALLVEMRRPATATALEYSTVVRISRSLFQRVL
FT                   ESDAVAARRLRDEFAHRANRIANDILMAGAKLMS"
FT   gene            complement(194532..195218)
FT                   /locus_tag="BRADO0183"
FT   CDS_pept        complement(194532..195218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0183"
FT                   /product="putative two-component transcriptional
FT                   regulator."
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74148"
FT                   /db_xref="GOA:A4YJS2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74148.1"
FT                   /translation="MANARKILIVDDDTDLRDTLMEQLSLHDEFEAQAVDTGAKGASAA
FT                   KANSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFSVGPYSFRPGSKMLTGANARKVRLTEKETAI
FT                   LRFLYRAGQQPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            195469..196017
FT                   /locus_tag="BRADO0184"
FT   CDS_pept        195469..196017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0184"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74149"
FT                   /db_xref="GOA:A4YJS3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74149.1"
FT                   /translation="MSLWTRCVGMPASLISIRTAAGSRQRGWLTVLGHVIPVALGRGGV
FT                   LANKREGDGGTPRGTFHPRRLWWRADRHPRPRTFLPVRPIRPEDAWCEDPADRHYNQPI
FT                   RLRGDQPGDRLARQDHLYDFIIEIDHNTRPRVPGRGSAVFLHLARPQFGPTAGCVAMTR
FT                   PAMLRLLQRIGPRTRIFIS"
FT   gene            196040..196825
FT                   /locus_tag="BRADO0185"
FT   CDS_pept        196040..196825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0185"
FT                   /product="putative Hydratase/decarboxylase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74150"
FT                   /db_xref="GOA:A4YJS4"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74150.1"
FT                   /translation="MRATDQPAGASAILRWHWLQGSKLSELPPKLRPRDRAAGYAIQAE
FT                   LEKHSDKPLFGWKIAATSEAGQRHINVAGPMAGRILAETVLPVDGTASMAGNLMRVAEP
FT                   EFAFRFGVDLPPRPTPYDVAEVLAAVDTLHPAIEIPDSRFAEFVGAGEAQLIADNACAH
FT                   LFVLGEPTSADWRSRDLVEERPRISLKGETFIGHGRNVLGDPRIALAWLVNELRELGIT
FT                   VRAGQVITTGTCHPPLPITGGDHMEADFGDLGRVSVRFD"
FT   gene            complement(196868..197551)
FT                   /locus_tag="BRADO0186"
FT   CDS_pept        complement(196868..197551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0186"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74151"
FT                   /db_xref="GOA:A4YJS5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74151.1"
FT                   /translation="MPDSTVATSSSPSALAAVEQEIQRACSDAKRDRSAVTLIAVSKTF
FT                   AADAIEPVILAGQRVFGENRVQEAKGKWPVMMAAHPGLSLHLIGPLQSNKAKEAVALFH
FT                   AIHSVDRPSLCSALAKEIGAQGRHPQLFVQINTGEEPQKAGIAPGDADAFIAACRRDYG
FT                   LEISGLMCIPPVDEAPGPHFALTAKIAARNGLANLSMGMSADFAAAIQFGATHVRVGSA
FT                   IFGHR"
FT   gene            197664..199361
FT                   /locus_tag="BRADO0187"
FT   CDS_pept        197664..199361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0187"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide, putative diguanylate cyclase (GGDEF) domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74152"
FT                   /db_xref="GOA:A4YJS6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74152.1"
FT                   /translation="MPSIRFNRNRVKLNRLMGIRARLALLALILVAPLMLERARSLESA
FT                   RTRQIALASEEFFALARQSADMQREVIMSVETVLKSTAYVRASAAGISRSCDMMRASLP
FT                   TTLPWIRTLMIAGRDGRIQCSTNNQYVGLDFSDRPYFRGAQEARDFVFSDYLLSKPTQM
FT                   PIVMAAYPVGAITGEPDAVMLASVNLEWMSKIMSNLGGRPGITAVLIDSEGTVLAAPAD
FT                   RTELIGRPLDSVPLLSAVAETAMSSSKQSDTMSFTAADGSKRAITFTRITDTGSRLIVS
FT                   IDETRVTAAIDREIRNAYLQAGLVCLMVLLGALIAAEKLIVKPVNMLAATAKRFGLGHW
FT                   SARVATKHLPSEFVPLAKSFNAMAAKLGQRERELVAANDRLTVMASIDMLSGLANRRGF
FT                   QNRIDVEWDRAQQTGSDLSLLMIDVDHFKLYNDTYGHPEGDACLSRLGETLAQIAGATT
FT                   AFAGRYGGEEFCLLLPGMSARQALEIGELVRAAVLELELPHATSVHQCVTVSVGVASTR
FT                   PNAALTPADLIEAADAALYAAKHRGRNTVVAHGFGDVLEADSDVARAG"
FT   gene            complement(199382..200368)
FT                   /locus_tag="BRADO0188"
FT   CDS_pept        complement(199382..200368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0188"
FT                   /product="putative diguanylate cyclase (GGDEF)domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74153"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74153.1"
FT                   /translation="MAQQRVPPTPNNFHLWFKYSLGSASDLKRAVDILVSNKRKFDKTT
FT                   NQALFDTYIGQQGTEAAVVHKVSQQLHGVMDSAKSYLTAAIADNRTHMAAIDGVAERSE
FT                   QGVDPKILIENLVSELAQATARAAKLEASFAEKSRELDTIRDSLNKSEQRARTDTLTGL
FT                   PNRRALEEFFRHAQIEAMERDEPLSILLIDVDHFKKFNDNYGHGVGDQVLRLVAKALRE
FT                   RVREKDLPARYGGEELIAVLPETDLEGCTGMAERIRRTIADCQFTRRSTGEVLPQITVS
FT                   IGVGQFQFGESMADLIDRCDRALYLAKKLGRNRVVTELELDRKLAVG"
FT   gene            200692..203316
FT                   /gene="leuS"
FT                   /locus_tag="BRADO0189"
FT   CDS_pept        200692..203316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BRADO0189"
FT                   /product="leucine tRNA synthetase"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.1.1.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3320963; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74154"
FT                   /db_xref="GOA:A4YJS8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74154.1"
FT                   /translation="MTSERYNAREAEPRWQRQWDEKAIFATKNDDPRPKYYVLEMFPYP
FT                   SGRIHIGHVRNYTLGDVLARFMRAKGFNVLHPMGWDAFGLPAENAAIERKVAPKAWTYD
FT                   NIAAMKKQLRSIGLSLDWAREFATCDPSYYKHQQKMFLDFMQAGLVEREQRKVNWDPVD
FT                   MTVLANEQVIDGRGWRSGAVVEQREMNQWVFKITKYSQELLDALDGLDRWPDKVRLMQR
FT                   NWIGRSEGLLIRFALDPKTVPAGESELKIFTTRPDTLFGAKFMAISADHPLAQAAAAKN
FT                   PELAAFIAEIKRIGTAQEAIDTAEKQGFDTGIRAVHPFDPSWTLPVYVANFVLMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYGLGNTPVVCPEGQDPASFVITDTAYDGDGRMINSRFLDGM
FT                   TIAQAKDEVAKRLESEQRGGSPIGERQVNFRLRDWGISRQRYWGCPIPVIHCATCDVVP
FT                   VPAGDLPVVLPDDVTFDKPGNALDHHPTWKHVTCPKCGGKATRETDTMDTFVDSSWYFA
FT                   RFTDPWNETAPTTPAVANRMMPVDQYIGGVEHAILHLLYSRFFTRAMKATGHVAMDEPF
FT                   AGMFTQGMVVHETYQKADGTYVNPADVKIEVGGNGRRAVLTATGEDITIGPIEKMSKSK
FT                   KNTVDPDDIIESYGADVARWFMLSDSPPDRDVIWSDERVQGAARFVQRLWRLVNESVAA
FT                   SAEAPSSRPANFSADALALRKAAHGALDKVTGGIERLHFNVCLAHIREFANALADVLAK
FT                   PAKPAPDLAWATREAAGILVQLFSPMMPHLAEECWQVLGHSGLISEASWPQIERDLLVE
FT                   DSMTLVVQVNGKKRGEVTVASNAQNPEIESAVLALDAVKVALDGKPVRKVIIVPKRIVN
FT                   VVG"
FT   gene            203303..203854
FT                   /locus_tag="BRADO0190"
FT   CDS_pept        203303..203854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74155"
FT                   /db_xref="GOA:A4YJS9"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74155.1"
FT                   /translation="MSSARFRIAARLIAVAALAGLTAGCFQPMYAEHADGTPGLRDKLM
FT                   GVELPPVDKPNASPEARLGVAIRNSLAFKLYGTATGTAPTHKLVLKFQTSRSSLIVSQT
FT                   TGLPTTENVGIDVQYNLVELATNKSVMTGTTFARTSYDIPGSYQRFARQRAFNDAEDRA
FT                   SEEVAEKIKTRLAAYFTAGT"
FT   gene            203873..204901
FT                   /locus_tag="BRADO0191"
FT   CDS_pept        203873..204901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0191"
FT                   /product="conserved hypothetical protein; putative DNA
FT                   polymerase III, delta subunit"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74156"
FT                   /db_xref="GOA:A4YJT0"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74156.1"
FT                   /translation="MVALRGRDIDAFLAKPDAARPLILLYGPDAGLVRERAEALIASAV
FT                   DNPDDPFSVVRLDGDELAAEPSRLVDEAMTVPLFGGRRAIRVRAGSRIFASGVETLSQM
FT                   NVRDCRIVIEAGDIRPDSPLRKICEKAATAVAIGCYPDTERDLARLIDDELRTANLRMA
FT                   PDARSYLMALLGGDRQASRNEIRKLTLFAHGEGEVTLDHVMAVVADASEMKLDPIVDGA
FT                   FGGKPDVVETEFGKAMIAGTYPGVIISAAQRHAAWLHKSALAVASGAPVSSILEGGFPR
FT                   LHFSRKPSAEVALRNFSPARLLPIIDQLATAALDMRKQPGLAAAIAQRTLLSIAVAARR
FT                   KG"
FT   gene            complement(205371..206210)
FT                   /gene="parB"
FT                   /locus_tag="BRADO0192"
FT   CDS_pept        complement(205371..206210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="BRADO0192"
FT                   /product="chromosome partitioning protein"
FT                   /function="8.1.2 : Replication"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9054507; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74157"
FT                   /db_xref="GOA:A4YJT1"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74157.1"
FT                   /translation="MNREAGAPPERPRNQRKVPIEFLKPNPRNPRKTFSDGELAELSAS
FT                   IKQHGVIQPIVVRPIKGQQDRYEIIAGERRWRASQAAGLHEVPIVPVDVSDSDALELAI
FT                   IENVQREDLNPMEEAQGYHALANEFKRNQEEIAKIVGKSRSHVANMMRLTKLPAEVQGF
FT                   IATGEISAGHARALINLPDPLTAAKKIIAEGLNVRQTEALAHEEGVPERKPQKPRSAGG
FT                   SAAPEKKDADTLALEKRVGDALGLTLSISHRDPGGTVQITYRSLEQLDEVMRRLEQG"
FT   gene            complement(206429..207280)
FT                   /gene="parA"
FT                   /locus_tag="BRADO0193"
FT   CDS_pept        complement(206429..207280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="BRADO0193"
FT                   /product="chromosome partitioning protein"
FT                   /function="8.1.2 : Replication"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9054507; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74158"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74158.1"
FT                   /translation="MSVIDQIYQEDRAPHPEGHPRILALANQKGGVGKTTTAINLGTAL
FT                   AAIGERVLIVDLDPQGNASTGLGIDRGSRNCSTYDVLIGEASLRDAVVATAVPRLHIAS
FT                   STMDLSGLELELGTSANRAFRLRDAIAGLNNNVSPENDYTYVLVDCPPSLNLLTVNAMA
FT                   ASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGIVLTMFDSRNNLSNQVVA
FT                   DVRQFMGSKVYNTMIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLKLATEVIQRERDLR
FT                   AN"
FT   gene            complement(207312..207980)
FT                   /gene="gidB"
FT                   /locus_tag="BRADO0194"
FT   CDS_pept        complement(207312..207980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BRADO0194"
FT                   /product="Glucose inhibited division protein B;
FT                   Methyltransferase gidB"
FT                   /function="8.1.2 : Replication"
FT                   /EC_number="2.1.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74159"
FT                   /db_xref="GOA:A4YJT3"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74159.1"
FT                   /translation="MKPTSSAAARNELASDKAAALALTPVSRETERRLDRYIALLLEWQ
FT                   AKTNLVAPSTLPHLWTRHISDSLQLLDLAPEASFWVDLGSGGGFPGVVLACALAERPGA
FT                   KVHLVERIAKKAAFLREAIRVTGSPGTVHLSEIGDIVEKWSGRVDCVTARALAPLHQLV
FT                   GFAEPLVKKGAKALFLKGQDVDAELTESTKYWKIEPKLHSSRTGGQGWIVAIDCIERRS
FT                   "
FT   gene            complement(207993..209867)
FT                   /gene="gidA"
FT                   /locus_tag="BRADO0195"
FT   CDS_pept        complement(207993..209867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BRADO0195"
FT                   /product="Glucose-inhibited division protein A"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74160"
FT                   /db_xref="GOA:A4YJT4"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74160.1"
FT                   /translation="MTEHTSYDVIVIGGGHAGCEAAAASARMGARTALVTHRFATIGAM
FT                   SCNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRVLNRRKGPAVRGPRAQADRKLY
FT                   AAAMQSAIRETTNLAVVEGEADDLIVVDGRVTGIKLADGRSLACGAVVITTGTFLRGLI
FT                   HLGEKTWPAGRVGEAPALGLSRSLEAIGFNLGRLKTGTPPRLDGTTIDWGAVEMQTGDD
FT                   PAEPFSVLTETITTPQIQCGITRTTIATHEVIRANVHRSPMYSGQIKSTGPRYCPSVED
FT                   KIVRFGDRDGHQIFLEPEGLDDSTVYPNGISTSLPEEVQLALLPTIPGLERVRMIRPGY
FT                   AIEYDHVDPRELEPTLQTKRMKGLFLAGQINGTTGYEEAAAQGLVAGINAALAAGGGAP
FT                   IVFDRADGYLGVMIDDLVTRGITEPYRMFTSRAEYRLTLRADNADQRLTDKGIALGCVG
FT                   GERVRFHRRKLAALQAARAVATSLTITPNEAAKHGLTLNRDGQRRSAFELMAYPEIDFA
FT                   KVRSIWPELEAIDPVVATHLEIDAKYDVYVRRQSEDVDAFRRDEGLVLGDIDYAIVPGL
FT                   SNEARAKLTAAKPWTIGQAGRIDGMTPAALGILAAYLRREARRNKAAS"
FT   gene            complement(210093..211427)
FT                   /locus_tag="BRADO0196"
FT   CDS_pept        complement(210093..211427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0196"
FT                   /product="putative tRNA modification GTPase (trmE)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74161"
FT                   /db_xref="GOA:A4YJT5"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74161.1"
FT                   /translation="MHPHDQTIFALSSGRLPSAIAIVRLSGPHAGAALQMLAGKMPAPR
FT                   LVTRALLRDPQGEPIDDAVVLWFPAPASATGENVVELHIHGSRAVIATLFGVLSETPEL
FT                   RPAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTDRQRRQALRQLKGLLGDKVRRWREQ
FT                   IIEAAALIEAGIDFSDEGDVPAELLAPALSRVQQLLLEIEAVLAAQGRAERLRDGLTVV
FT                   IAGPPNAGKSTLMNQLARREVAIVSPQAGTTRDLIEVQLDLDGYPVTVIDTAGIRETDD
FT                   PVEQEGVRRARDRAAHADLVLWLSEHDGAEVERQGETPLWLVRTKTDLDGAERATRPDT
FT                   KASRTFGISARSGAGMGALLDALVGFARNFFGSTESGLITRERQRQSLRQTADALQRSL
FT                   DTVDLGEELVAEELRIAALALGRLLGRVDVEDLLDVIFREFCIGK"
FT   gene            complement(211749..213014)
FT                   /gene="rho"
FT                   /locus_tag="BRADO0197"
FT   CDS_pept        complement(211749..213014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="BRADO0197"
FT                   /product="Transcription termination factor Rho"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.3 : Repressor"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8606169; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74162"
FT                   /db_xref="GOA:A4YJT6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74162.1"
FT                   /translation="MREIKLQDLKSKTPAELVSFAEENGVENASTMRKQELMFAILKQL
FT                   AIQETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNTLNFEDPEKSKHKVNFDNLTPLFPDERFRLELEDPTRKDLSPR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAARHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVADKRTFPAIDIARSGTRKEELITEPQNLKKMYVLRRILNPMGTMDAI
FT                   DFLLDKLRSTKSNAEFFESMNT"
FT   gene            complement(213257..213679)
FT                   /locus_tag="BRADO0198"
FT   CDS_pept        complement(213257..213679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0198"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74163"
FT                   /db_xref="GOA:A4YJT7"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74163.1"
FT                   /translation="MYEWIKALHVIAVIAWMAGMLYLPRLFVYHCDAEIGSKQSETFKV
FT                   MERRLLKAIINPAITVTWLAGLYLVWAGHWYTSGWFHAKFLLVLIMSGVHGLFTRWVRE
FT                   FGEDRNTRSQKFYRIINEVPTVLMIGVVILVIVKPF"
FT   gene            214094..214933
FT                   /locus_tag="BRADO0199"
FT   CDS_pept        214094..214933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74164"
FT                   /db_xref="GOA:A4YJT8"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74164.1"
FT                   /translation="MPTTGNYFHLHLVSDSTGETLITVARAVAAQYANVTPVEHVYPLV
FT                   RSQKQLDRVLDEIEEAPGIVLFTLLEKDLVSRLEAKCQQINIPSLSIIGPVMQLFEAYL
FT                   GASTAGRVGAQHVLNAEYFARIDALNYTMLHDDGQMVDGLEDADVVLVGVSRTSKTPTS
FT                   IYLANRGVRTANVPLVPGIPIPHQLEVLKKPLVVSLHATPERLIQVRQNRLLSMGAESG
FT                   NENYVDKQSVTDEVAYARKLSAKFNWVMLDVTRRSIEETAAAILKLYSDRQRQRLPE"
FT   gene            214944..215552
FT                   /locus_tag="BRADO0200"
FT   CDS_pept        214944..215552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0200"
FT                   /product="putative maf-like protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74165"
FT                   /db_xref="GOA:A4YJT9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74165.1"
FT                   /translation="MTLWCGDAPLVLASQSRARRMLLENAGLACEAVPADIDERAIQAE
FT                   AGLVAPYEIALHLATAKAKAVSALNPGCYVVGADQTLALGERMFNKPAGRQQAMHQLLA
FT                   LAGRTHALHSAISVVRNGEVLFSHVAVAWMTMRTLTESDVACYLDTAGHAVLSSVGAYQ
FT                   LEGLGVHLFDRIDGDHFTILGLPLLPLLAFLREAKLLKF"
FT   gene            215581..216186
FT                   /gene="coaE"
FT                   /locus_tag="BRADO0201"
FT   CDS_pept        215581..216186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="BRADO0201"
FT                   /product="Dephospho-CoA kinase"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /EC_number="2.7.1.24"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74166"
FT                   /db_xref="GOA:A4YJU0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74166.1"
FT                   /translation="MRMRVLGLTGSMGMGKSTTAKLFAEAGVPVYDADATVHKVYEGEA
FT                   APAVEAAFPGTTVDGKVDRSKLSAKVVGNPEAIRRLEAIVHPMLRSYHQAFLDQAEQSG
FT                   VPVAVVDVPLLFETGGDKRVDAVVVVSTSPEIQRQRILARGTMTEAALDALLARQMPDA
FT                   EKRQRADFVVDTSHGLDPVRARIRDILAEVVKMPRRRG"
FT   gene            216220..216918
FT                   /gene="dnaQ"
FT                   /locus_tag="BRADO0202"
FT   CDS_pept        216220..216918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="BRADO0202"
FT                   /product="DNA polymerase III: epsilon subunit, 3-5
FT                   exonucleolytic proofreading function"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3540531; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74167"
FT                   /db_xref="GOA:A4YJU1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74167.1"
FT                   /translation="MREIVLDTETTGLDALRGDRLVEIGCVEIINRMPTGQVFHRYINP
FT                   QRDMPAEAFAVHGLSTEFLSDKPLFHEVVEDFLAFIGDAPLVIHNASFDIGFINAELDR
FT                   VKRAAIPRERLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   VDLVGARQSQLILTQDAQEIRIGNAGDTPRRQRDVPLAPRVTEAEREAHRAFVATLGDK
FT                   PIWMDFLTGA"
FT   gene            complement(216975..217463)
FT                   /gene="secB"
FT                   /locus_tag="BRADO0203"
FT   CDS_pept        complement(216975..217463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="BRADO0203"
FT                   /product="protein-export protein"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2656409; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74168"
FT                   /db_xref="GOA:A4YJU2"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74168.1"
FT                   /translation="MTNGNGATPEAAPPPQLNVLAQYIKDLSFENPNAPQSLAPQGQPP
FT                   QINIQINVGANALAETEYEVTLTIEGKAESGSQVMFSFELVYGGVFRLVNVPQEHLSPM
FT                   LLIECPRLLFPFAREIVANSVRDGGFPPLMLDPVDFVSLYRQNMERQAAAQGVQGRPS"
FT   gene            217866..218567
FT                   /locus_tag="BRADO0204"
FT   CDS_pept        217866..218567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74169"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74169.1"
FT                   /translation="MDIYTIIFLGLAVFIFLRLRSVLGQRTGSERTPFDRTARNAVGAP
FT                   DNHVMPVPGAPLDPAGPSTGAADFGAPSDRWRGIAEPGTPLARGLDAIAANDASFDPRH
FT                   FLTGARSAYEMIVLAFANGDRRALRDLLSSEVYDSFDAVIKDREKNEQKTETRFVSIDT
FT                   AELVNAEARDRTAQLTVRFVSQMISVTRDKTGNIVDGNPDKVADITDIWTFARDTGSRD
FT                   PNWKLVGTGSH"
FT   gene            218707..220335
FT                   /locus_tag="BRADO0205"
FT   CDS_pept        218707..220335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0205"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74170"
FT                   /db_xref="GOA:A4YJU4"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74170.1"
FT                   /translation="MVREIWKRVFTARSLRYWTPALALSVAAVALAPYAAEAVRARHRA
FT                   ASPPMRHLPYPQLDWPMEITNSQYQPLSWSDVPGWNDDDQLAAYRTFRASCKPIAAKTD
FT                   ATPEDKALGDSLRDPCREARTAELADSAAARAFFERHFEPLKISKLGDADGFVTGYYEP
FT                   VIEGSRTQNEVYNVPVYRRPSNLFVRGFKQDSASLPNKGPVYRKIGRRKLVPYYDRAEI
FT                   EDGAIEGRGLEIAWLRNQTDLLFAQIQGSARISLDDGSTVRINYDAYNGHPYTPVGRIL
FT                   IERGIIPREQMSMQRIREWMEQNPQGADELRRMNRSYIFFREVQLSEKDEAVGAQGIPL
FT                   TPGRSIAVDKSLHVYGTPFFITGELPIDSEKQKNPFHRLMIAQDTGSAIVGPARADLYF
FT                   GAGQEAGKVSGRLKHSIQFVMLVPKSLDPVARGRKMPLPDARPSERIAKLFPQVLPKEP
FT                   VKDAQTEPAKDQSKDPAKSQDQPSTAASSVKDAKAPAPAAGASATTTVAQNIIAPVPLP
FT                   EARPRLESDRNSRRLRYGRRHRNHP"
FT   gene            220348..220923
FT                   /locus_tag="BRADO0206"
FT   CDS_pept        220348..220923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0206"
FT                   /product="Conserved hypothetical protein; putative Smr
FT                   protein/MutS2 C-terminal"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74171"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74171.1"
FT                   /translation="MSHDPDPPRGRRKRGLSEDERALWETVARQVKPLRKAQRPARPHP
FT                   PMATAEPQADKPLTTPRPVASVVIPKPIRPAIPPLVSLGRKERSKLSRGRSEIDARLDL
FT                   HGMTQSRAHQALHHFLHRAQHDGLTFVLIITGKGTIGADPERGVLRRQVPHWLSLPEFR
FT                   SLIVGFEEAHVGHGGAGALYVRIRRPRG"
FT   gene            complement(220927..222048)
FT                   /locus_tag="BRADO0207"
FT   CDS_pept        complement(220927..222048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0207"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74172"
FT                   /db_xref="GOA:A4YJU6"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74172.1"
FT                   /translation="MTGAYARHWRAMLAVNAAVMLGVFVHKLTLPPYIPYIHLLVDYHH
FT                   GFIKRALIGAVVGLFTTKVPVWLVFALAGGVWLITFTLFVLLFRRTFGLDRNQLPLFIF
FT                   TAGSPFVFKNFLFTLGHFDIYGCLGAIVLLLVPASSLAYVLLAALISAVLVLIHHIHLL
FT                   MYVPTITAIVVLRYYLTRPITGPDIVVGAVALIGLGALFLAAQFLGTMPLAEADFVAYL
FT                   KTRMIDPSRTELLQFAYVWYQPLAKEVQDTWARLPSNLLGLPVYALLLWLHLPLLRVFK
FT                   QQIDALSTRRHRQIVIAALVVISSAYFVMFAMVFDYSRWISSWVVCMVLMLHAVKTLPA
FT                   TKPVALIDGDDRKATILGWIVTVIPRVGIIRPF"
FT   gene            complement(222266..223570)
FT                   /gene="hslU"
FT                   /locus_tag="BRADO0208"
FT   CDS_pept        complement(222266..223570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BRADO0208"
FT                   /product="ATPase component of the HslUV protease, also
FT                   functions as molecular chaperone; heat shock protein"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="2.3.6 : Turnover, degradation"
FT                   /function="3.1.3.4 : Proteases, cleavage of compounds"
FT                   /function="5.1 : Cell division"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8244018; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74173"
FT                   /db_xref="GOA:A4YJU7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74173.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQADAKRAVSIALRNRWRRLQLDTGLR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAIHQVRERKRKDVAARAQLAAEERVLDALVGANSSAATRDSFRRKLRAGELNDKEIE
FT                   IETQSSGGGMPMFEIPGMPGAQMGAISIGDIFGKLGGRTKTRRVTVEASHDILIAEESD
FT                   KLLDSDQLVQEAINVVENNGIVFLDEIDKICVRENRHGGDVSREGVQRDLLPLIEGTTV
FT                   STKHGAVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELQALTRDDMRRILTEPEA
FT                   SLIKQYVALMKTEGVTLDITDDAIDALADVAVAVNSTVENIGARRLQTVMERVLDDISF
FT                   TASDRTGETMRVDAAYVQQHIGDLAKNADLSRFIL"
FT   gene            complement(223576..224088)
FT                   /locus_tag="BRADO0209"
FT   CDS_pept        complement(223576..224088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0209"
FT                   /product="putative Aminoglycoside N(6')-acetyltransferase
FT                   (aacA4)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /EC_number="2.3.1.82"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74174"
FT                   /db_xref="GOA:A4YJU8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74174.1"
FT                   /translation="MVVGFRAMTEDDLPAIRDWLHQPHVREWWGDPDEQYALIDGDRDE
FT                   HAMDQYIMLINEGAAGYLQCYALTQWNDGFLPQPDGTRGIDLFIAGQQRIGQGHGPLVI
FT                   RTFCNLMFQRGVPRVVTDPSPANARAIRAYEKAGFRRERLVDTPDGQALLMSCEPADLP
FT                   RRPSEPS"
FT   gene            complement(224102..224362)
FT                   /locus_tag="BRADO0210"
FT   CDS_pept        complement(224102..224362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0210"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74175"
FT                   /db_xref="GOA:A4YJU9"
FT                   /db_xref="InterPro:IPR019691"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74175.1"
FT                   /translation="MAADGISIASRRSSGLWLGLVLALLALQAAILFAMGRLPVWLTAL
FT                   IPIAFELGVGLHIRDNLTLNILMLIYPTEAIRQWQAGPPLL"
FT   gene            complement(224366..224926)
FT                   /gene="hslV"
FT                   /locus_tag="BRADO0211"
FT   CDS_pept        complement(224366..224926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="BRADO0211"
FT                   /product="ATP-dependent protease hslV (protease subunit of
FT                   a proteasome-like degradation complex)"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="2.3.6 : Turnover, degradation"
FT                   /function="3.1.3.4 : Proteases, cleavage of compounds"
FT                   /function="5.1 : Cell division"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.4.25.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8244018, 7682410, 12646382; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74176"
FT                   /db_xref="GOA:A4YJV0"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74176.1"
FT                   /translation="MHALSQEPTVWHGTTILTVRKGGRVVVGGDGQVSIGQTVIKSNAR
FT                   KVRKLGKGDVIGGFAGATADAFTLFERLESKLEQYPGQLTRAAVELAKDWRTDRYLRRL
FT                   EAMMIVADKEVSLVLTGTGDVLEPEAGVMAIGSGGNYALAAARALIDTDKDAESIVRKS
FT                   LDIAADICVYTNRNITIEALSAE"
FT   gene            225121..225714
FT                   /gene="hisB"
FT                   /locus_tag="BRADO0212"
FT   CDS_pept        225121..225714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="BRADO0212"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /function="1.5.1.16 : Histidine"
FT                   /EC_number="4.2.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3062174, 15042344; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74177"
FT                   /db_xref="GOA:A4YJV1"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74177.1"
FT                   /translation="MRSAAIKRKTKETDIEVSVNLDGTGVVEIATGIGFFDHMLDLLAR
FT                   HSRIDMTVKAVGDLHIDFHHTTEDVGIALGQAVKQALGDMAGITRYASIHMPMDETLTR
FT                   VVIDVSGRPMLVFRTAFSRDKIGEFDTELVREWFNAFAMNAGITLHVETLYGENAHHIA
FT                   ESCFKGLARALRAALAIDPRNKGEVPSTKGQLGG"
FT   gene            225755..226279
FT                   /locus_tag="BRADO0213"
FT   CDS_pept        225755..226279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0213"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74178"
FT                   /db_xref="GOA:A4YJV2"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74178.1"
FT                   /translation="MPVYTVHAPLAAGADLRSTDRFVFIRDGFHLWAAVLGAVWLAWHR
FT                   LWLAVIGYIALVIVIDVVLAKVGVAGGAIATVDLLIAILLGLEASSLKRWSYSRGNWRQ
FT                   LDVVVADDLDAAERRFFERWAARRSDLGTDNHTVDRGAAPPTRDNGNGQRPPPLPHASI
FT                   IGLFPEPGGGR"
FT   gene            226276..226926
FT                   /gene="hisH"
FT                   /locus_tag="BRADO0214"
FT   CDS_pept        226276..226926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="BRADO0214"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH (IGP synthase glutamine amidotransferase subunit) (IGP
FT                   synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS
FT                   subunit hisH)"
FT                   /function="1.5.1.16 : Histidine"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3062174; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74179"
FT                   /db_xref="GOA:A4YJV3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74179.1"
FT                   /translation="MSVAIIDYGSGNLHSAAKAFERAARGMEEPQKVVVTRDPDTVYRA
FT                   DRIVLPGVGAFADCRRGLDAVDGMLEAMTEAVRHKARPFFGICVGMQLMATRGKEHVTT
FT                   DGFDWVSGDVEKITPRDESLKIPHMGWNTLDVLQEHPVLEKLPLGPKGLHAYFVHSYHL
FT                   NAVNENDVLARADYGGPITAIVGKDTAIGTQFHPEKSQRFGLALISNFLKWKP"
FT   gene            226985..227719
FT                   /gene="hisA"
FT                   /locus_tag="BRADO0215"
FT   CDS_pept        226985..227719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="BRADO0215"
FT                   /product="N-(5'-phospho-L-ribosyl-formimino)-5-amino-1-(5'-phosphoribosyl)-4-imidazolecarboxamide
FT                   isomerase"
FT                   /function="1.5.1.16 : Histidine"
FT                   /EC_number="5.3.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8028028; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74180"
FT                   /db_xref="GOA:A4YJV4"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74180.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAKSFADQGFE
FT                   YLHVVDLDGAFAGKPMNAQAVEAMLKIVKMPVQLGGGIRDLKTVEAWLGKGITRVIIGT
FT                   AAVRDPELVKMAAKAFPGRVAVGLDARDGKVAVEGWAETSEVTALDIAKRFEDAGVAAI
FT                   IFTDIARDGLLKGLNLDATIALGDAISIPVIASGGLASIEDVKAMLTPRARKLEGAIAG
FT                   RALYDGRLDPAEALALIRAISG"
FT   gene            227731..228507
FT                   /gene="hisF"
FT                   /locus_tag="BRADO0216"
FT   CDS_pept        227731..228507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="BRADO0216"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   hisF (IGP synthase cyclase subunit) (IGP synthase subunit
FT                   hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF)"
FT                   /function="1.5.1.16 : Histidine"
FT                   /EC_number="4.1.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74181"
FT                   /db_xref="GOA:A4YJV5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74181.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVNLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTIDDIKTLLRSGADKVSINS
FT                   AAVSRREFVKEAAEKFGEQCIVVAIDAKSVPRPGGGSRWEIFTHGGRKSTGIDAIEYAQ
FT                   EVVALGAGEILLTSMDRDGTRQGFDLPLTRAVADSVPVPVIASGGVGNLDHLVDGIQQG
FT                   RATAVLAASIFHFGEFTIRQAKEHMVRQGLPMRLDP"
FT   gene            228589..228912
FT                   /gene="hisE"
FT                   /locus_tag="BRADO0217"
FT   CDS_pept        228589..228912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="BRADO0217"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /function="1.5.1.16 : Histidine"
FT                   /EC_number="3.6.1.31"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15740738; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74182"
FT                   /db_xref="GOA:A4YJV6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74182.1"
FT                   /translation="MSRFTLHDLAAIIDARAAAGGESSYTRKLLDKGPAQCAKKMGEEA
FT                   VETVIAAVGTDREHLISESADLLFHLLVVLKSRDVRLEEVEAALGKRTGQSGLEEKASR
FT                   KTE"
FT   gene            228946..229902
FT                   /gene="coaA"
FT                   /locus_tag="BRADO0218"
FT   CDS_pept        228946..229902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="BRADO0218"
FT                   /product="pantothenate kinase"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /EC_number="2.7.1.33"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1328157; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74183"
FT                   /db_xref="GOA:A4YJV7"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74183.1"
FT                   /translation="MDMRTTEQQYNPYRVFTRQQWAELRNDTPMTLEPGEFSKLRSMHD
FT                   RLDLQEVEEIYLPLSRLLSMYVDAAQRLYYAQRQFLGIRDRKMPYIIGVAGSVSVGKST
FT                   TARVLQALLTRWSPRPKVDLITTDGFLYPNAVLERQGLMQKKGFPESYDLPRLLAFLSD
FT                   IKAGRHPVRAPVYSHLSYDIVPNQWTEIDQPDILIVEGVNVLQTGPLPRDGKAVPVVSD
FT                   FFDFSVYIDAEEAVLRRWYVKRFLSLRDTAFHDPRSYFNRYALLSDEEATATAIAIWER
FT                   TNLANLEDNILPTRPRATLILKKGADHEIETVALRRL"
FT   gene            complement(230205..232469)
FT                   /locus_tag="BRADO0219"
FT   CDS_pept        complement(230205..232469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0219"
FT                   /product="Putative Sensor histidine kinase with PAS and
FT                   Response regulator receiver domains"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74184"
FT                   /db_xref="GOA:A4YJV8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74184.1"
FT                   /translation="MGQGLRIRLHLRRFMRRHQLVFTILRSLMIFSAGFGGAYGFIKAS
FT                   ISEHSGYNPHAFAIGASFLFALACVGLATLSMRLRFVHKKLHKIALHNEVLADRNWELQ
FT                   EAEQRARNLFEQQGDLIVMREQDGTIVFVNDAYCQMAGLDRENLVGSKFAFALIEQGDS
FT                   ALEPSGTRVHDQRIESAIGPRWIAWREALVRSDAGHPAVLQCVGRDVTDRTETERALAD
FT                   ARDQANAANRAKSRFLAMASHEIRTPLNGILGMGGLLLETPLTPEQTTYAKAVRASGEA
FT                   LMSLINELLDYSKIEAGKLALEAQPFSLAALIEEITELLAPRAQAKQLEIAAYMDERLP
FT                   TWVTGDAARLRQVLLNLAGNAIKFTAKGGVAVIAEPGIWPNEISFQVRDTGIGIAAEAQ
FT                   ERIFREFEQADDSVARSFGGTGLGLAISDRIVKRMGGRISLQSEPGAGATFEVCVPLPA
FT                   ALERGEQNSFRGPDLAGQSIMLIAPAGLQAELIERRLQNWGAQTSLVTDTGVAEALLPE
FT                   RTWHAVLVDDAVGGERARHLSEAARRHTTRLIVLVTPVSRHELMPVAPFTGYLVKPLRA
FT                   ASLAARVGFDVDGDGDGDGDGPAGAEIEESVPMAAPPIAARAGSGLSILVAEDNDINAL
FT                   LMRSLLTKLGHHADIAVHGEAALDSWLAARSAGTPYDLILMDVQMPRLDGIAAAKRIRA
FT                   LEATEAGRRTPILALTANTLVEDRYACFEAGMDGFLVKPIDRDKLDEALANLAAARQVA
FT                   A"
FT   gene            complement(232607..233101)
FT                   /locus_tag="BRADO0220"
FT   CDS_pept        complement(232607..233101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0220"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74185"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74185.1"
FT                   /translation="MSVRVMLRFKVLVSAVPLIAAAVFARIELAPSPQPCIAVGADGVA
FT                   LGEAPYHADLHVDFTEDPALATVRVALTDSPDAADLVLVDDAPGNEDRGCGMTSATQVV
FT                   ATAADPHPDAPLIYLIRDDAADGPADYRIYVRSSRVTAEQAAALLVAARNHPTSPANPV
FT                   L"
FT   gene            complement(233191..234729)
FT                   /locus_tag="BRADO0221"
FT   CDS_pept        complement(233191..234729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0221"
FT                   /product="putative enzyme (N-terminal); transcriptional
FT                   regulator with P-loop containing NTP hydrolase domain
FT                   (C-terminal)(yifB)"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74186"
FT                   /db_xref="GOA:A4YJW0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74186.1"
FT                   /translation="MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFAIVGLPDKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADVPKEGSHYDLPIALGLMAAIGAIPPDALSGFT
FT                   VLGELGLDGSIAPVAGVLPAAIGANSREEGLICPAGCGAEAAWASPDLQIIAANSLIQI
FT                   ANHFKGTQVLSRPQPKIQEAPASLLDLRDIKGQESGKRALEIAAAGGHHLLMIGSPGAG
FT                   KSMLAARLPSILPPLSPAELLEVSMIASVAGEIDGGALTNRRPFRSPHHSASMAALTGG
FT                   GLRARPGEISLAHHGVLFLDELPEFDPRVLDSLRQPLENGEVSISRANHRVTYPARFML
FT                   VAAMNPCRCGNAFEPGYACKRGRIDRCTADYQTRISGPLMDRIDLRIEVPAVSAADLIL
FT                   PPAKEGSAEVAARVAAARDRQRERYVKAGLPHIRTNAEAPAAVLDDIAKLDAPGQKLLR
FT                   EAAETMRLSARGYHRVLRVARTLADLDHAEAIGRLHLAEALSYRALAEDNRHAA"
FT   gene            234956..236017
FT                   /locus_tag="BRADO0222"
FT   CDS_pept        234956..236017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0222"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74187"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74187.1"
FT                   /translation="MPLPAAAAKTQAGEARTVSELATEMLRRTTALFLAGPRPAADEQL
FT                   DLYDQMFARLMPQVATEVLAELSTALAVVERAPYATVRLLAVHPELRVAGPVLAKAAVL
FT                   TERDLAEFIRASSPAHLVAVASRRGIGDALTAQLIARGFPPVRMALAQNLTAKLSEDSY
FT                   RSLFKVAERDEDLAEKLALRTDLPAKLSRAFVAAASEAARARFIKAAPPATRATLQAAP
FT                   TRSAAAAMRAMWDYEPVKAEVAALNRTGKLGDSAVNRFCVTGDFPAVIAALALLCVIPI
FT                   ETVESLLDESRMMDLLLACKAARLSWATTGMILKARPGCDAIAAEDFEEARKRFEKLVL
FT                   SEAQWKVRGLQTS"
FT   gene            complement(236042..236809)
FT                   /locus_tag="BRADO0223"
FT   CDS_pept        complement(236042..236809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0223"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74188"
FT                   /db_xref="GOA:A4YJW2"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74188.1"
FT                   /translation="MACAVAACALTSVAGHATAQTTPAPKAAQKSGGQLNASDQQRGQP
FT                   PATVQTTPPNPIIPDPRRNVPASIFTSFDANQKAVAAKVSAYLSSLQTLVGNFVQVGPD
FT                   GSKTKGDFYIQKPGKVRFEYEPPTPIDIIADGSSLVVRDRKLATQDVYPLSQTPLRYLL
FT                   SDRIDLLKDTNVIAVTADELYVTITIEEKQALIGTSRLMLMLGAKDGQLKQWTVTDPQG
FT                   YDTTIAVYNLDTTKKLDPAMFKIDFTNYATPPG"
FT   gene            complement(236989..239454)
FT                   /gene="ftsK"
FT                   /locus_tag="BRADO0224"
FT   CDS_pept        complement(236989..239454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="BRADO0224"
FT                   /product="DNA translocase"
FT                   /function="4.9.A.16 : The Septal DNA Translocator (SDT)
FT                   Family"
FT                   /function="5.1 : Cell division"
FT                   /function="5.8 : SOS response"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11832210; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74189"
FT                   /db_xref="GOA:A4YJW3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74189.1"
FT                   /translation="MRMPAIERVIPLVNHLPTSLRDALVRRLRELAGLCLIALCGVAAA
FT                   ALMTWSVQDPSLSHATSRAIRNIVGYPGAISADLLMQILGLGSIMAILPLAIRGWRMMT
FT                   HRPFDREALRFGAWVLAAVIAAGFASCWPRSHAWPLPTGLGGVVGDALVRAPAVVFGPP
FT                   GVIYRLVLGSLLLIAMIGCLLVAGGLGAKQADPSELADDEDDTPLADSEDDDDRKAIRL
FT                   GWIFHAIMSAKAQIGWFLSTAYRALVSSGPQPRSAAGRQEPSLGRSQKPTLAPEMEDEG
FT                   GEEEEAEEEDDEEEEPTPKARKKPAPKTPPKKSSDKYELPSVSMLAAPKSSDRQPLSKS
FT                   ELEANSRALEGVLQDFGVRGEIVKAHPGPVVTLYELEPAPGIKSSRVIGLADDIARSMS
FT                   ALSARVAVVPGRNAIGIELPNVHREKVYLRELLVAKEATESVAKLPLCLGKNIGGESII
FT                   IDLARTPHMLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYDGIPH
FT                   LLTPVVTDPKKAVVALKWAVREMEERYKKMAKLGVRNIDGYNARVAEARAKGEELTRTV
FT                   HTGFDKETGKAIYEEEKLDLDPLPYIVIIVDEMADLMMVAGKDIEGTVQRLAQMARAAG
FT                   LHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLYMA
FT                   GGGRISRVHGPFCSDEEVEKVVRHLKAQGSPEYLEAVTAEEPSEEDGAVFDATGMGGGG
FT                   GGDDLFAQAVAVVKRDRKASTSYIQRRLQIGYNKAASLMERMEQEGIVGQANHAGKREI
FT                   LVPEEEGGF"
FT   gene            complement(239466..240680)
FT                   /locus_tag="BRADO0225"
FT   CDS_pept        complement(239466..240680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0225"
FT                   /product="putative aminotransferase (aatC)"
FT                   /EC_number="2.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74190"
FT                   /db_xref="GOA:A4YJW4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74190.1"
FT                   /translation="MAMTASSPAPAGASHSESERSPFARLNELLAPYSPGKPMITLAVG
FT                   EPQHPVPDFVGPVLAQHIADFGRYPAAKGIEPFRKAAAAWLSRRFALPRPIDPEHEILV
FT                   LNGSREGLFFAAHAALRHVGPRRGRPAILMPNPFYPVYGVGARTAGCDSIYLPTTRDNG
FT                   FLPDLDAIDEATLARTVAFYIATPANPQGSVASADYMRKLVQLAKTYGFLIFSDECYSE
FT                   IYTKTAPGSMLEHAGPDYTNVVAFQSLSKRSNVPGMRIGFAAGDRRFLAAFHELRNVAA
FT                   PQVPVPLQHVAVAAYADEDHVEANRRLYRAKFDLADQIIGNRYGYTRPDGGFCVWLDVA
FT                   DRGGDADVALRLYRDAGVRVVPGSYLARPQPDGFNPGVGYIRLALVADAASTGEALHRL
FT                   VETLG"
FT   gene            241580..244084
FT                   /locus_tag="BRADO0226"
FT   CDS_pept        241580..244084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0226"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide; putative outer membrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74191"
FT                   /db_xref="GOA:A4YJW5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74191.1"
FT                   /translation="MMRLRLPGVLALMLLAMPVSSLPRMAVAAPAVAATSITVEGNRRI
FT                   EADTIRSYFKPGPSGALDAGQVDDGLKALIETGLFADVKIDRQGGRLIVRVVENPVIGR
FT                   VAFEGNKKVKDEQLSAEVQSKPRGTLSRPMVQSDAQRIAEIYRRSGRYDVRVTPEIIEQ
FT                   PNNRVDLVFTVVEGVKTSVKSVDFVGNKAFSATRLRDIIKTRATNWLSFLASNDIYDPD
FT                   RVEADRDLIRRFYLKNGYADVQVVAALTEYDPEQKGFLVTFQIEEGQQYRVGSVQFQST
FT                   IAALDGNTLRGYSRVNVGALYNVEQLEKSVEEMQIEASRRGFAFAVVRPRGDRNLEAHT
FT                   VAIVFSVDEGPRTYIERISIRGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLKNLD
FT                   FFKDVKIATEPGSSSDRVILVVNLEEKSTGDFSISGGYSTTDGALAEVSISERNFLGRG
FT                   LFAKASVTYGQYARGVSLSFVEPYLLDYRVALGLDVSYRQQLANSYTSYGTRTVGFSPR
FT                   LGFQLREDLSLQLRYSLYRQEITLPSYLANCNNNAANGLLAFNPTPAYIQSVLGGVDPT
FT                   NSTTSGVYGYGCYGDGESSLAVRKELNQGASLTSALGYTLTYNTLDNTKNPTEGLLIDW
FT                   RQDFAGVGGNVSYLKSAVDAKYFTLLVSEIVSVIHLQGGVLEKIGDKDLRMLDHYQMGP
FT                   TLVRGFAANGIGPRDITYRSFGATGDALGGTKYWGASAELQMPFWFLPKEIGLKGSVYA
FT                   DAGSLWGYQGPTSWAATGEVNTSACKCAMQYDDSKVVRSSVGVGLIWASPFGPLRFDYA
FT                   VPLTKGKYDVVQEFRFGGGTSF"
FT   gene            complement(245029..245787)
FT                   /locus_tag="BRADO0228"
FT   CDS_pept        complement(245029..245787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0228"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase 1 (fabG1)"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74192"
FT                   /db_xref="GOA:A4YJW6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74192.1"
FT                   /translation="MTKGKRIAWITGGGTGIGEAGALALAADGWTVVVSGRRKAVLDAV
FT                   VARIVADGGTAEAIALDVAKSADAQAAADAILMRHGRIDLLVNSAGVNVPRRRWDDMTL
FT                   DGWNQLVEINLNGVLYCMKAVLPAMRKQRDGTIINVSSWAGRHVSKMPGPAYTSTKHAV
FT                   LALTHSFNMEECINGLRACCLMPGEVATPILEQRPVVPSAEEQARMLQPEDLGRTIAFV
FT                   ASMPPRVCVNEILISPTWNRGFIQTPANRE"
FT   gene            245967..247493
FT                   /locus_tag="BRADO0229"
FT   CDS_pept        245967..247493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0229"
FT                   /product="putative O-succinylbenzoate--CoA ligase (menE)"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="6.2.1.26"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8626063; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74193"
FT                   /db_xref="GOA:A4YJW7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74193.1"
FT                   /translation="MNHAANTNLFARLFDGLDDPSRLAIETHDGQRITYGDLVARAGQM
FT                   ANVLVSRGVKPGDRVAAQTEKSVSGLVLYLATVRAGGVYLPLNTAYTLNELDYFIGDAE
FT                   PTVVVCDPSKAEGIGALAAKVGAKVETLDASGRGSLTDAADKAETAFITVPRAPDDLAA
FT                   ILYTSGTTGRSKGAMLSHDNLASNSLTLIDYWRFTRDDVLIHALPIYHTHGLFVASNVT
FT                   LFARASMIFLPKLDPDLIINLMARATVLMGVPTFYTRLLQNPRLSKETTSHMRLFISGS
FT                   APLLADTHREWFARTGHAVLERYGMTETNMNTSNPYAGERVPGAVGFPLPGVSVRVTDP
FT                   ETGKELARDDIGMIEVKGPNVFKGYWRMPEKTKSEFRPDGFFITGDLGKIDPQGYVHIV
FT                   GRGKDLVISGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRQPGADVS
FT                   EVGVLKGLDGRLAKFKMPKRVFVVDELPRNTMGKVQKNVLRDQYKDIYTK"
FT   gene            complement(247501..247689)
FT                   /locus_tag="BRADO0230"
FT   CDS_pept        complement(247501..247689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0230"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74194"
FT                   /db_xref="GOA:A4YJW8"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74194.1"
FT                   /translation="MQEPAEEPLTCILGFTAAGLFAACLAIAIQHEIAWLAVVKLALIC
FT                   AAPPLAALAGLAIARRR"
FT   gene            248333..248731
FT                   /gene="sdhC"
FT                   /locus_tag="BRADO0232"
FT   CDS_pept        248333..248731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="BRADO0232"
FT                   /product="Succinate dehydrogenase cytochrome b556 subunit"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.4.1 : Electron donor"
FT                   /function="1.4.3 : Electron carrier"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="1.3.99.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8637872; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74195"
FT                   /db_xref="GOA:A4YJW9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74195.1"
FT                   /translation="MTARIERPLSPHLQTYRWTLTMILSIVHRATGVALYFGTLLLAWW
FT                   LIAAASGPSAYSYVQGFMGSFLGRLIVFGYTWALLHHLLSGIRHFVWDLGYGFKPNERE
FT                   TLTWGALIGGISLTVLVWIVAYAVGGGR"
FT   gene            248752..249126
FT                   /gene="sdhD"
FT                   /locus_tag="BRADO0233"
FT   CDS_pept        248752..249126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="BRADO0233"
FT                   /product="Succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.4.1 : Electron donor"
FT                   /EC_number="1.3.99.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8637872; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74196"
FT                   /db_xref="GOA:A4YJX0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74196.1"
FT                   /translation="MRTPLGRVRNLGAAHSGTGDFWRQRITAVAMTLLIVPVVVVVIML
FT                   LGRNQAGAAQILGSLPIALIMLLFVVASCWHMKIGMQVIIEDYVHTESLKLIAIMGNNF
FT                   FAVTVAIASIYALIKLSTGV"
FT   gene            249130..250968
FT                   /gene="sdhA"
FT                   /locus_tag="BRADO0234"
FT   CDS_pept        249130..250968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BRADO0234"
FT                   /product="Succinate dehydrogenase flavoprotein subunit"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.4.1 : Electron donor"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.3.99.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8637872; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74197"
FT                   /db_xref="GOA:A4YJX1"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74197.1"
FT                   /translation="MAGGANGSANGAPATNGKAYPIEDHTYDVVVVGAGGAGLRAVVGC
FT                   SEAGLRTACITKVFPTRSHTVAAQGGISASLGNMHQDDWRWHMYDTVKGSDWLGDQDAI
FT                   EYMVRNAPDAVYELEHWGVPFSRTEDGKIYQRPFGGMTMDYGKGQAQRTCAAADRTGHA
FT                   MLHTMYGQSLRHAAEFFIEFFAIDLIMDDQGTCRGVIAIKLDDGTLHRFRAQTTILATG
FT                   GYGRAYASCTSAHTCTGDGGGMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGG
FT                   YLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEIREGRGVGKKKDHIFLHLDHLDPKV
FT                   LAERLPGISESAKIFANVDVTREPIPIVPTVHYNMGGIPTNYHAEVLTKKDGDDNAIVP
FT                   GLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALRLAEKLTPNGKQPDLPKDSADKA
FT                   LSRLDHYRYASGGTPTAKLRESMQHVMQTNCAVFRTGEVLQEGHNLIHKVYGGIGDIAV
FT                   SDRSLVWNSDLIETLEFDNLIAQAVVTMDSAVNRTESRGAHAREDFPDRDDKNWMKHTL
FT                   AWIDNKDGKTTIDYRPVHNYTMTNDVQYIPPKARVY"
FT   gene            251018..251800
FT                   /gene="sdhB"
FT                   /locus_tag="BRADO0235"
FT   CDS_pept        251018..251800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BRADO0235"
FT                   /product="succinate dehydrogenase, Fe-S protein"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.4.1 : Electron donor"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.3.99.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8637872; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74198"
FT                   /db_xref="GOA:A4YJX2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74198.1"
FT                   /translation="MAEFALPKNSQITGGKTWPKPAGATEVREFKVYRWNPDDGKNPSV
FT                   DTYYVDVNDCGPMVLDGLIWIKNHIDPSLTFRRSCREGVCGSCAMNIDGQNTLACTRSM
FT                   HDVKDGAVKINPLPHQPVVKDLVPDLTNFYAQYASIEPWLKTTTPTPQKEWKQTHEDRE
FT                   KLDGLYECILCACCSTSCPSYWWNSERYLGPAALLQATRWVKDSRDEATGERLDNLEDP
FT                   FRLYRCHTIMNCAKACPKGLNPAEAIAELKLKLVERQI"
FT   gene            251919..254069
FT                   /locus_tag="BRADO0236"
FT   CDS_pept        251919..254069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0236"
FT                   /product="putative sensor histidine kinase with a Response
FT                   regulator receiver domain"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74199"
FT                   /db_xref="GOA:A4YJX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74199.1"
FT                   /translation="MQTAQRKSLTMLRWMMVASLALPIALFLVAAYVSYGATTDEADRE
FT                   IRRSLDVVHEHALKVFETIERSLSEIDEIVRDLSDSDIKTREQALHVRLRQLSDSLPQM
FT                   KSAWVFDANGRPLVNSLIYPAPEVSFLDRDYFSAHVKDSIGTFIGAPLTPRSPYPGAAF
FT                   FSVSRRRQSDDGSFTGIIQASVLPDYFEHFYARIGRAPGSYFALKRFDGLTLARFPAAE
FT                   RSAGPAPNDIPAGAADTEQLVTETSRRDGIERRVGYQRLPGYPVYVAAGLETATIRNRW
FT                   LGTMSRHLIFGIPATALLVVFLTLARRRTERFYIEAARRLEAEDALKHGQRMEALGQLT
FT                   GGVAHDFNNLLTVIRASADLLRRPNLPDERRQRYIDAISDTVARASKLTSQLLAFARRQ
FT                   TLKPEVFDIGRSVVTLRDMTKTLVGSRIEIVTSVPDEPCYVNADAGQFETALINMAVNA
FT                   RDAMAGQGLLSITVVPAPDLPTPVAPHDRPPLGYVAIAVQDTGVGIPQEQVGRIFEPFF
FT                   TTKTIGQGTGLGLSQVFGFAKQSGGEIGVVSEVGRGATFTLYLPRVAPMQDQHHAAPGH
FT                   AVPITGRGMSVLVVEDNIDVGRSATEALAELGYLTTLVDNAKDALEELIDGASRFDVVF
FT                   TDVVMPGMTGLELAEEIRRLELNIPVVLASGYSHVLAQQGTNGFELLRKPYSIEELSRV
FT                   LHKVVPVPLYGAPPVAPNSEVR"
FT   gene            254109..256085
FT                   /locus_tag="BRADO0237"
FT   CDS_pept        254109..256085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0237"
FT                   /product="putative ABC transporter (fused ATP-binding and
FT                   permease components)"
FT                   /function="4.3.A.1.am : ATP binding and membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74200"
FT                   /db_xref="GOA:A4YJX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74200.1"
FT                   /translation="MGSGYRDMGQIQDIERPVTSEPVKGPIIEIAAENGDQVEPPPPEV
FT                   VEPDPELSPEEAEQVRKRYLLTRFWISARGYWGRAGDRLAWPFTIGLLMLIVGTVAFQY
FT                   GINVWNRSIFDAIEKRDAATVFHLTAIFFPLAIGSVILAVAQVYARMAIQRRWRAWLTN
FT                   SVITRWLTSGRYYQLNLVSGDHKNPEYRIAEDLRIATDSPVDFVAGVTSALLSAATFIV
FT                   VLWTIGGALTLRLGGSELTIPGFLVIAAVVYAVIASGSIMAIGRRFVQTSEDKNQAEAD
FT                   FRYTLTRVRENGESIALLGGETEERAGIDRTFGNVLQQWARLAGQHMRTTLVSQGSSLI
FT                   APVVPLLLCAPKFLDGSMTLGQVMQAASAFTIVQTAFGWLVDNYPRLADWNACARRIAS
FT                   LMMSLDALERAERGDGVGRIKRGETTGEAMLSLNDLSVTLDDGKAVVGETEVVVDPGER
FT                   LLVAGESGTGKSTLVRAIAGLWPWGGGSINFHPDRRLFMLPQRPYVPSGSLRRAVAYPG
FT                   AAEDWSVEQVGEALHKVGLDHLKDRIEEEAPWDQTLSGGEKQRLAFARLLLHGPDIVVL
FT                   DEATSALDEKSQDKMMQMVTNELPKATIVSVAHRAELEAFHSRKIVLERRKGGARLVSD
FT                   IDLIPRKGKRRLIGRFLRQRKAV"
FT   gene            256182..257009
FT                   /locus_tag="BRADO0238"
FT   CDS_pept        256182..257009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0238"
FT                   /product="conserved hypothetical protein; putative
FT                   methyltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74201"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74201.1"
FT                   /translation="MTPDNDPSPPPFGAFAPNAAQALVIRLAHGSGLKRGAFRPMLTRA
FT                   VNLLRAGPVDVSYQGANFRFYHQLSATERGALFNPDYNREELDFLRSHVPPAGTAVDVG
FT                   ANVGTFALPLARHVGPAGRVIAVEPHPVTHARLSFNRDASALSQVRLVAAAAGDSDGEV
FT                   MIETDGDNLGASHIVVGTAGAEAFKVPSLRLQAILEQAGATKVDALKIDVEGFEDRVLT
FT                   CFFRDAPQTLWPRAVVIEHLSRDEWQNDCLADMIRRGYREVGRTRSNTLLLRG"
FT   gene            257098..257583
FT                   /locus_tag="BRADO0239"
FT   CDS_pept        257098..257583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0239"
FT                   /product="conserved hypothetical protein; putative general
FT                   stress protein 26"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74202"
FT                   /db_xref="GOA:A4YJX6"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74202.1"
FT                   /translation="MSNDDTRDQDRVWELMKKIGFAMLVTKDGDKLRARPMSAYLARDE
FT                   GLIYFLTDARHHKDEEIARAPQVNLSFADAGSQKYVSLTGTATISNDRAKIRDLFTTTA
FT                   KAWWDSAEDPNIRLLKITPDDAEFWDSPGTVISYVKMAAAAVTNTRPDVGDNRKVAM"
FT   gene            257580..257819
FT                   /locus_tag="BRADO0240"
FT   CDS_pept        257580..257819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74203"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74203.1"
FT                   /translation="MMPIEPPEIPPATPGHPVEPPPEDPVGHPSPEVPPPVHEPDTPAP
FT                   PRELPGQTPDEVPGRGPLGPTTPSPVTDEGPVTD"
FT   gene            259183..260196
FT                   /locus_tag="BRADO0242"
FT   CDS_pept        259183..260196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0242"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74204"
FT                   /db_xref="GOA:A4YJX8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74204.1"
FT                   /translation="MAAPIPAPPPPTPQQLTPIAPGAALPGPQRLDDFRGQRREVQEGG
FT                   RTVIYEPGRVIVRDPSGQEFVRHDELERFRFGARDIRVEREDRGETRTVVFRPDGSQIV
FT                   TITAPDGRLLRRIRRDIGGREIIIIDNTYRDPQAVGGFYVELPPPEIRIPYNRYIVDAE
FT                   EAPPDVIYDTLIAPPVERVQRRYSLDEVRYSPSVRQLMPSIDLNTITFDTGSWEIAPDQ
FT                   VAKLQVIADGLNQAIQRNPREVYLIEGHTDAVGNETDNLSLSDRRAESVATLLTQQFGV
FT                   PAENLTSQGYGEQYLKEQTQGPSRINRRVTVRRITPLLNGGQAALPPPPPGVAPPR"
FT   gene            complement(260750..262096)
FT                   /gene="argG"
FT                   /locus_tag="BRADO0243"
FT   CDS_pept        complement(260750..262096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="BRADO0243"
FT                   /product="argininosuccinate synthetase"
FT                   /function="1.5.1.3 : Arginine"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.3.4.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74205"
FT                   /db_xref="GOA:A4YJX9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74205.1"
FT                   /translation="MTTILKGLPTGEKVGIAFSGGLDTSAALLWMKQKGARCFAYTANL
FT                   GQPDESDYDEIPRKAMSFGAEKARLVDCRTQLVHEGIAAIQSGAFHISTGGATYFNTTP
FT                   LGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNPNLKIYKPWLDQQFI
FT                   DELGGRAEMSAFLTAHGFNYKMSAEKAYSTDSNLLGATHEAKDLESLSSGIRIVNPIMG
FT                   VPFWREDCAVRPETVVVRFEEGQPVALNGQTFTDPVALFLEANAIGGRHGLGMCDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRMSGMKLGRLLYQGRWFDSQ
FT                   ALMLRETAQRWVASAITGEVTLELRRGNDYSLLNTESPNLTYQPERLSMEKVEDAAFTP
FT                   ADRIGQLTMRNLDITDTRTKLKLYSDTGLLSGAEGAQIFQLGHDKGDKS"
FT   gene            complement(262196..262978)
FT                   /locus_tag="BRADO0244"
FT   CDS_pept        complement(262196..262978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0244"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein; putative phosphatase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74206"
FT                   /db_xref="GOA:A4YJY0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74206.1"
FT                   /translation="MNRTGLFIALSLALVIGVLFGVYPELDLKLAALFYDPHTRSFPVK
FT                   LDGYAAFARDAAMWISWGLALPSIIALVVKLIRPDRPLLIKGRTIAFLLLTLSLSAIVI
FT                   TNLTFKSYWGRPRPVVVTEFGGDMQFVPWWDPRGGCGRNCSFFSGEGATAFWTLAPAAL
FT                   TPPAIRPVAYAAAVLFGLATSVLRMAFGGHFFTDITAAGLVTFLVIWLLHGYIYRWPST
FT                   RLTDAGVDTALTRFAMPGFRLMRRLFGRRRPADSSPAA"
FT   gene            complement(263018..263500)
FT                   /locus_tag="BRADO0245"
FT   CDS_pept        complement(263018..263500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0245"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74207"
FT                   /db_xref="GOA:A4YJY1"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74207.1"
FT                   /translation="MALIGRLIVIAFAFLLACFVAGLVVVTAILIPEFSDIGIGPIDQS
FT                   AFQIIIGFGFIFVSGFALIPALLIALITEAFSIRSVLAYAIGGGVVGAACYLGLIPFDP
FT                   ETLHFEGIVRRQLEILTGAGILGGLIYWLIAGRNAGRWREPPPQLPPPPLPPGAPR"
FT   gene            complement(263654..264865)
FT                   /locus_tag="BRADO0246"
FT   CDS_pept        complement(263654..264865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0246"
FT                   /product="putative pyruvate formate lyase activating enzyme
FT                   2 (yfgB)"
FT                   /function="3.1.3.3 : Inhibition / activation of enzymes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74208"
FT                   /db_xref="GOA:A4YJY2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74208.1"
FT                   /translation="MATTAGLRDAAAPLEKIPLETYVPPAKPSLIGLSRAELAARLGDI
FT                   GVPERQQKMRVQQLWHWLYFRGARSFDEMTSVSKDTRNGLAERFTVDRPEVVAEQISND
FT                   GTRKWLLRLPSGDDLQKAHEVECVYIPETDRGTLCVSSQVGCTLNCAFCHTGTQRLVRN
FT                   LTAGEIVGQIMVARDRLNDWADRETPHGNRLITNIVMMGMGEPLYNFEAVRDALLIVSD
FT                   NEGIGISRRRITLSTSGVVPNIKRAGEEIGVMLAISLHAVRDELRNELVPLNRKYPIAE
FT                   LLQACRDYPGASNARRITFEYVMLKGVNDSLDDARLLVKLLKGIPAKINLIPFNPWPGS
FT                   AYECSDWEQIEKFSEYVFNAGYSSPVRTPRGRDILAACGQLKSETEKLSARERQALRAM
FT                   AMTD"
FT   gene            complement(264981..265544)
FT                   /locus_tag="BRADO0247"
FT   CDS_pept        complement(264981..265544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74209"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74209.1"
FT                   /translation="MAHAQTASPKAPPKAAPAPQPKAAPKADAKPAVPSIGGAEPTLIG
FT                   QYGGWGAYTAMPAGKKVCFALAKPTSSKTNPANRPRDPAYAFVSTRPSEKVFNEVSIMI
FT                   GYALKPGADGSLDVGGASYAMYAQGDGLWIKNAAEEERMVEAMRKAPEAVVKGVSAKGT
FT                   ETTDVFSLKGLAQALDRIAQDCRR"
FT   gene            265947..266921
FT                   /locus_tag="BRADO0250"
FT   CDS_pept        265947..266921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0250"
FT                   /product="putative quinone oxidoreductases (NADPH) and
FT                   Zn-dependent alcohol dehydrogenases"
FT                   /EC_number="1.6.5.5"
FT                   /EC_number="1.1.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74210"
FT                   /db_xref="GOA:A4YJY4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74210.1"
FT                   /translation="MKAILCSQFCQPDDLVLAEVPDPVAGPGEAVIAIKAAALNFFDIL
FT                   MIQGKYQIKPPFPFSPGAEVAGIIESVGDGVTDLKVGDRVVASCGHNGAREKIALPAAA
FT                   IVKIPDHLDFDRAAGIIIIYGTALHALEDRASPKPGETLAVLGAAGGTGLAACELGQLM
FT                   GLKVIACASSDEKLAFAKQHGATLTLNYAKDDLKEGLRRLTDGKGADIIFDPVGGTYAE
FT                   AALRSIAWEGRFLVIGFAAGDIPKMPLNLALLKGCDIRGVFWGAWTRLNPAKNRANLEK
FT                   LVQWTADGKLSSHVDRTFPLAQTADALKVLAGRQAMGKVILHP"
FT   gene            267422..268447
FT                   /locus_tag="BRADO0251"
FT   CDS_pept        267422..268447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74211"
FT                   /db_xref="GOA:A4YJY5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74211.1"
FT                   /translation="MGMKAMAERTTRGRFDDRSSTGPEFRPFPDDPPQDRPQTYRFGRS
FT                   AQDHYPNDESMPMFLSEYEAGHQIESTEFDDQWPVRARRTSVSSRILLAVVAAAGVAVL
FT                   FALVTSDATRDLIASAKASMVGSAPDPTAPPQPSATQLTARDMQLNEPARVTPEPQPMA
FT                   APAAAAAAAPVQMAAVTPSRDDIANAYQTALQNRVPTPPAPPAPSVATAPPAMTPPSMT
FT                   SPGAGAAIVAPGLGSVTAAPPPAQARRLDPDELAGIMKRAKGLLAAGDIPSARLLLERA
FT                   AEAQEPAAALMLAQTYDPHVLGTKDIRNINADPAAARNWYRRAAQLGSAEAQRRLDQLQ
FT                   N"
FT   gene            268594..269769
FT                   /locus_tag="BRADO0252"
FT   CDS_pept        268594..269769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0252"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide, putative TRAP-type uncharacterized transport
FT                   system"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74212"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74212.1"
FT                   /translation="MRRLIGAAVAAVLIACGFAAHAEESEFDPAKVSDSLKAIFQFGSV
FT                   QTKQALNANTVTLITGTIGGTYVQFGADLASLLDDGNSLRVLPIVGRGSVQSVADILFL
FT                   QGVDLGVVRADTLDYLERKGFAKDIKKQFTYVTKLYNEEMQVIAPRAVRNLRDLEGRRV
FT                   SVDLPNGGTFVTALTVFERLGLRANFLYIEQRIAMEKLKRGELDAVIVVGGKPYKSVSN
FT                   FVNDGRFHLVNVDYDRPLQNDYLPATLTAKDYPNLIAEGEKVDTIAVPAVLAAYNWAPN
FT                   TDRYRKLATFVDAFFTKFPAFQNPPFHPKWKEVSLSAPLAGWQRLPAASKWLETHAMEG
FT                   AQRDRFDDFLKQSSAGKALPTEADREALFKQYQAWEAEKTGSARAQARPQR"
FT   gene            complement(269896..270240)
FT                   /locus_tag="BRADO0253"
FT   CDS_pept        complement(269896..270240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74213"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74213.1"
FT                   /translation="MRRRFWIKFKQVVARIPFAEDLLAAYYCAFDKETPRHVQVALLGA
FT                   LAYFILPFDFLPDVMPVLGFTDDAAVLATAIRMVASHITPDHHAAAKAALARLQDDADA
FT                   DLDNNGEQAG"
FT   gene            complement(270442..270744)
FT                   /gene="phhB"
FT                   /locus_tag="BRADO0254"
FT   CDS_pept        complement(270442..270744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhB"
FT                   /locus_tag="BRADO0254"
FT                   /product="Pterin-4-alpha-carbinolamine dehydratase"
FT                   /function="3.1.2.4 : Complex regulation"
FT                   /EC_number="4.2.1.96"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74214"
FT                   /db_xref="GOA:A4YJY8"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YJY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74214.1"
FT                   /translation="MVERLSAEARASALRDLSGWAELDGREAISRTFTFRDFNEAFGFM
FT                   TRVALIAEKRDHHPEWRNVYRTVEVVLATHDAGGVTMLDIELARAMDAIAAAISG"
FT   gene            271120..272466
FT                   /locus_tag="BRADO0255"
FT   CDS_pept        271120..272466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0255"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74215"
FT                   /db_xref="GOA:A4YJY9"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74215.1"
FT                   /translation="MFIVIAGILAIIGALAGAYYFAMRPVVLKIAVGPPNSDDLKVVQA
FT                   LTQAFSQNHAYVRLRPVPSEGAAESGQALAAGKVDLAIIRGDLEVPKNAQAVATLRKNV
FT                   AVLWVPSAGKGKGRKGAAKITKISQLAGHKVGIIGRTPANANLLKVVLHQYGVDPAKVE
FT                   MVQFPASEAAEAVRSQKADVWLAAGPVNSKITADAIAAATKDGGVPTFLAIDSAEAIAQ
FT                   NHPEYEAAEIPAGAFGGSPDRPEDEIKTISFNHHIVARKGLADSTVSAFTHQLFSVRQQ
FT                   LLSEFPLAAKIETPDTDKDAAIPAHPGAAAFVDGEEKTFLDRYSDYIWWGLMALSAMGS
FT                   AGAWFAGYLKRDERTINTSLRDRLLEMISIARKSDSTDELDQLQAEADEILRNTLTCFE
FT                   DGAIEHAALTAFNIALEQFHNAVADRKLILMSMPAHLQRTGAQLRAAGT"
FT   gene            272589..274160
FT                   /locus_tag="BRADO0256"
FT   CDS_pept        272589..274160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0256"
FT                   /product="putative alkaline phosphatase (phoD); putative
FT                   signal peptide"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74216"
FT                   /db_xref="GOA:A4YJZ0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74216.1"
FT                   /translation="MTVHIPRPNLKLSRRRFLSTAAGAGIATLSMPYLSRAADRPQITH
FT                   GVQSGDVSMDGGVVWARADRPSQMLVEVATTESFKDARSLPPIAALPESDFTAKMLVDN
FT                   LPSGQDIFYRVKFRDLAHVSVESEPVVGRFRTAPGNKRDVSFVWGGDVAGQGWGINPDD
FT                   GGMFTFSTMKKHRPDFFLHSGDTIYADGPIKSEVKLPDNKVWKNLTVEEKAKVAETLDE
FT                   FRAAHKYNFLDENVRGFNAEVPIFVQWDDHEVTNNWSASKDLPAAYKERNIQLLAARAA
FT                   RAFHEMYPMRESIVEPGRVYRTINYGPHLDVFVLDERSYRGANGANLEDKYGPASYFIG
FT                   PEQMRWLKQALLNSRATWKVIASDMPLSLIVYDDAANRRGSEAIAQGDGPARGRELEIA
FT                   EILRFIKTAPIQNTVWLTADVHYAAAHYYDPNKAQFQDFEPFWEFVSGPLHAGTFGPNE
FT                   LDNTFGPEVRFIKAPGLDKQNLPPSAGMQFFGHVKIDGASGQMTVTLRDRADVALWSTT
FT                   LDPKLA"
FT   gene            complement(274182..274556)
FT                   /locus_tag="BRADO0257"
FT   CDS_pept        complement(274182..274556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0257"
FT                   /product="conserved hypothetical protein; putative
FT                   two-component response regulator"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74217"
FT                   /db_xref="GOA:A4YJZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74217.1"
FT                   /translation="MTSSQSRVPELYQHVLVVEDDPIIALGLEDTITDLGVADVRVAAN
FT                   VATALAMIEERAPQFALLDVGLVREKSFAIAERLNTLGIPFAFSTGYGADGVPSAFSDR
FT                   PRLPKPCPTEALEVVLRRRD"
FT   gene            274724..275485
FT                   /locus_tag="BRADO0258"
FT   CDS_pept        274724..275485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0258"
FT                   /product="conserved hypothetical protein; putative
FT                   transcriptional regulator with a cAMP-binding domain-like,
FT                   Crp/Fnr family"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74218"
FT                   /db_xref="GOA:A4YJZ2"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74218.1"
FT                   /translation="MLSQGVTTLARERPYNNLLRRLSPPDYALIAPYLVEDQAAPNELL
FT                   YRPGDDVQIVHFPCGPALTSYLVPNEDGRDVETILVGREGAVGGIVSEGFLPAYTRIVV
FT                   KFGGPFARLPLSRLAAAKLQSKTLRNVFARYADCMLAQMFQSTACNAIHSIEQRTAKWI
FT                   VAAMDRTDGEPIVPLTHEQLATLLGVGRSYVSRVVQTFRAEGILDTRRGAFMVRDFAAL
FT                   KQRSCLCNEAVKTHFEEVLRGVYPTEQAAAG"
FT   gene            275567..276286
FT                   /locus_tag="BRADO0259"
FT   CDS_pept        275567..276286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0259"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein; putative prolipoprotein diacylglyceryltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74219"
FT                   /db_xref="GOA:A4YJZ3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74219.1"
FT                   /translation="MDGAALHAMFDLAAWLSAGAAGWWLTRIAGVSFPKQSTEWPYVAA
FT                   LVFGAGVGAYLFGTLNLWLSGMSGLARSVEGALTGGIVAVELYKWRHGIALRTGARFAL
FT                   PLAVGVAVGRIGCYAAGLDDFTYGTPTALPWGHDFGDGISRHPVQLYESLAMAAFAVVY
FT                   VAAVLRRSEPVIANGFYLALLVYGLQRFVWEFLKPYGPVVGPLTLFHLLSLAIAAYAAA
FT                   MLATAPQPKALHERAAA"
FT   gene            276267..277679
FT                   /locus_tag="BRADO0260"
FT   CDS_pept        276267..277679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0260"
FT                   /product="conserved hypothetical protein; putative
FT                   predicted Fe-S oxidoreductases"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74220"
FT                   /db_xref="GOA:A4YJZ4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74220.1"
FT                   /translation="MNAPLRKSRPYVFWGQTQSLCETCLELVPTKIQIVDNEVWYEKRC
FT                   RQHGVQTTLISDDAAYWRRCKSFIKPGDTPLSFQRRTEYGCPYDCGLCPDHEQHSCLAL
FT                   IEITDHCNLTCPVCFAESSPQRAHFSPLATVERMLDALVQSEGEPDLVQISGGEPTLHP
FT                   EFFDILAAVRARPIRHVMINTNGLRIAREPDFVSRLAETKRGLEVYLQFDSLSRAGLTN
FT                   IRGADLRRIRQQALENLERAGISTTLVATIKRGVNDDEIGDIVRHALQWSCVRGVTLQP
FT                   VQDAGRNADFNKETDRIMLSEIRRRVIETGVFGDQDMIPLPCNPESISIGYGLRNGTTV
FT                   LPLTSMVPQEELLSVMPNTISPEKYPVLREKFVELFSLSSGPLNTGERVAEFLCCLPSV
FT                   QVPDNLGYEHVFRVTIVQFLDRFNFCVGNVKRSCIHFVTERGEIIPFDTYNLFYRNGAI
FT                   DGIRARLAEGQT"
FT   gene            277676..277909
FT                   /locus_tag="BRADO0261"
FT   CDS_pept        277676..277909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0261"
FT                   /product="Mercuric transport protein (Mercury ion transport
FT                   protein) (fragment)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74221"
FT                   /db_xref="GOA:A4YJZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74221.1"
FT                   /translation="MSDKPPSLPPRAKRHGCLSVLMVVGGVVLLLPGLCAGQLAVGALI
FT                   RLSWPWEITPLIAFGLLCGAAGLWLLVKVSRG"
FT   gene            278131..278367
FT                   /locus_tag="BRADO0262"
FT   CDS_pept        278131..278367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0262"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74222"
FT                   /db_xref="GOA:A4YJZ6"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74222.1"
FT                   /translation="MTLPEQPAQPAPWGCLRVIVSILLLLIGLVLLAPGLLCLVSVRNT
FT                   PGLFAVFALGAIVLGLFLVLAAIRLMRPCRHGR"
FT   gene            278390..278626
FT                   /locus_tag="BRADO0263"
FT   CDS_pept        278390..278626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0263"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74223"
FT                   /db_xref="GOA:A4YJZ7"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74223.1"
FT                   /translation="MSPFLEEVRRARAPAGLTATIGAILGGLALMFPFGCVMALMRREW
FT                   NEFGGLFGPGAILAGMAVAGLVMIVLAVRRRWG"
FT   gene            278637..279413
FT                   /locus_tag="BRADO0264"
FT   CDS_pept        278637..279413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0264"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74224"
FT                   /db_xref="GOA:A4YJZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74224.1"
FT                   /translation="MSSPERPGPDAARGTPPLPKERWKGPPGGIPDEEGPRGKGCLNPL
FT                   IMAGSLALIAWGLFAAIYFAVFVRWHMGGYFGFFLEGLTASVVGAVVMLSARHRLRAPT
FT                   LGRPEAGTAAASGCLPSFMLVAGCALLLPGACSLLFGLSAMGSVEHIGDPSLLLAVFTL
FT                   GAVGIASLWWVSARPAGVAGPLMAAGIVFMIPGLFLAVYGFSRLYWINQMPSVLLPIGL
FT                   PAGVIGIVCFWMAWQRWLADASADPLAVPPGPAPDS"
FT   gene            279639..281465
FT                   /gene="typA"
FT                   /locus_tag="BRADO0265"
FT   CDS_pept        279639..281465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="BRADO0265"
FT                   /product="GTP-binding protein typA/bipA (Tyrosine
FT                   phosphorylated protein A)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74225"
FT                   /db_xref="GOA:A4YJZ9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A4YJZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74225.1"
FT                   /translation="MNLRNIAIIAHVDHGKTTLVDKLLQQSGTYRENQRTVERAMDSND
FT                   LERERGITILAKCTSVQWQDTQINIVDTPGHADFGGEVERILSMVDGVIVLVDAAEGPM
FT                   PQTKFVVGKALKLGLKPIVAINKVDRPDARITEVVNEVFDLFAALDATDEQLDFPILYG
FT                   SGKNGWMATTPDGSHEDGMKPLFDLVLKHVAPPVVEEGPFRLLGTIIEANNYLGRIITG
FT                   RIASGSVKPNQAVKVLSRDGKLIETGRITKILAFRGLERQPLDYAEAGDIVAIAGLTKG
FT                   TVADTFCDPSVETPLQAQPIDPPTVSMSFIVNNSPLAGTEGDKVTSRLIRDRLLREAEG
FT                   NVALRVVESQDKDAMEVSGRGELQLAILIETMRREGFELSVSRPRVVFEKDPATGQTLE
FT                   PIEEVVIDVDEEHSGVVVQKMSERKAELIEMRPSGGNRLRLVFYAPTRGLIGYQGELMT
FT                   DTKGTAIMNRLFHNYMPYKGAIQGRRNGVLISNDQGEAVAYAMFKLEDRGPMMIEPGWK
FT                   VYKGMIVGEHTRDNDLEINVLKGKQLTNIRTTSKDEAVRLTPPIRMTLEKALAYIEDDE
FT                   LVEITPKSIRLRKKHLDPNERKRAEKQKEAVA"
FT   gene            281718..282965
FT                   /locus_tag="BRADO0266"
FT   CDS_pept        281718..282965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0266"
FT                   /product="conserved hypothetical protein; putative amine
FT                   oxidase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74226"
FT                   /db_xref="GOA:A4YK00"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74226.1"
FT                   /translation="MSSLPSSVDIAIIGAGAAGLGAAHALKNAGVSFVVLEGRDRIGGR
FT                   AHTIMASPEVTFDLGCGWLHSADRNSFVGIAEQLAFTIEKSRPPWRDRAYEAAFSRAER
FT                   DDFLRALEAFFTRTAATAASGHDAPASVCLEPGNRWNGMIDAICTYLNGCELDQMSLLD
FT                   FEAYEDTELNWRIRRGYGALVSAYGAGLPIALNCNVTLIDHSDKRIRLTTSQGTLTADK
FT                   VIVTVPTNLIADEALRFTPALPDKLAAAAGLPLGLDNKVTLALDGWDHLPKDSGLRGRS
FT                   STARVGSLQLRPFGQPCIEGFYGGSFAREIEAAGEGALAAQAIDDVAALLGNDIRRSLK
FT                   PLAESRWGADPFARGAYSHALPGHADKRALLAAPVDDRLSFAGEATPPDFFSTAHGARD
FT                   SGERAAREALAWLGKR"
FT   gene            complement(283115..284002)
FT                   /locus_tag="BRADO0267"
FT   CDS_pept        complement(283115..284002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0267"
FT                   /product="putative transcriptional regulatory protein, LysR
FT                   family"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.2 : Activator"
FT                   /function="3.1.2.3 : Repressor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74227"
FT                   /db_xref="GOA:A4YK01"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74227.1"
FT                   /translation="MTLEQLRIFVAVATREHVTQAARELNLTQSATSAAVAALEARYQT
FT                   RLFDRVGRRIVLTAAGKAFLVEAKAVLARTAAAETVLDDLAGLKRGQLALAASQTIAGY
FT                   WLPAFIHRFNAAHPAIRLQLSIGNTEQVADRVREGAADLGFVEGDIDDPLLAAQPVAED
FT                   EMVLVGPADHPLCRGASVSAANLKAARWVLREQGSGTRAVLEAALGRFGLRTGELDVAF
FT                   ELPSNEAVRSAVEAGAGITVLSRLVVMRGVKAGLLAVANLELAKRPFYSLRHKEHHQTQ
FT                   AVREFLRMVGETFA"
FT   gene            complement(284011..284985)
FT                   /locus_tag="BRADO0268"
FT   CDS_pept        complement(284011..284985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0268"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74228"
FT                   /db_xref="GOA:A4YK02"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74228.1"
FT                   /translation="MPGLALSAAIAAGAFGLRQLPGLGMFSPMILAIVAGMALHNVVGT
FT                   PAQARPGVTFAMRRVLRVAIILLGLQLTAADIVEVGARGLAVIALSLTGTFLFTVWMGR
FT                   LLGVDRKLTELIAAGTSICGASAVIATNTVTRAHDEDVAYAVACVTVFGSLAMVVYPLL
FT                   PALLHLDAHAFGLWSGASIHEIAQVVAAAFQQGQQAGEFGTIAKLARVMLLAPVVLTLG
FT                   LLATRRACHGRRGQSSAQPPLPWFVLGFVALVGVNSVITVPAEAKTIIVTATTFLLSTA
FT                   LAAMGLETDFAKLKAKGLRPAALGFAAFLFIASFSLALVKLTT"
FT   gene            complement(285188..285598)
FT                   /locus_tag="BRADO0269"
FT   CDS_pept        complement(285188..285598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74229"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74229.1"
FT                   /translation="MTSWPDDDVILYDGVCVFCSRWVQFVIARDSARRFRFTPIQSPYG
FT                   IRLARAFGIDPGEPDTNAVVHGGKVHLKSDAALTVLSNLEGWGWTRALFAVPKPLRDAV
FT                   YSVIARNRYRIFGKFESCFVPDAELRRRVLEQ"
FT   gene            complement(285610..286938)
FT                   /locus_tag="BRADO0270"
FT   CDS_pept        complement(285610..286938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0270"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74230"
FT                   /db_xref="GOA:A4YK04"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74230.1"
FT                   /translation="MIASATSRILVLGASGLIGRFVTDDLRRRGFATIGVARAFSASQR
FT                   VSSLDVELPIMTFDAAALAGLIRAREIDVIVNCLGVLQDGPGSDTDAVHHQFVARLLAA
FT                   IPSSGRGVRLLHISIPGTAEEDRTAFATTKREAERLIAASGLPHAILRPGFVIAPSAYG
FT                   GSAMLRALAALPIDLPGKDAATPFQPVAVADIAATVAWLAARPLDEDATRAVNWDLMQP
FT                   EPVTLGGVIAAFRRSFGTTDGPRLPVPAPLVDFGAVAGDLASRLGWMPPMRTTAIAELR
FT                   RGVRGDPAPWMAATGIAPTTLSEAVGAHGATIQDKWFARLFLVKALMIASLVLFWIASG
FT                   GIALFISFPATTAILTTRGWPEGFAVPFAAVTSMMDISVGVLIAFRKTAAFGLAAGIFV
FT                   SLGYMLGCAVLTPDLWLEPLGALVKTGPAIVLMLVALLMMDNR"
FT   gene            complement(286949..287419)
FT                   /locus_tag="BRADO0271"
FT   CDS_pept        complement(286949..287419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0271"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74231"
FT                   /db_xref="GOA:A4YK05"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74231.1"
FT                   /translation="MMTVYFLVKYLHVLGAIVILGTGTGIAFFMLMAHLSGEAAFIART
FT                   AGVVVIADMLFTLSAVLLQPVTGGALMWLSSAAVTDGWLLTSLVLYVVAGLFWVAVVFM
FT                   QIELRDLARAADSRTEKLTPRYFTVFRRWFLCGIPGFGSVMAILWLMIAKPF"
FT   gene            287995..288504
FT                   /locus_tag="BRADO0274"
FT   CDS_pept        287995..288504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0274"
FT                   /product="putative N-acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74232"
FT                   /db_xref="GOA:A4YK06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74232.1"
FT                   /translation="MSTTLIEVRPAKAADAAAVASAHDEAWRSAYQGIIPGAELEKLIN
FT                   RRGPQWWDSAIRKGSRVSVLVFNDKVAGYANYGRNRARSLHFDGEVYELYLRPEFQGLG
FT                   FGRRLFQAAKRDLAQSGLKSMVVWALSDNDPATEFYRALGGRMVARSSERFGPKSLDKV
FT                   AFAWTN"
FT   gene            288708..289244
FT                   /gene="ppa"
FT                   /locus_tag="BRADO0275"
FT   CDS_pept        288708..289244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="BRADO0275"
FT                   /product="Inorganic pyrophosphatase (Pyrophosphate
FT                   phospho-hydrolase) (PPase)"
FT                   /function="1.7.1 : Unassigned reversible reactions"
FT                   /function="1.8.1 : Phosphorous metabolism"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.6.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9304784; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74233"
FT                   /db_xref="GOA:A4YK07"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74233.1"
FT                   /translation="MRIDAIPIGKDPPREVNVVIEVPVGGEPIKYELDKEAGTLFVDRF
FT                   LYTAMRYPGNYGFIPHTLSNDGDPCDVLVANTRAIVPGAVMSVRPVGVLLMEDEAGGDE
FT                   KIIAVPSSKLTQRYDKVRTYSDLPDITLQQIQHFYEHYKDLEPGKWVKVLRWGNADDAH
FT                   QLIAEGIARAKAAKK"
FT   gene            289439..290851
FT                   /locus_tag="BRADO0276"
FT   CDS_pept        289439..290851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0276"
FT                   /product="putative Gly-X carboxypeptidase (CPS1)"
FT                   /function="4.S.152 : peptide"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.17.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74234"
FT                   /db_xref="GOA:A4YK08"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74234.1"
FT                   /translation="MLVNTFRQGSRQLEVAALPKASVDQAAAAQRLAEAVRFRTVSSPD
FT                   DPELNAEAFAALRAHIEASFPAFHTAAAQEVVAGHSLLYTWRGSDTSAKPIALLAHQDV
FT                   VPIAPGTEPDWAVPPFAGVIKEGFVWGRGAWDDKGNLYAMLEAAEALIKAGFKPRRTIY
FT                   FAFGHDEEVGGVRGAKAMSAILAARNVRLDFVIDEGLLISEGGIKGLDKPAALVGVAEK
FT                   GYASLVLTAKATPGHSSMPPRDTAIGMMSAALAKLEANRLPMRIDGTVGEMFAALAPEM
FT                   SGINRAVLSNLWLTKPLLFSEFAKSGPAEAMVRTTTALTIFNAGDKDNVLPGNASATVN
FT                   FRLLPGDTEAGIIDHIRQTVANDRISISALRGNREPPLVTSTASPAYQLVNRTIREIFN
FT                   DAVVAPGLMIAGTDSSHYAGIADSIFRFSPLRATTEDLKRFHGTNERLSVEGYGDMIRF
FT                   YRRLLETAAGPA"
FT   gene            complement(290848..291732)
FT                   /gene="folD"
FT                   /locus_tag="BRADO0277"
FT   CDS_pept        complement(290848..291732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="BRADO0277"
FT                   /product="bifunctional: 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase; 5,10-methylene-tetrahydrofolate
FT                   cyclohydrolase"
FT                   /function="1.5.3.2 : Folic acid"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8765228; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74235"
FT                   /db_xref="GOA:A4YK09"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74235.1"
FT                   /translation="MTARIIDGKIIAADLRAQVAREVERVKHDLGLTPGLAVVLVGNDP
FT                   ASEVYVRSKHTQTQAAGMASFEHKLPADVAQAELLALISKLNQDPSVHGILVQLPLPKG
FT                   LDTEAVINAIDPAKDVDGLHPHNAGRLAGGQPALAPCTPLGCIILSKTVHASLEGMNAI
FT                   VIGRSNLVGRPLVQLLLNENATVTIAHSRSRDLPALTARADLVYAAVGRPEMVKRDWIK
FT                   PGATVIDVGINRIPTPEGKTRLVGDVAYAEVAEVAGAITPVPGGVGQMTVACLLVNTLR
FT                   AACAIAGLPKPSV"
FT   gene            complement(291856..292185)
FT                   /locus_tag="BRADO0278"
FT   CDS_pept        complement(291856..292185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74236"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74236.1"
FT                   /translation="MEPWRAATGGLTVALRVTPRGGRDAIDGIETLSDGRSVLKVRVRA
FT                   IADGGEANRAVTELLAKAIGVTKKAVRITSGTTSRLKQVAIDGDALALDLALRDLIAVH
FT                   KPTRT"
FT   gene            complement(292197..292487)
FT                   /locus_tag="BRADO0279"
FT   CDS_pept        complement(292197..292487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74237"
FT                   /db_xref="GOA:A4YK11"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74237.1"
FT                   /translation="MRAVLDIVLIVLDLYVWLLIASAILSWLIAFNVVNTRNQFVSAVA
FT                   EFLYRITEPVLAPIRRMLPNLGGLDISPIILILIIMLIQRVITYYIYPNVF"
FT   gene            292712..292787
FT                   /locus_tag="BRADOtRNA2"
FT   tRNA            292712..292787
FT                   /locus_tag="BRADOtRNA2"
FT                   /product="tRNA-Ala"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(292932..293678)
FT                   /locus_tag="BRADO0280"
FT   CDS_pept        complement(292932..293678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0280"
FT                   /product="putative glutamine amidotransferase class-I"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74238"
FT                   /db_xref="GOA:A4YK12"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74238.1"
FT                   /translation="MSTPAAAAAPRRPVLIILHQETSSPGRIGNALRARGYRLDIRRPR
FT                   FGDPLPKTLAEHSGAVIFGGPMSANDPDDFVRREIDWIEVPLREQRPFLGICLGAQMLA
FT                   IQLGAKVAPHPQGRAEIGYYPIRPTRAGKRLCPHWPDNVYHWHREGFDLPSGADLLAEG
FT                   VDFPVQAYQYGNATGLQFHPDVTYAMMCRWTTRGHARLDTPGACPRHHHFEGRAVHDAA
FT                   ERVWLKHFLDGWLARQPVAAMAEAAE"
FT   gene            complement(294001..294780)
FT                   /locus_tag="BRADO0281"
FT   CDS_pept        complement(294001..294780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0281"
FT                   /product="putative short chain dehydrogenase/reductase
FT                   family member"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74239"
FT                   /db_xref="GOA:A4YK13"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74239.1"
FT                   /translation="MGEGVTLVTGASSGIGTELARVFAANGHRLALTARREDRLAALAA
FT                   EISAKGAPAPLVIPCDLTSPNAGATIEAALSAAGVELEYLVNNAGFGLFGKAVQLDRTE
FT                   QLDMIAVNVRALTELSLRFSDQLIRNKGGILNLGSVAGFLPGPGMAVYYASKAYVISFT
FT                   EALRKELAPHGVRVTVLCPGPVPSEFQDRAGFKPGVDSVILNVPPKAVAEAGYRGLMAD
FT                   KRVVLPGIGIKIVPFLLRWFPRGFILDAVGRLQLKRS"
FT   gene            complement(294998..295465)
FT                   /locus_tag="BRADO0282"
FT   CDS_pept        complement(294998..295465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74240"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74240.1"
FT                   /translation="MLEGLRQFIADVVSPQETPAFDDNGYQLAATALLIHVISLDGEPS
FT                   EAERRKLHGLIELRFGLDHGSADRLIAQAMLAEGEAVDLYRFTSVIMREVNEAGRLRIV
FT                   EMMWELVYADGKVTEFEDNVVWRASELLGIPTRDRIDLKHRVAARRPDNPA"
FT   gene            complement(295604..296980)
FT                   /locus_tag="BRADO0283"
FT   CDS_pept        complement(295604..296980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0283"
FT                   /product="putative cytochrome P450 hydroxylase superfamily
FT                   proteins"
FT                   /EC_number="1.14.14.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74241"
FT                   /db_xref="GOA:A4YK15"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74241.1"
FT                   /translation="MSTADVHYLPRSPLVPPMPPRAPDSMGALRRVLMMGENAISTWSQ
FT                   RAYEDEIVHGRFFGSSSYILNTPETIKHVLVDNWENYARTVGAIRVLRPVLGEGLLIAE
FT                   GKAWKHQRRTLAPAFTPRAVSGLIPHMVAVTEETVARLQQQCGQPLDLREIMQRMTLDI
FT                   AGRTMFSFEMGRHGATLRDFVFEYGERLASPHLLDIVLPLSWPTPRDFARRRFRKRWTD
FT                   FVGMLMAERRAAGKREDAPPRDLFDLMGAARDPETGAAFTDAQLADEVATMILAGHETT
FT                   ATALFWALYLIALDPANQEKLAQEAQAATDLSNPDLLPFTRAVMDETVRLYPPAFLIAR
FT                   AASGPDQIAAFEVKRGDVVLISPWLLHRHERLWRSPNAFMPERFLPGAPPPERFAYLPF
FT                   GAGARVCIGAHFALVEAVLALARLVAAFRIELVDPAPVMPVGVVTTQPDRSPLFRITPR
FT                   "
FT   gene            complement(297202..298569)
FT                   /locus_tag="BRADO0284"
FT   CDS_pept        complement(297202..298569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0284"
FT                   /product="conserved hypothetical protein; putative
FT                   hydrolase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74242"
FT                   /db_xref="GOA:A4YK16"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR040664"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74242.1"
FT                   /translation="MKLTRRTILQSMGTLPLLTSGLTLPALAQTAAAPASDMPPVLFVH
FT                   GNGDHAALWITSLWRMESNGVPRARLAALNFTDPLARNDDAVAQPNRSSTDDQRRELTE
FT                   AIKALKERTGAARVALVGSSRGGNAIRNVVKNGGGGDVSHAVLCGTPNHGVFDWDDSPG
FT                   SEFNGRGPFLRGLNSGDSEVTDGTAFLTLRSDGLDKYAQADGRLVGKPGVPTGITTEGP
FT                   ALKGATNLVIGALDHREVAFHPRAFREIYKFIAGREPSFIAIQPEREVRISGLVTGTPG
FT                   GAPTNRPVAGATVEVYRVSGETGARNGEPVYRGQTGSDGRWGPAEIDPASYIEIVLTSP
FT                   GAPITHFYRSPFPRSSDVVHLRAARPLGQADAGAGAIVIMARPRGYFGLPRDIVLLDGR
FT                   EPADVQKGVPTDAATTLRLPAGEVGRSVTGLFNEERITARLWPASESRITMIELTN"
FT   gene            298724..300406
FT                   /locus_tag="BRADO0285"
FT   CDS_pept        298724..300406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0285"
FT                   /product="putative permease of the major facilitator
FT                   superfamily (MFS) transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74243"
FT                   /db_xref="GOA:A4YK17"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74243.1"
FT                   /translation="MTAPQKRELFAAESIAAPLKHTVFRRIWLASLLSNLGLLIQAVGS
FT                   AWAMTQMTASADKVALVQTALMLPVMFISMPAGAVADMYDRRIVALVSLAVALGGATTL
FT                   TVLAWLGLVTPERLLALCFVIGSGMALMGPAWQSSVSEQVPPETLPAAVALNGISYNIA
FT                   RSFGPAIGGVVVAAAGAVAAFAANALLYLPLLAALFLWRRVVEPSRLPREPLNRAIVSG
FT                   VRYIIHSPSIRIVLIRTLVTGLIGGSISALMPLVARDLLHGGAQTYGIMLGAFGMGAVV
FT                   GALNIGEIRKRLSGEAAIRTCALTLGAATAAVALSTEPVLTAAALVVAGAVWMLAVALF
FT                   NIGVQLSAPRWVAGRALAAFQAAISGGIAIGSWGWGRLTDAAGVEVALLVSAALMVVSP
FT                   LLGLWLRMPPVGARNEDGETLADPEVQLELTPRSGPLVVEIEYRVAQDDARAFHDLMQD
FT                   VQLSRQRNGAYGWSIARDIADPELWTERYHCPTWIDYLRQRNRATRAERELHKRAIDFH
FT                   IGADPVRIRRMLERPFGSVRSRDDIDRTAEQAPAVASAARSGP"
FT   gene            complement(300520..300735)
FT                   /locus_tag="BRADO0286"
FT   CDS_pept        complement(300520..300735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0286"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74244"
FT                   /db_xref="GOA:A4YK18"
FT                   /db_xref="InterPro:IPR001893"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74244.1"
FT                   /translation="MSRFLLVIPLVVMASVASAQQQPDQDACARDVSRHCRAVMNAGDQ
FT                   AVLACLKEHRAKLSKACEKVLTDHGQ"
FT   gene            complement(300855..301142)
FT                   /locus_tag="BRADO0287"
FT   CDS_pept        complement(300855..301142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0287"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74245"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74245.1"
FT                   /translation="MTKTFAFLRTAALTAVAAAALSTVASSASFAFSAEAQQMCTGDAF
FT                   RLCSSEIPNIPAITACMIKNRSSLSSGCRTVLDKEVLKRGGKVAEAADAN"
FT   gene            301471..302511
FT                   /locus_tag="BRADO0288"
FT   CDS_pept        301471..302511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0288"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide; putative polysaccharide deacetylase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74246"
FT                   /db_xref="GOA:A4YK20"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74246.1"
FT                   /translation="MRNALGLLLATVVAALAITGVWYWVSKPNAAKAAAQTAAAQPSEP
FT                   APAPAKLAAKGAKDDVDSTGTVPAKSASTAAPPMPPKSNCANPDALGISRTVVVDTTGG
FT                   PGFGLDHFKQFDFLADREVVLTFDDGPWPGNTPAVLKALADECTTGIFFSIGKHATYHP
FT                   EILRQVLAAGHVVGVHTWSHANLNGKKMTDEMAKEELEKGFSAVKFALGTNPAPFFRFP
FT                   QLQHRPSAVAYLGSRNVAMFSCDVDSFDFRSKDADQVVNTVMTGLEKKGKGIILMHDFQ
FT                   KNTALALPTLLRRLKAGGYKVVAMKPKGTLDTMPEYDAMIGQDPKLPTTMTNARPISSV
FT                   IQTVQQ"
FT   gene            complement(302603..303013)
FT                   /locus_tag="BRADO0289"
FT   CDS_pept        complement(302603..303013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0289"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74247"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74247.1"
FT                   /translation="MRKMILAGAMMLAAITAANADGTRSLSLSSSDTAAAPAPQRPVYL
FT                   QQAGDVTVTPAPVPAAAAPAQTAAQPAAPATASAAPAAAQPAAAPAAAPQPTPAAQTSS
FT                   RRSRSAGASKPRAKGWTEARIVRELHRHGIYW"
FT   gene            303447..304025
FT                   /locus_tag="BRADO0290"
FT   CDS_pept        303447..304025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0290"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74248"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74248.1"
FT                   /translation="MRRMMIAVVVAALGGLAVIGPGRAQGGENEVEEIYVGRTVRHGRV
FT                   VPSDFCAPTKTGFAPALEDQLSIHAVNVQASDGRMTGTSDKSIGEMRVCIGQAMDPTLL
FT                   GIYTEAQLNGISFSGLGDCRLVRGNLPEEGILTHRCFLALSGLPDPYVGGFLISSSLYS
FT                   KTPFGPESSPPGYAQAGIFIVRLWRKRLP"
FT   gene            complement(304048..305457)
FT                   /locus_tag="BRADO0291"
FT   CDS_pept        complement(304048..305457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0291"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74249"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014982"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74249.1"
FT                   /translation="MSTTTALDNHTQFQSIVGQIRTLAYKYIEDKDFVSAQLAFQKLLE
FT                   LDPKDINARFIYAQLIDDGSHKKRAEARDMMLAILDENPEIFEQATEGNLHLIRSAAVR
FT                   CSHVGPFTRSMELFRKLAKASNEAADYFSLSEILTQNNEFEEAVAALEKAIKLNPAYDI
FT                   PVNRETLDLARSNAKKGKARDAKAGRAKVGRYPETKDFLGDLQTLITSHIAVNLASAPK
FT                   FLDKSTRFFTMGSCFARNLSKSLNDSGYNSHHMEISEYINTTFANRVFVDWLRGAKIDP
FT                   EIRERIVELLPQGSSQENTLAVIKQADVFILTLGVAAAFFDRETGAFVLPRPTALNSRA
FT                   LAEKYKFRTASVQENVDNVRYLIDFVRSIRPGIKVIVTVSPVPLLTSFEYESVVQADCL
FT                   SKSTMRLVAHEIVNNSGLEDIWYWPSFEVFRWGGSNASSFFAADDGAAWHVSEDKVSAT
FT                   VRAFVQTFSPA"
FT   gene            305866..306231
FT                   /locus_tag="BRADO0292"
FT   CDS_pept        305866..306231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0292"
FT                   /product="putative transposase from insertion sequence"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74250"
FT                   /db_xref="GOA:A4YK24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74250.1"
FT                   /translation="MAKSEVEVITSERRRRHWSRADKERVVAAALQPGATILGVARAFG
FT                   VHSSQVFRWRQQLCGKETPSPGFAAVTIAADPHAAPACTQGLIEVEIGTETKIRISGPA
FT                   DAATVTAVIAALRVGSR"
FT   gene            306228..306578
FT                   /locus_tag="BRADO0293"
FT   CDS_pept        306228..306578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0293"
FT                   /product="conserved hypothetical protein; putative IS66
FT                   Orf2 like"
FT                   /function="8.3 : Transposon related"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74251"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74251.1"
FT                   /translation="MTIPIPSGTQVWLATGHTDMRKGFDGLALLVQETLKRDPHGGHLF
FT                   VFRGRSGSLIKVLWHDGQGMCLFAKRLERGRFIWPQAVDGALTITPAQLGYLLEGIDWR
FT                   HPQRTWRPEAVG"
FT   gene            306620..308245
FT                   /locus_tag="BRADO0294"
FT   CDS_pept        306620..308245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0294"
FT                   /product="putative transposase IS66 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74252"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74252.1"
FT                   /translation="MIPSPAMITADSLPDDVATLKALVLAGQAAQLAAEAKARNLEAEV
FT                   RARTLLIEQMKFTIAKLKHEQYGPSSERASVLEQLELELADLEEDAAEAEAAAQMAAER
FT                   AKAETINVHPFERRRPARRPLPEHLPRERVVHPAPANCPCCGGDRLRKIGEDVTETLEL
FT                   VPRQWKVIQHVREKFSCRGCEAISQPPAPFHPISRGRAGPRLLAHILFAKYGLHLPLNR
FT                   QSTTYAHEGVALDVSTLADWVGAAAATLMPLVEAIKAHVLAGERIHADDTTVPVLAKGK
FT                   TRTGRVWTYVRDDRPFAGHAPPAAMFYYSPDRAGVHPETHLAGYAGPMQADAYAGFNRL
FT                   YEAARKPGPVIEVGCWAHARRKFFEIARLKKAPIAIETIAKIDALFAIEREINGLPAHE
FT                   RKAVRNERSRPLVDELHDFLRERRIKLSGKSETAKAIDYSLKRWQVFTRFIDDGRLCMT
FT                   NNAAERELRAVALGRKNWTFAGSDEGGRRAAAIYTLIQTAKLNDVDPQAWLADVLARLP
FT                   DHPASKVADLLPWSWLAAQASAAA"
FT   gene            complement(308732..309484)
FT                   /locus_tag="BRADO0295"
FT   CDS_pept        complement(308732..309484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0295"
FT                   /product="conserved hypothetical protein; putative phage
FT                   protein Gp37/Gp68"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74253"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74253.1"
FT                   /translation="MANNSSIEWTEATWNPVVGCTIISPGCANCYAMRMARRLEAMGQP
FT                   KYAGTTRISGGRPKWNGVVRIDEDSLQLPAKWKAGRMIFVNSMSDLFHENVPMVFINRV
FT                   FTTMRKTPQHTYQILTKRAERLEELSPKLVWPDNAWMGVSVENEDYIYRIDHLRRTQAA
FT                   IKFLSLEPLLGPLDNLDLTGIDWVIAGGESGPHARPVEADWIRKIRDLCFDEGVAFHFK
FT                   QWGGANKKKTGRVLDGRTWDEFPASSGA"
FT   gene            complement(309474..309965)
FT                   /pseudo
FT                   /locus_tag="BRADO0296"
FT   CDS_pept        complement(309474..309965)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CAL74254.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(310014..310631)
FT                   /pseudo
FT                   /locus_tag="BRADO0297"
FT   CDS_pept        complement(310014..310631)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0297"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CAL74255.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(311530..311605)
FT                   /locus_tag="BRADOtRNA49"
FT   tRNA            complement(311530..311605)
FT                   /locus_tag="BRADOtRNA49"
FT                   /product="tRNA-Thr"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(311774..313708)
FT                   /locus_tag="BRADO0299"
FT   CDS_pept        complement(311774..313708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0299"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide;putative HemY porphyrin biosynthesis protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74256"
FT                   /db_xref="GOA:A4YK30"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74256.1"
FT                   /translation="MFRIVVFLILVGLAAAGSAWVAEQTGDVVLNWGPWRVAMTLPVFV
FT                   LALGLTIAACVLVWNLLSALLRAPNRIRKAHRERRHRRGRHAITHGLLAIGHGDSTAAR
FT                   QHADMAKRLAGDDPLTLLLHAQAAQLEGDRDGARRAFRAMAERQDTRLLGLRGLFIEAQ
FT                   RADDAMAAVVIADEALKLAPNASWASHAVLGFRCAQGDWNGALSILDGNYTAGMIDKPT
FT                   YRRQRGVLLTARAMALETENRDLARASAMEAVKLAPTLVPAAVLAAKFESEAHQVRRAM
FT                   KIIEAAWTSCPHPDLADAYAHVRLGDSAVQRLSRITNLAARTPNHVEGALAVARAAIDA
FT                   AEFGRARAALAPFTEDPTQRVAMLMAELERTEHGDAGKAREWTLRAVRARHDPAWTADG
FT                   YVSDRWRPISPVTGRLDAFQWQTPVASLPSERNSVIESSEFAEAILAPPSRPAIPEGLV
FT                   EPPRTVPAAPVVITPTLQDNEPPRPAEPEPAVETAVADVVDKPVDKPVDIRVEKAEDKV
FT                   EKAVEGPVAEPAVVTSRPASAEPAPPLQAAAPSEADAEAETAEEPETPPEPAKPAETAA
FT                   AAPTPLFRNRSDLAKPPETPIQAIVPIMRPPDDPGVEDDDQPRDEFAEQIAPKAQAGGW
FT                   RGFWSRFGS"
FT   gene            complement(313726..314862)
FT                   /locus_tag="BRADO0300"
FT   CDS_pept        complement(313726..314862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74257"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74257.1"
FT                   /translation="MAEGSSGAADDSHPHGAPEAEPAAVATETPEETVAAAAPPQAELP
FT                   PPPPPRPVSPWIIAPFSGAAAAALVIGVGWMLGWPPVQPPSPTTPLSTAVDELTSRVAT
FT                   LEQRAGKPDAAVAGRIDAVDKAIAAVRSDVAALRSQSDKTVAALNDVKAQPRDSAAPAP
FT                   APVDLSGLTARIDALERASKTQSAALAQDRAKLSEATQARSADDAPLRRVIAATLLDVA
FT                   VRHGDPFGAALSTATSLAPDASALKPLEPFAANGVPSPAALSRDLLTIVPKLAPPAAES
FT                   TTGNSILSKLSAGAQNLVKVERTDGAGTDRGAVVARVTAAALRNDLGEARRELKSLSAE
FT                   DRAPANDWLAKADARDAALAAARKFADDSMTALAKPAQ"
FT   gene            complement(315081..315809)
FT                   /locus_tag="BRADO0301"
FT   CDS_pept        complement(315081..315809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0301"
FT                   /product="putative UROPORPHYRINOGEN-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74258"
FT                   /db_xref="GOA:A4YK32"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74258.1"
FT                   /translation="MAVLVTRPAPDNERTAQALRERGFDVLLAPMLRFEPVALLADVGQ
FT                   DAAGIVVTSANALRAAAPQLRSSALLLLPLFAVGDQTAAAARAAGFAKVISAAGDAAAL
FT                   REVIATSGAIEAKATLLYLAGADISRDLAAELGARGFEVVTQTVYRMAQVTSLPREVCE
FT                   AFAANTIQAVLHYSRRSAAAFVAAIRAEGVEISALAVPHGCLSANVAEVLRDAGATQVT
FT                   IPAHPDENEMLEGLARALRS"
FT   gene            315949..317016
FT                   /locus_tag="BRADO0302"
FT   CDS_pept        315949..317016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0302"
FT                   /product="putative O-sialoglycoprotein endopeptidase, with
FT                   actin-like ATPase domain (ygjD,gcp)"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74259"
FT                   /db_xref="GOA:A4YK33"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74259.1"
FT                   /translation="MLGIETTCDETAAAVVSRDSDGKGHILSNVVRSQTDEHAIYGGVV
FT                   PEIAARAHVEMLDHLIDAAMREAGIDYAALSGVAAAAGPGLIGGVIVGLTTAKAIALVH
FT                   DTPLIAVNHLEAHALTPRLTDAIDFPYCLFLASGGHTQIVAVAGVGDYVRLGTTVDDAM
FT                   GEAFDKVAKMLGLPYPGGPQVEQAARNGDATRFAFPRPMQGRSDANFSLSGLKTAVRNE
FT                   IGRLESVSEQDVADLCASFQAAVLESTADRLRVGLDLFEQRFGAPTALVAAGGVAANQA
FT                   IRGALDDVAQAAGTRLIVPPPALCTDNGAMIAWAGAERLALGLVDGMDAPPRARWLLDA
FT                   NAQVPGKFANTRAGF"
FT   gene            317176..318159
FT                   /gene="gpsA"
FT                   /locus_tag="BRADO0303"
FT   CDS_pept        317176..318159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BRADO0303"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="1.1.1.23 : Galactose degradation"
FT                   /function="1.7.6 : Glycerol metabolism"
FT                   /function="1.8.1 : Phosphorous metabolism"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.1.1.94"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15557260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74260"
FT                   /db_xref="GOA:A4YK34"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74260.1"
FT                   /translation="MSHRFQTIAVVGAGAWGTALAAVAARAGRNVTLYARDADHAVRIA
FT                   TARENPRLPGIPLADSITVTTDLARAARADAILIVVPAQHLRGAVMHLAPLLAPGTPLV
FT                   ACAKGIEHSTHKFMTEVIAEAAPRATPAILSGPSFADDVARGLPTAVTLAAPDEALASA
FT                   LVQALGSSTFRPYHSTDVRGVEIGGAAKNVLAIAAGIVSGRDLGASALAALTTRGFAEL
FT                   VRLGRAYGARSETLTGLSGLGDLILTCAGPQSRNFAAGLALGRGEPLPAGKLAEGQYTA
FT                   PVLVELAASRGVEMPVAQAVAAILSGTVTIDAAIEALMLRPFKAEE"
FT   gene            318296..318709
FT                   /locus_tag="BRADO0304"
FT   CDS_pept        318296..318709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74261"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74261.1"
FT                   /translation="MSYWLVKSEPSVWSWDQQVEKGAKGEAWTGVRNYTARQNLVAMKQ
FT                   GELAFYYHSNEGKAIVGIAEIIKEAYPDPTDKTEKFVCVDIKAHKAFKTPVTLAAIKAE
FT                   PKLAEMALVKQSRLSVQPVTPEEWKLVCKMGGV"
FT   gene            complement(319040..320542)
FT                   /gene="amtB2"
FT                   /locus_tag="BRADO0305"
FT   CDS_pept        complement(319040..320542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB2"
FT                   /locus_tag="BRADO0305"
FT                   /product="ammonium transport protein (Amt family)"
FT                   /function="4.2.A.49 : The Ammonium Transporter (Amt)
FT                   Family"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15563598, 14600241; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74262"
FT                   /db_xref="GOA:A4YK36"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74262.1"
FT                   /translation="MTFKRPTSAGWVTLAIAGLCIASLADVAFAEDAPAAAAAAAPVPN
FT                   KGDTAWMLVSSALVLMMSVPGLALFYGGLVRTKNMAAILTQVFAIVAMVGVVWTLYGYS
FT                   LAFTDGGSMTSWIGGFSKAFMHGIDANSTAATFSNGVVIPELAYFVFQMTFAMITPALI
FT                   VGAFAERIKFSAVMLFVLLWVTFIYFPIAHWVWYIAAPDDVAAAAKALAAAGDAAAKTA
FT                   AQAKLDEVTGAVGWLAGAGALDFAGGTVVHINAGIAGLVGAVLIGKRTGYGKELMAPHS
FT                   LTMTMIGASLLWVGWFGFNAGSNLESNGVTALAFVNTMVATAGAALSWLLCEWAVKGKP
FT                   SLLGICSGAVAGLVAVTPASGLAGPIGALVLGLIVSPVCLFFVSTVKNSLGYDDALDVF
FT                   GVHCIGGIIGALATGILVNPALGGVGITDYTNITGNNAGTYDFATQMVAQIKAVVATLV
FT                   WSGVGSAILYKVVDVIIGLRPTVEQEREGLDITDHGERAYNY"
FT   gene            complement(320582..320833)
FT                   /locus_tag="BRADO0306"
FT   CDS_pept        complement(320582..320833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0306"
FT                   /product="regulatory protein (P-II 2) for nitrogen
FT                   assimilation, regulates GlnL (NRII), GlnE (ATase), and AmtB
FT                   (ammonium transporter) (fragment)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74263"
FT                   /db_xref="GOA:A4YK37"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74263.1"
FT                   /translation="MTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKIEVAIPSDQVDKTI
FT                   DAISSAAKTGQIGDGKIFVISLDHAVRIRTGEADAAAL"
FT   gene            complement(321252..322562)
FT                   /gene="amtB1"
FT                   /locus_tag="BRADO0307"
FT   CDS_pept        complement(321252..322562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB1"
FT                   /locus_tag="BRADO0307"
FT                   /product="ammonium transport protein (Amt family)"
FT                   /function="4.2.A.49 : The Ammonium Transporter (Amt)
FT                   Family"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15563598, 14600241; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74264"
FT                   /db_xref="GOA:A4YK38"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74264.1"
FT                   /translation="MGTCASRCLRTSVALAAAGALVFATPASAAAPSTIDAADTAWMIV
FT                   ATALVLMMTIPGLALFYSGMVRKKNVLATMAQSLAAVMLISILWVAFGYSLAFVGDGAW
FT                   IGSLDRAFLAGMGMDSVHPGAKTIPEALFMLYQMTFAIITVALVAGSVADRMRFSAYLV
FT                   FGVAWFIFVYVPLAHWIWGGGFLAQAGVVDFAGGLVVHLSAGTGGLVAALVMGRRHGYG
FT                   SENLSPFDLSLAVVGTGLLWVGWFGFNGGSALGANAHAVMAILTTHLAACAGAVTWGAL
FT                   EWSTRRKPSVLGMISGAVAGLGTITPASGFVAPWHGLVIGALAGIICYWACTSLKHRFN
FT                   YDDSLDVFGVHGIGGLTGTVLAGVFATAAIGGTSGLIEGHPMQLAAQLYGVAVTLVWSG
FT                   GVTWALLKLVSAFVPLRVSREQELEGLDISQHGEALQ"
FT   gene            complement(322648..322986)
FT                   /gene="glnK1"
FT                   /locus_tag="BRADO0308"
FT   CDS_pept        complement(322648..322986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK1"
FT                   /locus_tag="BRADO0308"
FT                   /product="regulatory protein (P-II 2) for nitrogen
FT                   assimilation, regulates GlnL (NRII), GlnE (ATase), and AmtB
FT                   (ammonium transporter)"
FT                   /function="1.8.3 : Nitrogen metabolism"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9733647, 8843440; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74265"
FT                   /db_xref="GOA:A4YK39"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74265.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTAIGVHGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVNSDIADKAVEVITTHARTGQIGDGKIFVTPIDHARRIRT
FT                   GETDSDAL"
FT   gene            323198..324073
FT                   /locus_tag="BRADO0309"
FT   CDS_pept        323198..324073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0309"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74266"
FT                   /db_xref="GOA:A4YK40"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74266.1"
FT                   /translation="MSNRSWYYAAQGQQQGPIAEDELRDLIARGVVTAETLLWSDGMAG
FT                   WEKAGRIPGLMTGVPSIAPGGPPAFDQGGPAAAGAVSIKLGTWSYLGWTLLYVLGQFLV
FT                   VITPWTAVYLYRYVVERISVPGRPNLSFIGQPLEIWYVFVGMGVLTYVGMSDQPLIKLA
FT                   AIIAQAFLGWMVMRWVLSRIASNGEPLPIRFEGSPVVYFAWYLGLIVSAVTIVGWAWVA
FT                   TAWMRWICRNIQGTRREVVFNGTGLQVLWRTLVFVLGCSVIIPIPWLLRWYSAWYVSQF
FT                   AVVPRGSQPV"
FT   gene            complement(324079..324954)
FT                   /locus_tag="BRADO0310"
FT   CDS_pept        complement(324079..324954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0310"
FT                   /product="Putative acyl-CoA thioesterase; putative
FT                   Palmitoyl-CoA hydrolase"
FT                   /function="1.7.1 : Unassigned reversible reactions"
FT                   /EC_number="3.1.2.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10876240, 1645722; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74267"
FT                   /db_xref="GOA:A4YK41"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74267.1"
FT                   /translation="MSKGLIDLISILDLEPIEVNLFRGNSPKTSWQRVFGGQVIGQAMM
FT                   AACRTVEGRLPHSLHCYFILPGDPQVPIIYQVERLRDGKSYATRRVTAIQHGNAIFSIM
FT                   VSFHSDEESAFNHQDKVPDVPPPEKLTAEEISKQPMFQEVFQRMPDFIRRYYESDRPIE
FT                   LRPVELSRYFGEKIDDGRIHVWIKTAATLPDDPALHMCALAYASDFSLLDAVMARYGRT
FT                   LFDKRMMPASLDHAMWFHRPFRADEWLLYAQDSPSAQGGRGLTRGSIFKPDGTLVASVA
FT                   QEGSIRERWA"
FT   gene            325116..326336
FT                   /locus_tag="BRADO0311"
FT   CDS_pept        325116..326336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0311"
FT                   /product="putative 2-polyprenyl-6-methoxyphenol hydroxylase
FT                   and related FAD-dependent oxidoreductases (UbiH)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74268"
FT                   /db_xref="GOA:A4YK42"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74268.1"
FT                   /translation="MTTQRSIVICGGAFAGLALALALRHGLGADVPVIVADPALANRPS
FT                   RDPRASAIVAACRKLFDAIGVWADVAPEAQPILDMVITDSKLEDATRPAFLTFAGQVEA
FT                   GEPFAHMVENRLLIDALVKHAEAAGVELRATPVTGFKTRTDAVTVTLGDGSELEASLLV
FT                   AADGARSKLRERAGILTHGWDYDQSGIVVTVGHERDHNGRAEEHFLPPGPFAILPLTGK
FT                   RSSLVWTERRREAKRLVDLSADEFHAELEKRAGLHLGELKVLDQPRAFPLSYFVARSFI
FT                   APRLALVGDAAHVIHPIAGQGLNLGLKDVAALAEVVVDAARMGIDPGQVDVLESYQRWR
FT                   RFDTMAMGVATNSLNFLFSNKSTLLRTVRDIGLGLVDRAPPLKELFIKQAAGLTGEMPR
FT                   LLKGEAL"
FT   gene            complement(326394..327317)
FT                   /locus_tag="BRADO0312"
FT   CDS_pept        complement(326394..327317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0312"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74269"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74269.1"
FT                   /translation="MRAAVIRCALAFALLTSAASAEESAIRVGAIDAVLATPPGVERPP
FT                   VALLIAGSGSTDRDGNGPQLKPATLKKLAEQLAARGIASLRYDKRGARGWKAEFGRAED
FT                   FRFKDYVDDSAALVDFLRGKFARIALVGHSEGGLVAILTARRTPVDRLVLLAASARRQG
FT                   DLLKTQLEKKLPAVAMEPVAKAIDAIMAGQVVDPPPPELPIAPRMQPGIGSAFAEDPID
FT                   PLKQIVIPILIVGGARDQQVARLDMVALAAAAPAAKTLWLPAMNHMLVDIANEDENLSS
FT                   YNDPDRPLDPDMVDAVAAFIAAPGPR"
FT   gene            complement(327321..327518)
FT                   /locus_tag="BRADO0313"
FT   CDS_pept        complement(327321..327518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74270"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74270.1"
FT                   /translation="MNAPLERPANSVDPKLLEILVCPMTKGPLEYDAARQELISRSAKL
FT                   AYPIRDGIPIMLPEEARKID"
FT   gene            complement(327575..328117)
FT                   /locus_tag="BRADO0314"
FT   CDS_pept        complement(327575..328117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0314"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74271"
FT                   /db_xref="GOA:A4YK45"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74271.1"
FT                   /translation="MSDQLSAGDWLDQGLKILASQGFTALKAEPMAKAMGVSRGSFYWH
FT                   FEDVSAFHAELLKHWREIAAEQIITGVESSAGTEPAIAVLLRRTFTIKATLERAVRSWA
FT                   ASDAIAQQAVQAIDKRRLGYVQSLLVAEGLGPEIAAARAQVLYWAFLGYALSGRPLPAA
FT                   QQDTVLTELIRIALLKP"
FT   gene            328286..328366
FT                   /pseudo
FT                   /locus_tag="BRADO0315"
FT   CDS_pept        328286..328366
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CAL74272.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            328403..328555
FT                   /pseudo
FT                   /locus_tag="BRADO0316"
FT   CDS_pept        328403..328555
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAL74273.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(328813..328965)
FT                   /locus_tag="BRADO0317"
FT   CDS_pept        complement(328813..328965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0317"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74274"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74274.1"
FT                   /translation="MPRLAPATTTFRTMSTNIDQSSRIETSKSENWYATASRSTVRHPF
FT                   ATTNS"
FT   gene            328985..329260
FT                   /locus_tag="BRADO0318"
FT   CDS_pept        328985..329260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74275"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74275.1"
FT                   /translation="MQAGGPNEICLTYANGQFEPKEPTVPADAPLTIRVKNMESKAIEF
FT                   ESETLKIEKVIAANSEAVLNVRAMKSGRYEFYNDFNEKARGFVIVQ"
FT   gene            329271..330101
FT                   /locus_tag="BRADO0319"
FT   CDS_pept        329271..330101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0319"
FT                   /product="conserved hypothetical protein; putative
FT                   high-affinity Fe2+/Pb2+ permease"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74276"
FT                   /db_xref="GOA:A4YK50"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74276.1"
FT                   /translation="MLAALIIVFREVFEAGLIVGIVLAVTSAVPHRLRWIGAGLFAGLV
FT                   GACIVAAFAGTLTQLFEGMGQEVFNAAILSTAVIMLTWHNVWMARHGREMANELRTMGQ
FT                   AVAEGAKPLVALATVIAIAVLREGSEVALFLYGVAASDEGGGRALLGGGVLGLLLGVAV
FT                   CLATYLGLMRIPPRALFRTTTVLITLLSAGMAAQAVFFLARANWLTSFDQVMWDSSSVL
FT                   PEKGLAGRTLKALIGYTDQPTAMQLAVYVGVIVATIALMRLTATPPRPRAMAAE"
FT   gene            complement(330114..330788)
FT                   /locus_tag="BRADO0320"
FT   CDS_pept        complement(330114..330788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0320"
FT                   /product="putative Lon family ATP-dependent protease"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74277"
FT                   /db_xref="GOA:A4YK51"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74277.1"
FT                   /translation="MPINAEYRGPAELPEVIPVFPLAGALLLPRGQMPLNIFEPRYLAM
FT                   VDDAFRDGHRLIGMIQPDVTHSSSEERPVLFKVGCVGRITQLAESGDGRYILELTGVSR
FT                   FKVVEEMSVLTPYRQCKVDYFPFVDDFTARKGEGAVDRDALLAVLTDFLKANNLKVDWA
FT                   GIEAAPNEALVNALAMMSPYGPAEKQAMLEAPDLKTRAEILVAVTEMDLAKKRTSGDPP
FT                   LQ"
FT   gene            complement(330848..331768)
FT                   /locus_tag="BRADO0321"
FT   CDS_pept        complement(330848..331768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0321"
FT                   /product="putative thioredoxin"
FT                   /function="1.4 : Energy production/transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74278"
FT                   /db_xref="GOA:A4YK52"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74278.1"
FT                   /translation="MTIVEQGGGAAPQVPDLIKDTTTQTFVKDVIEESKRQPVLIDFWA
FT                   PWCGPCKQLTPILEKAVKAAKGKVKLVKMNIDEHPAIPGQMGIQSIPAVIAFVGGRPAD
FT                   GFMGAVPESQINAFIEKITKGVPGVGEPDINEILKEAEAVLAEGDPAGAAQIYAEVLSF
FT                   DAANIPALAGLARCYLETGAIEQAKETLAQVPEAKRGDSAVSAVQAAIDLAEQAQSLGP
FT                   LGELEQKVAANPLDHQARFDLAIALNAAGKRKEATDHLLEIVKRDRKWNEDGARKQLVQ
FT                   FFEAWGGADEATVEGRKRLSTILFS"
FT   gene            332058..332132
FT                   /locus_tag="BRADOtRNA3"
FT   tRNA            332058..332132
FT                   /locus_tag="BRADOtRNA3"
FT                   /product="tRNA-Gly"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(332169..333623)
FT                   /locus_tag="BRADO0322"
FT   CDS_pept        complement(332169..333623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0322"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74279"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74279.1"
FT                   /translation="MRGVSGRVGQLFFLVVAIALLTGATPAAADKRVALVIGNSIHEHA
FT                   PLLDEPAVDAKLIADKLAQLGFTLSGGSGQIDLTKQGFDRALAEFKGRIADADVALIYF
FT                   AGYGINLGGANYLVPVDAAPAKAADVETELRSLAGIMRELDGPDSRANVVVLDAFRSNP
FT                   FAARGIAGLSAGLVATSVPANTLLSFSAQPGTVGQRGPYGHSAFTNALVEALTAPSPGA
FT                   LLATLNQAGVAVKRATSGAQQPLLLATPLGGSEVVFGPPRANPAPGTAESTIKTPANRQ
FT                   AAATAAMGPPPASTASDGRTPGLAVLYDEDPSDPKGKRYTGSVTWRMETIKSPQSGRAV
FT                   PVIRAEIDVPDRKLKATLQLRRNDDPTLPASHVAELTFARADDFAGGGINNVPGILMKS
FT                   NEQARGTPLAGLAVKVTEGSFLVGLSNVDADRARNGELLAGREWFDIPLVYSNQRRGIL
FT                   AIGKGPSGDRVFADVFAAWDKSQPVQ"
FT   gene            complement(333731..335035)
FT                   /gene="pncB"
FT                   /locus_tag="BRADO0323"
FT   CDS_pept        complement(333731..335035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="BRADO0323"
FT                   /product="Nicotinate phosphoribosyltransferase (NAPRTase)"
FT                   /function="1.5.3.7 : Nicotinamide adenine dinucleotide
FT                   (NAD)"
FT                   /EC_number="2.4.2.11"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74280"
FT                   /db_xref="GOA:A4YK54"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74280.1"
FT                   /translation="MTVTDIASRTYNHGWRLDPIVRSLLDTDFYKLLMLQMIREFYPDQ
FT                   KVTFSVINRTKRVRLGDVIDEGELRAQLDHARTIRFSKKELIWLAGNTFYGKTHMFSPD
FT                   FLAWLANFRLPEYELHKADGQYELHFHGLWTHTTMWEIPALAIVNELRSRQAMKGQGRF
FT                   ALDVLFARAKAKLWAKVERLRKLEGLRLSDFGTRRRHGFLWQRWCVEAVKEGLGSSFTG
FT                   TSNVLLAMDNDLEAIGTNAHELPMVAAALAKDDDELRFAPYRILDQWRQTYAGNLLIAL
FT                   PDAFGTKAFLRDAPDWVADWTGFRPDSAPPIQAGEEIIAWWKSKGRDPRQKLLVFSDAM
FT                   DVESIEQIHQRFSDQVRLSFGWGTNLTNDFVGCSPDGSVDLDPISLVCKVTSVDGRPAV
FT                   KLSDNPEKATGDPAEIARYLRVFGDAGRVRTPVFV"
FT   gene            complement(335130..336482)
FT                   /locus_tag="BRADO0324"
FT   CDS_pept        complement(335130..336482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0324"
FT                   /product="putative amidase (amiD)"
FT                   /EC_number="3.5.1.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74281"
FT                   /db_xref="GOA:A4YK55"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74281.1"
FT                   /translation="MSQPSDLQTPKAGAGVLELLRQFAADPASASAYGEDCLKRTQSIE
FT                   PQLKAFEYLPRDVTAKRGPLGGIPVAIKDVIATSDMPTTNGSAIYRDHVPDADAWVVAR
FT                   LRDLGATIFGKTVSTEFAWRHPGPTVNPWNPAHTPGGSSSGSAAAVAAGLVPLALGTQT
FT                   LGSVIRPAAFNGVVGFKPSFGAIPRTGVHPLSPSLDHVGFFARRVDDVALALSLLAGRS
FT                   ADDLHGRPLPGFSVDIGHGLAPLAKPRLAVVRFAKWERAEAEQKAVFEAVIDKLRGAGA
FT                   AIEEVALTELDSASWDAINTIMLSEATTIFSDLIARYPDRVSDVMKGHVESGRAKTAMA
FT                   YLAAKATQAARQTALAAELAGHDAVLTLPAFGEAPRGLDWTGDAEYCAPWTFVGAPAVA
FT                   LPAGFGRNGLPLGVQVAGTYRNDLQLLRVAKWVETALAFDPGLPLMAQPTR"
FT   gene            336871..338148
FT                   /locus_tag="BRADO0326"
FT   CDS_pept        336871..338148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0326"
FT                   /product="putative Glucose/sorbosone dehydrogenase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74282"
FT                   /db_xref="GOA:A4YK56"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74282.1"
FT                   /translation="MISVFHRSILALATISLLAGTSIAGAQQQSDQGKGLKKYESGTKE
FT                   FWTHPPDDWFLGDETEAQKGLAPPSGPPTGASDAELAKIVKQVKLPEGFKMEVWASGVL
FT                   AARQMAWGDKGTLFVGSFGLGNVYAISDKGGKREVKTVLKGLNMPTGLAFQDGNLYVIA
FT                   VDKLIKYENAEANLDNLGQGKVVYDDMPSYAAHGWKYIAVDKEGWFYIPFGPPFNIGIP
FT                   PTSVSQIRRVDPRTGNAEIWALGVRNSVGGDVDPRTGRYWFTENARDWVSDDLPSDKLN
FT                   MISKIGEHFGYPYCHQGDMPDPKFAMGHKCSEFTPPALNLGAHVAPLGMKFYTGDQFPA
FT                   EYKNNIFIAEHGSWNRHKYQGARIMRVVVGPDGKDAKQEVFASGWIEGDQGYLGRPDDI
FT                   VLAKDGSMLVADDWAGAIYRISYEKK"
FT   gene            338325..338900
FT                   /locus_tag="BRADO0327"
FT   CDS_pept        338325..338900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0327"
FT                   /product="putative cytochrome c4 precursor"
FT                   /function="1.4.1 : Electron donor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74283"
FT                   /db_xref="GOA:A4YK57"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74283.1"
FT                   /translation="MRQVMVAALMLVLSALPAVAADLTAGKAKAELCAGCHGENGISQT
FT                   ENIPSLAGQQDQFIQWQLVFFRAGTRKNEAMKPIVDQLSNEDIRNLGAYFASLQPAKSP
FT                   PDDDADLSKKGAEAAAGRRCASCHLDSYAGTKGVARLAGQREEYLVKALHDYKSGQRVG
FT                   GSQAAMTDVAYPLSAEEITALAHYLAHL"
FT   gene            complement(339114..340037)
FT                   /gene="panE"
FT                   /locus_tag="BRADO0328"
FT   CDS_pept        complement(339114..340037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="BRADO0328"
FT                   /product="2-dehydropantoate 2-reductase (Ketopantoate
FT                   reductase) (KPA reductase) (KPR)"
FT                   /function="1.5.2.2 : Pyrimidine biosynthesis"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /EC_number="1.1.1.169"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11123955, 10736170; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74284"
FT                   /db_xref="GOA:A4YK58"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74284.1"
FT                   /translation="MRILVVGAGAIGGYFGGRLLQSGADVTFLVRPRRAAELTNAGLVI
FT                   RSASGDVTLPNPPTVQADSLKQHFDVVLLSCKAYDLDDAIASFAPAVGADTAIIPLLNG
FT                   MKHLDVLDAKFGRARVLGGLCAIAATLNEKREVVQLQPMQSLNFGERDGGSSERVRAIF
FT                   EIFQRGNFNAAASDHIMQDMWEKWVFLASLAASTTLMRAPVGVILTAPGGKDFLLGMLD
FT                   ECSATAAAAGYAPAGAFFQRVSGMITTEGSPMTASMFRDLRAGLPVEADHVIGDLVARA
FT                   DAAKVPVPRLRISYTQLKVYEAQRGK"
FT   gene            complement(340169..340909)
FT                   /locus_tag="BRADO0329"
FT   CDS_pept        complement(340169..340909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0329"
FT                   /product="putative Acetoin(diacetyl) reductase (Acetoin
FT                   dehydrogenase) (AR) (Meso-2,3-butanediol dehydrogenase);
FT                   oxidoreductase, short chain dehydrogenase; putative short
FT                   chain dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74285"
FT                   /db_xref="GOA:A4YK59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74285.1"
FT                   /translation="MMQQRNATVAVIGAGDYIGAEIVKKFAAEGFTVFAGRRNGGKLAP
FT                   LVAEVEAAGGRIVARSLDARKEDETTAFLNDADKHAPLEVVIFNVGANVNFPILETTDR
FT                   VFRKVWEMACWAGFVAGREAARLMLPRGGGKIFFTGATASLRGGSGFAAFASAKFGLRA
FT                   VAQSMARELMPQNIHVAHLIIDSGVDTAWVRERRAQLWGKEALDNPDLLMPPASVAGAY
FT                   WQLYQQPKSAWTFEMEIRPFGEKW"
FT   gene            complement(340970..342127)
FT                   /locus_tag="BRADO0330"
FT   CDS_pept        complement(340970..342127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0330"
FT                   /product="putative transposase; putative insertion element"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74286"
FT                   /db_xref="GOA:A4YK60"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74286.1"
FT                   /translation="MPWREVSVMDQRREFVMLAKQEGANRRELCRRFSISPQTGYKWIQ
FT                   RHDTGDTALADRSRRPHRSPERTAAAIEQQIVALRDAHPAWGARKLARRLERDGQAVPA
FT                   ISTVHTILRRYDRVMEPAGTPGQPYTRFEKDTPNQLWQMDFKGHSALENGVSCHPLTAL
FT                   DDHSRFSLCLAACDNERGSTVKGHLETTFRRYGLPDAMFVDNGGPWGFTLEDPWTALTV
FT                   WLLKLGVRTIHSRPYHPQSRGKNERFHRSLKAEVFAFRRYRDLPDVQRAFDEWRSIYNL
FT                   DRPHEALNFDVPASRYRPSQRTMPDRLPVVEYDEGETVRSVSTTKAYVSFEGRLWKVPQ
FT                   AFRGERLAIRPLSADGQFGIFFAAHQIAAIDLRDPKSVNYVPEQV"
FT   gene            complement(342283..342891)
FT                   /locus_tag="BRADO0331"
FT   CDS_pept        complement(342283..342891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0331"
FT                   /product="conserved hypothetical protein; putative
FT                   2-hydroxychromene-2-carboxylate isomerase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74287"
FT                   /db_xref="GOA:A4YK61"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74287.1"
FT                   /translation="MSRPGPEFMFDFGSPNAFLSHEAIPAVEKRIGVQFFYVPVLLGGI
FT                   FKATNNKSPAESLAGIKNKREFHEVETQRFLKRFHVQPWVWNPHFPVNTLNLMRAAIAA
FT                   QLEGVFETYVDAAFHHMWREPKKMDDPEIAIAAITSSGLDGAKLFARAQEPEVKAKLVE
FT                   NTQRAVERGAFGSPTFFVGNEMFFGKEQLRDVEEMILGR"
FT   gene            complement(342999..344354)
FT                   /locus_tag="BRADO0332"
FT   CDS_pept        complement(342999..344354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0332"
FT                   /product="putative multi antimicrobial extrusion protein
FT                   (MatE)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74288"
FT                   /db_xref="GOA:A4YK62"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74288.1"
FT                   /translation="MIAVTTPASLRKPFLMFLAPMMLSNILQSLFGTINNVYLGQMIGV
FT                   DALAAVSVFFPAMFFFVSFVMGLGSGASVLIGQAWGAKEPAKVKAIAGTTLTITLLLAV
FT                   LIAVGGLYSRELLTALATPANIIDAASGYARIMMLTMPLTFAYIMLSSQMRAVGDTVTP
FT                   LAALAASTTLGLVLTPMFIRGWLGVPQLGVASAAWASATSTLITLTSLHLYLRRRKHPL
FT                   AIDAAFIRGMRPDPLLLRVVLRLGIPAAIGMIVMSLAEMVLIGLVNGFGSDATAAYGAV
FT                   NQVLGYVQFPALSIAISVSIFGAQAIGRGNAEQIGRIVRTGIEMNVVLTGGLVAIGYLF
FT                   SRTLMGFFITDPAVIEVAQRSLHIVLWSSVLFGMSTTFSAAMRASGTVWMPLAISAFCI
FT                   ALIEVPAATWLSRTIGLDGVWWAYPITFSAMALLQMSFYLLVWRRRTVQKMI"
FT   gene            complement(344471..345052)
FT                   /locus_tag="BRADO0333"
FT   CDS_pept        complement(344471..345052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74289"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74289.1"
FT                   /translation="MMDMDTYTAFAGADRVAAGPLPKVALALKHAPASPAPVIIFSDRT
FT                   GRPIDLDLRGSDREILARLAGGSNMPAEPAPSEPRGRGRPRLGVVAREVTLLPEHWEWL
FT                   GAQPGGASVALRKLVHEARRASGDKDRAREARDAAYHFMSTMGGNLPNFEEAARALFAD
FT                   DLTRVTALIIDWPADIRDHAMALAQRHHTD"
FT   gene            345214..345879
FT                   /locus_tag="BRADO0334"
FT   CDS_pept        345214..345879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0334"
FT                   /product="putative Glutathione S-transferase III (GST-III)"
FT                   /function="1.5.3.10 : Glutathione"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74290"
FT                   /db_xref="GOA:A4YK64"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74290.1"
FT                   /translation="MLTVHHLNNSRSQRVLWLLEELGVPYEIVRYERQPDMRAPKELRA
FT                   IHPLGKSPVITDNGNTVAESGAIVEYLIETYGNGRLIPPPKTPERLRYSYWLHYAEGSA
FT                   MPLLLLKLLFNIMPKRAPALLRPIVRKVSNQALTTLVNPQLKQHMGFWESELQKSDWFA
FT                   GNEFTAADIQMSFPLQAAAARGGLEQGHPRAMDWLARIEARPAYKIALEKGGPYEIGR"
FT   gene            complement(345883..347289)
FT                   /locus_tag="BRADO0335"
FT   CDS_pept        complement(345883..347289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0335"
FT                   /product="putative beta-lactamase"
FT                   /EC_number="3.5.1.46"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74291"
FT                   /db_xref="GOA:A4YK65"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74291.1"
FT                   /translation="MNLRRLFVGLLVFAGLLVAGWLTYRPDRALRAATTAVAEIICAKT
FT                   FVSGLDPQTTFAETMERPGLRRLRAVMRYRVEPDMRVVDASLLGLHASRASYHDGLGCV
FT                   SLQGQKPPYVPHSDINALRGGGPAAALPDFADANPVEPANPALKAALDHAFEEPAAPPL
FT                   RRTKAVVVIKDGRLIAERYAPGIGVETPLMGFSMTKTVTNALLGILTRQGKLSPSIQAP
FT                   VPEWRDPGDGRHEITIEQLMRMTSGLALDETNSGFDASSQMAIHRDMAAFAVHAPPIAP
FT                   PGQRWAYSSASTQILARIIRDAAGGPEQTIELAWRELFNPLGMRHVTLQYDGTGTLQGF
FT                   GNMLASARDWARLGLLYLGDGVVGGQRILPEGWVAMSATATLDTDYGAGLWTNRSQQIH
FT                   AQGRARAGIPADALFAFGLLGQRLVIMPSQHMVVARLGDSVDPDGDIKGVARLVREVIA
FT                   ATAAPATAAK"
FT   gene            complement(347463..349169)
FT                   /gene="ggt"
FT                   /locus_tag="BRADO0336"
FT   CDS_pept        complement(347463..349169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="BRADO0336"
FT                   /product="Gamma-glutamyltranspeptidase precursor [Contains:
FT                   Gamma-glutamyltransferase large chain;
FT                   Gamma-glutamyltransferase small chain]"
FT                   /function="1.5.3.10 : Glutathione"
FT                   /EC_number="2.3.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1360205; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74292"
FT                   /db_xref="GOA:A4YK66"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74292.1"
FT                   /translation="MLLLAGCWPAHALDPQGVDVPQPPNVAAPAQAPAHGMVVAQERIA
FT                   AEVGQRVLALGGNAVDAAVATGFAMAVTYPVAGNIGGGGFMVIHLAKTNEDVAIDYRET
FT                   GPAAMTRGIFLGADGRPDNAKSRDSALSIGVPGSVAGLALALEKYGSGKFTLAQLVAPA
FT                   IVLARDGIPVADDVAFTLPMMAPRLAKWPSSAAIFIRPDGTVLKEGDRLVQRDLAATLA
FT                   AIAERGPRGFYEGPVAEKLAKAIQAAGGIMTADDLKAYQPVLRTPVRGTYRGYDIVSMP
FT                   LPSSGGTVLVETLNILEGFKLSELKQGSPASLHLLIEAMKRAYADRARYLGDPAFVDAP
FT                   VRAMLSKDYAAQQRAGIDPARATGAGDVLNIKPLREGSNTTHFSVVDNDGNAVSNTYTL
FT                   NFPYGVGLIAEGTGVLLNNELDDFTAAPGASNAFGLVGFEANLPGPGKRPLSSMSPTIV
FT                   LKDGKPVLVTGSPGGSRIISTVLQVIVNVLDYEMDVPQAVSAPRLHHQWMPDEVRIEKG
FT                   FGDDVLADLRARGHKIEEPMGRTSANSILVTSDGLVGAPDPRSKGATAAGR"
FT   gene            349361..350764
FT                   /locus_tag="BRADO0337"
FT   CDS_pept        349361..350764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0337"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter; putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74293"
FT                   /db_xref="GOA:A4YK67"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74293.1"
FT                   /translation="MAVTTIQNTEATEERSYPGRAAVVSWIFFDWAAQPYFTLITTFVF
FT                   APYFAAHVAPDAASGQALWGFATAAAGIVIALLSPVFGAIADATGRRKPWIAAFGALLV
FT                   IGSSLMWIGRPGAPDLIPPLLAAYVLATIGVEFATVFNNAMMPTLVPPERIGRLSGTGW
FT                   ATGYVGGILSLILVLGFLAANPDSGRTLFGLTPLFGLDPVTHQGDRMSGPLTGVWFIIF
FT                   VLPMFLFTPDFPARHRLGAAVREGIGELKQTLRSLPQQRDVALFLIANMIYTDGLVSLY
FT                   AFGGIYAAGTFGWNTIQIGTFGIILAVAGTLGGWVGGKLDDRLGSRRVIAGSMALLLLA
FT                   IIAILLVSRDSILFIPVTPAVPGGPLFASLPERAYLLLGCVMGACGAPLQAASRSLLIR
FT                   MVPKERVAQYFGLFALTGKVTSFIGPLLIGIITAATASQKAGMAVLVLFFAVGLLLLAR
FT                   VNSSRHARA"
FT   gene            complement(350840..352432)
FT                   /gene="purH"
FT                   /locus_tag="BRADO0338"
FT   CDS_pept        complement(350840..352432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BRADO0338"
FT                   /product="Bifunctional purine biosynthesis protein purH
FT                   [Includes: Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase (AICAR transformylase); IMP
FT                   cyclohydrolase (Inosinicase) (IMP synthetase) (ATIC)]"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2687276, 2192230; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74294"
FT                   /db_xref="GOA:A4YK68"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74294.1"
FT                   /translation="MTNQLRPVRRALLSVSDKTRLTDFARALAARGVELISTGGTAKAI
FT                   AEAGLKVKDVSDLTGFPEMMDGRVKTLHPKVHGGLLAIRDNDEHTEAMKTHGIAPIDLL
FT                   VVNLYPFEATVERGAQFSDCIENIDIGGPAMIRAASKNHEDVAVVVDVDDYEAVLEDLA
FT                   RHEGSTTLLLRRRLAAKAYARTAAYDAAISNWFAATIHNDAPDYRAFGGKLIQSLRYGE
FT                   NPHQHAAFYALPGRRPGVATARQVQGKELSYNNINDTDAAYECIAEFDPARTAACVIVK
FT                   HANPCGVAEGPDLISAYQKALACDSTSAFGGIIAMNRKLDAATARAITGIFTEVIIAPD
FT                   ATEEAIAVVAARKNLRLLLAGALPDPREAGLTAKTVAGGLLVQSRDNAVVDDMTLKVVT
FT                   KRAPTDAELRDLRFAFRVAKHVKSNTIVYAKDSATVGIGAGQMSRVDSARIAARKALDA
FT                   AAELKLAEPLTKGSVVASDAFFPFADGMLACIEAGATAVIQPGGSVRDDEVIKAADEHG
FT                   IAMVLTGVRHFRH"
FT   gene            complement(352908..354599)
FT                   /locus_tag="BRADO0339"
FT   CDS_pept        complement(352908..354599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74295"
FT                   /db_xref="GOA:A4YK69"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74295.1"
FT                   /translation="MSNVSGVSVSVSGLWPGRADRLIIAPHDLRTSDATRAAEIYAGRF
FT                   VFAGKIVTCHGRSIFDLEPPSEDWEVALLGFGWLRHLRAADTALTRANARALVDDWITN
FT                   QIGRHPLSRRADVLARRVISLLSQAPLVLADSDGKFYRRYLRGLTREIRFLRYSTIDIP
FT                   DGVPRLQVLIALCYAALCLANQAKHIRSASRKLSEELQRQILPDGGHVSRNPGALIELL
FT                   IDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRHGDGNMALFNGMGGTPTDLLATL
FT                   LAYDDTHGTPMASMPHSGFQRLDAGQMTVIVDTGAPPPPHLSHEAHAGCLAFELSSGTS
FT                   RIVINCGLPSTGRDNWRTFARSTVAHSTLTYHNTSSCTFVEMSAMKRLLHGAPIVSGPT
FT                   RVENFREIVPDGTVLSTSHNGYAAKFGLIHRRVLVAAEDGSRLDGEDTVTPAQGARLRG
FT                   GGSDYTLRFHLHPAVKASRLSDGHGAMLVLPNREVWTFETFDDRVDLEDSVFLAGNDGP
FT                   RRTTQLVIRQDAQQSPSIRWSFVRSSTSPSETNARRNARREPELPL"
FT   gene            complement(354869..356221)
FT                   /locus_tag="BRADO0340"
FT   CDS_pept        complement(354869..356221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0340"
FT                   /product="putative Ribosomal RNA small subunit
FT                   methyltransferase B (rRNA
FT                   (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967
FT                   methyltransferase)(rsmB)"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74296"
FT                   /db_xref="GOA:A4YK70"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74296.1"
FT                   /translation="MPPPRFATPSEVPGLAARRIAADVIDGVLHKHRTLDDQLDGPGAH
FT                   PGLKQLADRDRALMRRLVATTLRRLGTLGNVLSRLLDRGIPTDAPRAQSALLIGAAQIL
FT                   WMDVPDHAAVDLSVRLVQADRRAAKYAGLVNAVLRRCAREGAALLDDAKGQPLDIAPWL
FT                   LKRWTDHYGEATARDIAAALGQEPSLDLTVKSDPAQWASRLHGEVLPTGTVRTLLHGSV
FT                   TVLPGFAEGQWWVQDAAAALPARLFGDVAGKSMADLCAAPGGKTAQLAHGGARVTAVDR
FT                   SPARMSRLKDNMTRLQLPAETVVTDAAEWQPADAGGFDGILLDAPCTSTGTIRRHPDVG
FT                   WLRNEADIAALSGTQVRLLTRAAGLLKPGGTLVYCTCSLEPEEGEQVVDHVLAAGTELR
FT                   RVPIDPAEVAGLAELVTPMGDLRTLPCHLPHADPRLGGLDGFYAARLERRP"
FT   gene            356456..356647
FT                   /locus_tag="BRADO0341"
FT   CDS_pept        356456..356647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74297"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74297.1"
FT                   /translation="MASNDAPRKPLTPAAQRALAEAEERRRIAAEQAKPMPKELQGPKG
FT                   PEPTRYGDWENKGIISDF"
FT   gene            complement(356706..357167)
FT                   /locus_tag="BRADO0342"
FT   CDS_pept        complement(356706..357167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74298"
FT                   /db_xref="GOA:A4YK72"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74298.1"
FT                   /translation="MTSKTACARPELVGIAGDYSPGTIVVKTSERRLYLVLDGSHAMRY
FT                   PVGVGKAGRQWAGTTKIDGKYKNPAWAPPADVKRDKPELPDVIAGGSPRNPMGVAAMTL
FT                   AGGEYAIHGTNVPNSVGGYVSYGCIRMLNQDITDLYDRVSIGTTVVVTR"
FT   gene            complement(357417..359369)
FT                   /gene="acsA"
FT                   /locus_tag="BRADO0344"
FT   CDS_pept        complement(357417..359369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="BRADO0344"
FT                   /product="Acetyl-coenzyme A synthetase (Acetate--CoA
FT                   ligase) (Acyl-activating enzyme)"
FT                   /function="1.1.2.3 : Propionate degradation"
FT                   /function="1.7.29 : Acetate catabolism"
FT                   /EC_number="6.2.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7751300; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74299"
FT                   /db_xref="GOA:A4YK73"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74299.1"
FT                   /translation="MSEKIYDVPAEWAKRAFVDDAKYQEMYASSIRDPNGFWAEQAKRV
FT                   DWIHAPTKIENVSYAPGNISIKWFEDGVLNAAYNCIDRHLATRADQTAIIWEGDDPADS
FT                   KHITYRQLHDEVCKMANILRNRNVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFA
FT                   GFSPDSLAQRIKDCDSKVVITADEGLRGGRKVPLKANVDAALNKVDNVDWVVVVKRTGG
FT                   KIEMNPTRDLWYHEAAEMVTTECPVEHMNAEDALFILYTSGSTGQPKGVLHTTGGYLVY
FT                   ASMTHQYVFDYHEGDVYWCTADVGWVTGHSYILYGPLANGAVTLMFEGVPNYPDNSRFW
FT                   NVIDKHKVNIFYTAPTAIRALMQGGDGPVTKTSRESLRLLGSVGEPINPEAWEWYHRVV
FT                   GDNRCPIVDTWWQTETGGILITPLPGATRLKPGSATRPFFGVVPEIVDADGNTLEGATE
FT                   GNLCLTRSWPGQMRTVYGDHARFEMTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVI
FT                   NVSGHRMGTAEVESALVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMAGETPSEELRKEL
FT                   VGWVRKEIGPIASPDQIQFSQGLPKTRSGKIMRRILRKIAEDEPGALGDTSTLADPAVV
FT                   DDLVQHRQNRKEKQA"
FT   gene            359749..360936
FT                   /locus_tag="BRADO0345"
FT   CDS_pept        359749..360936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0345"
FT                   /product="conserved hypothetical protein; putative
FT                   eukaryotic-like DNA topoisomerase I"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74300"
FT                   /db_xref="GOA:A4YK74"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74300.1"
FT                   /translation="MMDQQNFESPRVGPADAEVALAKALGQWPPKPGRRKLTLKDLAHA
FT                   KTAHAQANAKTTVEELAKRIGLKLGDQSELTIRRIKRGKSYSFIRANGTQIRHAGTIRR
FT                   LHAMAVPPAYREVRYAPDPSLHLQAVGIDAAGRLQYRYHADWEKVREHRKAHRLAKLVG
FT                   ALPRIRRAVSKHLAGDAPTREFALAAVIELIARTAIRPGSESYARLNGTRGAATLLKSN
FT                   VLLEDDCLVLTFKAKGGKAVRKECDAAKLVRAVGVLRGLPGRRMFQYRDAQGVVRAVST
FT                   TQVNAFLREIAGIKISAKDFRTLMASAVALETLSRITPAESARGRKKQILEAIRAAADE
FT                   LTNTPAICRKSYVHDTIVTAFEDGILERFAATMKGQRSQTKREQLLAQVVTAVSA"
FT   gene            complement(360949..361275)
FT                   /locus_tag="BRADO0346"
FT   CDS_pept        complement(360949..361275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0346"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74301"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74301.1"
FT                   /translation="MTPGDMTGETTSSLIREPIPGVDTLNESDRSFEAQAIEVNEAARL
FT                   PLPSKVARSSLVARRAKAPTKATVLRPTKQPVAPVKRAAASCKALDPIARFLASAKIGP
FT                   RCQV"
FT   gene            361787..362341
FT                   /locus_tag="BRADO0348"
FT   CDS_pept        361787..362341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0348"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein; Fas1 domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74302"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74302.1"
FT                   /translation="MSKRIAFLAAAAFSALSLTSIAVAPARAEEKTVMVGGAAMYPSKN
FT                   IIQNAVNSKDHTTLVAAVKAAGLVQTLEGKGPFTVFAPTNAAFGKLPAGTVDNLVKPEN
FT                   KATLTKILTYHVVPGKLEAADLKDGQVLKTVEGEQLTVKRDGKTVMIMDAKGGSSTVTI
FT                   SNVNQSNGVIHVIDTVLLPAS"
FT   gene            362552..363181
FT                   /locus_tag="BRADO0349"
FT   CDS_pept        362552..363181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0349"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74303"
FT                   /db_xref="GOA:A4YK77"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74303.1"
FT                   /translation="MSSITASETTIVSPQTRLIQPAWVRVMHWINAVAMIMMIMSGWQI
FT                   YNASPLFDFRFDRSITLGGWLGGALLWHFAAMWLLMLNGLAYLVTGLITGRFRRKLLPI
FT                   SPASVIADLKAALTFKLSHDDLSAYNAVQKLLYLGIILVGIVVVLTGLSMWKPVQLHWL
FT                   VTLFGDYPAARYVHFVCMALICAFLVIHIVLALLVPKSLRAMIIGR"
FT   gene            363196..363978
FT                   /locus_tag="BRADO0350"
FT   CDS_pept        363196..363978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0350"
FT                   /product="putative oxidoreductase molybdopterin binding"
FT                   /function="1.4.3 : Electron carrier"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74304"
FT                   /db_xref="GOA:A4YK78"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74304.1"
FT                   /translation="MAKRPFLIPGVDKRLLIKDSIKAMPDLTRRRFITGGASLGALTLL
FT                   TGCDVVDGDTAEELLKKVSKFNDAVQSWIFNPDALAPTFPESAITKPFPFNAYYTLDEA
FT                   PEIDAADWKLEVRGLVDNKKSWTLDELHALPQVKQITRHICVEGWSAIGSWTGTPLRDF
FT                   LKLVGADTRAKYVWFNCADSQGYNSPLDMRTALHPQTQMTFKFDDQILPRAYGFPMKIR
FT                   VPTKLGFKNPKYVVAMEVTNDYKGGYWEDQGYNSFSGS"
FT   gene            complement(364144..365340)
FT                   /locus_tag="BRADO0351"
FT   CDS_pept        complement(364144..365340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0351"
FT                   /product="Putative permeases of the major facilitator
FT                   superfamily"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74305"
FT                   /db_xref="GOA:A4YK79"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74305.1"
FT                   /translation="MPTPPSDTTPAHPALTNLTLSLGPIIGLGIGRFAYALVLPDMRET
FT                   LHWSYSAAGFMNTVNAAGYLIGALIASQTARRFGALAAVRGGTLAALASLVVCATTGDF
FT                   VALSLARLVTGIGAGVALVAGGALAARVALARPAQASFVLSLFYAGPPLGIVISGLIAP
FT                   FVLQAFGPGSWWIVWAVLACVGAVLIVPLLLTRLPSNATAPETRADRVSLRPMAIYLFG
FT                   YFLYGAGYIAYLTFMIAYVRDLGGGAAAQSGFWCLIGLAGFATPWVWRRVLALDRGGWP
FT                   TALILTINAIGAALPALSHSPIMLTLSAAVFGIAFSTVTTATTAFVRFNLPQAAWPRAI
FT                   AALTISFGVGQTLGPFAVGAITDAMGSLTYALNVSAALLLLGAVMAAMQGKLKRTGRA"
FT   gene            365614..366726
FT                   /gene="leuB"
FT                   /locus_tag="BRADO0353"
FT   CDS_pept        365614..366726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="BRADO0353"
FT                   /product="3-isopropylmalate dehydrogenase (Beta-IPM
FT                   dehydrogenase) (IMDH) (3-IPM-DH)"
FT                   /function="1.5.1.19 : Leucine"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.1.1.85"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74306"
FT                   /db_xref="GOA:A4YK80"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74306.1"
FT                   /translation="MATHKLLLLPGDGIGPEVMAEVKRLIGWLNGKGLASFETEDGLVG
FT                   GAAYDAHGASISEGDMDKAKAADAIIFGAVGGPKWDGVPYEVRPEAGLLRLRKDLGLFA
FT                   NLRPAVCYPALADASSLKREIVEGLDIMIVRELTGGVYFGEPKTITDLGNGQKRAIDTQ
FT                   VYDTYEIERIARVAFDLARKRKNKVTSMEKRNVMKSGVLWNEVVTAVHAREYKDVTLEH
FT                   QLADSGGMNLVKYPKMFDVIVTDNLFGDMLSDIAAMLTGSLGMLPSASLGEVDAKTHKR
FT                   RALYEPVHGSAPDIAGRGLANPIAMLTSFGMALRYSFDLGALADKLDAAIAAVLASGLR
FT                   TADIKAEGSTPASTTQMGEAIIKELETLTA"
FT   gene            complement(368192..368572)
FT                   /locus_tag="BRADO0356"
FT   CDS_pept        complement(368192..368572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0356"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74307"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74307.1"
FT                   /translation="MIEFPAATRVMALAVIAATGLAVTSFAITSAEAATTKRRPAEVYS
FT                   NGPNYSYQAGPRTRVYVTRRSFLDGGTEVLPGDRKFSDYAFPPAVGYPSFARENLNRPI
FT                   DRQPLMPPSDLGGYPTRIPIPY"
FT   gene            complement(368798..369601)
FT                   /locus_tag="BRADO0357"
FT   CDS_pept        complement(368798..369601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74308"
FT                   /db_xref="GOA:A4YK82"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74308.1"
FT                   /translation="MRPDSASIVATPRNSLVPPAVKAMVDEVCGTFARLFAYVGALALI
FT                   AMMGLAVWNRLDSEDDPSPTKAGWTVADGATPAFSLRLTDQPDRTATYTVVTHQAGGRK
FT                   DVLRWGERAERPAAEIEVYRIGPERDGMRNPVGELAARMGRPAPELEAAGIIDSRFGPV
FT                   TLLRQAGAPDGPGACLGFMKTIAVPALRISGWSCQGVALQTRRAAIGCMLNRLTLLASP
FT                   AHDAALTDLFTQAEPRRADCDAPAVAKTLNDWITALDNPKLRGTY"
FT   gene            369716..370750
FT                   /gene="asd"
FT                   /locus_tag="BRADO0358"
FT   CDS_pept        369716..370750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="BRADO0358"
FT                   /product="Aspartate-semialdehyde dehydrogenase (ASA
FT                   dehydrogenase) (ASADH)"
FT                   /function="1.5.1.7 : Lysine, diaminopimelate"
FT                   /function="1.5.1.8 : Threonine"
FT                   /function="1.5.1.9 : Methionine"
FT                   /EC_number="1.2.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10369777; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74309"
FT                   /db_xref="GOA:A4YK83"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74309.1"
FT                   /translation="MGYKVAVVGATGNVGREMLNILDERKFPADEVVALASRRSVGVEV
FT                   SYGDRTLKVKALEHYDFADVDICLMSAGGTVSKEWSPKIGAAGAVVIDNSSAWRMDPDV
FT                   PLIVPEVNADAAAGFNKKNIIANPNCSTAQLVVALKPLHDKAHITRVVVSTYQSVSGAG
FT                   KDAMDELFSQTKAVYTNDELVAKKFPKRIAFNVIPHIDVFMEDGFTKEEWKMMAETKKI
FT                   LDPKIKLTATCVRVPVFVGHSEAVNVEFEQPITADEAREILRRAPGCLVIDKQEPGGYA
FT                   TPYEAAGEDATYISRIREDATVENGLAFWCVSDNLRKGAALNAIQIAEVLINRKLITAK
FT                   KKAA"
FT   gene            371068..371628
FT                   /locus_tag="BRADO0359"
FT   CDS_pept        371068..371628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0359"
FT                   /product="putative membrane protein"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74310"
FT                   /db_xref="GOA:A4YK84"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74310.1"
FT                   /translation="MADSKSTEPAAAPASDKHAPSAIERGLESFLFKSRWLMAPFYVGL
FT                   VVSLAVLLFKFVLLLWENVIHLPTAKESDIILGVLSLIDVCLTGNLVLIVVFSGYENFV
FT                   SRIDPNGHPDWPEWMTKVDFAGLKQKLLASIVAISAIQLLKAFMNLDAGYDSTKLAWLV
FT                   GVHMTFVVSTVMLALSDRWTSDH"
FT   gene            complement(371710..372354)
FT                   /locus_tag="BRADO0360"
FT   CDS_pept        complement(371710..372354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0360"
FT                   /product="putative carbonic anhydrase 2 (Carbonate
FT                   dehydratase 2)(cynT)"
FT                   /function="1.7 : Central intermediary metabolism"
FT                   /EC_number="4.2.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74311"
FT                   /db_xref="GOA:A4YK85"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74311.1"
FT                   /translation="MISFPQRLLEGYRAFTTQRLPTEQSRYLELSERGQSPEVMVIGCC
FT                   DSRVSPEVIFDVGPGELFVLRNIANLVPIYQPDANAHGVSAALEYAVTVLMVKHIVILG
FT                   HAQCGGIRAFVDKAAPLSPGDFIGRWMSMFIKPGEIVEQRDRESFQDFVTRIEKAAVFR
FT                   SLENLMTFPFVRSRVEAGDLQLHGAYFGVAEGSLFVLDQAAKEFRSARASQ"
FT   gene            372456..373334
FT                   /locus_tag="BRADO0361"
FT   CDS_pept        372456..373334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0361"
FT                   /product="putative citrate lyase beta chain (Citrase beta
FT                   chain) (Citrate (pro-3S)-lyase beta chain) (Citryl-CoA
FT                   lyase subunit) (citE)"
FT                   /function="1.7.1 : Unassigned reversible reactions"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.1.3.34"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74312"
FT                   /db_xref="GOA:A4YK86"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74312.1"
FT                   /translation="MIRPRRSLLFMPGSNARALEKGRNLPADGLILDLEDSVAPDVKAA
FT                   AREQIAKAVAADGYGKRELLIRINSLDTPWWSDDVAMAGQTATDGILVPKVSTVADLRT
FT                   VSNRLAEVGADPALKVWAMIETARAVLDADLLAATVHEAGSRLAGFVFGPNDISRETRI
FT                   RMVPGRATMLPMISHCVLATRAHGLEILDGPYSDFANTDGFAQECIQARDLGFDGKTLI
FT                   HPGQIDACNAIFTPPAVEIAEARKILAAFELPENASRGAIQIDGRMVERLHAEMAKRTI
FT                   AIADAIAEMTK"
FT   gene            complement(373356..373727)
FT                   /locus_tag="BRADO0362"
FT   CDS_pept        complement(373356..373727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0362"
FT                   /product="putative Cytochrome c precursor (Cytochrome
FT                   c552)(cycB)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74313"
FT                   /db_xref="GOA:A4YK87"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74313.1"
FT                   /translation="MSLPNLHRNTWLHVGAAILLALAAMLLIRLHYANGATPAAESVQA
FT                   GRKLAESWCSPCHAIDASGARAQTRTAPDFAAVANMPSTTELSLKVFLQSSHPTMPNVI
FT                   LTSEQRGDLVNYILSLRQI"
FT   gene            complement(373767..374183)
FT                   /locus_tag="BRADO0363"
FT   CDS_pept        complement(373767..374183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74314"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74314.1"
FT                   /translation="MSAQAKPYPRVQFLIDTFAQWLRHRRELSELRQLDRDDFERIALD
FT                   LQVTPSDLDELVRQGEHAADELPLMLKALGIDEAALSRAEPLVLRDMERVCAMCKDKPR
FT                   CHRDLAAGTSDAHYEDYCLNAPTIDRLGVAVTKH"
FT   gene            complement(374283..375080)
FT                   /locus_tag="BRADO0364"
FT   CDS_pept        complement(374283..375080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74315"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74315.1"
FT                   /translation="MPRVLPEVVTFWRGPLDRLRQTCLRSQLAAGHKVTVYSFDPLPGL
FT                   PDGVGNADAEAILPCAFAERLRPPQPDGSWRDWTTLQFSDFFRMRLMAERAGLWLDADV
FT                   LLLRPVEIDPALPTFAWERPRQLGNSVLYLPPDDPIVAEFAALMAQDALTPNWLSLRHR
FT                   ITFALRRLRGVSDRLSDIRVAIFGPAALTALARRHGSLRHALPKRSFYAAHAEPRAFFD
FT                   PSDFSGLISDPGIIGLHISPKGRGGEAPIPGSLYAWATERFGA"
FT   gene            complement(375166..375777)
FT                   /gene="leuD"
FT                   /locus_tag="BRADO0365"
FT   CDS_pept        complement(375166..375777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BRADO0365"
FT                   /product="3-isopropylmalate dehydratase small subunit
FT                   (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI)"
FT                   /function="1.5.1.19 : Leucine"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.2.1.33"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74316"
FT                   /db_xref="GOA:A4YK90"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74316.1"
FT                   /translation="MPPMDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGL
FT                   FSEQRYKDDGSENPDFVLNQPAYRNAKILVAGDNFGCGSSREHAPWALLDFGIRCVIST
FT                   SFGDIFYNNCFKNGILPIRVSQADLDKLFDDAERGANATLTIDLAAQEIRGPDGGTVKF
FT                   EIDPFRKHCLLNGLDDIGLTLEKKASIDSYEAKLAERAWA"
FT   gene            complement(375862..376257)
FT                   /locus_tag="BRADO0366"
FT   CDS_pept        complement(375862..376257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74317"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74317.1"
FT                   /translation="MTELKAPSLADMEAMAHDVFERLPAHFRRMCEGVIIRVDDFPTEE
FT                   VLDEMQAESEFDLLGLFQGTGLPFRSNDDLPRLPNMIWLYRRPILDYWAEHDESLGHIV
FT                   RHVLIHEIGHHFGMSDDDMEAIEAAAD"
FT   gene            376409..376738
FT                   /locus_tag="BRADO0367"
FT   CDS_pept        376409..376738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0367"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74318"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74318.1"
FT                   /translation="MLAGTALAAAIMVSMSAGARAEPPAGANREAMQLESMQRDASTDF
FT                   SAQRRPRRVPIYPRQYEGHWEPDVVPHYNPGPNAVRVCNASYVPEHRPSGTVIVPHMSC
FT                   YWRRG"
FT   gene            377067..377282
FT                   /locus_tag="BRADO0368"
FT   CDS_pept        377067..377282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74319"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74319.1"
FT                   /translation="MAAPAQRAEALSLSNPGAAAAVQQGAAQETTQAHWHGRRHWHPRR
FT                   HYYPRHYYPRHHWRPHHWHRHHHRHW"
FT   gene            377999..378661
FT                   /locus_tag="BRADO0372"
FT   CDS_pept        377999..378661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0372"
FT                   /product="conserved hypothetical protein (partial)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74320"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74320.1"
FT                   /translation="MMRMKDQRAGLARRLSLAAAALIVLAGASGRPASAMTPVSPGATP
FT                   VAPASAEALTIQVRGPGGHGGGGGGHGGGGFHGGGGFHGGGGFHGGGGGFHAGPAFHGG
FT                   GGPAFHGGGGMFRGGPVFHGGGGPRPVFHGGGGYYQRPHYAYRPYFHHHRRHFYGYSSY
FT                   YYPTYTTGYYYPYRRCRIVYTYYGPRRVCHYRHFRGYHWRHHHRWHHRHHRHHWRYY"
FT   gene            complement(378736..378951)
FT                   /locus_tag="BRADO0373"
FT   CDS_pept        complement(378736..378951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0373"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74321"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74321.1"
FT                   /translation="MAEKPEYVDLIRDATRQRRKTPPAKIIAKPEEPKEERRLSNWPPG
FT                   RFAKWRLETLVPWKLTVKNWQFKDWL"
FT   gene            complement(379156..380562)
FT                   /gene="leuC"
FT                   /locus_tag="BRADO0374"
FT   CDS_pept        complement(379156..380562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BRADO0374"
FT                   /product="3-isopropylmalate dehydratase large subunit 2
FT                   (Isopropylmalate isomerase 2) (Alpha-IPM isomerase 2) (IPMI
FT                   2)"
FT                   /function="1.5.1.19 : Leucine"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.2.1.33"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74322"
FT                   /db_xref="GOA:A4YK96"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74322.1"
FT                   /translation="MSKPTTLYDKIWNDHLVHEAEDGTCLLYIDRHLVHEVTSPQAFEG
FT                   LRMTGRKVHAPEKTLAVVDHNVPTTDRSKPNPDPESIEQIKTLAENAKDFGIEYYNEFD
FT                   RRQGIVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLIQK
FT                   KAKNMRVTVDGKLPDGVTGKDIILAIIGEIGTAGGTGYVLEYAGEAIRALSMEGRMTVC
FT                   NMSIEGGARAGLVAPDEKAYDFLRGRPKAPQGAAWDAAMRYWETLRSDEGAHFDHELRL
FT                   DAAKLPPIVTWGTSPEDVISVTGMVPDPDKIADEAKRISKHRALKYMGLTAGTKITDIK
FT                   LDRVFIGSCTNGRIEDLRAAAKIAEGKTVSSHVNAMVVPGSGIVKEQAEAEGLDKIFIK
FT                   AGFEWREPGCSMCLAMNPDKLAPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAAIA
FT                   GHFVDVRDWR"
FT   gene            complement(380987..381373)
FT                   /gene="rplS"
FT                   /locus_tag="BRADO0375"
FT   CDS_pept        complement(380987..381373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BRADO0375"
FT                   /product="50S ribosomal protein L19"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7559342; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74323"
FT                   /db_xref="GOA:A4YK97"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74323.1"
FT                   /translation="MNLIQQLEKEQFDKLSANKTIPEFGPGDTVIVNVKVVEGERTRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPILSPMIDSIKVVRRGKVRRAKLYYL
FT                   RQLRGKSARIVEKQDRQQAAAVNE"
FT   gene            complement(381481..382254)
FT                   /gene="trmD"
FT                   /locus_tag="BRADO0376"
FT   CDS_pept        complement(381481..382254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BRADO0376"
FT                   /product="tRNA (Guanine-N(1)-)-methyltransferase"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.1.1.31"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6337136, 6357787; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74324"
FT                   /db_xref="GOA:A4YK98"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4YK98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74324.1"
FT                   /translation="MTTSPPLTAPWRATVLTLFPEMFPGPLGVSLAGRALTSGIWSLEA
FT                   RDIRASATDKHRSVDDTPAGGGPGMVLRADVLAAAIDAAAIAPERPKLLMSPRGRPLTQ
FT                   AFVRELAAGPGPLIVCGRFEGIDQRVIDARELIEVSIGDYVLSGGEIAALVLIDACVRL
FT                   LPGVMGKLESGTDESFSDGLLEYPQYTRPQVFEGRSIPDVLTSGDHAKVAAWRHAQSLA
FT                   LTEARRPDLWGEWQARQPREQSRTSQKAPKSTTDG"
FT   gene            complement(382458..383057)
FT                   /gene="rimM"
FT                   /locus_tag="BRADO0377"
FT   CDS_pept        complement(382458..383057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BRADO0377"
FT                   /product="16S rRNA processing protein, putative function"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74325"
FT                   /db_xref="GOA:A4YK99"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YK99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74325.1"
FT                   /translation="MMSKLICVARIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGS
FT                   RSFEVTKAREAKDHLVASFKGITDRNAAERLNGVELYVPRDRLPETDDDEYYHADLIGL
FT                   AAETTAGAPLGRVLAIHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIELP
FT                   DEIDGEDRASADESASAEDDAAAPNSARHPRESGDP"
FT   gene            complement(383183..383515)
FT                   /gene="rpsP"
FT                   /locus_tag="BRADO0378"
FT   CDS_pept        complement(383183..383515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BRADO0378"
FT                   /product="30S ribosomal protein S16"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74326"
FT                   /db_xref="GOA:A4YKA0"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74326.1"
FT                   /translation="MSVVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLMP
FT                   KDNEARLKLDMEKVKGWLAKGAQPSDRVARFLDTAGVKKREARNNPEKAVPRKERKAQA
FT                   EAAAKG"
FT   gene            complement(383656..385203)
FT                   /gene="ffh"
FT                   /locus_tag="BRADO0379"
FT   CDS_pept        complement(383656..385203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BRADO0379"
FT                   /product="4.5S-RNP protein, GTP-binding export factor, part
FT                   of signal recognition particle with 4.5 RNA, ffh family
FT                   (fifty four homolog)"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8898086; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74327"
FT                   /db_xref="GOA:A4YKA1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74327.1"
FT                   /translation="MFDNLSERLGGILDRLTGRGSLSEADVDAAMREVRRALLEADVAL
FT                   EVVRSFTDRVREQAIGATVVKSVTPGQMVVKIVHDELVKTLGDDGQTIDLNAVPPVPIM
FT                   MVGLQGSGKTTTTAKLARRMVQRDKRKVLMASLDVYRPAAMEQLAVLGRDLDIPTLPIV
FT                   AGQMPPQIARRAIEAAKLGGYDVVLLDTAGRTTLDEDMMKEAAEIKAVANPHEVLLVAD
FT                   SLTGQDAVNLARSFDQRVGLTGIALTRIDGDGRGGAALSMRAVTGKPIKLLGTGEKTDA
FT                   LEDFYPSRIAGRILGMGDIVSLVEKAAANIDAEKAARAAEKMRKGQFDLNDMREQLLQM
FT                   SQMGGISGLMGMMPGISKMKNQIAAAGIDDKILKRQVAIIDSMTREERKHPDLLKASRK
FT                   KRIAAGSGQSVEHVNKLLKMHRNMADVMKAMGSGKRGPLAGIAQAMGFGGGGGMPSPEQ
FT                   LKALADKMPGGMPGGLPNLPKDLPAGLRGGLPNLPGLTGLSGKPTLPGLGLPPGKKK"
FT   gene            385555..386547
FT                   /locus_tag="BRADO0380"
FT   CDS_pept        385555..386547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0380"
FT                   /product="putative metallo-hydrolase/oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74328"
FT                   /db_xref="GOA:A4YKA2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74328.1"
FT                   /translation="MLRRSRTYSGPVTDHFDGKRFYDPDGVPPKSLAQVLRWQFDRNGK
FT                   RSRWPAWAPSPHADTPPHRIEGETVRLSFIGHASWLVQTGGLNILIDPVWSERVSPLSF
FT                   AGPRRHNDPGIAFEALPHIDVVLVSHGHYDHLDIRTLSKLTARFAPRVVTPLGNDLTMT
FT                   DADAKIRAEAYDWHDRVTLNDEVAVTLVPTRHWTARGIFDRNKALWASFVLETPRGRLY
FT                   IVCDSGYGTGKHFRRVAEAHAPLRLAILPIGAYEPRWFMRDQHMNPEDAVQALQDCGAE
FT                   TALAHHHGTFQLTDEAIDAPVHALHAALDSAGIPRERFSVLKPGQVVEI"
FT   gene            complement(386759..387472)
FT                   /locus_tag="BRADO0381"
FT   CDS_pept        complement(386759..387472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0381"
FT                   /product="conserved hypothetical protein; putative secreted
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74329"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74329.1"
FT                   /translation="MMLRPLLVAAMMASAALPALADDIARQDTPAITVSGEGSVQAPPD
FT                   LAQIDAGVASDAKTAREAAEANNVAMAKVLQSLKTAGIADKDVQTSRLSLQPQYAQNRP
FT                   GQPAVTGYRASNRVTIKVHDIAKVANVIDTVVAAGANDVGNVFFSVAEPSKLLDQAREK
FT                   AVADARRKAEIYAKAAGVTLGQPLNIAEDGAPTPVFRAKTFAAPMAAGAPTPVAQGEET
FT                   LSVTVSVTWAIKAGQ"
FT   gene            complement(387478..388212)
FT                   /locus_tag="BRADO0382"
FT   CDS_pept        complement(387478..388212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0382"
FT                   /product="conserved hypothetical protein; putative secreted
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74330"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74330.1"
FT                   /translation="MNLSTFRLVLAVGTVALALGGPLARAQAPSASPAPAASASPAPAP
FT                   SATPAPSALPAASASPSPTPAASASPSSSPAAQAPATPPAAAPSQAADAFGEEIKLEAK
FT                   KVVLVKGTANWDNAFDTLIDSFKALSTTLDKQGVKPAGNGMIVYTSTDDNGFTYLAEMP
FT                   IDQEPKTLGKGMSIGQSPEGKALKFVHRGSYDNMDNTYEAITNHLDERRLEAKDTFIEE
FT                   YLTDPLKTAEDKLVINVYVPLK"
FT   gene            388384..389253
FT                   /gene="dapF"
FT                   /locus_tag="BRADO0383"
FT   CDS_pept        388384..389253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="BRADO0383"
FT                   /product="diaminopimelate epimerase"
FT                   /function="1.5.1.7 : Lysine, diaminopimelate"
FT                   /EC_number="5.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3031013; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74331"
FT                   /db_xref="GOA:A4YKA5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74331.1"
FT                   /translation="MSPLANHSFVKMNGIGNEIVVLDLRDVKHVVTPDEARAVASRVPY
FT                   DQMMVLQRPRFDGTEAFIRIYNNDGSESGACGNGMRCVVSQVFGKTGQTSATFETRAGL
FT                   LNCWQGPAPDLYTVDMGVPRFGWQDIPLAEEFRDTRYIELQIGPIDAPILHSPSVVSMG
FT                   NPHAVFWVDNDVNSYDLERFGPLLENHPIFPERANITLAQIVDRDHITMRTWERGAGLT
FT                   RACGSAACATAVAAARLKRANRLVHMTLPGGELTIEWRERDDHVLMTGTATFEFEGRFE
FT                   PALFASVA"
FT   gene            389250..390581
FT                   /locus_tag="BRADO0384"
FT   CDS_pept        389250..390581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0384"
FT                   /product="putative MiaB-like tRNA modifying enzyme"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74332"
FT                   /db_xref="GOA:A4YKA6"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74332.1"
FT                   /translation="MSVDVVTFGCRLNAFESELIARHVEAAGADDTIVINSCAVTNEAV
FT                   AQARQSIRKLKRERPYARIVVTGCAAQTQADMFAAMPEVDRVIGNDDKLRPDAWRATTQ
FT                   VLAAPRFGIDATEKVAVSDIMAVTEMAPHLVDGFQRGLPRVFVQVQNGCDHRCTFCIIP
FT                   YGRGNSRSVPMGAVVDQVRTLAERGHAEIVLTGVDLTSYGADLPGTPKLGLLVKQILRH
FT                   VPELKRLRISSIDSIEADADLLDALADDARLMPHLHLSLQAGDDLILKRMKRRHVRADA
FT                   IAFCDQVRRLRPDIALGADLIAGFPTETEEMFTRSLDLVEACGLTLLHVFPYSPRPGTP
FT                   AARMPQVDGAVIRDRARRLRAVGEAALRRRLDAEIGCAREVLIESATQGRTEHYLPVSV
FT                   TGAEPGSVQRLVIAGHDGGKLSAPPSVSSPGLTGRSSTPRPLGQ"
FT   gene            complement(390678..391580)
FT                   /locus_tag="BRADO0385"
FT   CDS_pept        complement(390678..391580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0385"
FT                   /product="putative RNA pseudouridine synthase (Uracil
FT                   hydrolyase)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74333"
FT                   /db_xref="GOA:A4YKA7"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74333.1"
FT                   /translation="MDINQPTDEEMLARVLHRDGLMLVIDKPAGIPVHKGPKGGPNLEA
FT                   SFDALRFGLPRPPVLAHRLDKETSGCLVLGRHRKATASLGLLFKHGKISKTYWAVVEGG
FT                   PEADEGVIELPLGKLNAERGWWQKPDPSGQPAVTKWRVLGRSYAVAAADPSPSSPPTCG
FT                   TTSPPPCGEGSGVGVPTGIAARSHPPPRPSPARGEGADRATGESAASSGKAPKLTWLAM
FT                   EPITGRTHQLRVHSAASGWPIIGDNIYGNGPRFGEPRLHLHAREISIPLSKNKPPVQVV
FT                   APAPLHMHERLRLCGWNGE"
FT   gene            391640..392587
FT                   /gene="ftsY"
FT                   /locus_tag="BRADO0386"
FT   CDS_pept        391640..392587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BRADO0386"
FT                   /product="Cell division transporter substrate-binding
FT                   protein FtsY (Signal recognition particle receptor)"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /function="5.1 : Cell division"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9002525; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74334"
FT                   /db_xref="GOA:A4YKA8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74334.1"
FT                   /translation="MNDTTSETPKRSWWRRLSDGLKRTSGALGTAVADLVTKRKLDRAM
FT                   LDDIEDVLLRADLGTQVAARIAEAVGAGRYDKAISADEVKAVVATEVEKVLSPVAKPLT
FT                   IEPGHKPFVILVVGVNGSGKTTTIGKLAQKFASEGKHVMLAAGDTFRAAAIEQLKVWGE
FT                   RTKAPVIAGAQGSDSASLAFNAITAAKEQGRDILLIDTAGRLQNKAELMNELEKVVRVI
FT                   RKVDASAPHAVLLVLDATVGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALSEK
FT                   FKLPVHFIGVGEGVDDLQPFAAKDFARAIAGIED"
FT   gene            392671..393273
FT                   /locus_tag="BRADO0387"
FT   CDS_pept        392671..393273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0387"
FT                   /product="putative intracellular septation protein
FT                   (ispA/ispZ family), putative membrane protein"
FT                   /function="5.1 : Cell division"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74335"
FT                   /db_xref="GOA:A4YKA9"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74335.1"
FT                   /translation="MDKTQPHPLFKLATELGPLIVFFFVNAKFNLFAATGAFMVAIIAA
FT                   LIASYVVTRHIPLMALVTAVVVIVFGTLTLVLHDETFIKVKPTIIYGLFAAVLGGGLVF
FT                   NRSFIAIMFDQMFNLTPAGWRILTFRWALFFAGMAVLNEIIWRTQSTDFWVGFKAFGVL
FT                   PLTMIFAIAQMPLIKRYHQDPASLEASDAAEGDVSKG"
FT   gene            complement(393582..394178)
FT                   /gene="ccmG"
FT                   /locus_tag="BRADO0388"
FT   CDS_pept        complement(393582..394178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmG"
FT                   /locus_tag="BRADO0388"
FT                   /product="periplasmic thioredoxin (cytochrome c
FT                   biogenesis)"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /function="1.6.15.2 : Thioredoxin, glutaredoxin"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="7.2 : Periplasmic space"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11256948, 9537397, 11843181; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74336"
FT                   /db_xref="GOA:A4YKB0"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74336.1"
FT                   /translation="MTDQTAPEAAPRRRSLLMLLPLVVFLGLAALFWFRLGNGDPSRIP
FT                   SALIGRPAPATPLPPLPELARDGAVIPGLDPAALKGKVSIVNVWASWCVPCHDEAPLLV
FT                   DLGRDKRFQIIGINYKDAADNARRFLGRYGNPYDFVGVDGNGRAGIEWGVYGVPETFVV
FT                   GREGTIVYKLVGPITAQNIDAVLKPEIEKALKAGG"
FT   gene            complement(394175..394354)
FT                   /gene="ccmD"
FT                   /locus_tag="BRADO0389"
FT   CDS_pept        complement(394175..394354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmD"
FT                   /locus_tag="BRADO0389"
FT                   /product="heme exporter protein D (Cytochrome c biogenesis
FT                   protein)"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74337"
FT                   /db_xref="GOA:A4YKB1"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74337.1"
FT                   /translation="MDLGPYTSFIATSYLAAALVVVLLIAWIAIDYRTQKARLRALEDS
FT                   GISRRSGRAATDMQ"
FT   gene            complement(394356..395132)
FT                   /gene="ccmC"
FT                   /locus_tag="BRADO0390"
FT   CDS_pept        complement(394356..395132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="BRADO0390"
FT                   /product="heme ABC transporter (heme exporter protein C),
FT                   permease protein (cytochrome c biogenesis)"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7635817; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74338"
FT                   /db_xref="GOA:A4YKB2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74338.1"
FT                   /translation="MSLIDLANPTRFLALAARLLPWLALVTVALLAAGLYLSALAPDDY
FT                   QQGATVKIMFIHVPNAWLSMFVWGVMSIASLGTLVWRHPLADVAAKAAAPIGASFTFLA
FT                   LLTGSLWGRPMWGTYWEWDARLTSVLILFLMYLGLIALWRSVEDPTRAARAAAVLTLVG
FT                   AINLPIIKFSVDWWNTLHQPASVMRMGGPALDKAFLIPLLVMAIGFSFLFITLHVAAMR
FT                   NEILRRRVRSLQMMQARSYQGSAPSGGATSQIVGAA"
FT   gene            complement(395225..395893)
FT                   /gene="ccmB"
FT                   /locus_tag="BRADO0391"
FT   CDS_pept        complement(395225..395893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="BRADO0391"
FT                   /product="heme ABC transporter (heme exporter protein B),
FT                   permease protein (cytochrome c biogenesis)"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74339"
FT                   /db_xref="GOA:A4YKB3"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74339.1"
FT                   /translation="MTALGALIRRDIRIALRIGGGALIGVLFFLTVVVLMPFAVGPDLA
FT                   LLTRLGPAILWLGALLASLLTLDRLFTADHEDGSLDLIIMSRTPLEFACAAKALAHWLA
FT                   AGLPLVIATPVLGLLLNLDATATGAVALTLLAGTPALTFIGMIGAALAVTMSRGGLLLA
FT                   VLVLPLSIPVLIFGVAASQAAIVGPLPFGAPFSILCALSLVSFVIGPFAAATSLRNGLD
FT                   "
FT   gene            complement(396101..396724)
FT                   /gene="ccmA"
FT                   /locus_tag="BRADO0392"
FT   CDS_pept        complement(396101..396724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="BRADO0392"
FT                   /product="heme ABC transporter (heme exporter protein A),
FT                   ATP-binding protein (cytochrome c-type biogenesis)"
FT                   /function="1.5.3.12 : Heme, porphyrin"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.6.3.41"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10339610, 10708391; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74340"
FT                   /db_xref="GOA:A4YKB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74340.1"
FT                   /translation="MQQSPPPSPRLFGHDVRCVRGGREVFAGLAFEARAGEALAVTGHN
FT                   GAGKTSLLRLIAGLLLPTGGTIAIEGGGGELTVPEQAHYLGHRDALKPALSVRENLTFW
FT                   ADFLGGGMTRPIPDCLAAVGIAHAIDLPAGYLSAGQRRRLSLARLLAVPRLLWLLDEPT
FT                   AALDVTGQAMFAGLMREHLATGGLIVAATHGPLGIDTRELRIGN"
FT   gene            396933..399668
FT                   /gene="acnA"
FT                   /locus_tag="BRADO0393"
FT   CDS_pept        396933..399668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="BRADO0393"
FT                   /product="aconitate hydratase 1"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /EC_number="4.2.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10585860; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74341"
FT                   /db_xref="GOA:A4YKB5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74341.1"
FT                   /translation="MGFPRMTSLDSFKCRKTLKVGTKSYIYYSLPTAEKNGLKDISKLP
FT                   YSMKVLLENLLRNEDGRTVTKDDIVAVSKWLRKKSLEHEIAFRPARVLMQDFTGVPAVV
FT                   DLAAMRNAMQKLGGDAEKINPLVPVDLVIDHSVIVNYFGDNKAFGKNVAEEYKQNQERY
FT                   EFLKWGQKAFSNFSVVPPGTGICHQVNLEYLAQTVWTKKEKMTVGRTKGTFEVAYPDSL
FT                   VGTDSHTTMVNGLAVLGWGVGGIEAEACMLGQPLSMLLPDVVGFKLTGALKEGVTATDL
FT                   VLTVTQMLRKLGVVGKFVEFFGPGLDHLSVADKSTIANMAPEYGATCGFFPVDTATIDY
FT                   LKTSGRKGPRVALVEAYAKAQGLFRTAKSADPVFTETLNLDLGDVVPSMAGPKRPEGRI
FT                   ALPAVAEGFATALAGEYKKPDAAEQRFAVEGKDFDIGHGDVVIAAITSCTNTSNPSVLI
FT                   GAGLLARNAAAKGLKAKPWVKTSLAPGSQVVAEYLANSGLQKDLDKVGFNLVGFGCTTC
FT                   IGNSGPLPEEISKSINDNGVVAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAYALAGT
FT                   VTKDLAVEPIGIGKDKKPVYLKDIWPTTKEVNDFVKKFVKASIFKKRYADVFKGDTNWR
FT                   KIKTVESETYRWNMSSTYVQNPPYFEGMKKEPEPIKDIVEARVLALFGDKITTDHISPA
FT                   GSIKLTSPAGKFLSEHQVRPADFNQYGTRRGNHEIMMRGTFANIRIKNFMLKGADGNIP
FT                   EGGLTKHWPDGEQMSIYDAAMKYQEEGVPLVVFAGAEYGNGSSRDWAAKGTRLLGVRAV
FT                   ICQSFERIHRSNLVGMGVLPLTFQEGTSWSSLGLKGGEKVTIKGLQGDLKPRQTLTAEI
FT                   VSADGAAQQVPLLCRIDTLDELDYYRNGGILHYVLRKLAA"
FT   gene            399857..400597
FT                   /locus_tag="BRADO0394"
FT   CDS_pept        399857..400597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74342"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74342.1"
FT                   /translation="MSWWSRAALCVCAVIAFVRPASADPRAVIELFTSQGCSSCPPADK
FT                   VLGELARDPNIIALSLPIDYWDYLGWKDTLADSRFTARQRAYSRARGDREVYTPQAVVN
FT                   GSVHVIGSDREAIEGAIEETAQAGNAMSVPVRLSIEGQELTVSVAAATEHTLRKHGEVW
FT                   VCSIARAVPIQVGRGENSGRELTYYNVVRSLLKLGDWNGTSVSWSVPLEKIAREGVDGA
FT                   VVYVQDGSRDRPGPMLGAAYSELH"
FT   gene            401015..401380
FT                   /locus_tag="BRADO0395"
FT   CDS_pept        401015..401380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74343"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74343.1"
FT                   /translation="MNLTPEDADPSENRAAARSAAVAPNRVTFDRLELNRILNLYGRMV
FT                   ADGEWRDYSIDFLRDRAVFSVFRRASEVPLYRIEKDPRLARKQGMYSVISATGLILRRG
FT                   HELERVLLAIAPKPALV"
FT   gene            complement(401410..401937)
FT                   /gene="pat"
FT                   /locus_tag="BRADO0396"
FT   CDS_pept        complement(401410..401937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pat"
FT                   /locus_tag="BRADO0396"
FT                   /product="phosphinothricin acetyltransferase (PPT
FT                   N-acetyltransferase)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74344"
FT                   /db_xref="GOA:A4YKB8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74344.1"
FT                   /translation="MSSIDIRPTTEADLSAITAIYGQAVREGTATFELDPPDLAEMTRR
FT                   FRALTDGDFPYFAAVLDGQVVGYAYAGPYRPRPAYRFTVENSIYLAPASQRRGIGMRLM
FT                   RQLIAACEEKGFRQMIAVIGDSANAGSVGLHTACGFQMIGTHPSVGLKFGRWLDTVMMQ
FT                   LSLGAGSSDIPA"
FT   gene            complement(402301..403092)
FT                   /locus_tag="BRADO0397"
FT   CDS_pept        complement(402301..403092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0397"
FT                   /product="putative transport protein; putative membrane
FT                   protein"
FT                   /function="4 : Transport"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74345"
FT                   /db_xref="GOA:A4YKB9"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74345.1"
FT                   /translation="MSDLNRNYASPFGRVAGRADAATVDAGLRAYMLRIYNYMSIGLAI
FT                   TGLAALGVYMAAVTGDPAAGVFKFGNAYLTQFGYAMFVSPLKWLFILAPLVMVFAISAG
FT                   INRLAPSTAQLLFWVFSALMGVSLSSIFLVYTHTSIVRVFFITAATFGALSLYGYTTKR
FT                   DMTGFGSFLFMGLIGIVLASLVNLFLASSMLQFIVSVIGVFVFAGLTAWDTQRLKNEYI
FT                   YGYASAGGDIAERAAITGALSLYLNFINLFTLLLQLLGQRD"
FT   gene            complement(403372..405942)
FT                   /locus_tag="BRADO0398"
FT   CDS_pept        complement(403372..405942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0398"
FT                   /product="putative ABC transporter, permease protein"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74346"
FT                   /db_xref="GOA:A4YKC0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74346.1"
FT                   /translation="MSTMAEPIPGRRVAALPARYALRELRGGLRGFYVFIACIALGVLA
FT                   IAGVGSVAASLNDGLVREGRTLLGGDVAFSLFQREAKPEEIAFLRSRGRVSLAATLRAM
FT                   VRAGDSKLALVELKAVDNAYPLLGKAELRPDLPIADVLAERDGVFGAAADPALLARLDI
FT                   KVGDIVNIDTVRFQIRSALQAEPDKLSGGIGLGPRFLISEEGLRATPLLQPGSLVRWTY
FT                   RVRLPDNATDDRAAAALIADTRETLPQAGWEIRSRSNASPQLERTIGRFTQFLTLVGLA
FT                   ALLVGGVGVANAVKSHVDRRTEVIAAFKALGATSRDVFGIYLIQVMVLATIGSIIGLCA
FT                   GAALPFVIVGLFGKILPLPVIPAVHPDELALSFLYGLLTALAFGLWPLGRVRDVPVAAL
FT                   FREAVIAEWHRPRWSYLALIAGTVALLIAVVVGLSYDKKIAAVFVVAAALVFVLLRGIA
FT                   AIVMAVARALPRSRFPMLRLAVSNIYRPGALTPSVVLSLGLGLAVLVTITQIDGNLRRQ
FT                   FLAQLPEQAPSFFFVDVPSGQASRFRDFLRELAPQSTVDDVPMLRGRIVSARGVRAEDL
FT                   KATADTEWVLQSDRGLTYTGEIPKGSKIVEGEWWGDTYSGPPLVSIEKRIADGLGLRLG
FT                   DDIVVNVLGRDITAKIGNMRTIDWQGLGINFVLVFSPNAFKGAPHTHVATLTESRSDAA
FT                   EDARVIRKVADAFPMVTSVRVREVMETVGSVVSNLALAIRGASAVTLISAILVLGGALA
FT                   AGHRHRVYDAVILKTLGATRLRLLGAYALEYLMIGFATAAFGVIAGSVSAWLIVTRLMT
FT                   LSFVWQAGSAALVVLAALVVTVGLGLAGTLLALNQKPATVLRNL"
FT   gene            complement(405939..406646)
FT                   /locus_tag="BRADO0399"
FT   CDS_pept        complement(405939..406646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0399"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74347"
FT                   /db_xref="GOA:A4YKC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74347.1"
FT                   /translation="MAGTAPDTITISNVNLSLGTGAARVHILKDISLRVGQGETIGLIG
FT                   PSGSGKSTLLMVMAGLERPDSGEVVVNGTAFNALDEDALARFRGRQVGIVFQSFHLIPT
FT                   MTALENVAVPLELAGHSGAAERAARELDSVGLGHRLQHYPTQLSGGEQQRVALARALAP
FT                   DPAILVADEPTGNLDEATGRQIVDLLFTKHAERGMTLVLVTHDSGLAHRCDRVVRLRSG
FT                   RIEADGAHEPADA"
FT   gene            406729..407361
FT                   /gene="tesA"
FT                   /locus_tag="BRADO0400"
FT   CDS_pept        406729..407361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="BRADO0400"
FT                   /product="multifunctional: acyl-CoA thioesterase I;
FT                   protease I; lysophospholipaseL(I)"
FT                   /function="1.7.1 : Unassigned reversible reactions"
FT                   /function="7.2 : Periplasmic space"
FT                   /EC_number="3.1.2.-"
FT                   /EC_number="3.1.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8098033, 1864840; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74348"
FT                   /db_xref="GOA:A4YKC2"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74348.1"
FT                   /translation="MHILVLMLALMTAGPAFAGTEAGKPIKLVVLGDSLSAGLGLSASD
FT                   SFPSKLQKALQAKGLAIDLTNAGVSGDTSSGGRDRLDWSVADGTEAVIVELGANDALRG
FT                   IDPSVTRQALTEIVKRLKARGIAVMLCGMLAPPNYGSDYAVKFNAIYPDLAKEFDVPLY
FT                   PFFLDGVAADPKLNQADGIHPTAAGVDIIVSRMLPTVEAFLRPLRGQ"
FT   gene            407568..408107
FT                   /locus_tag="BRADO0401"
FT   CDS_pept        407568..408107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0401"
FT                   /product="putative 2'-5' RNA ligase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74349"
FT                   /db_xref="GOA:A4YKC3"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74349.1"
FT                   /translation="MPRLFTGLEIPAEVGQTLSTLRGGLPGARWIDPENYHVTLRFIGD
FT                   IDGASANEIAAMLWRVNRKPFEVTVQGLSSFGGRKPRAVVANIAPSRPLIELQAELERM
FT                   MQRIGLDPEGRKFVPHVTLARLHDASSQDVADYLSVRGYFPSRVFMAERFVLFSSRAST
FT                   GGGPYVVEDAYDLCAA"
FT   gene            408263..409444
FT                   /locus_tag="BRADO0402"
FT   CDS_pept        408263..409444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0402"
FT                   /product="putative ATPase (yhcM) AFG1 family"
FT                   /function="1.7.1 : Unassigned reversible reactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74350"
FT                   /db_xref="GOA:A4YKC4"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74350.1"
FT                   /translation="MLSTPSDAFRAQYQSLVDTGAIEADPAQAEVADALAALERRLSTY
FT                   KPARKQSLFGRLFSDKSEPPSGLYVHGEVGRGKTMLMDLFFQTCPVEHKRRAHFHEFMA
FT                   EVHERIYGYRQNIARGELGDADVIGLTAQAIFDQAWLLCFDEFHVTDIADAMILGRLFA
FT                   KLFELGTVVVATSNVAPEDLYKGGLNRALFLPFIKQIADHMDVVRLDARTDFRLEKLAG
FT                   VKMWLVPADVDARAALDKAWGRLTGNARCKPRDMTIKGRILHVPCSANGVARFGFADLC
FT                   EKPLAASDYLRLAHDYHTILIDHVPVMDYAERNAAKRFITLIDTLYDNAVKLIASAEAD
FT                   PISLYVATEGIEAMEFKRTSSRLIEMGSESYLALPHGRKDSAASGTSTGLVET"
FT   gene            409671..410639
FT                   /gene="mdh"
FT                   /locus_tag="BRADO0403"
FT   CDS_pept        409671..410639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="BRADO0403"
FT                   /product="malate dehydrogenase"
FT                   /function="1.1.1.20 : Glycol degradation"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.7.8 : Gluconeogenesis"
FT                   /function="1.7.21 : Glyoxylate degradation"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /EC_number="1.1.1.37"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9190829, 1507230; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74351"
FT                   /db_xref="GOA:A4YKC5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74351.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHLVGLKELGDVVMFDIAEGVPQGKAL
FT                   DIAQSSPVDGFDAHYTGANSYEALDNAKVCIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGLPAKKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLTKYSTVAGIPLPDLVKMGWTSQARIDEIVDRTRNGGAEI
FT                   VNLLKTGSAYYAPAASAIAMAESYLRDKKRVLPCAAYLNGEFGVKDMYVGVPVVIGSKG
FT                   VERIVEIELAGKDREAFDKSVAAVQGLVDACKKIAPDLLGR"
FT   gene            410766..411962
FT                   /gene="sucC"
FT                   /locus_tag="BRADO0404"
FT   CDS_pept        410766..411962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="BRADO0404"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /EC_number="6.2.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3002435, 8144675; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74352"
FT                   /db_xref="GOA:A4YKC6"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74352.1"
FT                   /translation="MNIHEYQAKALLHEFGVPISKGVPVLRPEDADAAAKTLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVNTFARQMLGATLVTVQTGPDGKQVN
FT                   RLYIEDGSDIDKEFYLSLLVDRETSKVAFVVSTEGGVNIEDVAHETPEKIVTFSVDPAT
FT                   GVMGHHGRAVAKALKLSGDLAKQAEKLTTQLYNAFVAKDMAMLEINPLVVTKQGQLRVL
FT                   DAKVSFDSNALFKHPEVVALRDETEEDAKEIEASKYDLNYVALDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMEPANFLDVGGGASKEKVAAAFKIITADPNVKGILVNIFGGIMKCDVIAE
FT                   GVVAAVKEVGLKVPLVVRLEGTNVDLGKKIISESGLNVLPADNLDDAAQKIVKAVKGG"
FT   gene            412018..412902
FT                   /gene="sucD"
FT                   /locus_tag="BRADO0405"
FT   CDS_pept        412018..412902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="BRADO0405"
FT                   /product="succinyl-CoA synthetase, alpha subunit,
FT                   NAD(P)-binding"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /EC_number="6.2.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3002435, 8144675; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74353"
FT                   /db_xref="GOA:A4YKC7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74353.1"
FT                   /translation="MSILIDKNTKVICQGFTGKNGTFHSEAAIAYGTKMVGGTSPGKGG
FT                   STHLGLPVFDTVKEAREATGADASVIYVPPPGAADAICEAIDAEVPLIVCITEGIPVLD
FT                   MVRVKRSLVGSKSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVF
FT                   QTTSEGLGQTTAVGIGGDPVKGTEFIDMLEMFLADPKTESIIMIGEIGGSAEEDAAQFI
FT                   KDEAKRGRKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGDAGSKTAAMEAAGITVSPSP
FT                   ARLGKTLVEKLKS"
FT   gene            413007..416000
FT                   /gene="sucA"
FT                   /locus_tag="BRADO0406"
FT   CDS_pept        413007..416000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="BRADO0406"
FT                   /product="2-oxoglutarate decarboxylase, component of the
FT                   2-oxoglutarate dehydrogenase complex, thiamin-binding"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /EC_number="1.2.4.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8981998, 6376123; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74354"
FT                   /db_xref="GOA:A4YKC8"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74354.1"
FT                   /translation="MIGRIEITRTSPMSRQDANAAFALSSFLQGTNATYIDEIYARYEK
FT                   DPSSVDADWQEFFKSLKDAPADVQKNASGPSWERSNWPVAPRDELTSALDGNWAVVEKK
FT                   VGEKIAAKAQTKGVELSPADVNQATRDSVRALMLIRAYRMRGHFHAKLDPLGIEAPRNR
FT                   EELDPRSYGFTESDYDRKIFLDHVLGLEYGSLREIVTICERTYCQTLGVEFMHISNAAQ
FT                   KAWIQERIEGPDKEISFTREGRRAILQKLVESEGFEKFCDVKFTGTKRFGLDGGESLIP
FT                   ALEQIIKRGGNLGVKEIVLGMPHRGRLNVLTQVMGKPHRALFHEFKGGSANPDAVEGSG
FT                   DVKYHLGASSDREFDGNRIHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDPPDMRNSVL
FT                   PLLMHGDAAFAGQGVVAECFALSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSD
FT                   VAKMIDAPIFHVNGDDPEAVVFAAKVATEFRQKFHKPVVIDMFCYRRHGHNEGDEPAFT
FT                   QPVMYKKIAGHPSTLEIYSKRLVAEGVMTEGEVEKAKADWRARLDAEFEAGTSYRPNKA
FT                   DWLDGKWAGLKSADQEEEARRGVTGVEIDRLKEIGRKITKVPDGFRVHRTIQRFLENRA
FT                   KAIDSGLGLDWATGEALAYCSLLLEGHKVRLSGQDSERGTFSQRHSVLIDQEDESRYTP
FT                   FNHLAPEQGHFEVINSLLSEEAVLGFEYGYSLAEPTALTLWEAQFGDFANGAQVLFDQF
FT                   ISSGERKWLRMSGLVCLLPHGYEGQGPEHSSARLERYLQMCAEDNMQVVYPTTPANYFH
FT                   VLRRQLHREIRKPLIVMTPKSLLRHKRAVSRLEELAKGTTFHRILYDDAQMQADDKTRL
FT                   VPDDQIRRIVLCSGKVYYDLYDEREKRGLNDIYLMRIEQLYPVPLKALVAELGRFKNAE
FT                   VVWCQEEPRNMGAWYFIEPYIEWVLNQTGGKSKRARYAGRAASAATATGLMSKHLAQLK
FT                   ALLDEALN"
FT   gene            416144..417385
FT                   /gene="sucB"
FT                   /locus_tag="BRADO0407"
FT   CDS_pept        416144..417385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="BRADO0407"
FT                   /product="Dihydrolipoamide succinyltransferase component of
FT                   2-oxoglutarate dehydrogenase complex (E2); acid-inducible"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /EC_number="2.3.1.61"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8867378, 8780784, 8981998, 6376123; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74355"
FT                   /db_xref="GOA:A4YKC9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74355.1"
FT                   /translation="MTDIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLGEIIAKDGETVAVGALLGQINDGAAAAKPAAAAPAPAPAKPAAAAPAPA
FT                   PAPAKALPADTPQAPSVRKLSAESGVDATTVPGSGKDGRVTKGDMLAAIERAASAPTPV
FT                   NQPAASVQVRAPSPADDAAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTHVM
FT                   ALRSQYKDVFEKKHGSKLGFMGFFTKAVVQALKDIPAVNAEIDGSDLIYKNYYHIGVAV
FT                   GTDKGLVVPVVRDCDHKSIADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSL
FT                   MSTPILNAPQSGILGMHKIQERPMVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRV
FT                   KESLEDPARLVLDL"
FT   gene            417454..418200
FT                   /locus_tag="BRADO0408"
FT   CDS_pept        417454..418200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0408"
FT                   /product="putative oxidoreductase (YgfF), NAD(P)-binding
FT                   domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74356"
FT                   /db_xref="GOA:A4YKD0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74356.1"
FT                   /translation="MTDRVAVITGGSRGIGRATAIAAVSRGFKIVVGYASNEAAAQSTV
FT                   AAIEAKNGKAIAVKCDVGREHDILALFKAADKFGTLGALINNAGIVGPTTRVDEMSAER
FT                   IERLMAVNVTGSILCAREAVKRMSTRHGGQGGVIINLSSVAAKLGSPNTYVDYAASKGA
FT                   IDSFTVGLGHEVANEGIRVAAIRPGLIDTDIHASGGEPDRAHRLAPMVPMKRVGTAEEI
FT                   ANAIVWLLSDEASYVTSAILDVSGGR"
FT   gene            418246..419649
FT                   /gene="lpd"
FT                   /locus_tag="BRADO0409"
FT   CDS_pept        418246..419649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="BRADO0409"
FT                   /product="dihydrolipoamide dehydrogenase,
FT                   FAD/NAD(P)-binding, component of the 2-oxoglutarate
FT                   dehydrogenase and the pyruvate dehydrogenase complexes"
FT                   /function="1.1.1.20 : Glycol degradation"
FT                   /function="1.1.3.5 : Glycine cleavage"
FT                   /function="1.3.3 : Pyruvate dehydrogenase"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /function="1.7.21 : Glyoxylate degradation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.8.1.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2211531; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74357"
FT                   /db_xref="GOA:A4YKD1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74357.1"
FT                   /translation="MATYDLVVIGTGPGGYVCAIRAAQLGMKVAVVEKNATLGGTCLNV
FT                   GCMPSKALLHASELFEEAGHSFAKMGIKVSAPEVDLPSMMNFKQQGIDGNVKGVEFLMK
FT                   KNKIDVLQGKGKILGTGKVQVTGNDGAAQTVETKNIVIATGSDIARLKGIEIDEKRIVS
FT                   STGALALDKVPSSLLVVGAGVIGLELGSVWRRLGAKVTVVEFLDRILPGMDLEIAKQFQ
FT                   RILEKQGFAFKLGAKVTGVDTSGAKLSATIEPAAGGAAEKIDADVVLVAIGRVPYTDGL
FT                   GLQEAGVALDNRGRVQIDHHFATSVPGVYAIGDVVAGPMLAHKAEDEGVACAEILAGQA
FT                   GHVNYDVIPGVVYTTPEVASVGKTEDELKQAGIVYTVGKFPFTANGRSKVNQTTDGFVK
FT                   ILADAKTDRVLGAHIIGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAAL
FT                   AVGKRAIHM"
FT   gene            419750..420319
FT                   /locus_tag="BRADO0410"
FT   CDS_pept        419750..420319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0410"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74358"
FT                   /db_xref="GOA:A4YKD2"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74358.1"
FT                   /translation="MPGAWRRWRPMLRRLLQPFWILLAIIFLIEAWLWDHLEPIVARIV
FT                   AAIPLRSLKRWLAARIETLSPALTLLVFIVPFVLLFPLKLVGMWLLMHHQWKLALLTIV
FT                   FGKMVGVGITAFIFDVTRHKLLQMGWFAWLYESVLTLRRRAAELVDPIKQRIRDIVRDV
FT                   LRTNTSGWSSRVLRQILRFRRSVQAR"
FT   gene            complement(420527..421117)
FT                   /locus_tag="BRADO0411"
FT   CDS_pept        complement(420527..421117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0411"
FT                   /product="conserved hypothetical protein, putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74359"
FT                   /db_xref="GOA:A4YKD3"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74359.1"
FT                   /translation="MSAHESMEHAEHAEHASGENKKIALLIAVIALFLALSETLGKGAQ
FT                   TESISKNVEASNLWAFFQAKTVRRTVVQTAAEQGKLNLPALPDDASKAALQKQIDDWQK
FT                   NAARYRSEPETGEGSEQLAERAKHAEHERDEATAKYHHYELASAAFQIGIVLASATIIT
FT                   GMIVLAWVSGGLALVGIAMTLLGLFQPHLLHLH"
FT   gene            complement(421199..422182)
FT                   /gene="xerC"
FT                   /locus_tag="BRADO0412"
FT   CDS_pept        complement(421199..422182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="BRADO0412"
FT                   /product="Tyrosine recombinase (integrase/recombinase)"
FT                   /function="2.1.3 : DNA recombination"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11832210; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74360"
FT                   /db_xref="GOA:A4YKD4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74360.1"
FT                   /translation="MAKTAEATDNAPDLPDLIGADDGVVRAMTQWLAHLRSERRLSPKT
FT                   VEAYARDLRQCLQFLCTHWGEPVTLPRFAALEASDIRAFMAMRRADDIAGRSLMRTLAG
FT                   LRSFGRFLEREGQGKVGALAGVRAPKIAKSLPKPLPMDSAKRLTDADERAGESRETWVL
FT                   ARDAAVMALLYGSGLRISEALGLKRREVPRPGEGDVLIVTGKGNKTRMVPVLQNVLALI
FT                   DEYARLCPYPLPAEGPMFLGAKGGPLSPRIIQLAMERLRGALGLPDSATPHALRHSFAT
FT                   HLLSRGGDLRAIQELLGHASLSTTQVYTGIDSERLLQVYASAHPRR"
FT   gene            422525..424735
FT                   /gene="priA"
FT                   /locus_tag="BRADO0413"
FT   CDS_pept        422525..424735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BRADO0413"
FT                   /product="Primosomal protein N' (replication factor Y)"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2162050; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74361"
FT                   /db_xref="GOA:A4YKD5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74361.1"
FT                   /translation="MDRPTDLFPGATSAAGVVDVLVPVALDHTYSYRVPRGMALKPGDV
FT                   VGVPLGPREVLAVVWAENANPDPRLHNRLKDVSEKLDVPPLKPELRSLVDWVANYTLSP
FT                   RGMVLRMALRMGEHLGPERVRLGVRLVGEPPKRLTPARRRVIEAVSDGLLHGKSDLVRE
FT                   IGVSASVIDGLVDEGTLTVEAMPRVLPPPTPDPSFAQPEFFDAQLAGVEAMRALAACGT
FT                   FNVALLDGVTGSGKTEVYFEAVAETVRRGRQSLILMPEIALTGQFLERFSRRFGVRPLE
FT                   WHSELTPRTRQRNWAAIAAGEAPVVVGARSALFLPYADLGLIVVDEEHDQAYKQDEGAH
FT                   YHARDMAVVRGHIAKFPVVLASATPSVETEVNARKGRYQRVALPSRFGGQHMPHIEAID
FT                   LRREPPPRGRYVSPRLAGHIRTAIERGEQALLFLNRRGYAPLTLCRACGHRFACTICDA
FT                   WLVDHRFRQRLVCHHCGFSMARPPTCPHCAAEESLVAVGPGVERLQEEAAALFPDARSM
FT                   VLSSDLITSIETMRAELTAIAEGRVDLIIGTQLVAKGHNFPRLNLVGVVDADLGLGNGD
FT                   PRAAERTWQLLNQVIGRAGREQGRGRGYLQTHQPEHPVMKALVACDREAFYTSEIEARE
FT                   RTGYPPFGRLASLIISAGDRPTAEGFARRLVASAPREEGVLLLGPAEAPLAVIKGRYRF
FT                   RLLLKSARNFDLSDYLRHWLAHAEKPKGNLKLEVDVDPQSFL"
FT   gene            complement(424855..425400)
FT                   /locus_tag="BRADO0414"
FT   CDS_pept        complement(424855..425400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0414"
FT                   /product="conserved hypothetical protein; putative rare
FT                   lipoprotein A (RlpA-like); putative secreted protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74362"
FT                   /db_xref="GOA:A4YKD6"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74362.1"
FT                   /translation="MLKLNNLSAGKIAGSRTALAVAVTLIVGGTATEASARSRHHHHHH
FT                   ARHHHHMARQAAQPAADSFSNGWSNNSSWMNSNASVAPTSGTGRTFSGMASYYGNESGS
FT                   RTASGQRMNANAMTCAHRSLPFGTKLRVTHGGNSVIVTVNDRGPFIRGRVLDLSTGAAR
FT                   AIGLTRSGVGRVTAEVVS"
FT   gene            426115..426612
FT                   /gene="atpH"
FT                   /locus_tag="BRADO0416"
FT   CDS_pept        426115..426612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="BRADO0416"
FT                   /product="ATP synthase subunit delta, membrane-bound, F1
FT                   sector"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9164460; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74363"
FT                   /db_xref="GOA:A4YKD7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74363.1"
FT                   /translation="MARDEKSVDAVKADLDKFNALLDESADLKRLVRSPVFGADTQLKA
FT                   LNAVLDKAGIAGVAANVLRVLTTNRRLFAVADVIRAFNALVAKYKGEATADVTVAEPIS
FT                   DKNLDALKAALKTVTGKDVALNVKVDPAIIGGLVVKLGSRMIDSSLRTKLNSIKHAMKE
FT                   AG"
FT   gene            426612..428141
FT                   /gene="atpA"
FT                   /locus_tag="BRADO0417"
FT   CDS_pept        426612..428141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BRADO0417"
FT                   /product="ATP synthase subunit alpha, membrane-bound, F1
FT                   sector"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2903146; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74364"
FT                   /db_xref="GOA:A4YKD8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74364.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRAIVDAPVGKGLL
FT                   GRVVDALGNPIDGKGPIQFTERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNAQPDEKIKLYCVYVAVGQKRSTVAQFVKVLEE
FT                   QGALEYSIVVAATASDPAPMQYLAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQM
FT                   SLLLRRPPGREAYPGDVFYLHSRLLERAAKLNETQGAGSLTALPVIETQANDVSAYIPT
FT                   NVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYRE
FT                   MAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGFLDGLPL
FT                   NKVRAFEDGLLSLLRGKHADLLNTIRDTRDLSDDSAAKLKAAVEGFAKTFS"
FT   gene            428298..429176
FT                   /gene="atpG"
FT                   /locus_tag="BRADO0418"
FT   CDS_pept        428298..429176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="BRADO0418"
FT                   /product="ATP synthase subunit gamma, membrane-bound, F1
FT                   sector"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74365"
FT                   /db_xref="GOA:A4YKD9"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74365.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQLAAEAARPY
FT                   AEKMDAVISNIAAASAGSPASSKLLAGTGRDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RALALMNQGKDVKFFCVGRKGYEQLRRQFEKQIIAHVDLRSVRQIGFVHAEDIAKQVIA
FT                   RFDAGEFDVCTLFYSRFKSVIAQIPTAQQIIPLVVEAPAANAAPVALYEYEPEEDEILS
FT                   ALLPRNVGVQIFRALLENNASFYGAQMSAMDNATRNAGEMIRKQTLVYNRTRQAMITKE
FT                   LIEIISGAEAV"
FT   gene            429266..430708
FT                   /gene="atpD"
FT                   /locus_tag="BRADO0419"
FT   CDS_pept        429266..430708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BRADO0419"
FT                   /product="ATP synthase subunit beta, membrane-bound, F1
FT                   sector"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2889623; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74366"
FT                   /db_xref="GOA:A4YKE0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74366.1"
FT                   /translation="MATAANQIGRVTQVIGAVVDVQFEGHLPAILNSLETKNGGNRLVL
FT                   EVAQHLGESTVRAIAMDTTEGLVRGQEVTDTGAPIRVPVGEGTLGRIINVIGEPIDEAG
FT                   PVKADNVRAIHQEAPTYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVAKAHGGYSVFAGVGERTREGNDLYHEFIESKVNADPHNPDPSVKSKCALVF
FT                   GQMNEPPGARARVALTGLTIAEDFRDKGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAV
FT                   GYQPTLATDMGALQERITTTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLSRS
FT                   IAEKGIYPAVDPLDSTSRMLSPLVVGEEHYAVARQVQQVLQRYKALQDIIAILGMDELS
FT                   EEDKLTVARARKVERFMSQPFHVAEIFTGSPGKFVELADTIKGFKGLVEGKYDHLPEAA
FT                   FYMVGTIEEAVEKGKKLAAEAA"
FT   gene            430809..431216
FT                   /gene="atpC"
FT                   /locus_tag="BRADO0420"
FT   CDS_pept        430809..431216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="BRADO0420"
FT                   /product="ATP synthase subunit epsilon, membrane-bound, F1
FT                   sector"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9331422; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74367"
FT                   /db_xref="GOA:A4YKE1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74367.1"
FT                   /translation="MATFHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATL
FT                   RPGILTVTTGGTQQKIIVLGGLAEISEKGLTILADVATSLKELDQTAFATEISGMEAKL
FT                   NEKQGDELDRAIERLDHFKTIQQQLNTTALH"
FT   gene            431384..433051
FT                   /locus_tag="BRADO0421"
FT   CDS_pept        431384..433051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0421"
FT                   /product="Putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74368"
FT                   /db_xref="GOA:A4YKE2"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74368.1"
FT                   /translation="MAGQIVLKRKIAAIFAADIAGYSRLVAEDEEETLRRLAAYREVVD
FT                   DFIARAGGRIFNTAGDAVLAEFPSAVEAVRCAIDIQESLRTRNMAYPPSRQMSYRIGIT
FT                   IGDVVERDGDLLGDGVNIAARLEGLADVGGICISRAVHEQVANKLSVQFADMGAREVKN
FT                   IPTPVHAYRVAMRREDGTYAAPQDKTKPPSVAKRLLKAGVAIVVLMVAVGVGTALYLDH
FT                   RDPPSSQPDAAKSAAAALSRLSAKPGSSGGATSPVSLSPEPAAATPAPQPSAQPSPIVT
FT                   AEKFVPDAVPFVGERTRIALARDYVPAPGAKAFATTVNGVSAYVTGQPSEEAAKAAALE
FT                   QCHQRAESSTSLHKCELYAVGDTIVYPHGKPPLPPLPWVRHDPTTERAFNAAEMPLARD
FT                   PGRARLEANYGNARRTKAIALGPGGQFVYFVGGDLADDVVRRSLESCGAQAGTPCLIVA
FT                   LDDAFVVPVPTVMKATGFFHAASHTAIAADARDEVARRLAAASSGWNAIAVGTSGHPGY
FT                   GLNGDREETAIGGALADCSTRDQDCRVIAIGPFTVEDN"
FT   gene            complement(433349..433858)
FT                   /gene="nudH"
FT                   /locus_tag="BRADO0422"
FT   CDS_pept        complement(433349..433858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="BRADO0422"
FT                   /product="(Di)nucleoside polyphosphate hydrolase (Invasion
FT                   protein A)(Nudix family)"
FT                   /function="5.10 : Defense/survival"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7890422, 9880487; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74369"
FT                   /db_xref="GOA:A4YKE3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74369.1"
FT                   /translation="MDASMTETRPYRPNVGIALLNADGLVFLGRRFRDDGPEIVLPGLE
FT                   WQMPQGGVDAGEDLQAAARRELWEETGIRDADILAETDWLTYEFPPFEDPNHRLARFRG
FT                   QRQKWFAMRFTGREADIDPVTPRNGQPAEFDAWRWERLARVPDLVVPFRREVYRAVAEA
FT                   FAHLAA"
FT   gene            complement(433984..434490)
FT                   /gene="nudH"
FT                   /locus_tag="BRADO0423"
FT   CDS_pept        complement(433984..434490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="BRADO0423"
FT                   /product="(Di)nucleoside polyphosphate hydrolase (Invasion
FT                   protein A)(Nudix family)"
FT                   /function="5.10 : Defense/survival"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7890422, 9880487; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74370"
FT                   /db_xref="GOA:A4YKE4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74370.1"
FT                   /translation="MTRYEDLPYRTCVGIALINSEGLVFIGRRAGGIEHVDDTHVWQMP
FT                   QGGVDPGEDAWEAAKRELYEETSVRSVEKLAEIDDWLTYDIPRTVAGRAWKGRYRGQRQ
FT                   KWFALRFTGKDSEIDVEHPGGGHHKAEFITWRWEPLQNLPTLIVPFKRPVYERVAKEFA
FT                   TLAGG"
FT   gene            complement(434572..435789)
FT                   /locus_tag="BRADO0424"
FT   CDS_pept        complement(434572..435789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74371"
FT                   /db_xref="GOA:A4YKE5"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74371.1"
FT                   /translation="MTETADELSAPLGQTETRRRRRIRLPFTALQALAMVLGLILVVFA
FT                   GFALFGDNPLGGEPVARVAINEGAKPGDKPDAAAKPDAKSDAKSEHGAAAAAKPDGERK
FT                   TITIIDGSSGARQEVAIGAGGRDTPEPGAAPANPMPGVDPRLLEKSRYGMIPVMTDGLK
FT                   SFTAYAADADRAKAARMPAVAIVIGGLGIGAAKTVDAIMKLPPAVTLAFTPYGSDPSKL
FT                   AERARAQRHEILLQVPMEPYDYPDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVGIG
FT                   NFMGARFVATETAMQPIVNEAAKRGLALFDDGAAPRSVAASLATGRAVPFAKGDVAIDA
FT                   VPTAVEIDNALAKLESLAKERGVAVGTASALPVSIDRIGTWIKGLDRKGILLVPLTTAM
FT                   LKSKSN"
FT   gene            complement(436005..437264)
FT                   /gene="ctpA"
FT                   /locus_tag="BRADO0425"
FT   CDS_pept        complement(436005..437264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="BRADO0425"
FT                   /product="Carboxy-terminal-processing protease precursor
FT                   (C-terminal-processing protease)"
FT                   /function="3.1.3.4 : Proteases, cleavage of compounds"
FT                   /EC_number="3.4.21.102"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9141685, 8034700, 8058761; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74372"
FT                   /db_xref="GOA:A4YKE6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74372.1"
FT                   /translation="MGSTARAATSDTYRQLNLFGDVFERVRSDYVEKPDDSKLVESAIS
FT                   GMLSGLDPHSSYMDAKSFRDMQVQTRGEFGGLGIEVTMEDGLIKVVSPIDDTPASKAGI
FT                   LANDIITNLDDEAVQGLTLNQAVEKMRGPVGTKIKLKVVRKGTDNPLDITLTRDNIRVR
FT                   SVRSRPEGDDIAYIRITTFNEQTTEGLKKSIADLQTSIGDKLKGYIIDLRNNPGGLLEE
FT                   AVTVSDAFLERGEIVSTRGRNAEETQRRAAHAGDLTKGKPVIVLINGGSASASEIVAGA
FT                   LQDHKRATLVGTRSFGKGSVQTIIPLGAGNGALRLTTARYYTPSGKSIQAKGIVPDIEV
FT                   LQDVPEELKSRTDTKGEASLRGHLKNDGDEKTGSQSYVPPDAKDDKALKMAADLLHGIK
FT                   NSANTPAPTEKASADKPKAN"
FT   gene            complement(437348..438718)
FT                   /locus_tag="BRADO0426"
FT   CDS_pept        complement(437348..438718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0426"
FT                   /product="conserved hypothetical protein; putative secreted
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74373"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74373.1"
FT                   /translation="MVFARPLSLSPIPARRGWARRASLIALLMALSGWPATAQTGLRPS
FT                   ITGTPSPNPPTPEQIKQREQELEAARAAQKAAAEAQERLKADIAALGEDRGKLNQQLID
FT                   VAAQVRSVEIRVAEAETRLRGLDGREQDLRTSLEARRTEIIEVLAALQRAGRRTPPALL
FT                   VRPEDALQSLRTAMLLGSVVPEMRGRAEKLSSDLGELVTIRKTIASERDKLATDRDKLR
FT                   ADQTRLAALVEERQRKQASAEKDMEAESARAAMLAQQIDSLQTLISTMELDLKSAAKAA
FT                   STASLQGVPVNAKPDANALRNPTRKAPAIAFASTKGMLTFPVNGTKIREFGASDGAGGS
FT                   DKGISLATRPGAQVTTPCDGWVVYAGPFRSYGQLLILNAGGGYHVLIAGMERISVNIGQ
FT                   FVQTGEPVATMGITSQVASILATNASQPVLYVEFRKDGTPIDPGPWWAANEGEKVRG"
FT   gene            complement(438752..439240)
FT                   /locus_tag="BRADO0427"
FT   CDS_pept        complement(438752..439240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0427"
FT                   /product="conserved hypothetical protein YbeA"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74374"
FT                   /db_xref="GOA:A4YKE8"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74374.1"
FT                   /translation="MHMRLVVIAIGRLKQGPERQLAERYRERFDDIGRKLGFRGLDIHE
FT                   IPESRARDAATRMAEEAAAIAAAIPDNSMLVCLDERGHNIDSATFAGHIGRWRDEGVAA
FT                   TAFVIGGADGLSPELRRKAKLGVAFGAATWPHQIVRVLLLEQIYRTATILAGHPYHRA"
FT   gene            complement(439281..439577)
FT                   /locus_tag="BRADO0428"
FT   CDS_pept        complement(439281..439577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0428"
FT                   /product="conserved hypothetical protein; plant
FT                   iojap-related protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74375"
FT                   /db_xref="GOA:A4YKE9"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74375.1"
FT                   /translation="MKAEETVTIDLHGKSAYSDYMVITTGRSNRHVGSIAENVAKGLKE
FT                   AGAKKLHIEGLPNCDWVLIDSGDVIVHVFRPEVREFYNLERMWTQGPKPAKTL"
FT   gene            complement(439956..440534)
FT                   /locus_tag="BRADO0429"
FT   CDS_pept        complement(439956..440534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0429"
FT                   /product="putative nicotinate-nucleotide
FT                   adenylyltransferase (nadD-like)"
FT                   /function="1.5.3.7 : Nicotinamide adenine dinucleotide
FT                   (NAD)"
FT                   /EC_number="2.7.7.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74376"
FT                   /db_xref="GOA:A4YKF0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74376.1"
FT                   /translation="MRIGLLGGSFNPPHQAHRAISLFALKRLQLDRVWWLVTPGNPLKD
FT                   NGGLHALAERAAAARKVAADPRIEISCLESVIGTRYTADTIDYLRRRASRLRFVWIMGA
FT                   DNLAQFHRWQKWQHIAAQVPIAVVDRPPRSFRALNAPAARALARYRVAEADASRLADRA
FT                   APAWVYLTGLKMSLSSTGLRNPDGSWKSF"
FT   gene            complement(440646..441935)
FT                   /gene="proA"
FT                   /locus_tag="BRADO0430"
FT   CDS_pept        complement(440646..441935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="BRADO0430"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /function="1.5.1.4 : Proline"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.2.1.41"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74377"
FT                   /db_xref="GOA:A4YKF1"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74377.1"
FT                   /translation="MTAPLKAIDGSADLPQLMNDLAKRARAAARVLALAPAEQKNRALE
FT                   AMERRIRARADVIIAANAEDVAEAKAVGVTPSFVDRLTLTPARVAAMADGIAVVRGVAD
FT                   PVGVVTESWQRPNGMTIERVRVPLGVIGVIFESRPNVAADAGVLCLKSGNAVILRGGSD
FT                   SFRSCRAIHECLVEGLREAGLPDTAITLVPTRDRAAVGLLLSGLNGGVDVIVPRGGKSL
FT                   VARVEAEARVPVFAHLEGVNHVYVDGAADLDMAKSIVLNAKMRRTGVCGAAETLLIDRA
FT                   SQDKIKPLVDMLIGAGCEVRGDEAVRAADARVTPANNEDWDTEYLDAIIAAKVVDGVDG
FT                   AIAHIHAHGSHHTDAIVTQDNKVADKFLNEVDSAIVLHNASTQFADGGEFGFGAEIGIA
FT                   TGKFHARGPVGVEQLTSFKYRIHGTGQTRP"
FT   gene            complement(442014..443150)
FT                   /gene="proB"
FT                   /locus_tag="BRADO0431"
FT   CDS_pept        complement(442014..443150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BRADO0431"
FT                   /product="gamma-glutamate kinase"
FT                   /function="1.5.1.4 : Proline"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.2.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74378"
FT                   /db_xref="GOA:A4YKF2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74378.1"
FT                   /translation="MAPRLENFRRIVVKVGSSLLVDSEAGEVRAAWLTALAADIARLHG
FT                   RGCELLVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIALARIWSEVLGAYGIGAG
FT                   QILVTLQDTEERRRYLNARSTIAKLLEWRAVPVINENDTVATAEIRYGDNDRLAARVAT
FT                   MASADLLVLLSDIDGLYTAPPAQDPNAKLIPVVESITADIEGIAGGAASEFSRGGMKTK
FT                   IEAAKIATTGGTHMLIASGKIEHPLAAIANGGRCTWFLTPANPVTSRKRWIAGSLEPKG
FT                   TLTIDAGAVAALRAGKSLLPAGVIKVDGQFARGDAVVVRGPDTDEIGRGLVAYDADDAE
FT                   RIKGRSSPDVAVILGMSGRAEMIHRDDLVIGPAGVGPA"
FT   gene            complement(443284..444354)
FT                   /gene="obgE"
FT                   /locus_tag="BRADO0432"
FT   CDS_pept        complement(443284..444354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="BRADO0432"
FT                   /product="GTP-binding protein with nucleoside triP
FT                   hydrolase domain; DNA-binding GTPase involved in cell
FT                   partioning; multicopy suppresssor of ftsJ(rrmJ)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74379"
FT                   /db_xref="GOA:A4YKF3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74379.1"
FT                   /translation="MKFLDEAKVYVRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDV
FT                   VIEAVDGLNTLIDYRYQQHFKAQKGENGMGKDRHGAGGKSIVLKVPVGTQIFDEDRETL
FT                   IHDFTAVGERFVLAEGGNGGFGNAHFKSPTNRAPRHANPGQPGEERWIWLRMKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNADGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHVERCRVLLHLVDATCEHAGKAYKTVRHELEAYGGDLTDKIEIVALNKI
FT                   DAVDPDELKKQRDRLKRAAKKTPILISGATGEGVKEALRKLADVVGEQPVSSKAKNAVE
FT                   SAATEEPWAAPVPPQG"
FT   gene            444556..445473
FT                   /locus_tag="BRADO0433"
FT   CDS_pept        444556..445473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0433"
FT                   /product="putative permease of the drug/metabolite
FT                   transporter (DMT) superfamily"
FT                   /function="4.2.A.7 : The Drug/Metabolite Transporter (DMT)
FT                   Superfamily"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74380"
FT                   /db_xref="GOA:A4YKF4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74380.1"
FT                   /translation="MSVLSRISTANDERSARLAGIGLMLLSIAMFSFGDALGKFLVSTY
FT                   AVGQLLWLRACAALLLLAPFIWRNRAAFVQLERPWLQLVRVILSTLEVAAFFLATVYLP
FT                   LADVITYYLAGPIFVTALSALVLREHVGWRRWTAILIGFCGVLIALRPSAQTFSLPALI
FT                   ALGGSLSFAVLMLITRSLRATPDIVMASSQFVGTFLLGAAMSAFGWVTPTPGSLVMFAA
FT                   AGLISVTALFCVNRSLKLAPASVVVPYQYTMIVWAVLFGFVVFGDVPHPATIIGAIIII
FT                   GAGLYIYLRERSLGQGAGSVNPPV"
FT   gene            complement(445629..446216)
FT                   /locus_tag="BRADO0434"
FT   CDS_pept        complement(445629..446216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0434"
FT                   /product="conserved hypothetical protein; putative
FT                   acetyltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74381"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74381.1"
FT                   /translation="MLQDITTPTLREARPCVLETPRLTLRPPVLADVKDIARLADDRRI
FT                   AENTRRLPHPYSEVDAARFVRALEQSGETAFLIAHLDAPIGMVGINRPASGRAELGYWL
FT                   GVEHWGRGFGTEAARAAIDDFFERGEDNVLIGHARVSNPASRNILEKCGFQWTGVELHR
FT                   FEVIGSSAPVDAFRLTRGVWASLKAWANAGRR"
FT   gene            complement(446355..446624)
FT                   /gene="rpmA"
FT                   /locus_tag="BRADO0435"
FT   CDS_pept        complement(446355..446624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BRADO0435"
FT                   /product="50S ribosomal subunit protein L27"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1225626, 10094780; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74382"
FT                   /db_xref="GOA:A4YKF6"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74382.1"
FT                   /translation="MAHKKAGGSSRNGRDSKGKRLGIKAFGGERVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKIEGVVEFHDRANRTFISVRPVAAQAAE"
FT   gene            complement(446751..447143)
FT                   /gene="rplU"
FT                   /locus_tag="BRADO0436"
FT   CDS_pept        complement(446751..447143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BRADO0436"
FT                   /product="50S ribosomal protein L21"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74383"
FT                   /db_xref="GOA:A4YKF7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74383.1"
FT                   /translation="MRTMFAVIKTGGKQYRVAPDDVLEIGKIDGEPGTIVQLNEVLVVG
FT                   GDTPVLGIPAVAGASVAVEVLDHKRGPKVIAFKKRRRKNSRRKRGYRDELTLIRVSEIL
FT                   TDNAKPTKGPRPKKAKAEAPAADAAE"
FT   gene            447422..448606
FT                   /locus_tag="BRADO0437"
FT   CDS_pept        447422..448606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0437"
FT                   /product="conserved hypothetical protein; putative
FT                   glucokinase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74384"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74384.1"
FT                   /translation="MADDVMTTTGIARHGAARLPSVEIDSFNIELKDEDGFLGDRASKG
FT                   AFRKILERWRKPLRKSGKDPFGDEDSETISKKALDAILVGDDTEASAVVHSAIEEFAQE
FT                   LAHVTRRFLRTKAWAKTECIVVGGGFRDSRLGELAIARTEIILKDEGFGVELEPIRYHP
FT                   DDAGLIGALHLAPSWIFEAHDSILAVDIGGTNIRCGVVETAWKKTPDLSKASVWKSDLW
FT                   RHADDEPTREGAVKRLAKMLKGLIEEADAEGLRLAPFIGIACPGVINEDGSIEKGAQNL
FT                   PGNWESSKFNLPASLVEAIPMIGDHDTAVLMHNDGVVQGLSEVPFMQEFERWGVLTIGT
FT                   GLGNARFTNRRKDNGRKDKDEKSKDEKSKDEKSKDEKAKDDKADDKKAAKKKKD"
FT   gene            449051..449140
FT                   /locus_tag="BRADOtRNA4"
FT   tRNA            449051..449140
FT                   /locus_tag="BRADOtRNA4"
FT                   /product="tRNA-Ser"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            450121..450939
FT                   /locus_tag="BRADO0438"
FT   CDS_pept        450121..450939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0438"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74385"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74385.1"
FT                   /translation="MISSTSVVDLIRPSPMYGSEVHWAQPTSPELSAVAISNLSVHQTT
FT                   LCLNYVPVDASFKLLVSDKGKISCPYNSLSVFWSNYFGGYERGTIFPFSIIINSVNWNP
FT                   GAPWSEQSVSGASQIERSSNALQSGASDLVDQVQVKSGMTLEEVAPLLGVTRRSLQHWR
FT                   KGKAISTRKERRLRALVDALSLLPAESPALRRRRLLERRPDGVRPYDLLAEGQFGAAHA
FT                   LMTGDEVRLPNSIKSVSPSLTAVTRLSTLSDGPSSVLGKLDVRRSARLKR"
FT   gene            450949..451845
FT                   /locus_tag="BRADO0439"
FT   CDS_pept        450949..451845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0439"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74386"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74386.1"
FT                   /translation="MPDAAAQLEVDKALLDWQQGDVILGADLPFSYLADVSRPITPEAE
FT                   EFAAVSPEGDSLAQIVVAAAGLVVTTQTCDVVRSCAERALVQVAALVQVDRATLDETKR
FT                   GFRPRFGYIPGVEAQGLLADFNAIMTIDKAVLTQTLAANRVRGCITDKDQRQFAEALSR
FT                   SLSRFAFPDDFVAAVKPIQKRIVEKHGKATKDKKGNPTGEGELLRKLCEIRVACFPSWD
FT                   AAENELTFYFVFESRRDIPADADTIVEALLQRFKPVGLYSDPTFRIVTLNEISAAAYKN
FT                   SDPLDLDNLSAGSVLTR"
FT   gene            452568..453899
FT                   /locus_tag="BRADO0441"
FT   CDS_pept        452568..453899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0441"
FT                   /product="putative ABC1 protein (chaperonin)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74387"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74387.1"
FT                   /translation="MSSTSDRPLPRFSAVPSSRPGRLLRLGGIAAGIAGGVVTDGLRQL
FT                   AQGRRPGLPELLLAPAQAMRLASGLAGLRGAAMKLGQMLSLDPGLVLPKEAAALLAQLQ
FT                   EAAPPMPPPQLERVLARAWGSGWRARFKSFEMRPFAAASIGQVHRAVTSDGRRLAIKVQ
FT                   YPGVRASIDSDVDNIAALLRLPGLLPRQMDISPLLSAAKAQLHAEADYAAEVAQLRAFG
FT                   DFLRDDPRFVVPSPVTALSTPEVLAMDFVDSRPIASLATAAPNQRDGAMTALIDLTMRE
FT                   LFVFGAMQTDPNPGNFRVTPDGTRIVLLDFGAVRPIAAELQASFRALLAAGLDADRAAS
FT                   RAAMQTIGYFDAATAPRHQDAIVDMFLRAMAPLRQRAPFDFARQDLLAELRDRGLALGL
FT                   DRDLMHVPPADTLFLHRKIGGLYLLATQLRAKVDCAACVAPYRA"
FT   gene            453896..455116
FT                   /locus_tag="BRADO0442"
FT   CDS_pept        453896..455116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0442"
FT                   /product="putative Deoxyribodipyrimidine photo-lyase"
FT                   /function="1.5.2.2 : Pyrimidine biosynthesis"
FT                   /EC_number="4.1.99.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74388"
FT                   /db_xref="GOA:A4YKG2"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74388.1"
FT                   /translation="MTGKLPIATRAAGLARLQTVLPRLGRAYAAGRNHDHGPGRPQAVS
FT                   GLSPWIRRRLVTEEEVVRAAVAAHGGAADKFVEEVIWRGYFKGWLERRPQVWTSYLRGR
FT                   DADLERLDSDGALQARVAAAEAGRTGLACFDAFAQELVATGMLHNHARMWFASLWIFTL
FT                   GLPWRLGADFFLRHLLDGDPASNTLGWRWVAGLHTRGKVYAATASNIAQYSAGRFAPRP
FT                   EDIVIPAQGLEAEEPEGLPSLRPLRVLIAPRRDVPSLWLITEEDCGLTDFDSDGFTWRG
FT                   AATLAASQLRSPRPVAEQVAAFEAAALRDGTTRIGLTAAALKAVDPAALVACAQDAGAT
FT                   QIVTAEVPQGPLRDWLDAAAPALAAAGLTLAEWRRPWDATLWPFATAGFFKVRERIPRL
FT                   LADMGID"
FT   gene            455271..455798
FT                   /locus_tag="BRADO0443"
FT   CDS_pept        455271..455798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0443"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74389"
FT                   /db_xref="GOA:A4YKG3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74389.1"
FT                   /translation="MSLSADTPLHPIAIIGAGMAGLACARRLAAAGQAVVLFDKGRAPG
FT                   GRLATRRAEDFQFDHGAQYVTARDDGFAADLANLAAGGSAAPWEAGAAGAWVGTPGMSA
FT                   LARAFAAGLTIHCGTPVTALTRTPDGWRLEVGETAHRAVRVVLTLPAPQAASLLGDDPL
FT                   AARLAPVRIAPC"
FT   gene            455802..456224
FT                   /locus_tag="BRADO0444"
FT   CDS_pept        455802..456224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0444"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74390.1"
FT                   /translation="MMAAVSAPAPFVVRRDDAADLAWIAHDGAKPGRSAQDGISTWVAQ
FT                   ASEAFSITHLERAPEAVRALMLPSLLSAIGSDVSAVRFAAAHRWRFARVTTPLGTPFLR
FT                   DESGTLYLGGDWCLAARVEAAHASGCAIADALLATA"
FT   gene            complement(456314..457489)
FT                   /locus_tag="BRADO0445"
FT   CDS_pept        complement(456314..457489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0445"
FT                   /product="putative oxidoreductase /dehydrogenase protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74391"
FT                   /db_xref="GOA:A4YKG5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74391.1"
FT                   /translation="MAITASQEAGRHDRIRLGMVGGGQGAFIGAVHRIAARIDDQFELI
FT                   AGALASDPARAKASAKEIGIADDRAYGSFEEMARAEAARADGIEAVAIVTPNHMHAPVA
FT                   KAFLRAGIHVICDKPLTTTVAEAEELVALVRSTGKVFVVTHNYTGYPMVRQARAMVASG
FT                   ELGDIRLVQAEYLQDWLTERLEQSDHKQAAWRTDPARSGPGGCIGDIGTHAYNLACFVS
FT                   GLALDELLAQLTTFVPGRRLDDDVQILLRWKGGAKGMLWASQVAVGHENGLSLRISGSK
FT                   GGLEWAQENPNQLWFTPYGRPKQLLTRGGAGAIGAAARVTRIPSGHPEGYLEGFATIYA
FT                   EAAHAIRAARTGDRPHHEVLFPTVEDGLAGVKFIDAAVRSSAAKGAWIRIG"
FT   gene            complement(457502..458557)
FT                   /locus_tag="BRADO0446"
FT   CDS_pept        complement(457502..458557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0446"
FT                   /product="conserved hypothetical protein; putative Xylose
FT                   isomerase-like"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74392"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74392.1"
FT                   /translation="MKPIKGPAIFLAQFAGDAAPFNSWDSICGWAASLGYEGVQIPSWD
FT                   GRLFDLHKASESQDYADEVKGIAARHGLAITELSTHLQGQLVAVHPAYDAAFDGFAVPE
FT                   VRGNPAARTDWAVDQVKRAIRASRRLGLTAHATFSGALAWPYIYPWPQRPAGLVEAAFD
FT                   ELARRWRPILDHAEEHGVDLAYEIHPGEDLHDGVSYEMFLSRVGNHARANLLYDPSHFV
FT                   LQQLDYLAYIDIYHQRIKAFHVKDAEFNPTGRQGVYGGFQNWADRAGRFRSLGDGQVDF
FT                   GAIFSKLTQYGYGSWAVLEWECAIKHPEQGAREGAGFIRSHIIEVTEKAFDDFAGSGAD
FT                   DVANRKMLGLS"
FT   gene            458857..459603
FT                   /locus_tag="BRADO0447"
FT   CDS_pept        458857..459603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74393"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74393.1"
FT                   /translation="MNQTSTSDPAALDKLKGRIQALRAKTIANGCTEEEALAAAAKVAE
FT                   LLDRHDLSLSDLELKASSCERKVYETHRKKRIPIDDCIGAIALFCDCRVWREKNAAGDN
FT                   IYVFFGLPADVEVAHYLTELIDNSVRAELGRYKTSIDYARFRHQDRHLANASFALGMVA
FT                   SVAERLVAMKKDRDQANASTGRGLVVLKTSVVDAEFGKLALNLRSARSTSRTVSMTAYE
FT                   AGGAAGATVAISPGVGTSSRGGGRGG"
FT   gene            459698..460270
FT                   /locus_tag="BRADO0448"
FT   CDS_pept        459698..460270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0448"
FT                   /product="putative acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74394"
FT                   /db_xref="GOA:A4YKG8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74394.1"
FT                   /translation="MTQTPFPVLATQRLRLRAIALDDRERYQDLLSIPDVTRYANIAFA
FT                   PNEEQTSDMLKKMAEMFDAGTGCSWIIEDAVTNDFVGAVRFNYFFKHARVGGVGYEIHP
FT                   RYWGRGVMTEALRVVVSTGHAIFDLNRIEAWTVPGNGASDRVLQKAGFVLEGVQRQKGS
FT                   FRGVLHDVRLFARLASDPMPPGPDDGH"
FT   gene            460382..460816
FT                   /gene="iorA"
FT                   /locus_tag="BRADO0449"
FT   CDS_pept        460382..460816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="BRADO0449"
FT                   /product="Isoquinoline 1-oxidoreductase alpha subunit"
FT                   /EC_number="1.3.99.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7782304; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74395"
FT                   /db_xref="GOA:A4YKG9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74395.1"
FT                   /translation="MNGRDHEVAVEADTPLLWVLRDTLGLTGTKYGCGIAQCGACTVMI
FT                   DGQATRSCQVPIESIGSAEIRTIEAIEQDATGRKVVEAWVADQVPQCGYCQSGQVMAAT
FT                   ALLTQNPKPSDSDIADAMTNLCRCGTYNRIAAAIRRAAQA"
FT   gene            460829..463066
FT                   /locus_tag="BRADO0450"
FT   CDS_pept        460829..463066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0450"
FT                   /product="putative Isoquinoline 1-oxidoreductase beta
FT                   subunit (iorB-like)"
FT                   /EC_number="1.3.99.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74396"
FT                   /db_xref="GOA:A4YKH0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74396.1"
FT                   /translation="MNALLKTDLANALPLLRPQGITNLSRRRLLGLGAGALVLGALLPA
FT                   AGARAATAAAVKPGTRVPAFLVIGKDNSVKLLSPFVEGGQGINTGLAQIVGEELDVHLN
FT                   RFEVECAPPGADYAIINGLRLTGGSFSTRSSYEVMRRLGASAREMLIRVAAAKLDVTPE
FT                   TLTTEDGQVVHAASNRRVPYGELAEQALALTPADTVALRDPATFRYIRQPMPRLDVRAK
FT                   STGKAVYAIDQKIEGMLYAAIQHAPVLGTEPERMVNEATVKAMPGVHAVHKLPGAVAVT
FT                   ADSWYRARKAVETLDVAWSKAPASGFDAVAADYSSANLLAALKASDANGVSAEKAGDVA
FT                   AAFASAATIVEAEYDAPYLAHGQLEPPSSMARFNADGTLELWVPNQMPELFQGIAAKVG
FT                   GVTPDRVILHSPMLGGFFGRHFAYGSSNPFQQAILLAKATQRPVKVLWSREEEFKMDAL
FT                   RPLSFSRFKAALDKDGKPAAIQVRTVGEGPMGRWFGVTAGGKVDSSAVEGIVEKPYAIA
FT                   NRSMEYARFAHPVTIAFWRSVGHSMNDYFYEGFLDELADAGKQDPYQLRLALLQDRPRH
FT                   FKLLETVAKMSGGWRRGPYDADGGKRARGVALASPFGSETATIAEVSLEKSEVRVHQLW
FT                   IAFDPGSIVNPAIVKSQVESAAALGLSAALFEELVYKDGQRQSHNFDDYPILSRASMPK
FT                   VDVEIVESGAPMGGVGEPGLPGIAPAVVNAVAALTGRHVRSLPLAKAKLGV"
FT   gene            complement(463109..463927)
FT                   /locus_tag="BRADO0451"
FT   CDS_pept        complement(463109..463927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0451"
FT                   /product="conserved hypothetical protein; putative
FT                   alpha/beta hydrolase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74397"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74397.1"
FT                   /translation="MSNDVTIHRLQTSYGELAWREDGAAGGVPLLLLQRFRGTMDDWDP
FT                   AFIQAISADRRVIRFDSAGIGRSEGAVPDSIGGIAAVAAEVISSLGLGQADVLGWSLGG
FT                   VVGQQLALDAPHLVRRLIVAGSSPGPVADGPQAHPRVAQVMTKPDNGAEDFLFLFYPET
FT                   ETAVAAGRASLARIAAQPQLGPKVTAASFMGQVKAISSWPGVLHRANELRLPMLVANGA
FT                   HDVMLPAYRSYVLSQQAPNAKLVLYPDAGHAFLFQEIDDFAAEVDRFLSK"
FT   gene            complement(464006..464974)
FT                   /locus_tag="BRADO0452"
FT   CDS_pept        complement(464006..464974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0452"
FT                   /product="putative bifunctional protein: class I glutamine
FT                   amidotransferase-like (N-terminal), transcriptional
FT                   regulator protein AraC/XylS family (C-terminal)"
FT                   /function="3.1. : Type of regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8451183; Product type pr : putative
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74398"
FT                   /db_xref="GOA:A4YKH2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74398.1"
FT                   /translation="MRQIGFIMEDGFQIMGVAAATAFEFANIQLGEKAYRVRIMSEKGG
FT                   PIRSTLGMHVETEPLGDFPDTLMVVGELLPKPSTAGLRAYIAEAGQKSRRVAGVCTGAF
FT                   LLAEAGLLDGRSATTHWAHAAELQQRFPSVKVDDDRIFIADGNIWTSAGMTAGIDLVLA
FT                   LIEDDHGAEMSRAVARRLVVYHRRPGGQSQFSALLELEPRSDRVRRALTYAKENLRNPL
FT                   SVEELAEAASLSPRQFSRIFREETGQSPAKAVERLRLEAAKVMLEDGRHSLDIVARDTG
FT                   FADRDRMRRAFLRFFGQPPQSLRRSLRLMEGEPGEAAYETT"
FT   gene            465097..465891
FT                   /locus_tag="BRADO0453"
FT   CDS_pept        465097..465891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0453"
FT                   /product="putative oxidoreductase protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74399"
FT                   /db_xref="GOA:A4YKH3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74399.1"
FT                   /translation="MTSQTKGAVLITGASSGIGAVYAERFAARGHDLILVARNQDRLNA
FT                   IADKLTARHGVKVKTLVADLTARDDLARVEAVLKSDASITHLVNNAGFGSAAPLAKADV
FT                   DEMERMVAINVTAPLRLTYAAVPQFVARQQGTIINIASIVAIGPEVLNGVYGGTKSFVL
FT                   AFSQSLRKELAGTGVHVQVVLPGATGTEFWDIAGLPASNLPKEWVMSAADLVDAALRGL
FT                   DRGEFATVPSLADGAEFDAWEAARQTMLPHLSSAAVAERYRA"
FT   gene            465995..466903
FT                   /locus_tag="BRADO0454"
FT   CDS_pept        465995..466903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74400"
FT                   /db_xref="GOA:A4YKH4"
FT                   /db_xref="InterPro:IPR003350"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74400.1"
FT                   /translation="MPMSYCVFMHRTDSIYDDSPAEQYQFPKQYLGRAEGSVGDWIVYL
FT                   EPTKVAATRGYFAIARVERIIPDPKASGMYLALIQPGSYLEFVNAVPFSELDGPIERGL
FT                   RNEAGRLSGRAQAAVRPISPQDFQRIIERGLDDHDPILPRVPDVVHPPDGFAEEQSPVV
FT                   VEQLRERIQRLTSRVLRDRLFRTIVLRAYGERCAITGLKLINGGGRAEVNAAHIRPVEA
FT                   NGPDLVTNGLALSGTVHWMFDRGLISLSDDLAILLSRQINDADRIRGFINPSGFAFSPE
FT                   RAGDRPHPHFLQWHREHCFKH"
FT   gene            467682..469013
FT                   /locus_tag="BRADO0456"
FT   CDS_pept        467682..469013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0456"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74401"
FT                   /db_xref="GOA:A4YKH5"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74401.1"
FT                   /translation="MIYVGQREFIIPTPLWAALPLAAVGYVAVDLAWQSWPSPTDLARV
FT                   GQTTDCFLYTIARFASAYLAAFLVVDIASRSRTPWYGLFLLIPFAHLVAAYVIADLIVQ
FT                   PLTWLGTAILLGAFAAAAVPRGPAGSEMLALVFGALAVVPLLAALAALFVTLASRIVAR
FT                   LPLLTPDARRDLWPNMAAAMVWLPGGMAVGMAPRVLGYVMPRPAALLAALVLALASICL
FT                   HLRLVHGVRREQMPHGNRLRTWLAAAVCCSALVLLAPNPIQYFSLVLVMPGYIRPVMPN
FT                   LSGLYIDHVRPAFRAIGMLPTPVIEVAGYRVDVPFNDRTTMMEPTEATGGYDFVRITLP
FT                   ADYGVTTVKHVPSVAILRAKAIRLSDLFWSERHGDLEQAARAAQPGQEVVVRRESGFKR
FT                   EVGLRSDAYPELEFWLRSVDPATSWEAAEQALRRFLQQRLRRVN"
FT   gene            469673..469828
FT                   /locus_tag="BRADO0458"
FT   CDS_pept        469673..469828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0458"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74402"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74402.1"
FT                   /translation="MQRRRVRSAKALQTGCKVRDDWPDEVPVTLTEVEVFEAWFGELLD
FT                   ELFGPF"
FT   gene            469847..470626
FT                   /pseudo
FT                   /locus_tag="BRADO0459"
FT   CDS_pept        469847..470626
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0459"
FT                   /product="putative recombinase"
FT                   /function="8.1.4 : Integration, recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CAL74403.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            470295..471035
FT                   /pseudo
FT                   /locus_tag="BRADO0460"
FT   CDS_pept        470295..471035
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0460"
FT                   /product="putative recombinase"
FT                   /function="8.1.4 : Integration, recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CAL74404.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            471032..471616
FT                   /pseudo
FT                   /locus_tag="BRADO0461"
FT   CDS_pept        471032..471616
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0461"
FT                   /product="putative recombinase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CAL74405.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            471638..472927
FT                   /locus_tag="BRADO0462"
FT   CDS_pept        471638..472927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0462"
FT                   /product="putative phage related integrase"
FT                   /function="5.4 : Genetic exchange, recombination"
FT                   /function="8.1.4 : Integration, recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74406"
FT                   /db_xref="GOA:A4YKI0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74406.1"
FT                   /translation="MLTRTPMAKLTKRAVDAAETSGADLFIWDDELPGFGLRVKKSGAK
FT                   SFLVQYRNANGRSRRLTIGRFGVLTVEEARKEAKLALGNVVRGSDPAEARKLARGAMTI
FT                   QDLAREYLEKAERGLILTRGGKGKSETTLYTDRGRVERHIIPLIGKRTIKDFTASDAGR
FT                   FLRDVIAGKSATDVKTEKKRGRAIVTGGKGTAARTAGLLGGIFSYAVAEGYRPDNPVSG
FT                   LRRPKDETREWRLDDEGYRRLGKALETAEANGAHWQRVLACRAAALTGCRLDEIQGLLK
FT                   SELDTKGMALRLGDSKTGKSVRPIGSAAVAVLVAASDKSKSKYVFPSITSDAKHHTGLT
FT                   RWLQDIAGKAVPGITSHGLRHSYSSTAEDLGFSIPTIKALIGHSRASVTEGYIHKIDSA
FT                   LLAAADRIASHIDNAMTGRSTEKVVQLRQA"
FT   gene            473018..473821
FT                   /locus_tag="BRADO0463"
FT   CDS_pept        473018..473821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0463"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74407"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74407.1"
FT                   /translation="MSTHDSGILPFRGRRLARLNLIAKQAPRNRKRIAIAKRARLRRSA
FT                   IEKQDRLGRIARFAETQRTCRRWISLGETLDWLTERSVIRAGRPNSEEPTAYRFMTALL
FT                   NALFTHRFSSKIGENWAPRVFMLDASQKLGRLGFGDIAAAADTTMYRDPHIARAFVSCL
FT                   WVRREDLLSVFNERGWEVPAWLSTVPAKAKTTSRSTATKRIAEAEILPMFEKWRRQQPT
FT                   GYIPTRDEDIEHMRQYGVSRERVRELRKSFPSRERGEKKCSRTDP"
FT   gene            474396..474758
FT                   /locus_tag="BRADO0464"
FT   CDS_pept        474396..474758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74408"
FT                   /db_xref="GOA:A4YKI2"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74408.1"
FT                   /translation="MMSKSQIESLKKSKGGRRSRDKGNRAERAITKFLQHRGFAAERVP
FT                   LSGSAGGSFVGDITILLLGVDRCAEVKVRADGFRVLYGWLEGRDLLIVKADRAEPLVVL
FT                   PLRFAAEIAAKAEGNR"
FT   gene            474755..475033
FT                   /locus_tag="BRADO0465"
FT   CDS_pept        474755..475033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0465"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74409"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74409.1"
FT                   /translation="MRERLPNRRGSLAFEFNHEGYKYRASIGRFDDGRLAEIFLDTGLI
FT                   DTPLQQNAENAAMLASLLLQHGAKVADIVHSVSGPVAVALAQAEAFS"
FT   gene            475030..475476
FT                   /locus_tag="BRADO0466"
FT   CDS_pept        475030..475476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0466"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74410"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74410.1"
FT                   /translation="MMLASDIQQLAIGVAVSLADAPFAELEAQSTQLAEMALEGFLTKQ
FT                   QASDIAFTAAKAAGLVHRHGPDVVQETISEGFNMAVLAPIEAPPIVPKIPAKRPYQTPE
FT                   STIAAFWYTVHNEDEATLRQWLLDHPADAPYLRKLWEARCCKSK"
FT   gene            475458..476627
FT                   /locus_tag="BRADO0467"
FT   CDS_pept        475458..476627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0467"
FT                   /product="hypothetical protein; putative RecA-superfamily
FT                   ATPase (involved in signal transduction)"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74411"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74411.1"
FT                   /translation="MLQEQVSRAFSVVMNDEPPFPSGPEDYGYSVAPAPAPAEPIAPFA
FT                   PITPAAWRGIEPTPQRWLAEGRIPLGDLTILAGNGGSGKTEIAAQLLVSVAAGLGDWLG
FT                   CVAETGPALFLSCEEPEDNVRDRVERIAKHRNIDPHGIDSLHLVFPDLDQTWLCNVDKS
FT                   GKVQRTHLLQQLESWIVQNKPALVAIDSVAAVFDGDAIQRRQVRAFLAMLRKLAREQET
FT                   AILLLDHPSVRGMADGSGTANSVDWRNSVRSMLHLSDPDKDDPDARYLEVKKSNRGRTG
FT                   EKTRIQWAGLTFSTALSAGSPRQAAAEREVDELFLRLLDKRNAQGRRVHASNAKGNAPS
FT                   EFAQDPEAAGVTAHAFRSSMERLLTAGTIRAVETGPASKRRQHLERDGR"
FT   gene            476936..477310
FT                   /locus_tag="BRADO0469"
FT   CDS_pept        476936..477310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0469"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74412"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74412.1"
FT                   /translation="MTVFAAPKSRTSQPANPVGAQALGKLKILEPFNGLEAISVPEASR
FT                   ATGVPETTLRRWTREHGLGRRVGGHVRPWTLSRIALAMHLAGDRDALAAYHLGIRQEES
FT                   VARYYRNEGLARLLRLPAFN"
FT   gene            477613..477789
FT                   /locus_tag="BRADO0470"
FT   CDS_pept        477613..477789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0470"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74413"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74413.1"
FT                   /translation="MHMTEEMKIVQFRAPDRLSRVIDEAASRNFQTKSEYIRQSIVEKL
FT                   RADGVQFDMVARS"
FT   gene            478191..479555
FT                   /locus_tag="BRADO0471"
FT   CDS_pept        478191..479555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0471"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74414"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74414.1"
FT                   /translation="MAPRTTFVNLSDGLQNMSLWDQAFADTGLLGTIPCTATGTNAFIL
FT                   TPIASLFPPNILAYQAGLQFSFVVPSTTSGPVTAAVGLLSALAVNRSDGSQASTGDLVQ
FT                   NRVAVIQFNTATSAFDLVSVEGKSVLTDATQALTNKTFNGNTWTAGSGTITINGSKTLT
FT                   LNNTIAFSGTDATTITFQGTDTYVGRGTTDTLSNKTIDTAAPNTVKINGNTLTAASGVA
FT                   TITFPNSTDTLVGRATTDTLTNKTIAAGSNTVTGLGVSNLGGFTGSPTNANFARGDGTW
FT                   AAPASSNYVLLNTLTASASAALSDTSSLTNAYSAYDLVFINLVPATNAVTLQLQIQSAG
FT                   VFQNTSYLTLVWGIATTNFTPSTGAPTTFIPLSNTNDVGNTGAGVSGTIRIYNPSATTF
FT                   PKAVSGMMFNNSGGVNSRAALTSGYWNSNAAVTGVQIQFSSGNITSGTIKIYGAS"
FT   gene            479574..482600
FT                   /locus_tag="BRADO0472"
FT   CDS_pept        479574..482600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0472"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74415"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74415.1"
FT                   /translation="MSFADVIASIDSGAEPDTSKRPPRAISKGGFRDVVRSIDNVFDQF
FT                   DGYSSKKKSGSNPFDKYDELPSREVKGKNPFDKYDVSSPKQATSSSLGWNAVSGLNEGI
FT                   ANTLGAPADAIAKGLNSDIHDINSVFGTNIRPIEDPFGGSKSIRRGMSRLGIATGETVE
FT                   ANNAAERIARGAGEGAGSLVAGAAELAVVNKLFKLAEGAPQIYKALEGLFGGPTPATAA
FT                   TGAAVGAGAAAGAEAAPEGYKGVGSLAGGLAGGVVPAAARVAWEGGKFAVNAAAQAARP
FT                   FTKAGQEQLAGQTLRGSSSNPYQVMNNLENGPNELVAGSKPTTFQQTGDMGLGQLERRV
FT                   RTNNPDDFLQRAAEQNSARRGAIEGVQATGNPTAVSAHFRGMRESLDRVTEAEVGNATN
FT                   LRNQATAELGGMGREEGYGAAMRAPAQEARDAAKEAENRLWEAVDPHRDLTMPAGPIAN
FT                   TARNVQGAMTRSAKPMTGEERDIFEVAQSYGPNTPFQEVKDLRSRISTAMFQELRTNGR
FT                   TPVYARLSQLRRSVEESIDGAIERQVRLDQRAVAQGRLPAEDTIGARLQREATEWARTR
FT                   QAGEVVGSGVGGMGPRREGSVSAAFGTEVPNRLRNAEGNSRVQEASPLDEAAAERLRAA
FT                   SAATRERAATFDQGATGNVLRPGARAGEYRTPDSLVPSKVFHPGANGGEDVRHFVAAVG
FT                   EDRAIPIIADYAASSLRRAAVRPDGSVDTAKALAWAKQHDAALAELPPAIRSRFANPGR
FT                   AEEVLAQASAARKEQLETFDRSAIAKVMGTESGDVVRQVGSVFEKQNAAAQMGELVRNA
FT                   RGNPSAMEGLRRSVVEYIQSKYIGNTEAATSEQALINANAFQTFIKNKADVLGKVFTPD
FT                   EIGNLRAVAQDIQRANRSINATKLPGGSNTAQDLANAAPQGSILNKLAVEAGAAAAGHA
FT                   VTNSISGGVFGWLGTRIASSLRDAGISHVDDLIKEAMLHPELARELMKKAPAQPTGGGV
FT                   ERIVKTLKRISVAVASNIK"
FT   gene            complement(482634..483038)
FT                   /locus_tag="BRADO0473"
FT   CDS_pept        complement(482634..483038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0473"
FT                   /product="hypothetical protein; putative secreted protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74416"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74416.1"
FT                   /translation="MRNQRRLAAIHALLAVILGACSVATMKSYEGKTVLDVILDYGPPS
FT                   AAYDTGDGRRAFVWTMNYAYGLPAQATTIASVANYGNQSFYSASTLVSPGATFSQSCNY
FT                   ALFAVRKNGATDGPAAWQVVDFAKPRLDCL"
FT   gene            complement(483118..483369)
FT                   /locus_tag="BRADO0474"
FT   CDS_pept        complement(483118..483369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0474"
FT                   /product="hypothetical protein; putative secreted protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74417.1"
FT                   /translation="MLKSFLAAAAAILITAPVMAQSYGYGTGSNPNNHGVSGYTRNDGT
FT                   YVQPYHATNPNGTQRDNYSSSGNMNPYTGSTGHRTPRY"
FT   gene            complement(483535..483963)
FT                   /locus_tag="BRADO0475"
FT   CDS_pept        complement(483535..483963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0475"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74418"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74418.1"
FT                   /translation="MTARTVGFRELAKVRLDWLKALRDNLSEYHSILMTSEDPDPDLEG
FT                   EAAKEAREKDEADDRRLSYLGTQLDLLLNQKKPLQKALWGISDEILALDTKEERQARDQ
FT                   ALVEAARAVLDFEWQKIKREMRGETSQVHPAVDRGIRL"
FT   gene            484087..484647
FT                   /locus_tag="BRADO0476"
FT   CDS_pept        484087..484647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0476"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74419"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74419.1"
FT                   /translation="MGILFHFPNYVFQAGRSVIAGETLYVIIDGLTRVSMSKRKRNYRE
FT                   QNRDKHLEHTTSSGILLVSTPKDSAASAREQPKIYVIAGVLPPPNIGAIATSVRISQCA
FT                   VTCILEKAAMPDELSVFGFVDEIEIEESAAVVVEQIDEEITVSIASVVSVNFQLTPEQT
FT                   MELSRALAIAAEKAAEFLASDEN"
FT   gene            484720..485664
FT                   /locus_tag="BRADO0477"
FT   CDS_pept        484720..485664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0477"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74420"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74420.1"
FT                   /translation="MPKSTGTMSDEVAAQVLQALRSGQTLFSICGGRPKNGERYPRITY
FT                   YEPYRAYCAAKPEYAREANALLAKSTAAANARKGMSKSFKLRTHCLRGHALTLDNLYFK
FT                   STNGTRQCKACTLASIGRGGPVTKQQIEKVRRAVLTGMNISDITRSNGKRKPILSFAQL
FT                   KRVRIECDNLNRFIIENVHSWRSRKALIGPMGIARLDGRMAQIIRLPRRADEIEIYEFR
FT                   PGDFEWLYGLTPWTWPKFAREEIVGDLFLELSERLIHRDDIPGRVKFYVAKHNRDYPSV
FT                   SHGDLRSPLSLDAPIFEDGNMTRADTIVRGLWD"
FT   gene            complement(485710..485991)
FT                   /locus_tag="BRADO0478"
FT   CDS_pept        complement(485710..485991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0478"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74421"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74421.1"
FT                   /translation="MPAQRRSWLIPMTINFEYDLDEIVQMAGKPITLAGALRRMPDQVG
FT                   PLAVLYRDAGKQPALFDAEQIQDLLDKHRSELEAGNPQGHREADKYDN"
FT   gene            complement(486029..486274)
FT                   /locus_tag="BRADO0479"
FT   CDS_pept        complement(486029..486274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0479"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74422"
FT                   /db_xref="GOA:A4YKJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74422.1"
FT                   /translation="MISIEQIRAARGLLGWSQTQLAEASGRSLPTIKRLEREDGDGPAV
FT                   SNDVRADVEAALEKAGVEFIPENGGGAGVRLKKRKR"
FT   gene            486415..486696
FT                   /locus_tag="BRADO0480"
FT   CDS_pept        486415..486696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0480"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74423"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74423.1"
FT                   /translation="MRRAWAIFREVYKYPQIKFSDIGRNCFAWALRKAWAEAREAARLS
FT                   AIPAQERQDCISCLNALIERAGFIDSGPAWRRTVTAYRDEIRQLETAI"
FT   gene            486716..487117
FT                   /locus_tag="BRADO0481"
FT   CDS_pept        486716..487117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0481"
FT                   /product="hypothetical protein; putative secreted protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74424"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74424.1"
FT                   /translation="MTTNRRAALKSLAALPLAALTGSCAAPALASSASAAPDPVWRAID
FT                   LWQEARIALDAEMARIKGTGEDLDDELSSDELDRATDLIATPPTTLEGLFALILTLQRL
FT                   DSWTLDDHHMNRTLVLSLSQGVANVRGLA"
FT   gene            487379..487699
FT                   /locus_tag="BRADO0483"
FT   CDS_pept        487379..487699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0483"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74425"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74425.1"
FT                   /translation="MMREPLVGLSSGYLVQRPELVGSIGLPCLYCGKPMENPTRDHVHR
FT                   SRSKGGKLEPGNKAIVCERCNMDKGSRSLASWLVWLQRSGDCRASVVGQLVLDRQAKIA
FT                   GT"
FT   gene            complement(488494..489252)
FT                   /locus_tag="BRADO0486"
FT   CDS_pept        complement(488494..489252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74426"
FT                   /db_xref="GOA:A4YKK0"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74426.1"
FT                   /translation="MCNLYSMTKNADAIRRLFRVEPENDRTGNLPSMPGIFPDYPAPIV
FT                   RTGADGRELVLARWGMPSSQKALMDATRRRAAKLEEKGKPVDFKELLRLEPDSGTTNIR
FT                   NVNSTHWKRWLMPANRCLVPFTSFSEYHTIDGKKVPVWFAADESRPLLCFAGLWTNWTC
FT                   VRKVKEGEITCNLYGFLTTEPNAVVAPIHPKAMPVILRTVDEYEVWLRAPWDEAKLLQR
FT                   PLPDDVLSIVARGSKEDKGARCGSTCQMSA"
FT   gene            489628..490401
FT                   /locus_tag="BRADO0487"
FT   CDS_pept        489628..490401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0487"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74427"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74427.1"
FT                   /translation="MSFKVIDGGGPDKEDRERVEKERQKAWEREQAEAEFSYALRECAA
FT                   NMLRIIRGAGSPFYLVRQMQEVIRTSLSFHEVHGYWPQDVLAKVLHLESEAEMWNRRLR
FT                   EGHLDQASFDRWTRDGSFEMMDAEHTIYRGVLQIVASEMLGQATQQSAGDREFHDGLRT
FT                   YNEAHDAHLRKFWAEQRNSAPAPAKGSKRVSPTSPPERQDSLPTKLKMDVAPAPQKSRS
FT                   RKFDQNDLKELRKAIKANDKKRIAELTAKIGQPEN"
FT   gene            complement(490551..491300)
FT                   /locus_tag="BRADO0488"
FT   CDS_pept        complement(490551..491300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0488"
FT                   /product="putative methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74428"
FT                   /db_xref="GOA:A4YKK2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74428.1"
FT                   /translation="MNENEGNRMSARDSSRFVIRVLRSRLRDHKVELSELRRYIRPGDI
FT                   VCDIGANKGSFLYWLARWAKPGRVVAFEPQPQLAKQLAGLCATFSIDNVTVEQAAVFSS
FT                   SDRRNLFIPDGHQPAASLLKPDGPFEAVSTRTIALDDYFTEADKVAAIKIDVEGAELDV
FT                   LQGARRTLARCMPLVVCECDRHNSSLDRINATFSFFSDLGYAGRFVSGSTLLPLSEFRA
FT                   DIHQNTHGEWFWKKKGYCNNFIFRMPT"
FT   gene            complement(491334..492293)
FT                   /locus_tag="BRADO0489"
FT   CDS_pept        complement(491334..492293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0489"
FT                   /product="Putative oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74429"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74429.1"
FT                   /translation="MIGDLSVSEIGLGCSGFWGNRRYGERQAVQIVHEAFDLGVNLFDT
FT                   GHNYCDFNAEPRLGRALVDILKRCDRSKLVVSTKAGTLRSKPLLPGTKAKTQDHSPDYI
FT                   ERACAQAIKNLGTGYIDIFYLHNFGPASLTDELLSKLDAMRRRGMFRLLGINTHSETHM
FT                   RYIADLDGVFDVALIDFNVAQLDRLPVVEYLHNAGVAVVAGTVLAQGHLIQGKLSHIRR
FT                   QADVWYLARAVLKPDSRRLARAAHSMRAALTGVEGMSSAQAAMAYVLAVPQIASCIFGT
FT                   TSLTNLREICESPHKSLSPLDSEQILYAFKESARSISS"
FT   gene            complement(492552..494183)
FT                   /locus_tag="BRADO0490"
FT   CDS_pept        complement(492552..494183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0490"
FT                   /product="putative recombinase"
FT                   /function="5.4 : Genetic exchange, recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74430"
FT                   /db_xref="GOA:A4YKK4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74430.1"
FT                   /translation="MIKARQAVITTKVQRAAQYLRVSTESQKYSIENQAAALAAYAARR
FT                   GIEIIETYADRGRSGLSISGREALKSLIKDVELSRALFDCILVFDVTRWGRFQDVDESA
FT                   YYEFICKRAGIQIHYCADEFENDGSLASVVLKNIKRVAAADYSRQLSKKVFLGQSRVAS
FT                   EGFWRGGPAPFGLRRLLVDERGRVKTVLQIGERKNLKSERTILGPGPKHEIAIVRRIFE
FT                   HFATRTKTRTEIAADLNAKRFRNAQGKLWTMLTISNVLRNEAYLGHIVYNRRSMKLGER
FT                   NVRNPPEMWIRHQNAFKPIIAPALFLKAQNVMAELESGRTRTDKELLELLKGLLLRDGR
FT                   LTMKSITLAKDMPNASVFTKRFGSLDEAYRLIGYRPAARYRFKEVRANIDQIIRSVADK
FT                   VSTDLERRGRRVSFLPELYLLTINGAVTLTIAVSRAVKDGTNGARPARRWELRKTRFAR
FT                   SDLTLVVRMNAINTMIQDYFLLPTSSLPASTGESRVRISERYFGDFRCSDLAEVTALLH
FT                   SRFQEQFTTGDDVPSERAARRASSVR"
FT   gene            complement(494474..494770)
FT                   /locus_tag="BRADO0491"
FT   CDS_pept        complement(494474..494770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0491"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74431"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74431.1"
FT                   /translation="MTRCSSSYSVPEPNPETKKKDVVWFALSDDRPLTCFAGIWTEFKG
FT                   DRGTKSKPVTGPHLVYGFLTTEPNAVLTPLSREAMPVILTTDEERGLAARAVG"
FT   gene            494622..494951
FT                   /locus_tag="BRADO0492"
FT   CDS_pept        494622..494951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74432"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74432.1"
FT                   /translation="MVPRSPLNSVQMPAKQVNGRSSDSANQTTSFFFVSGFGSGTEYDE
FT                   EHLVTYLRLLDAAKEGADWREVSRIVLHRDPDAEPDKARQAFDSHLARENGSQRLGICR
FT                   LCEAA"
FT   gene            complement(494976..495221)
FT                   /locus_tag="BRADO0493"
FT   CDS_pept        complement(494976..495221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0493"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74433"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74433.1"
FT                   /translation="MGKQGVSTRSAEISCPLAGAASLLPDPSDKHGPPDKEPAYTPPRE
FT                   PKIGEVCPRCGYILTIVMLYTCSDKQCPYPDFPGRE"
FT   gene            complement(495267..495343)
FT                   /locus_tag="BRADOtRNA48"
FT   tRNA            complement(495267..495343)
FT                   /locus_tag="BRADOtRNA48"
FT                   /product="tRNA-Arg"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(495463..495852)
FT                   /locus_tag="BRADO0494"
FT   CDS_pept        complement(495463..495852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0494"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74434"
FT                   /db_xref="GOA:A4YKK8"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74434.1"
FT                   /translation="MLLNILWIVFGGAYMAFGWLVASVVMAITIVGLPWARAAFNIAAY
FT                   TLLPFGSRAVRRDEVTGMEDVGTGPLGLLGNIIWFVLAGWWLALGHLLTAVFLAVSIIG
FT                   LPFAWVHLKLAGLAAWPIGKTIVPA"
FT   gene            complement(496252..499392)
FT                   /locus_tag="BRADO0495"
FT   CDS_pept        complement(496252..499392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0495"
FT                   /product="conserved hypothetical protein with PAS, GGDEF
FT                   and EAL domains; putative membrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74435"
FT                   /db_xref="GOA:A4YKK9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74435.1"
FT                   /translation="MEQVISFRVDQGMQGAADTSEAGGTAPERIATALWRGPVLGLIAC
FT                   CTLLIAAIVVGTIVMANGFRARTIDNHQRELENTVLLLTRHFAQQFEDAETAVAHAIQR
FT                   MQLGSISSPDALRARVTQDDIREILQSQVNGLSYMGDLTIIDADGNFVSWSSSDPLPSV
FT                   NVSDRPYFKELKTASQPNAFVIAPVVSRVTSGWATIVAHRLSGANGEFLGLLTRRVDPR
FT                   TYETFMESIALGNNAAITLFHADGTVLARYPHIASVMGRRIITGNLHESVADGGVRTGV
FT                   VKSPVDDIDKIVAAARISRFPLTMTVTKTIDDALADWRSQMVLLVGAAVLAVFVIAVMF
FT                   SLMIRQIVQQNQVARSRLENEKQRVETALDNMTQGLISFDEHACVVMFNQRFIDLLGLS
FT                   ADAIRPGLHLSEVVAHCKASGAFVGDVASFCSGVIERATGRDTSQMIAEGSSGRFFNVI
FT                   DKPLASGGWVTTIEDISEQRRLEQERDRNYAFLNEIIDHIPSHIIVKDVRDRRYVLINR
FT                   SSEQGFGLPRQDIVGKTVFDLMPRPSAEKITADDDRALEQPDGLFLGEHAWQTPGLGLR
FT                   YITSRRITIEDEAQRPRYLINVMEDTTERRLADEKIAHLAHFDALTELPNRVLFRERID
FT                   EEIERVRHGTFFALLYIDVDEFKGINDSLGHHVGDELLKTIARRIESCLGPEDMVARLG
FT                   GDEFAVLLTTAADQDEVVVVVTEILDTIRKPYRCLGHQLSTDASIGIALAPRDGTERDQ
FT                   LTKHADLAMYAAKAGGRRTFRFFEPSMDENARARLQLQQDLRRAIVENQFELHYQPLLG
FT                   FTQNVMTGCEALLRWRHPERGMVPPLDFIPLAEDTGLINEIGDWVMRTACAEAANWPAD
FT                   IRVAVNVSPVQLKSPTLALRIAAALSAAGLPPQRLEIEITEAVLISDDDVALNVLHQLH
FT                   DMGVRIALDDFGTGYSSLSYLKRFPFDKIKIDRCFVSDLNVGSSSAIVQAVVSIAAASN
FT                   MTTTAEGVETGAQQSALRQLGCTEMQGYLFSAPKPAAELRKLFAPETGTDEDLQAAG"
FT   gene            complement(499555..500625)
FT                   /locus_tag="BRADO0496"
FT   CDS_pept        complement(499555..500625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0496"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, permease protein"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74436"
FT                   /db_xref="GOA:A4YKL0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74436.1"
FT                   /translation="MMILSGDPPRSRALSILLVVIVLALLATPFIFPGAKALNVAAKIC
FT                   IFAALVASYDLLLGYTGSVSFAHTMFYGIGSYAIAIALYGLGPNWTSVAVAVAAGLPLA
FT                   LLLALAIGLFSLRVEAIFFAMITLAIASAFLVLASQLSWLTGGEDGRSFQLPELLRPST
FT                   VFIGKEWFGFPINGRILTYYLVLSACALMILALLRVVNSPFGRVLQAIRENRFRAEALG
FT                   YRTVFHLTYANCIAAVIAACAGMLNALWLRYAGPDTSLAFSIMLDILLMVVIGGMGTIY
FT                   GAIIGAAIFILAQNYLQALMGIASSAAADAGLPLLPGLLHPDRWLLWLGLLFIASVYFF
FT                   PTGVVGRLRNTPGSPR"
FT   gene            complement(500622..501605)
FT                   /locus_tag="BRADO0497"
FT   CDS_pept        complement(500622..501605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0497"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, permease protein"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74437"
FT                   /db_xref="GOA:A4YKL1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74437.1"
FT                   /translation="MPKPKRDIAPLLLPVVLALLMIPLVGSTSSWVTLTVASLAMGMMI
FT                   FIMASGLTLVFGLMDVLNFGHGAFIAVGAYVATLVLLPLASWAQADSLLTNLAVLVPAA
FT                   LLSMGVTGALGLVVERVLVLPVYGQHLKQILMTTGGLIVAEQTLYALFGPQIIPMPLPA
FT                   ALRGSFILGDVAISKYRLLALLIGLVIFVAIELVLNRTKIGLLIRAGVENREMVEALGY
FT                   RIRRLFLGVFMTGSALAGLGGVMWGLYREQVHASIGDELTVLVFIVVIIGGLGSITGCF
FT                   IGAILVAMVANYGGFLVPKLALVSNILLMVAVLMWRPRGLYAVTSR"
FT   gene            complement(501629..502351)
FT                   /locus_tag="BRADO0498"
FT   CDS_pept        complement(501629..502351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0498"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74438"
FT                   /db_xref="GOA:A4YKL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74438.1"
FT                   /translation="MNALLKLADVETYIGRYHILQGVDFEVPEGQTTMLLGRNGAGKTT
FT                   TLRTIMGLWQARTGTISLTGEPIEKLSTPDIAQRGVGYVPESMAVFSDLTVKENLVLAA
FT                   RNGPLDDAQLAWIFGFFPALKKFWLSRAGSLSGGQKQMLSIARAIVEPRKLLLIDEPTK
FT                   GLAPAIVMSLIECLKEIKRRGATILLVEQNFHAARELGDQVLVMDNGTIVHRGEMAALA
FT                   ADVPLQERLLGLSLEAHQ"
FT   gene            complement(502348..503148)
FT                   /locus_tag="BRADO0499"
FT   CDS_pept        complement(502348..503148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0499"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74439"
FT                   /db_xref="GOA:A4YKL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74439.1"
FT                   /translation="MEAILRSHPADAMSITLETRDLTIRFGGHVAVNSVSCSFRPGELT
FT                   AIVGPNGAGKTTYFNLISGQLTASSGSILFDGLDITGLSAPLRSRAGLGRAFQLTNLFP
FT                   NLSVEENVRLAVQAQSGTHYDLLRPWMARRDLIARADAILDQVALGGRRSVTATTLSHG
FT                   DQRKLEVALMMALEPKVFMFDEPTAGMSIDEVPVVLDLIARLKQDTSKIILLVEHKMDV
FT                   VRSLADRIIVLHNGQLVADGKPAEVIASPIVQEAYLGVAPRSAA"
FT   gene            complement(503191..504399)
FT                   /locus_tag="BRADO0500"
FT   CDS_pept        complement(503191..504399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0500"
FT                   /product="putative branched-chain amino-acid ABC
FT                   transporter, periplasmic binding protein"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74440"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74440.1"
FT                   /translation="MRTSQIVKSPIFKGFISTFAAALLATAARADDLKIALIYGKTGPL
FT                   EAYAKQTEAGLRLGFEYATKGTNMIDGRKIVIITKDDQGKPDLSKAALSEAYQDDGADI
FT                   AIGTTSSAAALADLPVAEENKKILIVEPAVADQITGEKWNRYIFRTGRNSSQDAISNAV
FT                   AIGKPDVTVATLAQDYAFGRDGVAAFKEALAKTGATLGAEEYVPTNTTDFTAVGQRLFD
FT                   ALKDKPGKKIIWVIWAGAGDPLTKLQDMDPKRYGIELSTGGNILPALAAYKRLPGMEGA
FT                   TYYYYDIPKNPVNDWLVAEHQKRFNAPPDFFTAGGFSAAMAVVSAVTKAKSTDTEKLIA
FT                   AMEGMEFETPKGKMIFRKEDHQALQSMYHFRVKVDPNLAWAVNEPVREIKIDEMTIPIR
FT                   NKR"
FT   gene            complement(504542..506320)
FT                   /locus_tag="BRADO0501"
FT   CDS_pept        complement(504542..506320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0501"
FT                   /product="conserved hypothetical protein with PAS,GGDEF and
FT                   EAL domains"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74441"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74441.1"
FT                   /translation="MYSSDRFNFSPDTNDGLGSPEAELRFLRGVLSQLPAGVTVQDEQG
FT                   RFLLVNEAAAAQLGTAADSADRMPAPHLDGRRLACLETIGRGRTVIAEEKVVGGQGTQT
FT                   LLTAHRPVHIGDRQLVISSSADITEQKEFEDQLFRAAYYDELTGLPLRRVAQHRADNLV
FT                   RRGRVEGRFALAFLDLDNFKYINDYYGHATGDALLVEFAKRISRDLRDTDLLSRISGDE
FT                   FLLLLHPIERAEEIAEFLHALLDRLSAPFFIGGAEVFASASVGVSLYPEHGASYDVLRQ
FT                   NADLAMYRVKNSGKGTLAFFSSAMEHEALARMKVEQSLRLAILEKRFCCAFQAKVDIRT
FT                   EEIKGIEALVRLRDNEDVIQAPGAFINLAVELGLIDELTHLVLDEIVKSIDLINATFGP
FT                   DATISINVAAKQASNPEFMQPFARALEATGFPKRFMVEVTEDAFVTRSHFQDEIVPLLR
FT                   GIGVGISIDDFGIGYSSLSALADITADEIKIDRSFITDIHKRPRSQGILRAIESLSEAL
FT                   GMTVIAEGIESFEELAYLQAATKIRYAQGYYFSRPIFLEELKPAAPYASEARISMASRA
FT                   VQENRQSYARSSRYRR"
FT   gene            complement(506512..507480)
FT                   /locus_tag="BRADO0502"
FT   CDS_pept        complement(506512..507480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0502"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74442"
FT                   /db_xref="GOA:A4YKL6"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74442.1"
FT                   /translation="MSMTRLIEDIKQVWRGEQQPSLVWSCSFAAACLLIATAIRYGLAH
FT                   LRPDVFFTPYMPAVFFATAMGGSGVGLATAILGAGLGLALDFNHGPVDGARLALMAMYL
FT                   VVAGLVIWGVNHYRGLAAKQREIARRLIEEEQYRKLLVDELHHRLKNKTSTIHAVLHQV
FT                   LHDQPQVWGRIDQRIRALATADDLIARADGQGCDLKDLLMSELGPYGHVRFELNGDSLF
FT                   LPAKLAVSLALIFHELATNAGKYGAFASPRGFLQVSWTMQDDRLKLTWDEAEGPALGEI
FT                   GKPGFGTKLLKAALSSFDGRTETTYLATGIHCTMQCRVPPS"
FT   gene            507659..508501
FT                   /locus_tag="BRADO0503"
FT   CDS_pept        507659..508501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0503"
FT                   /product="putative short-chain alcohol
FT                   dehydrogenase/reductase with NADP-binding domain"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74443"
FT                   /db_xref="GOA:A4YKL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74443.1"
FT                   /translation="MGRLDGKIAVITGATSGIGLRTAEIFVAEGATVIAAGRRSAEGEA
FT                   LARRLGAACIFRQTDVTVDAQMRALIDVAVERFGRIDCLFNNAGGPAQTGGIERLDADR
FT                   FDQAMAVLVRSVMLGMKYAAPHMKKQGGGSIINNGSIAGRLAGYSTSVVYSTAKAAVIH
FT                   LTKCVAMELGESGVRVNSISPGLIATGIFGKALGLSTEAAEKTPETIRNAYATAQPIPR
FT                   AGLPDDIAHAALFLASDESSFINGHDLVIDGAITGGRNWSQQQQGYAAMRKLLGDAVE"
FT   gene            complement(508651..510012)
FT                   /locus_tag="BRADO0504"
FT   CDS_pept        complement(508651..510012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0504"
FT                   /product="putative cytochrome P450 family proteins"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74444"
FT                   /db_xref="GOA:A4YKL8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74444.1"
FT                   /translation="MVSEPIRLTSPRRNSLTHIPGDEGWPIIGKTFEVLADPKGHVERN
FT                   ARKYGPVYRSHMFGEVNVVLLGPEANELVLFDQAKLFSSAHGWGHILNLLFPRGLMLLD
FT                   FEEHRMHRKALSVAFKAGPMKSYLSGLDHGIAARIAQWRERPGEMLFYPAIKQLTLDLA
FT                   ATSFLGTEIGPEVDTINRAFIDMVAAAVAPIRKPLPGTQMARGVKGRQRIVAYFSEQIP
FT                   LRRARSDGDDLFSHLCRATDDEGALLSTQDIVDHMSFLMMAAHDTLTSSLTSFVAQLAA
FT                   NPAWQQKLRAEVYSLGLAKDEPMTSEHLEKMKLTEMAFQETLRLMPPVPSLPRRPVRDF
FT                   TFKGFKIPAGTGVGVNPMYTHHMPEIWPEPQRFDPLRFTDEAQRGRHRFAWVPFGGGAH
FT                   MCLGLHFAYMQAKCFARHFLSNVEVSLAPGYQPSWQVWPIPKPRDGLKVQLKAV"
FT   gene            complement(511085..511243)
FT                   /locus_tag="BRADO0506"
FT   CDS_pept        complement(511085..511243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74445"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74445.1"
FT                   /translation="MSLSSAKNYALRAERSQDPKEAADLLAKAILELAASIEATDAKVK
FT                   KINKSAG"
FT   gene            511736..512146
FT                   /locus_tag="BRADO0507"
FT   CDS_pept        511736..512146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0507"
FT                   /product="putative response regulator receiver (CheY-like
FT                   protein)"
FT                   /function="3 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74446"
FT                   /db_xref="GOA:A4YKM0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74446.1"
FT                   /translation="MSNQLLVIEDAEVHLSILRKIAVQCGYEATCVTSVDAAAELLRKN
FT                   KYDCITLDLSLGDRCGADILLLLNELKIRTPVIFISGAEDGTREEHVRLATVLGLVVYP
FT                   QFQKPVDLPALRETLKQIATLADCERLVAAVR"
FT   gene            complement(512329..513567)
FT                   /locus_tag="BRADO0508"
FT   CDS_pept        complement(512329..513567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0508"
FT                   /product="putative alkanal monooxygenase (FMN-linked)
FT                   (luciferase-related)"
FT                   /EC_number="1.14.14.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74447"
FT                   /db_xref="GOA:A4YKM1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74447.1"
FT                   /translation="MARLKFGAFLAPHHPIGEHPMLQFRRDLDLVSQLDELGYDEFWCG
FT                   EHHSSGWEMIASPEMFLAAAGERTKRIRLGTGVISLPYHHPFNVAQRMVQLDHMTGGRA
FT                   IFGSGPGALASDAHTLGIDPMTQRDRQDEAIAIIRRLFNGERVTAKSDWFTMNDAALQI
FT                   LPLQEDMPFVVASQISPSGMTLAGKYGIGIISLGSMSTQGLMALPQQWEFAEDAAKKHG
FT                   TTVSRANWRVLLSWHIAETREQARREAGAGLMRWHNEYNVGTLMRPGLKTFASPDEAVD
FT                   KTAFVEGAASTIGTPDDLVKTIKNLMQVSGGVGAIIGFVHDWANPENTRRSWDMVARYV
FT                   VPEINGYIDGLRRSQKFVIENRAIFERAGQAVMAKIMDNDKAAAALSQTGPGRIAIPAV
FT                   NAPDLQEAAKRRR"
FT   gene            514027..515520
FT                   /locus_tag="BRADO0509"
FT   CDS_pept        514027..515520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0509"
FT                   /product="putative polyhydroxy-alkanoate/butyrate(PHA/PHB)
FT                   depolymerase"
FT                   /function="1.1.2 : Fatty acids (fatty acid oxidation)"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74448"
FT                   /db_xref="GOA:A4YKM2"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74448.1"
FT                   /translation="MPKDETAKEPHLSLAENVEYLRRLRELNGITGFGDFHRQLRPAPE
FT                   CPLVEVEEFGSNPGRLKMFAYVPAQRQPLLPLVVVLHGCGQGAAEYDLGAGWSTLAKHF
FT                   GFALLMPEQQRINNPQRCFNWFQSEDITRGQGEVASIREMIARMVADCAIDSNRIFVTG
FT                   LSAGGAMTMAMLSAHPDLFAAGAVIAGLPFGTARNMRDAILQMRMPPARPAGELGDLVR
FT                   RASHHRGKWPKLSVWHGTADYTVHPDNAGEIVKQWLDLHHLPLAPMAANEVNGYPHEQW
FT                   WNSDGVTVVESFTITNMAHGTPIGVAANDKRYGKAGPFLLEAGISSSYLIAKFFGVTDW
FT                   IRQPKPAVTSPSTRLIPEVSPISVLPTLTKMLRRPEDAAEPVEAKASPEPVKTAKPARA
FT                   KSNRAARPPKRKVDASTAEPGEIKALSATPADAPAEVKPPVARPPVAKAVDMTPADPPP
FT                   VIAVKAPPSPAELPPTPKARRVIDVAAVIDRALKAAGLK"
FT   gene            complement(515679..516347)
FT                   /locus_tag="BRADO0510"
FT   CDS_pept        complement(515679..516347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0510"
FT                   /product="putative enzyme with
FT                   metallo-hydrolase/oxidoreductase domain (ycbL-like)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74449"
FT                   /db_xref="GOA:A4YKM3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74449.1"
FT                   /translation="MSEQNQIKAKAGAMIVPVTPFEQNCTILWCEATKKAIVIDPGGDV
FT                   PNIQAAIAQANVTVEKIWLTHGHIDHVGGAADLRDALKVPIEGPHIADKYLLDNVVESG
FT                   KRFGITGVRDVTPDRWLEEGDTVQIGELVFDILHCPGHSPGSVVFFNKQMRFAHVGDVL
FT                   FNGSVGRTDLPGGSHETLISSIKDKLLPLGDDIGFICGHGAGSSFGQERMTNPFLTGMA
FT                   "
FT   gene            516493..518091
FT                   /locus_tag="BRADO0511"
FT   CDS_pept        516493..518091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0511"
FT                   /product="Putative glycosyl hydrolase, family 13; Putative
FT                   alpha-glucosidase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10400573; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74450"
FT                   /db_xref="GOA:A4YKM4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74450.1"
FT                   /translation="MAEQGAWWREGIFYQIYPRSFQDSDGDGVGDLTGIIHRLPYLMTL
FT                   GVDAIWLSPIFTSPMADFGYDIADYTGIDPVFGTMEDFDALVKAAHDGGLKLILDLVPN
FT                   HTSDQHPWFLQARQSRDDPHRDWYIWRDPAADGGPPNNWLSEFGGSAWQFDSRTGQYYY
FT                   HAFLAQQPDLNWRNPAVRAAIYNVMRFWLRKGVDGFRVDVIWHLIKDAAFRDNPANPDY
FT                   HGGRPPHEQIISRYSADQPEVHEVVAEMRAVIDEFEDRVLIGEIYLPLERLMTYYGKDL
FT                   GGAHLPFNFALLSAPWHAREIETIIADYEAALPAGAWPNWVLGNHDRPRVASRVGEDQA
FT                   RVAAMLLLTLRGTPTLYYGDEIGMHQVTISPEQVRDPFERNVPGIGVGRDGCRTPMQWS
FT                   ALPGAGFSHATPWLPVAEDYTRENVVNLSADRRSILNLYRALIRLRKQHRVLVTGNYRP
FT                   VAAQGDLLLYRREGDGEVLTVALNLADEPVSIATEGNGLDGDLLLSTWLDRDGERIDGT
FT                   LDLRGNEGVVIGRRA"
FT   gene            complement(518312..520021)
FT                   /locus_tag="BRADO0512"
FT   CDS_pept        complement(518312..520021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0512"
FT                   /product="putative glycosyl hydrolase, 13 family; Putative
FT                   Maltose alpha-D-glucosyltransferase (trehalose synthase)"
FT                   /function="1.1.1.18 : Trehalose degradation, low
FT                   osmolarity+"
FT                   /EC_number="5.4.99.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9042362; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74451"
FT                   /db_xref="GOA:A4YKM5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74451.1"
FT                   /translation="MIDDLWYKNAVFYCLSVGTYMDADGDGIGDFKGLTRRLDYLHGLG
FT                   ITAIWLMPFQPSPQRDDGYDVADYYGVDPRYGTLGDFVQFTHGCKQRGIRVIIDLVVNH
FT                   TSDQHPWFIDARSAKHSRYRDWYVWSDRKPANADKGMVFPGVQKTTWTRDKQAGAYYFH
FT                   RFYDFQPDLNTSNPEVQAEILKIMGFWIQLGVSGFRMDAVPFVIAAKGADVKKPVEQYE
FT                   MLRTFREFLQWRQGEAIILAEANVLPDTDMEYFGDDGDRMHMMFNFHVNQHLFYALAAS
FT                   DVRPLAKALQATKPRPAAAQWGLFLRNHDELDLGRLSKPQRDAVFAAFGPDKSMQLYDR
FT                   GIRRRLAPMLGGDRRRIELAYSLMFTLPGTPVIRYGDELAMGDDLKLPERNCARTPMQW
FT                   STEPHGGFTKSETAVSPVIDHGPYGYEHVNAAKQRRDPDSMLNWTERIIRMRKEVPEVG
FT                   WGDFQVIATKDPAVLIMRYDWRNNSVLFVHNLDEKPREISFDAGLPDDTGKLLINLLSE
FT                   DHSHADDRGRHTLVLEPYGYRWYRVGGLDYLLRRSDIETESPGKRARKGRKR"
FT   gene            520146..520628
FT                   /locus_tag="BRADO0513"
FT   CDS_pept        520146..520628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74452"
FT                   /db_xref="GOA:A4YKM6"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74452.1"
FT                   /translation="MESSAARISLVPADRRQSETALAIARGTSRLLRSLGFATVSELPL
FT                   PSGRRADLVALNARGAIWIVEIKSSVEDLRADHKWEAYRAHCDRLFFAFTQDLPCELFP
FT                   KSTGLIVADAYGAHLHCEAPEHKLPAPTRKLMTVRFALAAAQRMNRLIDPQGHAEV"
FT   gene            520953..521282
FT                   /locus_tag="BRADO0514"
FT   CDS_pept        520953..521282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0514"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74453"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74453.1"
FT                   /translation="MGQARAEEMAFYVIGVGADSCEKFIVAAEEQPPGTYKAIGNPDGP
FT                   YVNAISKYQQWMMGYVSAVNAARGDEGMQIKLDLTEMDSWMRNWCSRNPRRTVFHALQA
FT                   FVKTH"
FT   gene            complement(521302..521856)
FT                   /gene="regR"
FT                   /locus_tag="BRADO0515"
FT   CDS_pept        complement(521302..521856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="BRADO0515"
FT                   /product="two-component transcriptional regulator RegR, Fis
FT                   family"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74454"
FT                   /db_xref="GOA:A4YKM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74454.1"
FT                   /translation="MGAIAELTNHPDRSLLIVEDDKPFLERLSRAMETRGFTVTSCESV
FT                   AEGISQIGKSAPAFAVVDLRLGDGNGLDVVSALKRKRPEARAIVLTGYGNIATAVTAVK
FT                   MGAVDYLAKPADADDVVAALLSTTSEKSELPANPMSADRVRWEHIQRIYEMCNRNVSET
FT                   ARRLNMHRRTLQRILAKRAPK"
FT   gene            complement(522019..523380)
FT                   /gene="regS"
FT                   /locus_tag="BRADO0516"
FT   CDS_pept        complement(522019..523380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regS"
FT                   /locus_tag="BRADO0516"
FT                   /product="two component sensor histidine kinase (RegS);
FT                   putative membrane protein"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74455"
FT                   /db_xref="GOA:A4YKM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74455.1"
FT                   /translation="MTEAMTDALIIDTPDTDYRHPRQRVRLDTILRLRWLAALGQLSAI
FT                   FIVVQGLEFDLPVVPCLAVISVSALLNLGLQIAFNPMQLLEPAHAGGLLALNIIELTVL
FT                   LYLTGGLENPFSYMFLAPVLIAATALPVRLTIMLGLLAVACATALFFMHLPLPWEGEEP
FT                   LIFPPIYLFGVWLSIALAIGVTSLYAFQVTEEARKLSNALAATELVLAREQHLTQLDGL
FT                   AAAAAHELGTPLATIVLISRELERALQDNSHVTSDIKTLREQAQRCRDILGKITQLSSV
FT                   GSMYDRMKLSTLIEETVAPHRDFGVEIKVRVAVAATKEPVGSRNPAILYGVGNILENAV
FT                   DFARNAVEVNAWWNNDTVELVISDDGPGFAPDILKRIGEPYLSRRRSGEDGQGGNQGGG
FT                   LGLGVFIARTLLERTGAKVSFTNRTFPDHGAVVQIVWPRRRFEAVEDGEDDQPE"
FT   gene            523480..524271
FT                   /locus_tag="BRADO0517"
FT   CDS_pept        523480..524271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0517"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74456"
FT                   /db_xref="GOA:A4YKN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74456.1"
FT                   /translation="MTQDDAAPTPSSAFSPGSPAIAVSRLTKIYKTATAVDGISFSIRR
FT                   GSITGLLGGNGAGKTTTIAMIMGLVQPTSGTVEVLGHKMPGEAAAVLGRMNFESPYVDM
FT                   PMRLTVRQNLTIFGRLYAVAHLKERIAELAAQLDLTDFIDRASGKLSAGQKTRVALAKA
FT                   LINDPELLLLDEPTASLDPDTADWVRGHLERYRKRRGATILLASHNMLEVERLCDRVII
FT                   MKRGRIADDDSPAAIMARYNRSTLEEVFLDVARGRDREAAQ"
FT   gene            524268..525080
FT                   /locus_tag="BRADO0518"
FT   CDS_pept        524268..525080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0518"
FT                   /product="putative ABC transporter, permease protein"
FT                   /function="4.3.A.1 : The ATP-binding Cassette (ABC)
FT                   Superfamily + ABC-type Uptake Permeases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74457"
FT                   /db_xref="GOA:A4YKN1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74457.1"
FT                   /translation="MNDLSLRIAPHRIGAMVLRYWYLLLSSWPRLLELMYWPTLQIITW
FT                   GFLQTYIASNAGFFARAGGTLIGAVILWDILFRGQLGFSISFLEEMWARNIGNLMMSPL
FT                   TPVEFLLALMTMSLVRLAIGIIPMTLIAVWFFDFNFYSLGLPLIAFFCNLIFTSWAVGI
FT                   FVSGLVLRNGLGAESIVWTLMFALMPLACVYYPVQVLPHWLQLVAWSLPPTYVFEGMRA
FT                   LLTDHVFRSDLMLTALGLNAALLLASFAAFIALLRSARRAGSLLSSGE"
FT   gene            525205..526533
FT                   /locus_tag="BRADO0519"
FT   CDS_pept        525205..526533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0519"
FT                   /product="putative intracellular PHB depolymerase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74458"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74458.1"
FT                   /translation="MPIGEFGGAPPLASEGSPVLTTPMYWMYEMAHASLNPARAVTDAT
FT                   KILFQNPLNPWAHTEMGKSIAAACELFERTTRRYGKPEWGLDETEVNGIRTAVEVRSIW
FT                   EKPFCRLLYFDRKLTRPLRAPQPRLLIVAPMSGHYATLLRGTVEAFLPTHEVYITDWSD
FT                   ARMVPLAEGRFDLDDYIDYVIEMLRFLGTNMHVMAVCQPAVPVLAAVSVMEAERDPFAP
FT                   ISMTLMGGPIDTRRNPTGVNNLAQERGIDWFRNHVITKVPFPHPGVMRDVYPGFLQLNG
FT                   FISMNLDRHVDAHKALFANLVKGDGDQVDKHRDFYDEYLAVMDLAAEYYLQTVETVFIR
FT                   HALPKGEMTHRGVLVDPSKVTRVALMTVEGEKDDISGLGQTEATHGLCSSIPDHRRVHY
FT                   VQPGVGHYGVFNGSRFKSEIVPRINDFMLSAADPKSLLAIAAE"
FT   gene            526985..527581
FT                   /locus_tag="BRADO0520"
FT   CDS_pept        526985..527581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0520"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74459"
FT                   /db_xref="GOA:A4YKN3"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74459.1"
FT                   /translation="MPPRGTIIEAKDFAQRHGAWIAARLGRLPKAAPFLPGTLVPLRGV
FT                   PHKIVHRAGERGTVWTETRDSGEKILCVAGGIEHTERRVLDFLKREARRDLQKAADAYA
FT                   DQLGVKVKRLSIRDQSSRWGSCTSAGSLSFSWRLILAPPFVLDYLAAHEVAHLIEMNHS
FT                   PRFWKVCGKICGSVERAKKWLDTCGNDLHRYGVED"
FT   gene            527889..530573
FT                   /locus_tag="BRADO0521"
FT   CDS_pept        527889..530573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0521"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL) with PAS and GAF domains"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74460"
FT                   /db_xref="GOA:A4YKN4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74460.1"
FT                   /translation="MNRTMLASEFQTAAPAPLLSAALDRTSEAVVFLDGHGRVHHANKA
FT                   AAELLGRDPASLAGADLIDLGLPADVMPARSTDETAEDDAADGRPARAQPDLACELTIR
FT                   KGDGSRCRVHLTRCDLPAGLTPVRALLLLRDITTEVQLRERNALMTSVADRSNRGVVVA
FT                   DHELKILYTNAAFTSIFGFTAEEAQGQQVEKLLVGPCTDPAMVERLKQCIIDDQGVEED
FT                   LLIYDKDGHEIWTTAHVKAHRNRQGKVKYLVGLLSDIRETKQLRSLQQLIMSSLASDVA
FT                   ITTIADQLCRRVEQLAPDVVCSLLHVDSEGKVHPLGGPSLPTAYSESLDGVAIGPDVGS
FT                   CGTAAYLCEPVLARDIDNDPRWQPYKAGPLDAGLRACWSTPIKGKDGRVIGTFAFYFRE
FT                   CRGPSPWHEQIVAACVQLGSLAIERQEVRSTISQVAYHDMLTGLPNRARIPSMIAEAIK
FT                   ACPEGSHLAVAFLDADNFKDVNDTLGHAAGDEFLVAFANRLRAQIRPGDMLGRLGGDEF
FT                   VIVLQNRGALEASLAAARITAALAMPLTIGKRQVPMSASMGLSLYPDNATDIETLIKQA
FT                   DGAMYKAKRAGRATYRFFSADIDKLAEERLMHSTALREAIASEALTLHYQPQICTRNGA
FT                   IHGVEALARWHDPVLGEVSPAKFIPLAEECGLIEQIGVWSIKTACQQMASWRRAGLDIP
FT                   CMSVNLSPINFQNVNLAAVVAQILAANDLPANMLMLEITEGVILNERATVIATMSELRN
FT                   MGVGLSLDDFGTGYSSLSRLAQLPIHELKIDRSFMRDFENGQGTRAIVTAVVRVGQSLD
FT                   VKVVAEGVETEGQRKLLAELGCDAMQGFLFARPMAASAFSRWLLDYSAHRASLMLRQVG
FT                   RALAQAAGPAAAGTTTRPAAAAG"
FT   gene            complement(530680..532914)
FT                   /locus_tag="BRADO0522"
FT   CDS_pept        complement(530680..532914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0522"
FT                   /product="putative penicillin-binding protein
FT                   pbpC/mrcB-like"
FT                   /function="4.S.15 : antibiotic"
FT                   /EC_number="2.4.1.129"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74461"
FT                   /db_xref="GOA:A4YKN5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74461.1"
FT                   /translation="MRMARGRKQGGGGRKEPRFGLAAAMADLRLDPKDRIPAGEDAPKK
FT                   STNKKKPVEPDDEDDVPAREPKANQPKPAPAKSKPARAKPRWGTSIGRMAYWAVVCGLW
FT                   GVIALVGVVIWAGAHLPPIQSLEIPKRPPTIEIVGVDGTMLAQRGEMAGANVALKDLPP
FT                   YLPKAFIAIEDRRFYQHFGIDPIGIARALVANILHRGVSQGGSTLTQQLAKNLFLTQER
FT                   TLARKLQEAELALWLERKYSKREILELYLNRVYFGSGAYGVEAAAQRYFGKSARQVTVA
FT                   EAAMLAGLVKSPSRLAPNRNPEGAAKRAQTVLAAMADAKFITEAQAQAQIAHPSVAVKP
FT                   AGAGTVNYVADWIGEVLDDLVGQVEDSIVVETTIDPKLQSVAEAAVIDELAAKSVKFNV
FT                   SQGALVAMTPDGAVRAMVGGRNYADSQFNRAVTARRQPGSAFKPFVYLTAIEQGLTPDT
FT                   VRQDAPLDLKGWRPENYTKEYFGPVTLTQALAMSLNTVAVRIGLEVGPKNVVRTAHRLG
FT                   IASKLDPNPSIALGTSEVSMIELVGAYAPFSNGGLAISPHVVTRIKTLDGKLLYMRQTE
FT                   QPAQVIDPRSVAMMNQMMQETLISGTAKKAEIPGWVAAGKTGTSQDFRDAWFIGYTSHL
FT                   VTGVWLGNDDNSPTKKATGGGLPVEVWTRFMRAAHQGVPVAALPNAQGAGLVPTLAQIA
FT                   SQITAPTAPAPTAAYSARTAAPGPSRGNARPDPAAGLDGWLVDRLFGGQR"
FT   gene            533057..533482
FT                   /locus_tag="BRADO0523"
FT   CDS_pept        533057..533482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74462"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74462.1"
FT                   /translation="MGHIDPTKEVFAQFRENDRPGPIHMLNLVRLRKEAAYPDGRKVSG
FT                   AEAYAAYGRESGPVFERLGGRIVWQGRFELMLIGPQEERWDHCFIAEYPSVQAFVEMIR
FT                   DPVYREAVKHRQAAVEDSRLIRHAVLPVGKNFGEVPE"
FT   gene            533814..534146
FT                   /locus_tag="BRADO0524"
FT   CDS_pept        533814..534146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0524"
FT                   /product="putative transcriptional regulatory protein, ArsR
FT                   family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8416957, 1838573, 12829264; Product
FT                   type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74463"
FT                   /db_xref="GOA:A4YKN7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74463.1"
FT                   /translation="MCLCVVMIESDIFKALADPTRYAIFEKLAAGRMNASALREGLTIS
FT                   QPAMSQHLAVLRDAGLVREERQGRFVNYEVDPDGLARIARWLAKYRAYWPSRVDALKTL
FT                   LKDMDQ"
FT   gene            534143..534502
FT                   /locus_tag="BRADO0525"
FT   CDS_pept        534143..534502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74464"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74464.1"
FT                   /translation="MTDQMADQQGDELVLDYDLDASPDKVWRALSIPALRDNWLPPGDL
FT                   ADAAPISSTPGEEVRYRMRDDAPPYLESIVTFQVVPKDDGGTRLRIIHGLPATMLLRRA
FT                   PQAANSNARRLMRVA"
FT   gene            534544..535161
FT                   /gene="clpP"
FT                   /locus_tag="BRADO0526"
FT   CDS_pept        534544..535161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="BRADO0526"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   (Endopeptidase Clp)"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /function="3.1.3.4 : Proteases, cleavage of compounds"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.4.21.92"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12213919; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74465"
FT                   /db_xref="GOA:A4YKN9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74465.1"
FT                   /translation="MRDTMQLVPMVIEQSSRGERSFDIYSRLLRERIVFLNGEVNDTVS
FT                   ALVCAQLLFLEAENPKRPIHLYINSPGGVVTSGLAMYDTMQFVKAPVHTLCMGTARSMG
FT                   SFLLMAGEPGERTALPNASLHVHQPLGGFQGQASDIMIHAREMEQTKRRMIRLYAEHCG
FT                   RSYEDVERTLDRDHFMTADEAQDWGLIDRVVKQRDLKSLSSD"
FT   gene            complement(535327..536577)
FT                   /locus_tag="BRADO0527"
FT   CDS_pept        complement(535327..536577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0527"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, periplasmic binding protein"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74466"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74466.1"
FT                   /translation="MRTSLFGLVGFKAWAIALAASLTVALPATSAYAQKKYDTGATDTE
FT                   IKIGQTVPFSGPASAYAGIGKTQAAYLRMINEKGGINGRKLNLIQYDDAYSPPKAVEQV
FT                   RKLVEGDEVLFTFQIIGTPSNAAVQKYLNAKKVPQLLASTGASRFTDPQNFPWTIAYNP
FT                   NYQSEGRIYAKYILANHPNAKIGILYQNDDLGRDYIAGLRSGLGAKADSMIVSEASYEL
FT                   SDPTVDSQIVKLKSSGADLLYNASTPKFAAQAIKKLADLGWKPVHILDINASPVSATLK
FT                   PAGLDISKDIISTNYGKDPADPQWKDDPGVKAYFEFMDKYYPEGDKLNTVNTYGYSTAE
FT                   LLVQILRQCGDDLTRENVMRQAANIKGFVPSLALPGLSINTSPTDFRINKQMQMMRFNG
FT                   ERWELFGPIIEDTGAAG"
FT   gene            complement(536945..538129)
FT                   /locus_tag="BRADO0528"
FT   CDS_pept        complement(536945..538129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0528"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, periplasmic binding protein"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74467"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74467.1"
FT                   /translation="MAATLSVTSAQAQKKYDPGASDTEIKIGQTVPFSGPASAYASIGK
FT                   TQAAYFNMINEQGGINGRKIKLIQYDDAYSPPKAVEQVRKLVEDDEVLLTFQIIGTPSN
FT                   AAVQKYLNAKKVPQLFAATGATKFTDPKNFPWTMGYNPNYFTEGRIYGQYILKEHPNAK
FT                   IGVLYQNDDLGKDYLNGIKADLGDKGSMIVAEASYEVSDPTIDSQLLKIKSAGADLLFS
FT                   AATPKQAAQAIKKLHELDWHPVHIVDINATSVGAVLQPAGLDASKGVISVNYGKDPLDP
FT                   QWKDDPGMKRYFEFMAKYYPDGDKNSNFNTYGYGNAELLVTILKMCGDNLTRENVMKQA
FT                   ASLKDVVGDLSLPGMKINTSPTDYRVNKQLQMMKFNGERWELFGPILEDKGPAG"
FT   gene            complement(539244..539603)
FT                   /locus_tag="BRADO0529"
FT   CDS_pept        complement(539244..539603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0529"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74468"
FT                   /db_xref="GOA:A4YKP2"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74468.1"
FT                   /translation="MIANIVVGLIGLLHVYILVLEMFLWTKPAGLRAFNNTLERAEATK
FT                   VLGANQGLYNGFLAAGLFWGLAHPAPAFAFQIKIFFLLCVLVAGLYGAATASRKILFIQ
FT                   SVPATIGLVLVWLAG"
FT   gene            complement(539728..542523)
FT                   /gene="glnD"
FT                   /locus_tag="BRADO0530"
FT   CDS_pept        complement(539728..542523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BRADO0530"
FT                   /product="[Protein-PII] uridylyltransferase (PII
FT                   uridylyl-transferase) (Uridylyl-removing enzyme) (UTase)"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /function="1.8.3 : Nitrogen metabolism"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /EC_number="2.7.7.59"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8412694; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74469"
FT                   /db_xref="GOA:A4YKP3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74469.1"
FT                   /translation="MDSVATDSKAFTSADFDSAGIAAAVDALAKQHSGREDMFRAAVVQ
FT                   FLKAELVKARAAAQAQLLQDRHGRHCAERLCVVQDEIIRILYAAATEHLYRSDVPSGAE
FT                   RMAVVATGGYGRGLMAPESDIDLLFILPYKQTAWGEQVAEAILYSLWDMGLKVGHATRS
FT                   VDESIRQARGDMTIRTAILETRYLAGDKPLYDELVQRFDTEVVQGTAAEFVAAKLAERE
FT                   ERHRRGGQSRYLVEPNVKDGKGGLRDLHTLFWIAKYVYRVRETAELVERGVFDAHEYRT
FT                   FRRCSDFLWSVRCNLHFVSGRPEERLSFDLQREIAVRLGYTSHPGMQDVERFMKHYFLV
FT                   AKQVGNLTAILCAKLEDQQAKAAPVLSRMISRLTTGSTWRRVPESDDFIVDNNRINLAA
FT                   PDVFKHDPVNLIRIFRLAQKNNLAFHPDAMRAVTRSLNMINAELRENPEANRLFMEILT
FT                   SNDAETVLRRMNETGVLGHFISAFGRIVSMMQFNMYHHYTVDEHLIRCIGFLQEIERGG
FT                   HDEFVLASDLMRKIRPEHRAVIYITVLLHDVAKGRPEDHSVAGAKIARRLCPRLGFNNA
FT                   DTELVAWLIEEHLTMSTVAQSRDLSDRRTIEKFAAVVQSVEQMKLLTILTTADIRGVGP
FT                   GVWNGWKAQLLRTLYYETEPVLTGGFSEVNRAKRITAAQAEFRNAFTDWPEDELNTYIG
FT                   RHYPAYWLKVELPRKIRHARFVRSSEDAGHKLAINVGFDPARGVTELTIFAMDHPWLLS
FT                   IIAGACASAGANIVDAQIYTTTDGRALDTIAISREYERDEDEGRRATRIGETIEQVLEG
FT                   KLRLPDAVARRTTRGKQHKAFSVEPEVSINNQWSELYTVIEVSGLDRPGLLYELTTAIS
FT                   KLNLNIASAHVATFGERARDVFYVTDLLGAQINAPTRQAAIKSALLHLLASEDAAAQPA
FT                   A"
FT   gene            542718..543692
FT                   /locus_tag="BRADO0531"
FT   CDS_pept        542718..543692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0531"
FT                   /product="putative sulfonate ABC transporter, periplasmic
FT                   binding protein (ssuA/ycbO-like)"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /function="4.S.5 : alkanesulfonate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74470"
FT                   /db_xref="GOA:A4YKP4"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74470.1"
FT                   /translation="MGGLSRRALAGLAAVVLLGCGAATAAEPVKEIRIDWATYNPVSLV
FT                   LKQKGLLEKEFAKDGISITWVQSAGSNKALEFLNAGSLDFGSTAGSAALVARINGNPIK
FT                   SIYVYSRPEWTALVTGKDSKIVSVADLKGKRVAVTRGTDPHIFLVRALLGAGLTDKDIT
FT                   PVLLQHADGKAALIRGDVDAWAGLDPMMAQAEVEEGAKLFYRKADANTWGVLNVREQFL
FT                   KDNPEIVRRVLATYEVARKDALANYDDLKKTFIAVTKLPETVVDKQLKERTDLTHSRIG
FT                   APQRDSILAAGLALQQAGVVDAKVDVKATLDALIDDQVPLPTN"
FT   gene            544045..544893
FT                   /locus_tag="BRADO0532"
FT   CDS_pept        544045..544893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0532"
FT                   /product="putative sulfonate ABC transporter, permease
FT                   protein (ssuC/ycbM-like)"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="4.S.5 : alkanesulfonate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74471"
FT                   /db_xref="GOA:A4YKP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74471.1"
FT                   /translation="MAMTVELQAPAAAAPPHTVSQPWLKRLARPLLGLLLPLSLALAWE
FT                   LAVRAGWSNGRLVPPPSKVFTTIAELARSGELSRHIAATLSRVGIGFGLGVAAGTLLGG
FT                   ICGYWSLARRLVDPTIQALRAIPSIAWVPLFILWLGIFETSKVALIAVGVFFPVYLGLT
FT                   GAILSVDRKIVEVGRVFRLSGPAMIRRILLPAVLPAYVVALRVGLGLGWMFVVAAEFMG
FT                   ASEGLGYLLIDGQQLGKPAQIVAAIVIFAVIGKATDWLLEIATAPLLRWQDSFARQSGA
FT                   A"
FT   gene            544893..545678
FT                   /locus_tag="BRADO0533"
FT   CDS_pept        544893..545678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0533"
FT                   /product="putative sulfonate ABC transporter, ATP binding
FT                   protein (ssuB/tauB/ycbE-like)"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74472"
FT                   /db_xref="GOA:A4YKP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74472.1"
FT                   /translation="MLQLSSVTKVYPNGVHALERFSSEIQLGEIVAIIGGSGCGKSTLL
FT                   RAVAGLDRASAGTVTLDGEAITAPHAKVGIIFQEPRLLPWLSVADNIGFGLSELPAAER
FT                   RERVARALDRVGLTEKAKVWPRELSGGQAQRVAIARALVAQPEVLLLDEPFSALDAFTR
FT                   KDLQDHLLDLWADTRPTLVLVTHDVEEAVVLADRVLVMRPHPGRLFEEITINLSRPRDR
FT                   NAPLFEQFKRHVLTALDRSLDRTLLDTQGRREPGGGLWW"
FT   gene            545735..546250
FT                   /locus_tag="BRADO0534"
FT   CDS_pept        545735..546250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74473"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74473.1"
FT                   /translation="MDAAELRAMQAPIKERYKADPSAAVITLKAKGEVGGEGLTCKLET
FT                   GRAMAVAGLHPATGGSGLELCSGDMLLEALVACAGVTLKSVATAVEVPLKSGLVLAEGD
FT                   LDFRGTLGVDKEAPVGFQEIRLRFEVDTDAPQDKLDLLLKLTERYCVVYQTIKNGPKVS
FT                   VSLKRVAA"
FT   gene            546440..547231
FT                   /locus_tag="BRADO0535"
FT   CDS_pept        546440..547231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0535"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74474"
FT                   /db_xref="GOA:A4YKP8"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74474.1"
FT                   /translation="MPFDSSFLLLLGLRMAIAASFVVSASMIAERTGPVIGALVATLPI
FT                   SAGPTYVFLALDHDAAFIAQGALTSLPVNAATIFLSLAYAVLAQRHSVWVASATAVAVW
FT                   LGLASLIKSVQWTLAMGIVANIVTFVICLPLLQRYRHAKMPLIVRRWYDVPLRASLVAT
FT                   LVATVTSVSGWAGPGVSGILALFPIVFTSMMLILQPRIGGPATAAVMANGAWGLIGFSL
FT                   AVVVLHLGSLHLGAVAGLSGALATCVGWNLGLWALGRRRPA"
FT   gene            547345..547854
FT                   /locus_tag="BRADO0536"
FT   CDS_pept        547345..547854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0536"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74475"
FT                   /db_xref="InterPro:IPR013423"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74475.1"
FT                   /translation="MPTANGTANGQPKWIANGLKDLGFHETGNNRGIQKFIDQAHCGAE
FT                   GDPWCAIWTNAKLEQSGVPGTRSASSQSFRTNKNFVKLDRPALGAIAVYTRGKPNSGLG
FT                   HVGFYMGETRTQVLTLGGNESDAVREQFEPKTRLVGYFWPKSVDLPKLGSIKVASEDGH
FT                   PVGSND"
FT   gene            complement(548056..550806)
FT                   /gene="mutS"
FT                   /locus_tag="BRADO0537"
FT   CDS_pept        complement(548056..550806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="BRADO0537"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74476"
FT                   /db_xref="GOA:A4YKQ0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74476.1"
FT                   /translation="MASFRAMTIQQPISVPVPQEATPAEAPAKLTPMMEQYLDIKAAHP
FT                   GLMLFYRMGDFYELFFEDAEVASKALGIVLTKRGKHQGQDIPMCGVPVERSEDYLHRLI
FT                   AQGIRVAVCEQMEDPAAARARGNKSVVKRGVVRVVTPGTLTEDNLLDARANNYLLSIAR
FT                   SRGSSGGDRLGLAWIDISTSDFIVTECAFAELTATLARINPNEVIVSDALYSDEAFEPV
FT                   LRELAAVTPLTRDVFDGATAERRLCDYFAVATMDGLAVLSRLEATAAAACVTYVERTQV
FT                   GQRPPLAPPAREATGSTMAIDPATRANLELTRTLAGERRGSLLDAIDCTVTSAGSRLLA
FT                   QRLAAPLTEPAQIGRRLDAVNAFVADSAAREDIRVILRGAPDMTRAMARLSVGRGGPRD
FT                   LAALRDGILAADQALARLSVLDQPPQEIASVMAALARPARALADEFARALDEQLPLIKR
FT                   DGGFVRSGYDATLDETRNLRDASRLVVASMQARYADQTGVKALKIRHNNVLGYFVEVTA
FT                   QHGDKLMSAPLNATFIHRQTLAGQVRFTTSELGEIEAKIANAGERALNLELEIFDRLCA
FT                   QALAIGDDLRAAAHGFAMLDVATALAKLALDDNYVRPEVDGSLGFAIEGGRHPVVEQSL
FT                   KREGQPFIANSCDLSPTPGHKSGQLWLLTGPNMAGKSTFLRQNALIALLAQIGSFVPAS
FT                   RARIGIVDRLFSRVGAADDLARGRSTFMVEMVETAAILNQAGERALVILDEIGRGTATF
FT                   DGLSIAWAAIEHLHESNRCRTLFATHYHELTALAAKLPRLFNATVRVKEWQGDVVFLHE
FT                   VLPGSADRSYGIQVAKLAGLPPAVISRAKSVLAKLEAADRGQNARALVDDLPLFAVPSR
FT                   AAVEPAMSKETEELIAAVKDLHPDEMTPREALDALYRLKAKLPAK"
FT   gene            551340..552548
FT                   /locus_tag="BRADO0538"
FT   CDS_pept        551340..552548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0538"
FT                   /product="putative acetyl-CoA acetyltransferase
FT                   (phbA/atoB/paaJ-like)"
FT                   /function="1.1.2.1 : Degradation of short-chain fatty
FT                   acids"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74477"
FT                   /db_xref="GOA:A4YKQ1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74477.1"
FT                   /translation="MRDVFICDAVRTPIGRFGGALAKVRTDDLAATPLKALKAKHPNLD
FT                   WAAVDEVFFGCANQAGEDNRNVARMALLLAGLPDSIPGQTLNRLCASGLDAVGAAGRAI
FT                   RAGEVDLAIAGGVESMTRAPFVQGKATEAFSRSAEIFDTTIGWRFINPLMKSQYGVDSM
FT                   PETGENVAEEFQVSRADQDAFAIRSQQRAGQAIASGYFAAEIAQVAVPGGKAGPIIVDK
FT                   DEHPRPETTLEGLAKLKPIVRNPGTVTAGNASGVNDGAAAMILASEAAVKKHGLTPRAR
FT                   VLGLASAGVPPRIMGIGPVPAVRKLLERLGLKITDFDLIELNEAFASQGIACLRQLGVA
FT                   EDADFVNPHGGAIALGHPLGMSGARIAMTAVHGLEVRGGKRALATMCVGVGQGVALAVE
FT                   MVN"
FT   gene            552643..553554
FT                   /locus_tag="BRADO0539"
FT   CDS_pept        552643..553554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0539"
FT                   /product="Catechol 1,2-dioxygenase"
FT                   /function="1.1.3.8 : Tryptophan utilization"
FT                   /EC_number="1.13.11.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74478"
FT                   /db_xref="GOA:A4YKQ2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74478.1"
FT                   /translation="MPKDRAMTISREQDVTSAVLAVMEQTSNPRLREIMVSLIRHLHGF
FT                   VRDVRLTEAEFREAAALIAELGQRTNDTHNEVVLMAGSLGVSPLVCLLNNGDGGNTETA
FT                   QSLLGPFWRLNSPRTENGGSILRSATPGPALFVQGHVVDPNGAPVAGAEVDVWHASPVG
FT                   YYENQDPDQADMNLRGKFTTDEDGRFWFRSVMMVGYPIPTDGVVGRLLKAQGRHPYRPA
FT                   HLHALIVKPGYRVLISQVYDPNDPHIDSDVQFGVTKALLGNFIRHDEPHPTEPDVTAAW
FT                   YSLDHVYRMESGDTVLPRAPIK"
FT   gene            complement(554354..555859)
FT                   /locus_tag="BRADO0541"
FT   CDS_pept        complement(554354..555859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0541"
FT                   /product="putative drug resistance transporter,
FT                   EmrB-FarB-QacA family"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74479"
FT                   /db_xref="GOA:A4YKQ3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74479.1"
FT                   /translation="MTICAMTATIMQALDTTIANVALPYMQGTLSASTDQINWVLTSYI
FT                   VAAAIMTAPVGWIANRFGRKRTFIICSAGFTLASVMCGLAQDITQMVLFRLLQGVFGAS
FT                   LVPLSQAVMLDSYALHERAKAMAIWGMGVMLGPIMGPSLGAWLTETYSWHWVFFVNLPF
FT                   GAVTVLGLMAFMEETKPNTALTFDWFGFMALAIGIGSLQIALDRGEDQGWLESNEIIIE
FT                   FIVAAIGFYYFLAHSLTTKRPFIQFALFKDRNFVGGCVFMTVMGLVLFSTMALSSPYLQ
FT                   NVIGYPIITAGVLLATRGCGTFVAMMLVGRLLRTIEARTLIIVGLSLTALSLFQMTGWT
FT                   DQTGVPEIVTISIMQGFGFGLVFVPLSTVAFLTLPGALRTDGTSMLTLVRNVASSIGIS
FT                   IAIAQLTEGTRRNHAILVEHINPFNHALQMPNVAGLLNLSTDAGRAMADAMVMVQAQIL
FT                   AFSHDYQLVMTFILVSIPLAVMIGSTRKALRQQSAPADHAVME"
FT   gene            complement(555915..557072)
FT                   /locus_tag="BRADO0542"
FT   CDS_pept        complement(555915..557072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0542"
FT                   /product="putative efflux pump protein (HlyD domain),
FT                   EmrA-FarA family"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74480"
FT                   /db_xref="GOA:A4YKQ4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74480.1"
FT                   /translation="MAEPALKLAPEQKASPDAAPPAAAAAKPARPGFLRRYRRTLLLVV
FT                   LPLVAAIGGFVLYLNGGRYVTTDDAYVGAQKVLITPDISGKIIKVLVKEGQQVEKGDEL
FT                   FEIDAVPYRLAVDQAKAALAQARTAYDNLTANIKIYGQMLDLANQGIDLKQKDVERKQT
FT                   LAKNNFGSQLDLDNAANALVTAGAQAQFIKQQLSNAKTQLLGNPDLPLEEFPPYVQAKA
FT                   KLEDAQRDLDHTTLRAPMPGIATQVDQIQLGRFVAAGTPVFSVIDISNPWVDANPKESD
FT                   FTYVAVGQPVELDVDAFPNHRFKGTVSSLSPGTGAQFAILPPQNATGNFVKVVQRVPVR
FT                   IAFDKTDKFVARLKAGMSVNVSIDTGHERTLAGLFGSAHAAGKDE"
FT   gene            complement(557065..557544)
FT                   /locus_tag="BRADO0543"
FT   CDS_pept        complement(557065..557544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0543"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74481"
FT                   /db_xref="GOA:A4YKQ5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74481.1"
FT                   /translation="MTRTSADVNFLFTLAELQRLMRAYADKEAARFGMTRAQWAVLAKV
FT                   ERNEGMKQSELADQLEMQPITLTRLIDKLADAGLIERRGDDTDRRVNRLYLKKAARPLL
FT                   AKLAVLRGELTDTALQGISPAEAERLMTHLEAIKENVRNALQSLCDEQRKEQRYG"
FT   gene            557724..558251
FT                   /locus_tag="BRADO0544"
FT   CDS_pept        557724..558251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0544"
FT                   /product="putative transcriptional regulator, Fur family;
FT                   zinc uptake regulator ZUR"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.3 : Repressor"
FT                   /function="3.3.1 : Operon (regulation of one operon)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74482"
FT                   /db_xref="GOA:A4YKQ6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74482.1"
FT                   /translation="MTLARPTFPAPDHDHGRCAADALDHAERVCAQRGQKFTPQRRQVL
FT                   EALLSSHRPLGAYEIIEELAKASTKASTKASTKAGARPAPITVYRALEFLMANGLVHRI
FT                   ESRNAFLACAHDHEQTALVAFLICESCGAVGEVPAAPIAESLKSAAAASGFTPKMSVVE
FT                   ITGLCAHCQKAA"
FT   gene            558568..559521
FT                   /locus_tag="BRADO0545"
FT   CDS_pept        558568..559521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0545"
FT                   /product="putative permease (drug-metabolite transporter
FT                   DMT family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74483"
FT                   /db_xref="GOA:A4YKQ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74483.1"
FT                   /translation="MSAISHSSAATRPLGPGAIAITLVLCLSWAFNQIAIKLALPEVPP
FT                   MLQATFRSAGALPVLLVFAQLRGVRMFERDGTLWLGLIAGALFGFEFVLIYQGLLLTSA
FT                   SRAVVFLYTAPFFVALGSFRFLGERLGPAQWGGLAMSFTGVALAIGIPQANVDSRVLLG
FT                   DLLVVGGGLLWGVTTVFIKGTRMRLIAPERALGYQVAVSVPIMAAAALIAGERLTHVPS
FT                   PFVLGLLAYQAIWVVGTTFTIWFALIKAYSASKLSAFTFITPLFGVVASYFILHDALTL
FT                   AFGLAAVLVIIGLFLVNRPNRAVAAATDPLLTVTKT"
FT   gene            559535..560836
FT                   /gene="ispG"
FT                   /locus_tag="BRADO0546"
FT   CDS_pept        559535..560836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="BRADO0546"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /function="1.5.3.19 : Isoprenoid biosynthesis"
FT                   /EC_number="1.17.4.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11752431; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74484"
FT                   /db_xref="GOA:A4YKQ8"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74484.1"
FT                   /translation="MNKPETVTENSLASDVAGPAPRHQTTKVMVGNVAVGGGAPIVVQS
FT                   MTNTDTADVDSTVAQVAALARAGSEMVRITVDRDEAAAAVPHIREQLDKRGITTPLIGD
FT                   FHYIGHKLLTEYPACAEALAKYRINPGNVGFKDKRDTQFSTIIELANKYGKPVRIGANW
FT                   GSLDQELLSKLMDENAASANPRNARAVMREAMVQSALHSAERAQELGMPKDRIILSAKV
FT                   SAVQDLIAVYQDLAARSDYAIHLGLTEAGMGSKGIVASSAALGILLQQGIGDTIRISLT
FT                   PEPGGDRTLEVQVAQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELARSIQDFIRDEM
FT                   PTWKIKYPGVEALNVAVMGCIVNGPGESKHANIGISLPGTGEAPAAPVFVDGKKFRTLR
FT                   GPTIAADFKALVIDYIDQRYGSGAKAPESVTAAE"
FT   gene            complement(560961..563564)
FT                   /locus_tag="BRADO0547"
FT   CDS_pept        complement(560961..563564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0547"
FT                   /product="hypothetical protein; putative GMP reductase
FT                   domain"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74485"
FT                   /db_xref="GOA:A4YKQ9"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74485.1"
FT                   /translation="MKYMAFAPIDRVVSRINTNSDSDFSLFMELLYAGELIVKLTTAAF
FT                   VACIEDDREKHRYQLCHALVRADGIGEWASKLEEILVGPPAQHLAQELVTDRRVFMERL
FT                   GAGTWQYEALDRLNSVLAGVHAAQPTGDKISLRTWFSRFAELRNKTRGHGAITPATCAR
FT                   LVPALKSSIELLIDNNPIFRRPWAYLHRNLSGKYNVVPIGGDATAFRSLTTNAALGTSL
FT                   PDGVYISAGKLRPVELLHSDLSLSDFYLPNGAFKGKSYELHSVITDSRLSGNAQPYLAV
FT                   ANNRPPSETEGQRELDVVGNVFTNLPTVPSGYVRRPRLEAEASKIISNDRHPIVTLVGR
FT                   GGIGKTSLVLAVLHEITSTTRYQAIVWFSARDIDLTTEGPKVVQPRVMAEKDIAAEYLA
FT                   LVGEDQSETSKKTSAVSRMSEHMRSCPIGPTLFVFDNFETVRNPVDLFQWIDTNIRLPN
FT                   KVLITSRFREFKADFPIEVLGMEPQEAENLIDQLAIKLGISHIISSKQRDQIIEESGGH
FT                   PYIIKIVLGEIANTHSFSKPSAMMVRKDEILEALFERTYANLSPLAAHTFLTLSAWRSL
FT                   VPQLALEAVLLRHHHREGVDPEQAIEELVRMSLVDRTRAADNTSFLGIPLAAALFGVKK
FT                   LNVHPHRQLIESDTRFLQDIGATVTTGLKEGIAPRIEALFKKVAKRISDGSVSFEEMRP
FT                   ILEYVARSYHPAWLLLAQINRESEGEKGVEATANYLRRFLEKNPSAEDSQQAWQQLIAI
FT                   YRATGNVIGGCNAFLRAAEIKDPPLHQIASMAHWLNSEREIIDQMSVVERGDLFKPIAK
FT                   LLESYLPVASATDLSRLAWLHLHAGDDGRALEVAQLGLKREPENRFCQGLVDRLQ"
FT   gene            563921..564433
FT                   /locus_tag="BRADO0548"
FT   CDS_pept        563921..564433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0548"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74486"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74486.1"
FT                   /translation="MNLDVSEMTLAETSLVIDYFYSSSIEQLDLMGIDPTRMPAKPVWA
FT                   GLFKTLYDTPFTERAALLVNWRLDGRPIGFSSCDRIVYGSRAHMHLHVTEPELRGRGLG
FT                   TECVRRSIDLYFDRLQLKQLFCEPNAYNTAPNRALQKAGFRYLKTYKTVPGPMNYHQAV
FT                   TRWMIER"
FT   gene            complement(564468..564755)
FT                   /locus_tag="BRADO0549"
FT   CDS_pept        complement(564468..564755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0549"
FT                   /product="putative plasmid stabilization system protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74487"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74487.1"
FT                   /translation="MRVRWSQSSLTEIGDIFSYIHERSPTAAASVVARIDRLTSSLATF
FT                   PWAGHVTDDPNVRVVSVVRYPFRIFYAIDQAADEVVILHVRHTAQDEPLE"
FT   gene            complement(565911..567518)
FT                   /locus_tag="BRADO0551"
FT   CDS_pept        complement(565911..567518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0551"
FT                   /product="putative sodium/hydrogen antiporter (exchanger);
FT                   putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74488"
FT                   /db_xref="GOA:A4YKR2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74488.1"
FT                   /translation="MEAHFQIFLILLAVLAGTALIARRANLAPAILLMLAGIALAFVPT
FT                   MPAFALPPELVLLVVLPPLIYSSSVAMSWREFKRNLRPIVLLAVGCVIFTASMVAVATH
FT                   VLLGLPWSLGFLLGAIVAPPDVVAPLAIARRLHLPRRVMVILEGEGLANDATALILYRF
FT                   AVAAITTGTFSLPVAAGEFAAIVIGEIAFGIGVGWLMLRARHYSDDTRVEITLSLLTPY
FT                   LAYWIPEHLGGSGVIATVACGLYMSWNGPLWISSATRLQGVFFWDLVVYLIEGMLFLLT
FT                   GFQMRLIYEKSKVFPLDEIMIATALVVAIVVIARFAWTFPATILPRVLSRSLRARDPLP
FT                   PWQQTFIIGFTGVRGTVSLATALALPLTLSTGDPFPYRDEILFIAFGVIFFTLIGLGLT
FT                   LPLVVRWLGVSRAGRAEHVREHEQEIAARREVLDRALQSLETMTNDRELSDEVVRLLRA
FT                   RHEVRANQLPERLNPDEYDASALGIELTRELIGVERKTIHAMLRDGQITDETRRRIERD
FT                   LDLEEASLANREYGQLPL"
FT   gene            complement(567549..567923)
FT                   /locus_tag="BRADO0552"
FT   CDS_pept        complement(567549..567923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74489"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039437"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74489.1"
FT                   /translation="MSADRSTVESVVQGYFDALYEGDADKLGAVFHPSADLRWVENGEL
FT                   KVLTVPDWLAWVRKRPSAKGEGKPREDFIVTIDRSDDKTAFIKVRCQLPPRYFTDYLVA
FT                   MKLKDGWQIVSKSYRYDLRD"
FT   gene            568145..570061
FT                   /locus_tag="BRADO0553"
FT   CDS_pept        568145..570061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0553"
FT                   /product="conserved hypothetical protein; putative caspase
FT                   (peptidase)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74490"
FT                   /db_xref="GOA:A4YKR4"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74490.1"
FT                   /translation="MCWSLRLRGFRWGGFLLAAALLLVGHPALADKRVALVIGNSAYQN
FT                   VPQLANPANDGAVMTQTFKNAGFDVVDYRRDLTARETRRALRDFADAARDADIAVVYYA
FT                   GHGMEVEGSNYLIPIDARLERDTDVYDETLSLDRILVAVEPAKKLRLVILDACRDNPFT
FT                   RNMQRTVATRSLGRGLAKVEPTSPNTLIAYSAKAGSTAQDGDGNNSPFTMALSRHIATP
FT                   GLDVRKAFGFVRDEVLKSTSNRQEPFVYGSLGGEDVPLVPGVPRVVTQMPVTPPPANPQ
FT                   ADIRRDYELAMQVGNKGALNAFLAQYPDGFYASLAKLQLEKLTAEENRAAAAEKARVTE
FT                   AERARLASEGARKDTLAKAEAEAKAAEQARLAAERANQLAQQQAAEAERKRQEQQLAAA
FT                   DNPRAATSPAAVPQQGPQVASLTPASQPADLTKSVQLELRRVGCLTDEADGDWGSASRR
FT                   SLSQFNRYAGTKLDTQAASADALQAIQLKQARVCPLVCPHGTKSDGDRCTRIVCAEGSF
FT                   LNDDNECEKRRDKKPVAKRDSSDDEDAAPRRRTRAVPEPGLAMPAPNVGVGVGIGVGGV
FT                   GLGVGMAPTIGAPKPQAEARPKPSSGQIYCDSYICRPVRPGCRLDFRGGGNRYGNAHVE
FT                   VCN"
FT   gene            complement(570062..570754)
FT                   /locus_tag="BRADO0554"
FT   CDS_pept        complement(570062..570754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0554"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74491"
FT                   /db_xref="GOA:A4YKR5"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74491.1"
FT                   /translation="MTGLHPDDPVLARFARLPRGLRIIYARPRTFMSLGIAAIAFFLLP
FT                   PALRLITRLLISWDIFTTIYLVLVAVMMLRSEHHHIRRKAVMQDDGRFVILMVTALGAF
FT                   ASIAAIVFELGASKRDAPALTLALLTVSLSWAAVHATFALHYAHDYYRGAKPGGLQFPS
FT                   GDKDEHADYWDFVYFSFIIGMTAQVSDVGITDKIIRRTATVHGIISFVYNTALVALMVN
FT                   IAASAISS"
FT   gene            complement(570770..571690)
FT                   /locus_tag="BRADO0555"
FT   CDS_pept        complement(570770..571690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0555"
FT                   /product="Putative Geranyltranstransferase
FT                   (Farnesyl-diphosphate synthase) (FPP synthase)"
FT                   /function="1.5.3.19 : Isoprenoid biosynthesis"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.5.1.10"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 2089044; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74492"
FT                   /db_xref="GOA:A4YKR6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74492.1"
FT                   /translation="MTATATDFTQRLDKTAEETEALLGELLSDAPLADEIARPKRLIES
FT                   MRYSSLGGGKRLRPFLVVESAAVFGVPRRGALMAGAALECIHCYSLIHDDLPAMDNSDL
FT                   RRGRPTLHKVYDDATAILAGDALLTIAFDIITRDEIHPDAGVRLALTRALARCAGVGGM
FT                   AGGQILDLAGEGRFGDRDPVDVARVQQMKTGALLRFGCIAGALLGQASAAEYKALDDYG
FT                   RALGEAFQIADDLLDVEGDAATLGKPAGADAELGKTTFVTQLGIEGAKQRVRDLLARGD
FT                   AALSIFGAKGDVLRAAAHFVAERKS"
FT   gene            571876..572547
FT                   /gene="mtgA"
FT                   /locus_tag="BRADO0556"
FT   CDS_pept        571876..572547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="BRADO0556"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase (Monofunctional TGase)"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74493"
FT                   /db_xref="GOA:A4YKR7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74493.1"
FT                   /translation="MRTVRAILLVVVLVLLVPYILTPFYALGHPVSSLMLWRTVTGRPV
FT                   ERRWIDLAAMSPYLPRSVVAAEDAKFCTHHGIDWGALREVMDDAEDGEVSRGGSTITQQ
FT                   VAKNLFLWQGRSYVRKALELPLALWIDLVLPKRRVLEIYLNIAELGPAGQFGVEAGANY
FT                   AFNRSAAGLGPREAALMASILPNPVRRSARTPGPGVRRLSATYLVRAQAQGLQTCWGER
FT                   R"
FT   gene            572718..572900
FT                   /gene="rpmF"
FT                   /locus_tag="BRADO0557"
FT   CDS_pept        572718..572900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BRADO0557"
FT                   /product="50S ribosomal subunit protein L32"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74494"
FT                   /db_xref="GOA:A4YKR8"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74494.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADAIKKPTYVEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVLKKKDA"
FT   gene            573083..573835
FT                   /locus_tag="BRADO0558"
FT   CDS_pept        573083..573835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0558"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74495"
FT                   /db_xref="GOA:A4YKR9"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74495.1"
FT                   /translation="MSMVGFPLLLIPLAIYNMIVFLMPGVAFSEILLRLQLPSGEVWTI
FT                   SLGDMLLALGVLLLLLEVIKAAKPNGKYLTDHLLSLLVFGGAAAEFAMWPKFGNSTFLL
FT                   LTLLAMVDFFGGVALRTKRAARAVVAAPDPVPAPAKATVSEPQTQPPVEEPAGEPVKEP
FT                   AKAELPPVEAAAPIVEESTVAVPAAASVAESVLLDRSVPPLPAPVQTTGWISDVKEAEA
FT                   ATTSAPEPELLKTDPPKTETPKTETPKS"
FT   gene            complement(573870..574145)
FT                   /locus_tag="BRADO0559"
FT   CDS_pept        complement(573870..574145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74496"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74496.1"
FT                   /translation="MLTIDQDQGSCGADEAPRAVALLPGTWSHERRVKVRAARPDAGFV
FT                   TQLIATAEHLPQTRTLRRAAAADVHSAYAARLQPATRAGDRTREII"
FT   gene            574405..576120
FT                   /locus_tag="BRADO0560"
FT   CDS_pept        574405..576120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0560"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74497"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74497.1"
FT                   /translation="MFQNEAILTSELPQTSMILASLGQAAFVWDLASDVIVWSDHVGAV
FT                   FADVPLPQLCNGGEFAKLIEPDRGIRSEVMRQAVPLHGAAGTPYRIEYGVRTRAGAPLI
FT                   WVEETGCWYAGSDGRPSRAQGIVRINNERHAREEQLVKLSRHDPLTGELNRTNLLATLA
FT                   EVIEESQRFRFACAFMLVGIDHLARINDAFGFDVADGVVLEVAQRIRARLRGGDALGRF
FT                   SGNKFGLILKSCTMDDMTIAAERFLAAVRDDVVPTKSGPVAVTATIGAVSVPRHARSVE
FT                   EAVNRAHETLDSAKRRRIGSFSTWRPNVERDAQRKVNIRVTDEIVTALNERRIVTAFEP
FT                   VVNAQTRTTAFYECLVRMRQDDGRALLAPDVVPVAERLGLIRLVDHRILELVVAELAAS
FT                   PNVTLSLNISPETTMDPDWWASIESMMRAHPGVAERLIVEITETVEIQDIDDLRGFVTR
FT                   LKDLGSRIAIDDFGAGHTSFRNLRKLGVDIVKIDGAFVQNLVRSADDRAFVQTLVELAR
FT                   RLQIKTVAEWVQDDASVALLRDWGCDYIQGRVIGLASVERPWIEQGRMELPAAS"
FT   gene            complement(576155..576751)
FT                   /locus_tag="BRADO0561"
FT   CDS_pept        complement(576155..576751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0561"
FT                   /product="putative polyhydroxyalkanoate synthesis repressor
FT                   PhaR-like"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74498"
FT                   /db_xref="GOA:A4YKS2"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74498.1"
FT                   /translation="MAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLAAMVKNGEDFLVY
FT                   DAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKYLEQSIDT
FT                   LTKEQEKFRKQIADTFSGTPFAPLEEQVRRNMELFQQTFSMFKPFAPAARTEEKAAEPA
FT                   AAASDDNIDELRRQMKEMQDRLDRMSEPKKDEQQG"
FT   gene            577130..578314
FT                   /gene="phbA"
FT                   /locus_tag="BRADO0562"
FT   CDS_pept        577130..578314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbA"
FT                   /locus_tag="BRADO0562"
FT                   /product="acetyl-CoA acetyltransferase with thiolase domain
FT                   (Acetoacetyl-CoA thiolase)"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="2.3.1.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7582015; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74499"
FT                   /db_xref="GOA:A4YKS3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74499.1"
FT                   /translation="MPMSDDVVIVSAARTPVGSFNGAFANVPAHELGAVAIKAALERAG
FT                   VEPGRVSEVIMGQILTAAQGQNPARQASIAAGIPVDSPAWGINQLCGSGLRSVALGYQA
FT                   LKNGDSDIVVAGGQESMSMAPHAQYLRGGVKMGSLEFVDTMIKDGLWDAFNGYHMGNTA
FT                   ENVAKQYQITRAQQDEFAVASQNKAEAAQRAGKFKDEIVAVTIKGRKGDTVVDTDEYPR
FT                   HGATLDAMAKLRAAFEKDGTVTAGNASGINDGAAAVVLMTAKQAAKEGKTPLARIVSWG
FT                   QAGVDPKIMGTGPIPASRSALKKAGWNIADLDLIEANEAFAAQACAVNKDLGWDPAKVN
FT                   VNGGAIAIGHPIGASGARVLVTLLHEMQKRDAKKGLATLCIGGGMGIALCVARD"
FT   gene            578585..579310
FT                   /gene="phbB"
FT                   /locus_tag="BRADO0563"
FT   CDS_pept        578585..579310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="BRADO0563"
FT                   /product="acetoacetyl-coA reductase"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.1.1.36"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2546004, 3286259; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74500"
FT                   /db_xref="GOA:A4YKS4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74500.1"
FT                   /translation="MARVALVTGGTRGIGAAISKALKAAGYKVAANYGGNDAAAEKFKS
FT                   ETDIPVYKWDVSSFEACSEGIKKVEAELGPIDVLINNAGITRDTAFHKMSLEQWSVVIN
FT                   TNLGSLFNMTRPIIEGMRARKFGRIINISSINGQKGQFGQVNYSAAKAGDIGFTKALAL
FT                   ETAKAGITVNVICPGYINTEMVQAVPKDVLEKSILPLIPVGRLGEPEEIARTVVFLAAD
FT                   EAGAITGSTLSVNGGQYMA"
FT   gene            579473..580345
FT                   /locus_tag="BRADO0564"
FT   CDS_pept        579473..580345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0564"
FT                   /product="conserved hypothetical protein; putative
FT                   transmembrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74501"
FT                   /db_xref="GOA:A4YKS5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74501.1"
FT                   /translation="MSQRTATLIGLTAILMWSLLALLTVATGKIPAFQLAAMTFAVGGL
FT                   VGMLTWIGRPAAPRSLKQPMRAWLVGVGGLFGYHALYFLALRFAPPAEAGLLNYLWPLL
FT                   IVLFSALLPGERLALHHVIGAALGLIGTVLLFMGNGASFAADQLPGLAAAFVAAFVWAI
FT                   YSVLSRRLKAVPTDAVAGFCLATSLLAAVVHGLVEPKVWPDGAVQWLAVAGLGIGPVGA
FT                   AFYAWDVGMKRGDIRVLGAASYATPLLSTAFLILAGYAQPTAAIAVAALLIAGGGLVAA
FT                   KDLFLLRRR"
FT   gene            580554..582590
FT                   /locus_tag="BRADO0565"
FT   CDS_pept        580554..582590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0565"
FT                   /product="conserved hypothetical protein with GGDEF domain
FT                   (N-terminal) and EAL domain (C-terminal); putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74502"
FT                   /db_xref="GOA:A4YKS6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74502.1"
FT                   /translation="MRTTTGRRMPDVRRYIARAGNLFRVPADNPELTRAQFQAFAKQMP
FT                   LLYFILITNSLALAYTFLPLAPMGLTLAVPALLSAITSVRMVWWLRQGHNVCTDAEALQ
FT                   YLRLTNRIAGPIGALFVVWSFSLFPYGDPFAQGQVAFYMAVTVIGIIFCLMHLRSAALI
FT                   VTLVVIVPYVIFFMATGVHALRAIAVNQLLVSCAMVTVLFIYYRDFAALVDSRKSLLAE
FT                   QAATQALSDENFRLANLDSLTDLPNRRRFFSELTNAFAEAERDGTRLAVGIIDLDGFKP
FT                   VNDTYGHTVGDRVLMEAARRIRDVCERRGAQVHLARLGGDEFGLVVTGNPTDDDLLSLG
FT                   RDITERIKLPYQFDATHSGLSCSTGFALYPRSATAADALYECADYALYHAKRRARGQAI
FT                   IFSSELEAEIRSRSVIEHLLRTADFETEMDLAFQPIMDATNSRTTGFEVLARWNSPKLG
FT                   LVSPASFIPAAERIGVIRSLTRFLLVKALAAARTWPDDIRISFNLSAHDICAPEGVLPL
FT                   IAVIQASGVPPRRIEFEITETAVAFDFARAEESIAALKALGCGISLDDFGTGYSSLSHV
FT                   HRLPLDKLKVDRSFVHDVNANPVSHKIIKSLTGLCADMDISCVVEGVETKEQLDSLKRL
FT                   GADYIQGYYFAEPMPADAISGFLARERQHFADRASVKVAGASA"
FT   gene            complement(582592..582927)
FT                   /locus_tag="BRADO0566"
FT   CDS_pept        complement(582592..582927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74503"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74503.1"
FT                   /translation="MDETGRAASTLIYFLLARGERSHWHKVDAVETWHYYAGAPLVLRI
FT                   AREGEGPHTTTLGIDFAAGQQPQAVVPAYAWQAAESTGDWTLVGCTVAPGFDFAGFELA
FT                   PADWEPV"
FT   gene            complement(583041..583808)
FT                   /locus_tag="BRADO0567"
FT   CDS_pept        complement(583041..583808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0567"
FT                   /product="putative hydroxyacylglutathione hydrolase
FT                   (Glyoxalase II)"
FT                   /function="1.7.23 : Methylglyoxal metabolism"
FT                   /function="1.7.28 : Pyruvate catabolism"
FT                   /EC_number="3.1.2.6"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74504"
FT                   /db_xref="GOA:A4YKS8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74504.1"
FT                   /translation="MAADIRVFTCLSDNFGYLIHDPATGATASVDAPEAGPIVRQLEAN
FT                   GWTLTDILITHHHYDHVGGVAELKQRYGCRVIGPHDRKAAIADVDLRVAHGDVVKVGEL
FT                   LARVLETPGHTLDHVSYVFDADKAVFAADTLFSIGCGRVFEGTYPMMWDSLLKLRTLPD
FT                   DFRLYCGHEYTASNVKFALTVDPDNEALKARAAEVTRLRAANQPTIPVLLGEEKQANVF
FT                   LRADDPAIAVRLRMKGASAEEVFGELRERKNKS"
FT   gene            583998..584804
FT                   /locus_tag="BRADO0568"
FT   CDS_pept        583998..584804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0568"
FT                   /product="conserved hypothetical protein; putative
FT                   SAM-dependent methyltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74505"
FT                   /db_xref="GOA:A4YKS9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74505.1"
FT                   /translation="MMFMDVIDLRNFYSGRLGIVARLLINRGIRARWPSAAGQRVLGVG
FT                   YPTPYLGLFREDSERCIAFMPAAQGVLKWPTARPTLASLVDEFSLPLPDAAVDRILIVH
FT                   ALEMSDDPAGLLREMWRVLAPAGRMIIVIPNRRGIWTRSDNTPFGHGRPYSRSQITQLL
FT                   RQTWFTPSAWGEALFMPPVGGWFLKSAMAWERVGAALSLPFAGVHIVEATKQVYRVIPA
FT                   RRERIRLIPRLEPVLAPAPSAQGSNLGSNFAAELDPDLASRSSSDD"
FT   gene            complement(584898..585737)
FT                   /locus_tag="BRADO0569"
FT   CDS_pept        complement(584898..585737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74506"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74506.1"
FT                   /translation="MRNGQNNKRMRNRNNGNNNNNRRGQNPLTRVFESNGPDIKIRGTA
FT                   SHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQPRNTDDLTV
FT                   DDLDDDGESFSNFGQEPGFVQPQPQAQPFVRDGGQRERGDNQQPYQRDQQQPREHREAR
FT                   EHRQPREHREPREPREHREPRENREAQEHRDREPREHRERPQPAAYQPQPQPVIADSGV
FT                   DRLPSFITGPQPQIANAPAAFEGGAERYPRRRRRPHGPRPEAAAAAPAPSEDLNPGE"
FT   gene            complement(586272..587159)
FT                   /locus_tag="BRADO0571"
FT   CDS_pept        complement(586272..587159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0571"
FT                   /product="Putative protein methyltransferase hemK modifies
FT                   release factors RF-1 and RF-2"
FT                   /function="2.3.2 : Translation"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11805295; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74507"
FT                   /db_xref="GOA:A4YKT1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74507.1"
FT                   /translation="MTKIAAGASIDSARRALAARFGDAGLDSPELDARLLVGHALQLDL
FT                   TGLVMHGKRALSHDDAQRLDALVQRRLAGEPVARILGHKEFWGLELRLSADTLVPRPDT
FT                   ETVVELALDHLSAGGALTRPLRIGDLGTGSGAILLALLSELPRASGVGTDISIAALTTA
FT                   RENARALGLNDRAAFVACSYATALAPPFDLIVSNPPYIPSADIAGLATEVHAHDPLRAL
FT                   DGGGDGLAAYRTLIPQAALLLQTGGAVIVEVGQGQSGDVAGLMTEAGLASDSSAIRADL
FT                   AGIPRAVMALKKRR"
FT   gene            complement(587353..588438)
FT                   /gene="prfA"
FT                   /locus_tag="BRADO0572"
FT   CDS_pept        complement(587353..588438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BRADO0572"
FT                   /product="peptide chain release factor 1"
FT                   /function="2.3.2 : Translation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8821264; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74508"
FT                   /db_xref="GOA:A4YKT2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74508.1"
FT                   /translation="MSSLPEAKLDVLLAHHASLEAELLGQVNSDRYVQITRELAELNPL
FT                   IDAVKAYRAGVKELADTEALIADPDTDAEMRAMAESERDELVARRGELEQKIRIALLPK
FT                   DAMDDRNVVLEIRAGTGGDEASLFAGDLFRMYERFASLQGWKVEVISASEGTVGGYKEI
FT                   IAEVQGRGAFAKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEIEDVDVDIKQDDL
FT                   RIETMRAQGAGGQHVNKTESAIRITHIPTGIVVMMQDSRSQHKNRASAMNILRSRIYDA
FT                   ERQKVDAARSAERKEKVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGEALGE
FT                   LVDALTTEHQAAQLAAQGAAA"
FT   gene            complement(588501..590768)
FT                   /gene="ptsP"
FT                   /locus_tag="BRADO0573"
FT   CDS_pept        complement(588501..590768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="BRADO0573"
FT                   /product="Phosphoenolpyruvate-protein phosphotransferase"
FT                   /function="4.4.A : Phosphotransferase Systems
FT                   (PEP-dependent PTS)"
FT                   /EC_number="2.7.3.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7686067, 8973315; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74509"
FT                   /db_xref="GOA:A4YKT3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74509.1"
FT                   /translation="MRSTSGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   SVYVLRVDNTLELYATEGLNRDAVHMTVLSAHEGLVGLVASEATPLNLSDAQNHPAFSY
FT                   RPETGEEIYHSFLGVPILRAGNTLGVLVVQNRAKRTYVEEEVEALQTTAMVLAEMIASG
FT                   ELAALAQPGAEPAVRHSVHKTGAVLSDGIALGHVVLHEPRVVVNNYIAEDLPKEIKRLD
FT                   AALVKLRADLDRMLERGDVADGGEHREVLEAYRMFANDQGWSHKLHEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRERLHDLEDLGYRLLRQLVGQDHAPSRDHLPDNAILIARA
FT                   MGPAALLDYDRKRLRGLVLEEGTANSHVAIVARALGIPAVGEVPNAPGIADPGDAIIVD
FT                   GTSGSIYVRPSAEIESAYAERVRFRARRQAQYSELRNKPCKTKDGQPVELMINAGLVID
FT                   LPHIEDTGSAGIGLFRTELQFMVSASLPRSSDQLALYRTVLDAAGSKPVTFRTLDIGGD
FT                   KALPYMETVIEENPALGWRAIRLGLDRPGLLRGQIRALLRAGGGRSLRIMFPMISEVAE
FT                   FDTAKAIVERELTYLRQHGHTLPERVDIGTMLEVPALLYQMDELLAKVDFISVGSNDLF
FT                   QFLFAVDRGNAKVSERFDTLSTPILRALQEIVRKAKAAKRSVSLCGEMASKPIGALALI
FT                   ALGYRSLSLSATAHGPVKAMILELDAAKAEAKMAEWLATPAGSISMRQKLTEFAESEGL
FT                   AL"
FT   gene            complement(591070..592326)
FT                   /gene="lysC"
FT                   /locus_tag="BRADO0574"
FT   CDS_pept        complement(591070..592326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="BRADO0574"
FT                   /product="aspartokinase"
FT                   /function="1.5.1.8 : Threonine"
FT                   /function="1.5.1.7 : Lysine, diaminopimelate"
FT                   /function="1.5.1.9 : Methionine"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11440130; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74510"
FT                   /db_xref="GOA:A4YKT4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74510.1"
FT                   /translation="MGRLVLKFGGTSVANIDRIRNVARHVKREVDAGHEVAVVVSAMSG
FT                   KTNELVAWCTEASPMHDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKT
FT                   SDAHASARIVGIDGSELIQRFQERKEVAVIAGFQGINAETGRITTLGRGGSDTSAVAIA
FT                   AAIKADRCDIYTDVDGVYTTDPRVVPKAKRLDKIAFEDMLELASQGAKVLQVRSVELGM
FT                   VHNMPIFVRSSFDKPEDIDPHANQPPGTLICSEEQIMENHVVTGIAFSKDEAQISVRQI
FT                   EDKPGIAASIFGPLADANINVDMIVQNVSEDGKTTDLTFTVPATDYNRARETITAAKDK
FT                   IGYQRMDAATDVAKVSVIGSGMRSHAGVAAKGFAALAARNINIRAITTSEIKFSVLIDA
FT                   AYTELAVRTLHTLYGLDQA"
FT   gene            592473..592940
FT                   /locus_tag="BRADO0575"
FT   CDS_pept        592473..592940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74511"
FT                   /db_xref="GOA:A4YKT5"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74511.1"
FT                   /translation="MARYIDEILQPGEKVLYSTNAHWMFYLPAIGAWIVVFGLIVLSRM
FT                   TVNDNLVMLCLATAAVMAVVALYWTVRAWFHRLTTETDVTNRRVVHKTGFIRRRTFEMA
FT                   LDKVESVDVNQTIMGRILNYGDVTILGVGEGKETISTIAEPLAFRNAITAR"
FT   gene            592981..593742
FT                   /gene="ubiG"
FT                   /locus_tag="BRADO0576"
FT   CDS_pept        592981..593742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="BRADO0576"
FT                   /product="3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="2.1.1.64"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1479344, 11583838; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74512"
FT                   /db_xref="GOA:A4YKT6"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4YKT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74512.1"
FT                   /translation="MTMSQDSRSTPGSTVDPAEIAKFSKLSETWWDPKGKMAPLHKINP
FT                   LRLTYIRDAACRKFERNAKSLNCLSGLRMLDIGCGAGLLCEPFTRLGAQVVGVDPSASN
FT                   IAAAKLHAEKGHMSIDYRCTTIEEMDPRERFDIVLAMEVVEHVTDVGAFLGRCAAVLKP
FT                   GGLMVVSTLNRNWKSFALAIVGAEYVLRWLPRGTHEWSKFVTPDELTKYLLDNRLVITE
FT                   QSGVVYSPFADRWSLSSDMDVNYMVVAEQMV"
FT   gene            complement(593835..594116)
FT                   /locus_tag="BRADO0577"
FT   CDS_pept        complement(593835..594116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0577"
FT                   /product="Putative excinuclease ABC, C subunit"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12034838; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74513"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74513.1"
FT                   /translation="MYYVYILASGRHGTLYIGVTNSIRTRLEQHRKGQGSDFVKKYGVF
FT                   RLVYVETYAAVEEAITREKQLKRWKRDWKIELIERDNLEWRDLSGLVS"
FT   gene            594351..595250
FT                   /locus_tag="BRADO0578"
FT   CDS_pept        594351..595250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0578"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74514"
FT                   /db_xref="GOA:A4YKT8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74514.1"
FT                   /translation="MLSITSLWIPFTLVAAAGQVARNAMQRSLTAKLGTWGATNIRFLF
FT                   GFPFSLVFLSMVLVATGDHLPWPPASFWPWLLLGALSQIVATGLMLLAMTDRSFVVTTA
FT                   YLKTEAIQTAIFGFIFLGDPLSLPKLVAILIATIGVVITALRPGGEKSFAELKPTVTGL
FT                   VAAAAFALSAVGYRGAIIAVQGVSFVTAASTTLVAGLFVQTAILTVYLLARAPDILRGI
FT                   LSLWRPSMMAGFVGAFASQFWFLAFALTAAANVRTLALIEVLFAQGVSYYSFKQPVSLR
FT                   ELCGIALIVAGVALLIAV"
FT   gene            complement(595251..595688)
FT                   /locus_tag="BRADO0579"
FT   CDS_pept        complement(595251..595688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0579"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74515"
FT                   /db_xref="GOA:A4YKT9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74515.1"
FT                   /translation="MSPLSSSWQLWALLSALFAALTAIFAKVGVEGLNSDLATLIRTAI
FT                   VLVTLALILFATGQLTTPGPISTKSWIFLTLSALGTGASWLCYFRALKLGPATLVAPID
FT                   KLSVVLVALFGAVFLGERPSLQGWTGIALIAAGAVLIAIKG"
FT   gene            complement(595875..596357)
FT                   /locus_tag="BRADO0580"
FT   CDS_pept        complement(595875..596357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74516"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74516.1"
FT                   /translation="MIRYALRCERDHSFESWFQSSSAYDSQVKRKLVECPACGSTKVEK
FT                   AIMAPRIVSKKGRETLPVPAAPAPVPTQEVIPPGPTSLLMAQERELRAKLKELRDHIVK
FT                   NADDVGERFPTEARKMHYGETEHRPIYGEASLDEARELIEEGIEVAPIPVLPDDRN"
FT   gene            complement(596354..597232)
FT                   /locus_tag="BRADO0581"
FT   CDS_pept        complement(596354..597232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0581"
FT                   /product="putative nitrilase"
FT                   /function="1.8.3 : Nitrogen metabolism"
FT                   /EC_number="3.5.1.77"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7987228; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74517"
FT                   /db_xref="GOA:A4YKU1"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74517.1"
FT                   /translation="MSNDRSFTAAMVQMRTALLPEPSLEQGTRLIREAVAQGAQYVQTP
FT                   EVSNMMQLNRTALFEQLKSEEEDPSLKAYRALAKELNIHLHIGSLALRFSAEKAVNRSF
FT                   LIGPDGQVLASYDKIHMFDIDLPGGESYRESANYQPGETAVISDLPWGRLGLTICYDVR
FT                   FPALYRALAESGASFISVPSAFTRKTGEAHWHTLLRARAIETGCFVFAAAQCGLHENKR
FT                   ETFGHSLIIDPWGEILAEGGVEPGVILARIDPSRVESVRQTIPSLQHGRRFGIADPKGG
FT                   PDYLHLVRGSA"
FT   gene            complement(597229..597504)
FT                   /gene="grxC"
FT                   /locus_tag="BRADO0582"
FT   CDS_pept        complement(597229..597504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="BRADO0582"
FT                   /product="glutaredoxin 3"
FT                   /function="1.6.15.2 : Thioredoxin, glutaredoxin"
FT                   /function="1.5.2 : Nucleotide"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7937896, 2668278; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74518"
FT                   /db_xref="GOA:A4YKU2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74518.1"
FT                   /translation="MTAAIEIYTRPGCGYCTAAKSLLTRKNVPFTEYDAGKDPNVRQQM
FT                   YDRVGPGSTFPQIFIGKTHIGGCDDLYALDREGRLDAMLAGDKATS"
FT   gene            complement(597535..598338)
FT                   /locus_tag="BRADO0583"
FT   CDS_pept        complement(597535..598338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0583"
FT                   /product="putative competence protein F (COMF)"
FT                   /function="2.1 : DNA related"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74519"
FT                   /db_xref="GOA:A4YKU3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74519.1"
FT                   /translation="MSLSLAPIRLGQLRVMASAARSACGHLAKLTLDIALPTLCIACRE
FT                   PVDGEGVCAACWGKLSFIERPYCPKLGIPFVYDPGPELLSMEAIAAPPAYARARAAVRY
FT                   DDVASTLVHALKYQDRTDLAPIMGRWMTRAGHELLADADLLVPVPLHWRRGFSRRYNQS
FT                   GALARVIARSSGVRMSGDTLRRVRATEQQVGLSRTQRASNVQGAFQVSSDRLHDVQGRR
FT                   VVIVDDVLTTGATVDACARALLRAKAAEVSVLVFARVVDAPRAPI"
FT   gene            598417..599274
FT                   /locus_tag="BRADO0584"
FT   CDS_pept        598417..599274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0584"
FT                   /product="conserved hypothetical protein; putative
FT                   SAM-dependent methyltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74520"
FT                   /db_xref="GOA:A4YKU4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74520.1"
FT                   /translation="MTQPATAPVLFDRSLLALRQRRASRSPETFLLERVAEDLADRLAA
FT                   VNRSFQSAADIWTPGNGLTPDLSGQVAQFAHIASPDTANEMLPLQPQSLDLAVSALAFQ
FT                   FVNDLPGLLVQIRRALRPDGLLLAAMIGGDTLTELRQSFAAAEAECEGGVSPRVAPFAD
FT                   LRDIGGLLQRAGFALPVTDVDRVVVRYASAFGLMQDLRRMGAANNLVERRRTPLRRATL
FT                   LRMVELYAERFADPDGRIRATFDIIWISGWAPHESQQKPLKPGSATASLEAAVRRAPGA
FT                   GRDE"
FT   gene            complement(599422..599832)
FT                   /locus_tag="BRADO0585"
FT   CDS_pept        complement(599422..599832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0585"
FT                   /product="Putative mutator protein mutT"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74521"
FT                   /db_xref="GOA:A4YKU5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74521.1"
FT                   /translation="MTDFKLTLVVACALVDTDNRVLLAQRPPGKTLAGLWEFPGGKLEP
FT                   GERPEASLIRELDEELGITVRETCLAPLTFASHAYETFHLLMPLYICRRWEGVVTAREG
FT                   QKLAWVRPNKLRDYPMPPADIPLLPHLIDLLM"
FT   gene            599996..601252
FT                   /locus_tag="BRADO0586"
FT   CDS_pept        599996..601252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0586"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74522"
FT                   /db_xref="GOA:A4YKU6"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74522.1"
FT                   /translation="MDRLLRYLRKFGHDQRGNIAVLFAIACVPVLAFVGAGIDYSMANK
FT                   LRTKLQMAIDEAVLAGVAAGKAALDSGATQAAAIAMAQAASSSYFTGNTAKIDATPTIN
FT                   FTTMGRTLSGTGSATSVMNTSFMRLVGFPTMTLNASSASSATMQPYLNVYLLVDISSSM
FT                   LLPATQAGITQMRNGTGCALACHETTNGTDSYSYALKNNVLLRYQVVNQGVQNLLTYLN
FT                   SSAVYKNYVKVGLWSFDNQLTQLSSLTSSFSSVAANFPAPGLAYNDAAAATPFDSLIGS
FT                   FVSSVGTAGDGSTSATPQKLVIIATDGVNDPTRAWTSQTSLRSQVRVFNTAFCNTFKSN
FT                   GVTVAIINTPYYPMTWDWGYNATLGQPGSLGGATRVDDIPIALKSCAGSNFIIASDVAT
FT                   IQNAFTTLFNKASPVRLTN"
FT   gene            601425..602753
FT                   /locus_tag="BRADO0587"
FT   CDS_pept        601425..602753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRADO0587"
FT                   /product="conserved hypothetical protein; putative vWFA
FT                   domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BRADO0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAL74523"
FT                   /db_xref="GOA:A4YKU7"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4YKU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAL74523.1"
FT                   /translation="MRSLSLLLSRFRRNAGGNVAVTFAIVCVPVITAVGCGVDYSRTNQ
FT                   MRAKLQAAVDAASVGAVSRTSPAFIAAGAMTTDGVIAAGNDDARKIFNGNMSGTTGYTL
FT                   DSLTPEVKKTGSVLTATVSFSATVPTLFMSIVGYKTMSLQGSSTAKASMPKYIDFYLLL
FT                   DNSPSMGVAATPADVTKMVSATSDKCAFACHDYNDANNYYNLAKTLGVTTRIDVLRSAT
FT                   QQLMDTAQQTQTYSNQFRMAIYDFGASSKTIGLRALFALSSSLTSAKSAAGNIDLMGVY
FT                   GNNDSFTADKDTPYTTALPAINNEIATPGDGTSGSPLKYLFFVSDGVADESNAACLKPK
FT                   ASGNRCQSPINPALCTALKNRGIKIAVLYTTYLQLPTNSWYMSWIDPFNKGPFGPSPNS
FT                   EIAQNMQACASDGFYFEVSPTQGIADAMNALFKKAVADARIAG"
FT   gene            complement(602814..604055)
FT                   /gene="argJ"
FT                   /locus_tag="BRADO0588"
FT   CDS_pept        complement(602814..604055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="BRADO0588"
F