(data stored in ACNUC9543 zone)

EMBL: CU329670

ID   CU329670; SV 1; linear; genomic DNA; STD; FUN; 5579133 BP.
XX
AC   CU329670; AL009197; AL009227; AL021046; AL021809; AL021813; AL021817;
AC   AL031180; AL034486; AL034565; AL034583; AL035064; AL035248; AL035254;
AC   AL035439; AL096845; AL109734; AL109738-AL109739; AL109770; AL109820;
AC   AL109831-AL109832; AL109951; AL109988; AL110469; AL110509; AL117210;
AC   AL117212-AL117213; AL117390; AL121732; AL121741; AL121745;
AC   AL121764-AL121765; AL121770; AL122032; AL132667; AL132675; AL132714;
AC   AL132769; AL132779; AL132798; AL132828; AL132839; AL132983-AL132984;
AC   AL133154; AL133156-AL133157; AL133225; AL133302; AL133357;
AC   AL133359-AL133361; AL133442; AL133498; AL133521-AL133522; AL135751;
AC   AL136078; AL136235; AL136499; AL136521; AL136538; AL137130; AL138666;
AC   AL138854; AL139315; AL157734; AL157811; AL157872; AL157917;
AC   AL157993-AL157994; AL158056; AL159180; AL159951; AL162531; AL162631;
AC   AL163031; AL163071; AL163191; AL163481; AL163529; AL353014; AL353860;
AC   AL355012-AL355013; AL355252; AL355452; AL355632; AL355652-AL355653;
AC   AL356333; AL356335; AL357232; AL358272; AL360054; AL360094; AL390095;
AC   AL390274; AL390814; AL391713; AL391744; AL391746; AL391783; AL441621;
AC   AL441624; AL512486-AL512487; AL512491; AL512493; AL512496; AL512549;
AC   AL512562; AL583902; AL590562; AL590582; AL590602; AL590605;
AC   AL590902-AL590903; AL672256; AL691401-AL691402; AL691405; Z49811;
AC   Z50112-Z50113; Z50142; Z50728; Z54096; Z54142; Z54285; Z54308; Z54328;
AC   Z54354; Z54366; Z56276; Z64354; Z66568; Z67757; Z67961; Z67998-Z67999;
AC   Z68136; Z68144; Z68166; Z68197-Z68198; Z68887; Z69086; Z69239-Z69240;
AC   Z69368-Z69369; Z69380; Z69725-Z69731; Z69795-Z69796; Z69944; Z70043;
AC   Z70690-Z70691; Z70721; Z73099-Z73100; Z81312; Z81317; Z94864; Z95334;
AC   Z95395-Z95396; Z97185; Z97208-Z97210; Z98056; Z98529-Z98533; Z98559-Z98560;
AC   Z98595-Z98598; Z98600-Z98603; Z98762-Z98763; Z98849; Z98944; Z98974-Z98975;
AC   Z98977-Z98981; Z99091; Z99126; Z99161-Z99168; Z99258-Z99262; Z99292;
AC   Z99295-Z99296; Z99531-Z99532; Z99568; Z99753;
XX
PR   Project:PRJNA13836;
XX
DT   09-JUL-2007 (Rel. 92, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 14)
XX
DE   Schizosaccharomyces pombe chromosome I, complete sequence
XX
KW   complete genome.
XX
OS   Schizosaccharomyces pombe (fission yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
OC   Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae;
OC   Schizosaccharomyces.
XX
RN   [1]
RP   1-5579133
RG   The Schizosaccharomyces pombe Genome Sequencing Consortium
RA   Wood V.;
RT   ;
RL   Submitted (29-JUN-2007) to the INSDC.
RL   European Schizosaccharomyces genome sequencing project, Sanger Institute,
RL   The Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA
XX
RN   [2]
RP   1-5579133
RX   DOI; 10.1038/nature724.
RX   PUBMED; 11859360.
RA   Wood V., Gwilliam R., Rajandream M.A., Lyne M., Lyne R., Stewart A.,
RA   Sgouros J., Peat N., Hayles J., Baker S., Basham D., Bowman S., Brooks K.,
RA   Brown D., Brown S., Chillingworth T., Churcher C., Collins M., Connor R.,
RA   Cronin A., Davis P., Feltwell T., Fraser A., Gentles S., Goble A.,
RA   Hamlin N., Harris D., Hidalgo J., Hodgson G., Holroyd S., Hornsby T.,
RA   Howarth S., Huckle E.J., Hunt S., Jagels K., James K., Jones L., Jones M.,
RA   Leather S., McDonald S., McLean J., Mooney P., Moule S., Mungall K.,
RA   Murphy L., Niblett D., Odell C., Oliver K., O'Neil S., Pearson D.,
RA   Quail M.A., Rabbinowitsch E., Rutherford K., Rutter S., Saunders D.,
RA   Seeger K., Sharp S., Skelton J., Simmonds M., Squares R., Squares S.,
RA   Stevens K., Taylor K., Taylor R.G., Tivey A., Walsh S., Warren T.,
RA   Whitehead S., Woodward J., Volckaert G., Aert R., Robben J., Grymonprez B.,
RA   Weltjens I., Vanstreels E., Rieger M., Schafer M., Muller-Auer S.,
RA   Gabel C., Fuchs M., Dusterhoft A., Fritzc C., Holzer E., Moestl D.,
RA   Hilbert H., Borzym K., Langer I., Beck A., Lehrach H., Reinhardt R.,
RA   Pohl T.M., Eger P., Zimmermann W., Wedler H., Wambutt R., Purnelle B.,
RA   Goffeau A., Cadieu E., Dreano S., Gloux S., Lelaure V., Mottier S.,
RA   Galibert F., Aves S.J., Xiang Z., Hunt C., Moore K., Hurst S.M., Lucas M.,
RA   Rochet M., Gaillardin C., Tallada V.A., Garzon A., Thode G., Daga R.R.,
RA   Cruzado L., Jimenez J., Sanchez M., del Rey F., Benito J., Dominguez A.,
RA   Revuelta J.L., Moreno S., Armstrong J., Forsburg S.L., Cerutti L., Lowe T.,
RA   McCombie W.R., Paulsen I., Potashkin J., Shpakovski G.V., Ussery D.,
RA   Barrell B.G., Nurse P.;
RT   "The genome sequence of Schizosaccharomyces pombe";
RL   Nature 415(6874):871-880(2002).
XX
DR   MD5; a5bc80a74aae8fd7622290b11dbc8ab3.
DR   BioSample; SAMEA3138176.
DR   EnsemblGenomes-Gn; ENSRNA049630661.
DR   EnsemblGenomes-Gn; ENSRNA049630718.
DR   EnsemblGenomes-Gn; ENSRNA049630773.
DR   EnsemblGenomes-Gn; ENSRNA049630825.
DR   EnsemblGenomes-Gn; ENSRNA049630868.
DR   EnsemblGenomes-Gn; ENSRNA049630944.
DR   EnsemblGenomes-Gn; ENSRNA049630991.
DR   EnsemblGenomes-Gn; ENSRNA049631028.
DR   EnsemblGenomes-Gn; ENSRNA049631077.
DR   EnsemblGenomes-Gn; ENSRNA049631116.
DR   EnsemblGenomes-Gn; ENSRNA049631187.
DR   EnsemblGenomes-Gn; ENSRNA049631250.
DR   EnsemblGenomes-Gn; ENSRNA049631317.
DR   EnsemblGenomes-Gn; ENSRNA049631359.
DR   EnsemblGenomes-Gn; ENSRNA049631425.
DR   EnsemblGenomes-Gn; ENSRNA049631467.
DR   EnsemblGenomes-Gn; ENSRNA049631524.
DR   EnsemblGenomes-Gn; ENSRNA049631591.
DR   EnsemblGenomes-Gn; ENSRNA049631624.
DR   EnsemblGenomes-Gn; ENSRNA049631682.
DR   EnsemblGenomes-Gn; ENSRNA049631718.
DR   EnsemblGenomes-Gn; ENSRNA049631780.
DR   EnsemblGenomes-Gn; ENSRNA049631827.
DR   EnsemblGenomes-Gn; ENSRNA049631884.
DR   EnsemblGenomes-Gn; ENSRNA049631945.
DR   EnsemblGenomes-Gn; ENSRNA049631987.
DR   EnsemblGenomes-Gn; ENSRNA049632025.
DR   EnsemblGenomes-Gn; ENSRNA049632057.
DR   EnsemblGenomes-Gn; ENSRNA049632115.
DR   EnsemblGenomes-Gn; ENSRNA049632161.
DR   EnsemblGenomes-Gn; ENSRNA049632208.
DR   EnsemblGenomes-Gn; ENSRNA049632230.
DR   EnsemblGenomes-Gn; ENSRNA049632274.
DR   EnsemblGenomes-Gn; ENSRNA049632300.
DR   EnsemblGenomes-Gn; ENSRNA049632350.
DR   EnsemblGenomes-Gn; ENSRNA049632393.
DR   EnsemblGenomes-Gn; ENSRNA049632447.
DR   EnsemblGenomes-Gn; ENSRNA049632499.
DR   EnsemblGenomes-Gn; ENSRNA049632545.
DR   EnsemblGenomes-Gn; ENSRNA049632595.
DR   EnsemblGenomes-Gn; ENSRNA049632641.
DR   EnsemblGenomes-Gn; ENSRNA049632671.
DR   EnsemblGenomes-Gn; ENSRNA049632703.
DR   EnsemblGenomes-Gn; ENSRNA049632767.
DR   EnsemblGenomes-Gn; ENSRNA049632801.
DR   EnsemblGenomes-Gn; ENSRNA049632852.
DR   EnsemblGenomes-Gn; ENSRNA049632915.
DR   EnsemblGenomes-Gn; ENSRNA049632972.
DR   EnsemblGenomes-Gn; ENSRNA049633034.
DR   EnsemblGenomes-Gn; ENSRNA049633085.
DR   EnsemblGenomes-Gn; ENSRNA049633127.
DR   EnsemblGenomes-Gn; ENSRNA049633163.
DR   EnsemblGenomes-Gn; ENSRNA049633212.
DR   EnsemblGenomes-Gn; ENSRNA049633274.
DR   EnsemblGenomes-Gn; ENSRNA049633334.
DR   EnsemblGenomes-Gn; ENSRNA049676222.
DR   EnsemblGenomes-Gn; ENSRNA049676244.
DR   EnsemblGenomes-Gn; ENSRNA049676282.
DR   EnsemblGenomes-Gn; ENSRNA049676312.
DR   EnsemblGenomes-Gn; ENSRNA049676348.
DR   EnsemblGenomes-Gn; ENSRNA049676374.
DR   EnsemblGenomes-Gn; ENSRNA049676412.
DR   EnsemblGenomes-Gn; ENSRNA049676459.
DR   EnsemblGenomes-Gn; ENSRNA049676491.
DR   EnsemblGenomes-Gn; ENSRNA049676517.
DR   EnsemblGenomes-Gn; ENSRNA049676538.
DR   EnsemblGenomes-Gn; ENSRNA049676559.
DR   EnsemblGenomes-Gn; ENSRNA049676580.
DR   EnsemblGenomes-Gn; ENSRNA049676599.
DR   EnsemblGenomes-Gn; ENSRNA049676636.
DR   EnsemblGenomes-Gn; ENSRNA049676666.
DR   EnsemblGenomes-Gn; ENSRNA049676691.
DR   EnsemblGenomes-Gn; ENSRNA049676707.
DR   EnsemblGenomes-Gn; ENSRNA049676723.
DR   EnsemblGenomes-Gn; ENSRNA049676761.
DR   EnsemblGenomes-Gn; ENSRNA049676787.
DR   EnsemblGenomes-Gn; ENSRNA049676807.
DR   EnsemblGenomes-Gn; ENSRNA049676829.
DR   EnsemblGenomes-Gn; ENSRNA049676882.
DR   EnsemblGenomes-Gn; ENSRNA049676922.
DR   EnsemblGenomes-Gn; ENSRNA049676952.
DR   EnsemblGenomes-Gn; SPAC110.05.
DR   EnsemblGenomes-Gn; SPAC13G6.04.
DR   EnsemblGenomes-Gn; SPAC1556.06.
DR   EnsemblGenomes-Gn; SPAC1D4.08.
DR   EnsemblGenomes-Gn; SPAC212.05c.
DR   EnsemblGenomes-Gn; SPAC212.07c.
DR   EnsemblGenomes-Gn; SPAC212.09c.
DR   EnsemblGenomes-Gn; SPAC212.10.
DR   EnsemblGenomes-Gn; SPAC22F3.11c.
DR   EnsemblGenomes-Gn; SPAC23A1.20.
DR   EnsemblGenomes-Gn; SPAC23D3.05c.
DR   EnsemblGenomes-Gn; SPAC29E6.04.
DR   EnsemblGenomes-Gn; SPAC2E12.05.
DR   EnsemblGenomes-Gn; SPAC2F3.13c.
DR   EnsemblGenomes-Gn; SPAC5H10.06c.
DR   EnsemblGenomes-Gn; SPAC823.17.
DR   EnsemblGenomes-Gn; SPAC977.01.
DR   EnsemblGenomes-Gn; SPAC977.13c.
DR   EnsemblGenomes-Gn; SPAPB24D3.05c.
DR   EnsemblGenomes-Gn; SPATRNAALA.01.
DR   EnsemblGenomes-Gn; SPATRNAALA.02.
DR   EnsemblGenomes-Gn; SPATRNAALA.03.
DR   EnsemblGenomes-Gn; SPATRNAALA.04.
DR   EnsemblGenomes-Gn; SPATRNAALA.05.
DR   EnsemblGenomes-Gn; SPATRNAALA.06.
DR   EnsemblGenomes-Gn; SPATRNAARG.01.
DR   EnsemblGenomes-Gn; SPATRNAARG.02.
DR   EnsemblGenomes-Gn; SPATRNAARG.03.
DR   EnsemblGenomes-Gn; SPATRNAASP.01.
DR   EnsemblGenomes-Gn; SPATRNAASP.02.
DR   EnsemblGenomes-Gn; SPATRNACYS.01.
DR   EnsemblGenomes-Gn; SPATRNACYS.02.
DR   EnsemblGenomes-Gn; SPATRNACYS.03.
DR   EnsemblGenomes-Gn; SPATRNAGLU.01.
DR   EnsemblGenomes-Gn; SPATRNAGLU.02.
DR   EnsemblGenomes-Gn; SPATRNAGLU.03.
DR   EnsemblGenomes-Gn; SPATRNAGLU.04.
DR   EnsemblGenomes-Gn; SPATRNAGLY.01.
DR   EnsemblGenomes-Gn; SPATRNAGLY.02.
DR   EnsemblGenomes-Gn; SPATRNAILE.01.
DR   EnsemblGenomes-Gn; SPATRNAILE.02.
DR   EnsemblGenomes-Gn; SPATRNAILE.03.
DR   EnsemblGenomes-Gn; SPATRNAILE.04.
DR   EnsemblGenomes-Gn; SPATRNALEU.01.
DR   EnsemblGenomes-Gn; SPATRNALEU.02.
DR   EnsemblGenomes-Gn; SPATRNALEU.03.
DR   EnsemblGenomes-Gn; SPATRNALEU.04.
DR   EnsemblGenomes-Gn; SPATRNALYS.01.
DR   EnsemblGenomes-Gn; SPATRNALYS.02.
DR   EnsemblGenomes-Gn; SPATRNALYS.03.
DR   EnsemblGenomes-Gn; SPATRNALYS.04.
DR   EnsemblGenomes-Gn; SPATRNALYS.05.
DR   EnsemblGenomes-Gn; SPATRNAMET.01.
DR   EnsemblGenomes-Gn; SPATRNAMET.02.
DR   EnsemblGenomes-Gn; SPATRNAMET.03.
DR   EnsemblGenomes-Gn; SPATRNAPHE.01.
DR   EnsemblGenomes-Gn; SPATRNAPHE.02.
DR   EnsemblGenomes-Gn; SPATRNAPRO.01.
DR   EnsemblGenomes-Gn; SPATRNAPRO.02.
DR   EnsemblGenomes-Gn; SPATRNAPRO.03.
DR   EnsemblGenomes-Gn; SPATRNASER.01.
DR   EnsemblGenomes-Gn; SPATRNASER.02.
DR   EnsemblGenomes-Gn; SPATRNASER.03.
DR   EnsemblGenomes-Gn; SPATRNASER.04.
DR   EnsemblGenomes-Gn; SPATRNATHR.01.
DR   EnsemblGenomes-Gn; SPATRNATHR.02.
DR   EnsemblGenomes-Gn; SPATRNATHR.03.
DR   EnsemblGenomes-Gn; SPATRNATHR.04.
DR   EnsemblGenomes-Gn; SPATRNATHR.05.
DR   EnsemblGenomes-Gn; SPATRNATRP.01.
DR   EnsemblGenomes-Gn; SPATRNATYR.01.
DR   EnsemblGenomes-Gn; SPATRNAVAL.01.
DR   EnsemblGenomes-Gn; SPATRNAVAL.02.
DR   EnsemblGenomes-Gn; SPATRNAVAL.03.
DR   EnsemblGenomes-Gn; SPATRNAVAL.04.
DR   EnsemblGenomes-Gn; SPNCRNA.01.
DR   EnsemblGenomes-Gn; SPNCRNA.03.
DR   EnsemblGenomes-Gn; SPNCRNA.05.
DR   EnsemblGenomes-Gn; SPNCRNA.1000.
DR   EnsemblGenomes-Gn; SPNCRNA.1001.
DR   EnsemblGenomes-Gn; SPNCRNA.1002.
DR   EnsemblGenomes-Gn; SPNCRNA.1003.
DR   EnsemblGenomes-Gn; SPNCRNA.1004.
DR   EnsemblGenomes-Gn; SPNCRNA.1005.
DR   EnsemblGenomes-Gn; SPNCRNA.1006.
DR   EnsemblGenomes-Gn; SPNCRNA.1007.
DR   EnsemblGenomes-Gn; SPNCRNA.1008.
DR   EnsemblGenomes-Gn; SPNCRNA.1009.
DR   EnsemblGenomes-Gn; SPNCRNA.1010.
DR   EnsemblGenomes-Gn; SPNCRNA.1011.
DR   EnsemblGenomes-Gn; SPNCRNA.1012.
DR   EnsemblGenomes-Gn; SPNCRNA.1013.
DR   EnsemblGenomes-Gn; SPNCRNA.1014.
DR   EnsemblGenomes-Gn; SPNCRNA.1015.
DR   EnsemblGenomes-Gn; SPNCRNA.1016.
DR   EnsemblGenomes-Gn; SPNCRNA.1017.
DR   EnsemblGenomes-Gn; SPNCRNA.1018.
DR   EnsemblGenomes-Gn; SPNCRNA.1019.
DR   EnsemblGenomes-Gn; SPNCRNA.1020.
DR   EnsemblGenomes-Gn; SPNCRNA.1021.
DR   EnsemblGenomes-Gn; SPNCRNA.1022.
DR   EnsemblGenomes-Gn; SPNCRNA.1023.
DR   EnsemblGenomes-Gn; SPNCRNA.1024.
DR   EnsemblGenomes-Gn; SPNCRNA.1025.
DR   EnsemblGenomes-Gn; SPNCRNA.1026.
DR   EnsemblGenomes-Gn; SPNCRNA.1027.
DR   EnsemblGenomes-Gn; SPNCRNA.1028.
DR   EnsemblGenomes-Gn; SPNCRNA.1029.
DR   EnsemblGenomes-Gn; SPNCRNA.1030.
DR   EnsemblGenomes-Gn; SPNCRNA.1031.
DR   EnsemblGenomes-Gn; SPNCRNA.1032.
DR   EnsemblGenomes-Gn; SPNCRNA.1033.
DR   EnsemblGenomes-Gn; SPNCRNA.1034.
DR   EnsemblGenomes-Gn; SPNCRNA.1035.
DR   EnsemblGenomes-Gn; SPNCRNA.1036.
DR   EnsemblGenomes-Gn; SPNCRNA.1037.
DR   EnsemblGenomes-Gn; SPNCRNA.1038.
DR   EnsemblGenomes-Gn; SPNCRNA.1039.
DR   EnsemblGenomes-Gn; SPNCRNA.1040.
DR   EnsemblGenomes-Gn; SPNCRNA.1041.
DR   EnsemblGenomes-Gn; SPNCRNA.1042.
DR   EnsemblGenomes-Gn; SPNCRNA.1043.
DR   EnsemblGenomes-Gn; SPNCRNA.1044.
DR   EnsemblGenomes-Gn; SPNCRNA.1045.
DR   EnsemblGenomes-Gn; SPNCRNA.1046.
DR   EnsemblGenomes-Gn; SPNCRNA.1047.
DR   EnsemblGenomes-Gn; SPNCRNA.1048.
DR   EnsemblGenomes-Gn; SPNCRNA.1049.
DR   EnsemblGenomes-Gn; SPNCRNA.1050.
DR   EnsemblGenomes-Gn; SPNCRNA.1051.
DR   EnsemblGenomes-Gn; SPNCRNA.1052.
DR   EnsemblGenomes-Gn; SPNCRNA.1053.
DR   EnsemblGenomes-Gn; SPNCRNA.1054.
DR   EnsemblGenomes-Gn; SPNCRNA.1055.
DR   EnsemblGenomes-Gn; SPNCRNA.1056.
DR   EnsemblGenomes-Gn; SPNCRNA.1057.
DR   EnsemblGenomes-Gn; SPNCRNA.1058.
DR   EnsemblGenomes-Gn; SPNCRNA.1059.
DR   EnsemblGenomes-Gn; SPNCRNA.1060.
DR   EnsemblGenomes-Gn; SPNCRNA.1061.
DR   EnsemblGenomes-Gn; SPNCRNA.1062.
DR   EnsemblGenomes-Gn; SPNCRNA.1063.
DR   EnsemblGenomes-Gn; SPNCRNA.1064.
DR   EnsemblGenomes-Gn; SPNCRNA.1065.
DR   EnsemblGenomes-Gn; SPNCRNA.1066.
DR   EnsemblGenomes-Gn; SPNCRNA.1067.
DR   EnsemblGenomes-Gn; SPNCRNA.1068.
DR   EnsemblGenomes-Gn; SPNCRNA.1069.
DR   EnsemblGenomes-Gn; SPNCRNA.1070.
DR   EnsemblGenomes-Gn; SPNCRNA.1071.
DR   EnsemblGenomes-Gn; SPNCRNA.1072.
DR   EnsemblGenomes-Gn; SPNCRNA.1073.
DR   EnsemblGenomes-Gn; SPNCRNA.1074.
DR   EnsemblGenomes-Gn; SPNCRNA.1075.
DR   EnsemblGenomes-Gn; SPNCRNA.1076.
DR   EnsemblGenomes-Gn; SPNCRNA.1077.
DR   EnsemblGenomes-Gn; SPNCRNA.1078.
DR   EnsemblGenomes-Gn; SPNCRNA.1079.
DR   EnsemblGenomes-Gn; SPNCRNA.1080.
DR   EnsemblGenomes-Gn; SPNCRNA.1081.
DR   EnsemblGenomes-Gn; SPNCRNA.1082.
DR   EnsemblGenomes-Gn; SPNCRNA.1083.
DR   EnsemblGenomes-Gn; SPNCRNA.1084.
DR   EnsemblGenomes-Gn; SPNCRNA.1085.
DR   EnsemblGenomes-Gn; SPNCRNA.1086.
DR   EnsemblGenomes-Gn; SPNCRNA.1087.
DR   EnsemblGenomes-Gn; SPNCRNA.1088.
DR   EnsemblGenomes-Gn; SPNCRNA.1089.
DR   EnsemblGenomes-Gn; SPNCRNA.1090.
DR   EnsemblGenomes-Gn; SPNCRNA.1091.
DR   EnsemblGenomes-Gn; SPNCRNA.1092.
DR   EnsemblGenomes-Gn; SPNCRNA.1093.
DR   EnsemblGenomes-Gn; SPNCRNA.12.
DR   EnsemblGenomes-Gn; SPNCRNA.124.
DR   EnsemblGenomes-Gn; SPNCRNA.13.
DR   EnsemblGenomes-Gn; SPNCRNA.130.
DR   EnsemblGenomes-Gn; SPNCRNA.136.
DR   EnsemblGenomes-Gn; SPNCRNA.137.
DR   EnsemblGenomes-Gn; SPNCRNA.138.
DR   EnsemblGenomes-Gn; SPNCRNA.139.
DR   EnsemblGenomes-Gn; SPNCRNA.14.
DR   EnsemblGenomes-Gn; SPNCRNA.141.
DR   EnsemblGenomes-Gn; SPNCRNA.142.
DR   EnsemblGenomes-Gn; SPNCRNA.143.
DR   EnsemblGenomes-Gn; SPNCRNA.144.
DR   EnsemblGenomes-Gn; SPNCRNA.145.
DR   EnsemblGenomes-Gn; SPNCRNA.147.
DR   EnsemblGenomes-Gn; SPNCRNA.148.
DR   EnsemblGenomes-Gn; SPNCRNA.154.
DR   EnsemblGenomes-Gn; SPNCRNA.155.
DR   EnsemblGenomes-Gn; SPNCRNA.156.
DR   EnsemblGenomes-Gn; SPNCRNA.158.
DR   EnsemblGenomes-Gn; SPNCRNA.159.
DR   EnsemblGenomes-Gn; SPNCRNA.160.
DR   EnsemblGenomes-Gn; SPNCRNA.163.
DR   EnsemblGenomes-Gn; SPNCRNA.164.
DR   EnsemblGenomes-Gn; SPNCRNA.166.
DR   EnsemblGenomes-Gn; SPNCRNA.168.
DR   EnsemblGenomes-Gn; SPNCRNA.169.
DR   EnsemblGenomes-Gn; SPNCRNA.171.
DR   EnsemblGenomes-Gn; SPNCRNA.173.
DR   EnsemblGenomes-Gn; SPNCRNA.174.
DR   EnsemblGenomes-Gn; SPNCRNA.175.
DR   EnsemblGenomes-Gn; SPNCRNA.177.
DR   EnsemblGenomes-Gn; SPNCRNA.178.
DR   EnsemblGenomes-Gn; SPNCRNA.181.
DR   EnsemblGenomes-Gn; SPNCRNA.182.
DR   EnsemblGenomes-Gn; SPNCRNA.184.
DR   EnsemblGenomes-Gn; SPNCRNA.185.
DR   EnsemblGenomes-Gn; SPNCRNA.186.
DR   EnsemblGenomes-Gn; SPNCRNA.187.
DR   EnsemblGenomes-Gn; SPNCRNA.188.
DR   EnsemblGenomes-Gn; SPNCRNA.189.
DR   EnsemblGenomes-Gn; SPNCRNA.19.
DR   EnsemblGenomes-Gn; SPNCRNA.190.
DR   EnsemblGenomes-Gn; SPNCRNA.192.
DR   EnsemblGenomes-Gn; SPNCRNA.194.
DR   EnsemblGenomes-Gn; SPNCRNA.195.
DR   EnsemblGenomes-Gn; SPNCRNA.197.
DR   EnsemblGenomes-Gn; SPNCRNA.198.
DR   EnsemblGenomes-Gn; SPNCRNA.199.
DR   EnsemblGenomes-Gn; SPNCRNA.200.
DR   EnsemblGenomes-Gn; SPNCRNA.201.
DR   EnsemblGenomes-Gn; SPNCRNA.202.
DR   EnsemblGenomes-Gn; SPNCRNA.204.
DR   EnsemblGenomes-Gn; SPNCRNA.205.
DR   EnsemblGenomes-Gn; SPNCRNA.208.
DR   EnsemblGenomes-Gn; SPNCRNA.209.
DR   EnsemblGenomes-Gn; SPNCRNA.21.
DR   EnsemblGenomes-Gn; SPNCRNA.210.
DR   EnsemblGenomes-Gn; SPNCRNA.212.
DR   EnsemblGenomes-Gn; SPNCRNA.213.
DR   EnsemblGenomes-Gn; SPNCRNA.214.
DR   EnsemblGenomes-Gn; SPNCRNA.215.
DR   EnsemblGenomes-Gn; SPNCRNA.216.
DR   EnsemblGenomes-Gn; SPNCRNA.217.
DR   EnsemblGenomes-Gn; SPNCRNA.218.
DR   EnsemblGenomes-Gn; SPNCRNA.219.
DR   EnsemblGenomes-Gn; SPNCRNA.220.
DR   EnsemblGenomes-Gn; SPNCRNA.222.
DR   EnsemblGenomes-Gn; SPNCRNA.226.
DR   EnsemblGenomes-Gn; SPNCRNA.227.
DR   EnsemblGenomes-Gn; SPNCRNA.228.
DR   EnsemblGenomes-Gn; SPNCRNA.229.
DR   EnsemblGenomes-Gn; SPNCRNA.230.
DR   EnsemblGenomes-Gn; SPNCRNA.231.
DR   EnsemblGenomes-Gn; SPNCRNA.232.
DR   EnsemblGenomes-Gn; SPNCRNA.233.
DR   EnsemblGenomes-Gn; SPNCRNA.234.
DR   EnsemblGenomes-Gn; SPNCRNA.236.
DR   EnsemblGenomes-Gn; SPNCRNA.237.
DR   EnsemblGenomes-Gn; SPNCRNA.239.
DR   EnsemblGenomes-Gn; SPNCRNA.240.
DR   EnsemblGenomes-Gn; SPNCRNA.242.
DR   EnsemblGenomes-Gn; SPNCRNA.243.
DR   EnsemblGenomes-Gn; SPNCRNA.244.
DR   EnsemblGenomes-Gn; SPNCRNA.246.
DR   EnsemblGenomes-Gn; SPNCRNA.247.
DR   EnsemblGenomes-Gn; SPNCRNA.248.
DR   EnsemblGenomes-Gn; SPNCRNA.249.
DR   EnsemblGenomes-Gn; SPNCRNA.253.
DR   EnsemblGenomes-Gn; SPNCRNA.254.
DR   EnsemblGenomes-Gn; SPNCRNA.255.
DR   EnsemblGenomes-Gn; SPNCRNA.256.
DR   EnsemblGenomes-Gn; SPNCRNA.257.
DR   EnsemblGenomes-Gn; SPNCRNA.258.
DR   EnsemblGenomes-Gn; SPNCRNA.260.
DR   EnsemblGenomes-Gn; SPNCRNA.261.
DR   EnsemblGenomes-Gn; SPNCRNA.263.
DR   EnsemblGenomes-Gn; SPNCRNA.264.
DR   EnsemblGenomes-Gn; SPNCRNA.265.
DR   EnsemblGenomes-Gn; SPNCRNA.266.
DR   EnsemblGenomes-Gn; SPNCRNA.267.
DR   EnsemblGenomes-Gn; SPNCRNA.268.
DR   EnsemblGenomes-Gn; SPNCRNA.269.
DR   EnsemblGenomes-Gn; SPNCRNA.27.
DR   EnsemblGenomes-Gn; SPNCRNA.270.
DR   EnsemblGenomes-Gn; SPNCRNA.271.
DR   EnsemblGenomes-Gn; SPNCRNA.272.
DR   EnsemblGenomes-Gn; SPNCRNA.273.
DR   EnsemblGenomes-Gn; SPNCRNA.274.
DR   EnsemblGenomes-Gn; SPNCRNA.275.
DR   EnsemblGenomes-Gn; SPNCRNA.276.
DR   EnsemblGenomes-Gn; SPNCRNA.277.
DR   EnsemblGenomes-Gn; SPNCRNA.278.
DR   EnsemblGenomes-Gn; SPNCRNA.279.
DR   EnsemblGenomes-Gn; SPNCRNA.28.
DR   EnsemblGenomes-Gn; SPNCRNA.280.
DR   EnsemblGenomes-Gn; SPNCRNA.281.
DR   EnsemblGenomes-Gn; SPNCRNA.282.
DR   EnsemblGenomes-Gn; SPNCRNA.283.
DR   EnsemblGenomes-Gn; SPNCRNA.284.
DR   EnsemblGenomes-Gn; SPNCRNA.286.
DR   EnsemblGenomes-Gn; SPNCRNA.30.
DR   EnsemblGenomes-Gn; SPNCRNA.306.
DR   EnsemblGenomes-Gn; SPNCRNA.31.
DR   EnsemblGenomes-Gn; SPNCRNA.310.
DR   EnsemblGenomes-Gn; SPNCRNA.311.
DR   EnsemblGenomes-Gn; SPNCRNA.326.
DR   EnsemblGenomes-Gn; SPNCRNA.333.
DR   EnsemblGenomes-Gn; SPNCRNA.341.
DR   EnsemblGenomes-Gn; SPNCRNA.37.
DR   EnsemblGenomes-Gn; SPNCRNA.396.
DR   EnsemblGenomes-Gn; SPNCRNA.43.
DR   EnsemblGenomes-Gn; SPNCRNA.432.
DR   EnsemblGenomes-Gn; SPNCRNA.46.
DR   EnsemblGenomes-Gn; SPNCRNA.47.
DR   EnsemblGenomes-Gn; SPNCRNA.499.
DR   EnsemblGenomes-Gn; SPNCRNA.50.
DR   EnsemblGenomes-Gn; SPNCRNA.507.
DR   EnsemblGenomes-Gn; SPNCRNA.510.
DR   EnsemblGenomes-Gn; SPNCRNA.52.
DR   EnsemblGenomes-Gn; SPNCRNA.524.
DR   EnsemblGenomes-Gn; SPNCRNA.525.
DR   EnsemblGenomes-Gn; SPNCRNA.528.
DR   EnsemblGenomes-Gn; SPNCRNA.529.
DR   EnsemblGenomes-Gn; SPNCRNA.53.
DR   EnsemblGenomes-Gn; SPNCRNA.530.
DR   EnsemblGenomes-Gn; SPNCRNA.54.
DR   EnsemblGenomes-Gn; SPNCRNA.551.
DR   EnsemblGenomes-Gn; SPNCRNA.552.
DR   EnsemblGenomes-Gn; SPNCRNA.553.
DR   EnsemblGenomes-Gn; SPNCRNA.554.
DR   EnsemblGenomes-Gn; SPNCRNA.555.
DR   EnsemblGenomes-Gn; SPNCRNA.556.
DR   EnsemblGenomes-Gn; SPNCRNA.557.
DR   EnsemblGenomes-Gn; SPNCRNA.558.
DR   EnsemblGenomes-Gn; SPNCRNA.559.
DR   EnsemblGenomes-Gn; SPNCRNA.56.
DR   EnsemblGenomes-Gn; SPNCRNA.560.
DR   EnsemblGenomes-Gn; SPNCRNA.561.
DR   EnsemblGenomes-Gn; SPNCRNA.562.
DR   EnsemblGenomes-Gn; SPNCRNA.563.
DR   EnsemblGenomes-Gn; SPNCRNA.564.
DR   EnsemblGenomes-Gn; SPNCRNA.57.
DR   EnsemblGenomes-Gn; SPNCRNA.58.
DR   EnsemblGenomes-Gn; SPNCRNA.59.
DR   EnsemblGenomes-Gn; SPNCRNA.600.
DR   EnsemblGenomes-Gn; SPNCRNA.601.
DR   EnsemblGenomes-Gn; SPNCRNA.602.
DR   EnsemblGenomes-Gn; SPNCRNA.603.
DR   EnsemblGenomes-Gn; SPNCRNA.604.
DR   EnsemblGenomes-Gn; SPNCRNA.605.
DR   EnsemblGenomes-Gn; SPNCRNA.606.
DR   EnsemblGenomes-Gn; SPNCRNA.607.
DR   EnsemblGenomes-Gn; SPNCRNA.608.
DR   EnsemblGenomes-Gn; SPNCRNA.609.
DR   EnsemblGenomes-Gn; SPNCRNA.61.
DR   EnsemblGenomes-Gn; SPNCRNA.610.
DR   EnsemblGenomes-Gn; SPNCRNA.611.
DR   EnsemblGenomes-Gn; SPNCRNA.612.
DR   EnsemblGenomes-Gn; SPNCRNA.613.
DR   EnsemblGenomes-Gn; SPNCRNA.614.
DR   EnsemblGenomes-Gn; SPNCRNA.615.
DR   EnsemblGenomes-Gn; SPNCRNA.616.
DR   EnsemblGenomes-Gn; SPNCRNA.617.
DR   EnsemblGenomes-Gn; SPNCRNA.618.
DR   EnsemblGenomes-Gn; SPNCRNA.619.
DR   EnsemblGenomes-Gn; SPNCRNA.620.
DR   EnsemblGenomes-Gn; SPNCRNA.621.
DR   EnsemblGenomes-Gn; SPNCRNA.622.
DR   EnsemblGenomes-Gn; SPNCRNA.623.
DR   EnsemblGenomes-Gn; SPNCRNA.624.
DR   EnsemblGenomes-Gn; SPNCRNA.625.
DR   EnsemblGenomes-Gn; SPNCRNA.626.
DR   EnsemblGenomes-Gn; SPNCRNA.627.
DR   EnsemblGenomes-Gn; SPNCRNA.628.
DR   EnsemblGenomes-Gn; SPNCRNA.629.
DR   EnsemblGenomes-Gn; SPNCRNA.630.
DR   EnsemblGenomes-Gn; SPNCRNA.631.
DR   EnsemblGenomes-Gn; SPNCRNA.632.
DR   EnsemblGenomes-Gn; SPNCRNA.633.
DR   EnsemblGenomes-Gn; SPNCRNA.634.
DR   EnsemblGenomes-Gn; SPNCRNA.635.
DR   EnsemblGenomes-Gn; SPNCRNA.636.
DR   EnsemblGenomes-Gn; SPNCRNA.637.
DR   EnsemblGenomes-Gn; SPNCRNA.638.
DR   EnsemblGenomes-Gn; SPNCRNA.639.
DR   EnsemblGenomes-Gn; SPNCRNA.640.
DR   EnsemblGenomes-Gn; SPNCRNA.641.
DR   EnsemblGenomes-Gn; SPNCRNA.642.
DR   EnsemblGenomes-Gn; SPNCRNA.643.
DR   EnsemblGenomes-Gn; SPNCRNA.644.
DR   EnsemblGenomes-Gn; SPNCRNA.645.
DR   EnsemblGenomes-Gn; SPNCRNA.646.
DR   EnsemblGenomes-Gn; SPNCRNA.647.
DR   EnsemblGenomes-Gn; SPNCRNA.648.
DR   EnsemblGenomes-Gn; SPNCRNA.649.
DR   EnsemblGenomes-Gn; SPNCRNA.650.
DR   EnsemblGenomes-Gn; SPNCRNA.651.
DR   EnsemblGenomes-Gn; SPNCRNA.652.
DR   EnsemblGenomes-Gn; SPNCRNA.653.
DR   EnsemblGenomes-Gn; SPNCRNA.654.
DR   EnsemblGenomes-Gn; SPNCRNA.655.
DR   EnsemblGenomes-Gn; SPNCRNA.656.
DR   EnsemblGenomes-Gn; SPNCRNA.657.
DR   EnsemblGenomes-Gn; SPNCRNA.658.
DR   EnsemblGenomes-Gn; SPNCRNA.659.
DR   EnsemblGenomes-Gn; SPNCRNA.660.
DR   EnsemblGenomes-Gn; SPNCRNA.661.
DR   EnsemblGenomes-Gn; SPNCRNA.662.
DR   EnsemblGenomes-Gn; SPNCRNA.663.
DR   EnsemblGenomes-Gn; SPNCRNA.664.
DR   EnsemblGenomes-Gn; SPNCRNA.665.
DR   EnsemblGenomes-Gn; SPNCRNA.666.
DR   EnsemblGenomes-Gn; SPNCRNA.667.
DR   EnsemblGenomes-Gn; SPNCRNA.668.
DR   EnsemblGenomes-Gn; SPNCRNA.669.
DR   EnsemblGenomes-Gn; SPNCRNA.670.
DR   EnsemblGenomes-Gn; SPNCRNA.671.
DR   EnsemblGenomes-Gn; SPNCRNA.672.
DR   EnsemblGenomes-Gn; SPNCRNA.673.
DR   EnsemblGenomes-Gn; SPNCRNA.674.
DR   EnsemblGenomes-Gn; SPNCRNA.675.
DR   EnsemblGenomes-Gn; SPNCRNA.676.
DR   EnsemblGenomes-Gn; SPNCRNA.677.
DR   EnsemblGenomes-Gn; SPNCRNA.678.
DR   EnsemblGenomes-Gn; SPNCRNA.679.
DR   EnsemblGenomes-Gn; SPNCRNA.680.
DR   EnsemblGenomes-Gn; SPNCRNA.681.
DR   EnsemblGenomes-Gn; SPNCRNA.682.
DR   EnsemblGenomes-Gn; SPNCRNA.683.
DR   EnsemblGenomes-Gn; SPNCRNA.684.
DR   EnsemblGenomes-Gn; SPNCRNA.685.
DR   EnsemblGenomes-Gn; SPNCRNA.686.
DR   EnsemblGenomes-Gn; SPNCRNA.687.
DR   EnsemblGenomes-Gn; SPNCRNA.688.
DR   EnsemblGenomes-Gn; SPNCRNA.689.
DR   EnsemblGenomes-Gn; SPNCRNA.690.
DR   EnsemblGenomes-Gn; SPNCRNA.691.
DR   EnsemblGenomes-Gn; SPNCRNA.692.
DR   EnsemblGenomes-Gn; SPNCRNA.693.
DR   EnsemblGenomes-Gn; SPNCRNA.694.
DR   EnsemblGenomes-Gn; SPNCRNA.695.
DR   EnsemblGenomes-Gn; SPNCRNA.696.
DR   EnsemblGenomes-Gn; SPNCRNA.697.
DR   EnsemblGenomes-Gn; SPNCRNA.698.
DR   EnsemblGenomes-Gn; SPNCRNA.699.
DR   EnsemblGenomes-Gn; SPNCRNA.70.
DR   EnsemblGenomes-Gn; SPNCRNA.700.
DR   EnsemblGenomes-Gn; SPNCRNA.701.
DR   EnsemblGenomes-Gn; SPNCRNA.702.
DR   EnsemblGenomes-Gn; SPNCRNA.703.
DR   EnsemblGenomes-Gn; SPNCRNA.704.
DR   EnsemblGenomes-Gn; SPNCRNA.705.
DR   EnsemblGenomes-Gn; SPNCRNA.706.
DR   EnsemblGenomes-Gn; SPNCRNA.707.
DR   EnsemblGenomes-Gn; SPNCRNA.708.
DR   EnsemblGenomes-Gn; SPNCRNA.709.
DR   EnsemblGenomes-Gn; SPNCRNA.71.
DR   EnsemblGenomes-Gn; SPNCRNA.710.
DR   EnsemblGenomes-Gn; SPNCRNA.711.
DR   EnsemblGenomes-Gn; SPNCRNA.712.
DR   EnsemblGenomes-Gn; SPNCRNA.713.
DR   EnsemblGenomes-Gn; SPNCRNA.714.
DR   EnsemblGenomes-Gn; SPNCRNA.715.
DR   EnsemblGenomes-Gn; SPNCRNA.716.
DR   EnsemblGenomes-Gn; SPNCRNA.717.
DR   EnsemblGenomes-Gn; SPNCRNA.718.
DR   EnsemblGenomes-Gn; SPNCRNA.719.
DR   EnsemblGenomes-Gn; SPNCRNA.72.
DR   EnsemblGenomes-Gn; SPNCRNA.720.
DR   EnsemblGenomes-Gn; SPNCRNA.721.
DR   EnsemblGenomes-Gn; SPNCRNA.722.
DR   EnsemblGenomes-Gn; SPNCRNA.723.
DR   EnsemblGenomes-Gn; SPNCRNA.724.
DR   EnsemblGenomes-Gn; SPNCRNA.725.
DR   EnsemblGenomes-Gn; SPNCRNA.726.
DR   EnsemblGenomes-Gn; SPNCRNA.727.
DR   EnsemblGenomes-Gn; SPNCRNA.728.
DR   EnsemblGenomes-Gn; SPNCRNA.729.
DR   EnsemblGenomes-Gn; SPNCRNA.73.
DR   EnsemblGenomes-Gn; SPNCRNA.730.
DR   EnsemblGenomes-Gn; SPNCRNA.731.
DR   EnsemblGenomes-Gn; SPNCRNA.732.
DR   EnsemblGenomes-Gn; SPNCRNA.733.
DR   EnsemblGenomes-Gn; SPNCRNA.734.
DR   EnsemblGenomes-Gn; SPNCRNA.735.
DR   EnsemblGenomes-Gn; SPNCRNA.736.
DR   EnsemblGenomes-Gn; SPNCRNA.737.
DR   EnsemblGenomes-Gn; SPNCRNA.738.
DR   EnsemblGenomes-Gn; SPNCRNA.739.
DR   EnsemblGenomes-Gn; SPNCRNA.74.
DR   EnsemblGenomes-Gn; SPNCRNA.740.
DR   EnsemblGenomes-Gn; SPNCRNA.741.
DR   EnsemblGenomes-Gn; SPNCRNA.742.
DR   EnsemblGenomes-Gn; SPNCRNA.743.
DR   EnsemblGenomes-Gn; SPNCRNA.744.
DR   EnsemblGenomes-Gn; SPNCRNA.745.
DR   EnsemblGenomes-Gn; SPNCRNA.746.
DR   EnsemblGenomes-Gn; SPNCRNA.747.
DR   EnsemblGenomes-Gn; SPNCRNA.748.
DR   EnsemblGenomes-Gn; SPNCRNA.749.
DR   EnsemblGenomes-Gn; SPNCRNA.750.
DR   EnsemblGenomes-Gn; SPNCRNA.751.
DR   EnsemblGenomes-Gn; SPNCRNA.752.
DR   EnsemblGenomes-Gn; SPNCRNA.753.
DR   EnsemblGenomes-Gn; SPNCRNA.754.
DR   EnsemblGenomes-Gn; SPNCRNA.755.
DR   EnsemblGenomes-Gn; SPNCRNA.756.
DR   EnsemblGenomes-Gn; SPNCRNA.757.
DR   EnsemblGenomes-Gn; SPNCRNA.758.
DR   EnsemblGenomes-Gn; SPNCRNA.759.
DR   EnsemblGenomes-Gn; SPNCRNA.760.
DR   EnsemblGenomes-Gn; SPNCRNA.761.
DR   EnsemblGenomes-Gn; SPNCRNA.762.
DR   EnsemblGenomes-Gn; SPNCRNA.763.
DR   EnsemblGenomes-Gn; SPNCRNA.764.
DR   EnsemblGenomes-Gn; SPNCRNA.765.
DR   EnsemblGenomes-Gn; SPNCRNA.766.
DR   EnsemblGenomes-Gn; SPNCRNA.767.
DR   EnsemblGenomes-Gn; SPNCRNA.768.
DR   EnsemblGenomes-Gn; SPNCRNA.769.
DR   EnsemblGenomes-Gn; SPNCRNA.770.
DR   EnsemblGenomes-Gn; SPNCRNA.771.
DR   EnsemblGenomes-Gn; SPNCRNA.772.
DR   EnsemblGenomes-Gn; SPNCRNA.773.
DR   EnsemblGenomes-Gn; SPNCRNA.774.
DR   EnsemblGenomes-Gn; SPNCRNA.775.
DR   EnsemblGenomes-Gn; SPNCRNA.776.
DR   EnsemblGenomes-Gn; SPNCRNA.777.
DR   EnsemblGenomes-Gn; SPNCRNA.778.
DR   EnsemblGenomes-Gn; SPNCRNA.779.
DR   EnsemblGenomes-Gn; SPNCRNA.780.
DR   EnsemblGenomes-Gn; SPNCRNA.781.
DR   EnsemblGenomes-Gn; SPNCRNA.782.
DR   EnsemblGenomes-Gn; SPNCRNA.783.
DR   EnsemblGenomes-Gn; SPNCRNA.784.
DR   EnsemblGenomes-Gn; SPNCRNA.785.
DR   EnsemblGenomes-Gn; SPNCRNA.786.
DR   EnsemblGenomes-Gn; SPNCRNA.787.
DR   EnsemblGenomes-Gn; SPNCRNA.788.
DR   EnsemblGenomes-Gn; SPNCRNA.789.
DR   EnsemblGenomes-Gn; SPNCRNA.79.
DR   EnsemblGenomes-Gn; SPNCRNA.790.
DR   EnsemblGenomes-Gn; SPNCRNA.791.
DR   EnsemblGenomes-Gn; SPNCRNA.792.
DR   EnsemblGenomes-Gn; SPNCRNA.793.
DR   EnsemblGenomes-Gn; SPNCRNA.794.
DR   EnsemblGenomes-Gn; SPNCRNA.795.
DR   EnsemblGenomes-Gn; SPNCRNA.796.
DR   EnsemblGenomes-Gn; SPNCRNA.797.
DR   EnsemblGenomes-Gn; SPNCRNA.798.
DR   EnsemblGenomes-Gn; SPNCRNA.799.
DR   EnsemblGenomes-Gn; SPNCRNA.80.
DR   EnsemblGenomes-Gn; SPNCRNA.800.
DR   EnsemblGenomes-Gn; SPNCRNA.801.
DR   EnsemblGenomes-Gn; SPNCRNA.802.
DR   EnsemblGenomes-Gn; SPNCRNA.803.
DR   EnsemblGenomes-Gn; SPNCRNA.804.
DR   EnsemblGenomes-Gn; SPNCRNA.805.
DR   EnsemblGenomes-Gn; SPNCRNA.806.
DR   EnsemblGenomes-Gn; SPNCRNA.807.
DR   EnsemblGenomes-Gn; SPNCRNA.808.
DR   EnsemblGenomes-Gn; SPNCRNA.809.
DR   EnsemblGenomes-Gn; SPNCRNA.81.
DR   EnsemblGenomes-Gn; SPNCRNA.810.
DR   EnsemblGenomes-Gn; SPNCRNA.811.
DR   EnsemblGenomes-Gn; SPNCRNA.812.
DR   EnsemblGenomes-Gn; SPNCRNA.813.
DR   EnsemblGenomes-Gn; SPNCRNA.814.
DR   EnsemblGenomes-Gn; SPNCRNA.815.
DR   EnsemblGenomes-Gn; SPNCRNA.816.
DR   EnsemblGenomes-Gn; SPNCRNA.818.
DR   EnsemblGenomes-Gn; SPNCRNA.819.
DR   EnsemblGenomes-Gn; SPNCRNA.82.
DR   EnsemblGenomes-Gn; SPNCRNA.820.
DR   EnsemblGenomes-Gn; SPNCRNA.821.
DR   EnsemblGenomes-Gn; SPNCRNA.822.
DR   EnsemblGenomes-Gn; SPNCRNA.823.
DR   EnsemblGenomes-Gn; SPNCRNA.824.
DR   EnsemblGenomes-Gn; SPNCRNA.825.
DR   EnsemblGenomes-Gn; SPNCRNA.826.
DR   EnsemblGenomes-Gn; SPNCRNA.827.
DR   EnsemblGenomes-Gn; SPNCRNA.828.
DR   EnsemblGenomes-Gn; SPNCRNA.829.
DR   EnsemblGenomes-Gn; SPNCRNA.830.
DR   EnsemblGenomes-Gn; SPNCRNA.831.
DR   EnsemblGenomes-Gn; SPNCRNA.832.
DR   EnsemblGenomes-Gn; SPNCRNA.833.
DR   EnsemblGenomes-Gn; SPNCRNA.834.
DR   EnsemblGenomes-Gn; SPNCRNA.835.
DR   EnsemblGenomes-Gn; SPNCRNA.836.
DR   EnsemblGenomes-Gn; SPNCRNA.837.
DR   EnsemblGenomes-Gn; SPNCRNA.838.
DR   EnsemblGenomes-Gn; SPNCRNA.839.
DR   EnsemblGenomes-Gn; SPNCRNA.84.
DR   EnsemblGenomes-Gn; SPNCRNA.840.
DR   EnsemblGenomes-Gn; SPNCRNA.841.
DR   EnsemblGenomes-Gn; SPNCRNA.842.
DR   EnsemblGenomes-Gn; SPNCRNA.843.
DR   EnsemblGenomes-Gn; SPNCRNA.844.
DR   EnsemblGenomes-Gn; SPNCRNA.845.
DR   EnsemblGenomes-Gn; SPNCRNA.846.
DR   EnsemblGenomes-Gn; SPNCRNA.847.
DR   EnsemblGenomes-Gn; SPNCRNA.848.
DR   EnsemblGenomes-Gn; SPNCRNA.849.
DR   EnsemblGenomes-Gn; SPNCRNA.850.
DR   EnsemblGenomes-Gn; SPNCRNA.851.
DR   EnsemblGenomes-Gn; SPNCRNA.852.
DR   EnsemblGenomes-Gn; SPNCRNA.853.
DR   EnsemblGenomes-Gn; SPNCRNA.854.
DR   EnsemblGenomes-Gn; SPNCRNA.855.
DR   EnsemblGenomes-Gn; SPNCRNA.856.
DR   EnsemblGenomes-Gn; SPNCRNA.857.
DR   EnsemblGenomes-Gn; SPNCRNA.858.
DR   EnsemblGenomes-Gn; SPNCRNA.859.
DR   EnsemblGenomes-Gn; SPNCRNA.86.
DR   EnsemblGenomes-Gn; SPNCRNA.860.
DR   EnsemblGenomes-Gn; SPNCRNA.861.
DR   EnsemblGenomes-Gn; SPNCRNA.862.
DR   EnsemblGenomes-Gn; SPNCRNA.863.
DR   EnsemblGenomes-Gn; SPNCRNA.864.
DR   EnsemblGenomes-Gn; SPNCRNA.865.
DR   EnsemblGenomes-Gn; SPNCRNA.866.
DR   EnsemblGenomes-Gn; SPNCRNA.867.
DR   EnsemblGenomes-Gn; SPNCRNA.868.
DR   EnsemblGenomes-Gn; SPNCRNA.869.
DR   EnsemblGenomes-Gn; SPNCRNA.87.
DR   EnsemblGenomes-Gn; SPNCRNA.870.
DR   EnsemblGenomes-Gn; SPNCRNA.871.
DR   EnsemblGenomes-Gn; SPNCRNA.872.
DR   EnsemblGenomes-Gn; SPNCRNA.873.
DR   EnsemblGenomes-Gn; SPNCRNA.874.
DR   EnsemblGenomes-Gn; SPNCRNA.875.
DR   EnsemblGenomes-Gn; SPNCRNA.876.
DR   EnsemblGenomes-Gn; SPNCRNA.877.
DR   EnsemblGenomes-Gn; SPNCRNA.878.
DR   EnsemblGenomes-Gn; SPNCRNA.879.
DR   EnsemblGenomes-Gn; SPNCRNA.88.
DR   EnsemblGenomes-Gn; SPNCRNA.880.
DR   EnsemblGenomes-Gn; SPNCRNA.881.
DR   EnsemblGenomes-Gn; SPNCRNA.882.
DR   EnsemblGenomes-Gn; SPNCRNA.883.
DR   EnsemblGenomes-Gn; SPNCRNA.885.
DR   EnsemblGenomes-Gn; SPNCRNA.886.
DR   EnsemblGenomes-Gn; SPNCRNA.887.
DR   EnsemblGenomes-Gn; SPNCRNA.888.
DR   EnsemblGenomes-Gn; SPNCRNA.889.
DR   EnsemblGenomes-Gn; SPNCRNA.890.
DR   EnsemblGenomes-Gn; SPNCRNA.891.
DR   EnsemblGenomes-Gn; SPNCRNA.892.
DR   EnsemblGenomes-Gn; SPNCRNA.893.
DR   EnsemblGenomes-Gn; SPNCRNA.894.
DR   EnsemblGenomes-Gn; SPNCRNA.895.
DR   EnsemblGenomes-Gn; SPNCRNA.896.
DR   EnsemblGenomes-Gn; SPNCRNA.897.
DR   EnsemblGenomes-Gn; SPNCRNA.898.
DR   EnsemblGenomes-Gn; SPNCRNA.899.
DR   EnsemblGenomes-Gn; SPNCRNA.90.
DR   EnsemblGenomes-Gn; SPNCRNA.900.
DR   EnsemblGenomes-Gn; SPNCRNA.901.
DR   EnsemblGenomes-Gn; SPNCRNA.902.
DR   EnsemblGenomes-Gn; SPNCRNA.903.
DR   EnsemblGenomes-Gn; SPNCRNA.904.
DR   EnsemblGenomes-Gn; SPNCRNA.905.
DR   EnsemblGenomes-Gn; SPNCRNA.906.
DR   EnsemblGenomes-Gn; SPNCRNA.907.
DR   EnsemblGenomes-Gn; SPNCRNA.908.
DR   EnsemblGenomes-Gn; SPNCRNA.909.
DR   EnsemblGenomes-Gn; SPNCRNA.91.
DR   EnsemblGenomes-Gn; SPNCRNA.910.
DR   EnsemblGenomes-Gn; SPNCRNA.911.
DR   EnsemblGenomes-Gn; SPNCRNA.912.
DR   EnsemblGenomes-Gn; SPNCRNA.913.
DR   EnsemblGenomes-Gn; SPNCRNA.914.
DR   EnsemblGenomes-Gn; SPNCRNA.915.
DR   EnsemblGenomes-Gn; SPNCRNA.916.
DR   EnsemblGenomes-Gn; SPNCRNA.917.
DR   EnsemblGenomes-Gn; SPNCRNA.918.
DR   EnsemblGenomes-Gn; SPNCRNA.919.
DR   EnsemblGenomes-Gn; SPNCRNA.92.
DR   EnsemblGenomes-Gn; SPNCRNA.920.
DR   EnsemblGenomes-Gn; SPNCRNA.921.
DR   EnsemblGenomes-Gn; SPNCRNA.922.
DR   EnsemblGenomes-Gn; SPNCRNA.923.
DR   EnsemblGenomes-Gn; SPNCRNA.924.
DR   EnsemblGenomes-Gn; SPNCRNA.925.
DR   EnsemblGenomes-Gn; SPNCRNA.926.
DR   EnsemblGenomes-Gn; SPNCRNA.927.
DR   EnsemblGenomes-Gn; SPNCRNA.928.
DR   EnsemblGenomes-Gn; SPNCRNA.929.
DR   EnsemblGenomes-Gn; SPNCRNA.93.
DR   EnsemblGenomes-Gn; SPNCRNA.930.
DR   EnsemblGenomes-Gn; SPNCRNA.931.
DR   EnsemblGenomes-Gn; SPNCRNA.932.
DR   EnsemblGenomes-Gn; SPNCRNA.933.
DR   EnsemblGenomes-Gn; SPNCRNA.934.
DR   EnsemblGenomes-Gn; SPNCRNA.935.
DR   EnsemblGenomes-Gn; SPNCRNA.936.
DR   EnsemblGenomes-Gn; SPNCRNA.937.
DR   EnsemblGenomes-Gn; SPNCRNA.938.
DR   EnsemblGenomes-Gn; SPNCRNA.939.
DR   EnsemblGenomes-Gn; SPNCRNA.94.
DR   EnsemblGenomes-Gn; SPNCRNA.940.
DR   EnsemblGenomes-Gn; SPNCRNA.941.
DR   EnsemblGenomes-Gn; SPNCRNA.942.
DR   EnsemblGenomes-Gn; SPNCRNA.943.
DR   EnsemblGenomes-Gn; SPNCRNA.944.
DR   EnsemblGenomes-Gn; SPNCRNA.945.
DR   EnsemblGenomes-Gn; SPNCRNA.946.
DR   EnsemblGenomes-Gn; SPNCRNA.947.
DR   EnsemblGenomes-Gn; SPNCRNA.948.
DR   EnsemblGenomes-Gn; SPNCRNA.949.
DR   EnsemblGenomes-Gn; SPNCRNA.95.
DR   EnsemblGenomes-Gn; SPNCRNA.950.
DR   EnsemblGenomes-Gn; SPNCRNA.952.
DR   EnsemblGenomes-Gn; SPNCRNA.953.
DR   EnsemblGenomes-Gn; SPNCRNA.954.
DR   EnsemblGenomes-Gn; SPNCRNA.955.
DR   EnsemblGenomes-Gn; SPNCRNA.956.
DR   EnsemblGenomes-Gn; SPNCRNA.957.
DR   EnsemblGenomes-Gn; SPNCRNA.959.
DR   EnsemblGenomes-Gn; SPNCRNA.96.
DR   EnsemblGenomes-Gn; SPNCRNA.960.
DR   EnsemblGenomes-Gn; SPNCRNA.961.
DR   EnsemblGenomes-Gn; SPNCRNA.962.
DR   EnsemblGenomes-Gn; SPNCRNA.963.
DR   EnsemblGenomes-Gn; SPNCRNA.964.
DR   EnsemblGenomes-Gn; SPNCRNA.965.
DR   EnsemblGenomes-Gn; SPNCRNA.966.
DR   EnsemblGenomes-Gn; SPNCRNA.967.
DR   EnsemblGenomes-Gn; SPNCRNA.968.
DR   EnsemblGenomes-Gn; SPNCRNA.969.
DR   EnsemblGenomes-Gn; SPNCRNA.970.
DR   EnsemblGenomes-Gn; SPNCRNA.971.
DR   EnsemblGenomes-Gn; SPNCRNA.972.
DR   EnsemblGenomes-Gn; SPNCRNA.973.
DR   EnsemblGenomes-Gn; SPNCRNA.974.
DR   EnsemblGenomes-Gn; SPNCRNA.975.
DR   EnsemblGenomes-Gn; SPNCRNA.976.
DR   EnsemblGenomes-Gn; SPNCRNA.977.
DR   EnsemblGenomes-Gn; SPNCRNA.978.
DR   EnsemblGenomes-Gn; SPNCRNA.979.
DR   EnsemblGenomes-Gn; SPNCRNA.98.
DR   EnsemblGenomes-Gn; SPNCRNA.980.
DR   EnsemblGenomes-Gn; SPNCRNA.981.
DR   EnsemblGenomes-Gn; SPNCRNA.982.
DR   EnsemblGenomes-Gn; SPNCRNA.983.
DR   EnsemblGenomes-Gn; SPNCRNA.984.
DR   EnsemblGenomes-Gn; SPNCRNA.985.
DR   EnsemblGenomes-Gn; SPNCRNA.986.
DR   EnsemblGenomes-Gn; SPNCRNA.987.
DR   EnsemblGenomes-Gn; SPNCRNA.988.
DR   EnsemblGenomes-Gn; SPNCRNA.989.
DR   EnsemblGenomes-Gn; SPNCRNA.99.
DR   EnsemblGenomes-Gn; SPNCRNA.990.
DR   EnsemblGenomes-Gn; SPNCRNA.991.
DR   EnsemblGenomes-Gn; SPNCRNA.992.
DR   EnsemblGenomes-Gn; SPNCRNA.993.
DR   EnsemblGenomes-Gn; SPNCRNA.995.
DR   EnsemblGenomes-Gn; SPNCRNA.996.
DR   EnsemblGenomes-Gn; SPNCRNA.997.
DR   EnsemblGenomes-Gn; SPNCRNA.998.
DR   EnsemblGenomes-Gn; SPNCRNA.999.
DR   EnsemblGenomes-Gn; SPRRNA.10.
DR   EnsemblGenomes-Gn; SPRRNA.11.
DR   EnsemblGenomes-Gn; SPRRNA.12.
DR   EnsemblGenomes-Gn; SPRRNA.13.
DR   EnsemblGenomes-Gn; SPRRNA.14.
DR   EnsemblGenomes-Gn; SPRRNA.15.
DR   EnsemblGenomes-Gn; SPRRNA.16.
DR   EnsemblGenomes-Gn; SPRRNA.17.
DR   EnsemblGenomes-Gn; SPRRNA.18.
DR   EnsemblGenomes-Gn; SPRRNA.19.
DR   EnsemblGenomes-Gn; SPRRNA.20.
DR   EnsemblGenomes-Gn; SPRRNA.53.
DR   EnsemblGenomes-Gn; SPSNORNA.01.
DR   EnsemblGenomes-Gn; SPSNORNA.02.
DR   EnsemblGenomes-Gn; SPSNORNA.03.
DR   EnsemblGenomes-Gn; SPSNORNA.04.
DR   EnsemblGenomes-Gn; SPSNORNA.05.
DR   EnsemblGenomes-Gn; SPSNORNA.06.
DR   EnsemblGenomes-Gn; SPSNORNA.07.
DR   EnsemblGenomes-Gn; SPSNORNA.08.
DR   EnsemblGenomes-Gn; SPSNORNA.09.
DR   EnsemblGenomes-Gn; SPSNORNA.10.
DR   EnsemblGenomes-Gn; SPSNORNA.11.
DR   EnsemblGenomes-Gn; SPSNORNA.12.
DR   EnsemblGenomes-Gn; SPSNORNA.13.
DR   EnsemblGenomes-Gn; SPSNORNA.14.
DR   EnsemblGenomes-Gn; SPSNORNA.15.
DR   EnsemblGenomes-Gn; SPSNORNA.16.
DR   EnsemblGenomes-Gn; SPSNORNA.17.
DR   EnsemblGenomes-Gn; SPSNORNA.18.
DR   EnsemblGenomes-Gn; SPSNORNA.19.
DR   EnsemblGenomes-Gn; SPSNORNA.20.
DR   EnsemblGenomes-Gn; SPSNORNA.29.
DR   EnsemblGenomes-Gn; SPSNORNA.30.
DR   EnsemblGenomes-Gn; SPSNORNA.31.
DR   EnsemblGenomes-Gn; SPSNORNA.42.
DR   EnsemblGenomes-Gn; SPSNORNA.43.
DR   EnsemblGenomes-Gn; SPSNORNA.48.
DR   EnsemblGenomes-Gn; SPSNORNA.49.
DR   EnsemblGenomes-Gn; SPSNORNA.50.
DR   EnsemblGenomes-Gn; SPSNORNA.52.
DR   EnsemblGenomes-Gn; SPSNORNA.53.
DR   EnsemblGenomes-Gn; SPSNORNA.54.
DR   EnsemblGenomes-Gn; SPSNRNA.02.
DR   EnsemblGenomes-Gn; SPSNRNA.03.
DR   EnsemblGenomes-Gn; SPSNRNA.06.
DR   EnsemblGenomes-Tr; SPAC110.05.1.
DR   EnsemblGenomes-Tr; SPAC13G6.04.1.
DR   EnsemblGenomes-Tr; SPAC1556.06.2.
DR   EnsemblGenomes-Tr; SPAC1D4.08.1.
DR   EnsemblGenomes-Tr; SPAC212.05c.1.
DR   EnsemblGenomes-Tr; SPAC212.07c.1.
DR   EnsemblGenomes-Tr; SPAC212.09c.1.
DR   EnsemblGenomes-Tr; SPAC212.10.1.
DR   EnsemblGenomes-Tr; SPAC22F3.11c.1.
DR   EnsemblGenomes-Tr; SPAC23A1.20.1.
DR   EnsemblGenomes-Tr; SPAC23D3.05c.1.
DR   EnsemblGenomes-Tr; SPAC29E6.04.1.
DR   EnsemblGenomes-Tr; SPAC2E12.05.1.
DR   EnsemblGenomes-Tr; SPAC2F3.13c.1.
DR   EnsemblGenomes-Tr; SPAC5H10.06c.1.
DR   EnsemblGenomes-Tr; SPAC823.17.1.
DR   EnsemblGenomes-Tr; SPAC977.01.1.
DR   EnsemblGenomes-Tr; SPAC977.13c.1.
DR   EnsemblGenomes-Tr; SPAPB24D3.05c.1.
DR   EnsemblGenomes-Tr; SPATRNAALA.01.1.
DR   EnsemblGenomes-Tr; SPATRNAALA.02.1.
DR   EnsemblGenomes-Tr; SPATRNAALA.03.1.
DR   EnsemblGenomes-Tr; SPATRNAALA.04.1.
DR   EnsemblGenomes-Tr; SPATRNAALA.05.1.
DR   EnsemblGenomes-Tr; SPATRNAALA.06.1.
DR   EnsemblGenomes-Tr; SPATRNAARG.01.1.
DR   EnsemblGenomes-Tr; SPATRNAARG.02.1.
DR   EnsemblGenomes-Tr; SPATRNAARG.03.1.
DR   EnsemblGenomes-Tr; SPATRNAASP.01.1.
DR   EnsemblGenomes-Tr; SPATRNAASP.02.1.
DR   EnsemblGenomes-Tr; SPATRNACYS.01.1.
DR   EnsemblGenomes-Tr; SPATRNACYS.02.1.
DR   EnsemblGenomes-Tr; SPATRNACYS.03.1.
DR   EnsemblGenomes-Tr; SPATRNAGLU.01.1.
DR   EnsemblGenomes-Tr; SPATRNAGLU.02.1.
DR   EnsemblGenomes-Tr; SPATRNAGLU.03.1.
DR   EnsemblGenomes-Tr; SPATRNAGLU.04.1.
DR   EnsemblGenomes-Tr; SPATRNAGLY.01.1.
DR   EnsemblGenomes-Tr; SPATRNAGLY.02.1.
DR   EnsemblGenomes-Tr; SPATRNAILE.01.1.
DR   EnsemblGenomes-Tr; SPATRNAILE.02.1.
DR   EnsemblGenomes-Tr; SPATRNAILE.03.1.
DR   EnsemblGenomes-Tr; SPATRNAILE.04.1.
DR   EnsemblGenomes-Tr; SPATRNALEU.01.1.
DR   EnsemblGenomes-Tr; SPATRNALEU.02.1.
DR   EnsemblGenomes-Tr; SPATRNALEU.03.1.
DR   EnsemblGenomes-Tr; SPATRNALEU.04.1.
DR   EnsemblGenomes-Tr; SPATRNALYS.01.1.
DR   EnsemblGenomes-Tr; SPATRNALYS.02.1.
DR   EnsemblGenomes-Tr; SPATRNALYS.03.1.
DR   EnsemblGenomes-Tr; SPATRNALYS.04.1.
DR   EnsemblGenomes-Tr; SPATRNALYS.05.1.
DR   EnsemblGenomes-Tr; SPATRNAMET.01.1.
DR   EnsemblGenomes-Tr; SPATRNAMET.02.1.
DR   EnsemblGenomes-Tr; SPATRNAMET.03.1.
DR   EnsemblGenomes-Tr; SPATRNAPHE.01.1.
DR   EnsemblGenomes-Tr; SPATRNAPHE.02.1.
DR   EnsemblGenomes-Tr; SPATRNAPRO.01.1.
DR   EnsemblGenomes-Tr; SPATRNAPRO.02.1.
DR   EnsemblGenomes-Tr; SPATRNAPRO.03.1.
DR   EnsemblGenomes-Tr; SPATRNASER.01.1.
DR   EnsemblGenomes-Tr; SPATRNASER.02.1.
DR   EnsemblGenomes-Tr; SPATRNASER.03.1.
DR   EnsemblGenomes-Tr; SPATRNASER.04.1.
DR   EnsemblGenomes-Tr; SPATRNATHR.01.1.
DR   EnsemblGenomes-Tr; SPATRNATHR.02.1.
DR   EnsemblGenomes-Tr; SPATRNATHR.03.1.
DR   EnsemblGenomes-Tr; SPATRNATHR.04.1.
DR   EnsemblGenomes-Tr; SPATRNATHR.05.1.
DR   EnsemblGenomes-Tr; SPATRNATRP.01.1.
DR   EnsemblGenomes-Tr; SPATRNATYR.01.1.
DR   EnsemblGenomes-Tr; SPATRNAVAL.01.1.
DR   EnsemblGenomes-Tr; SPATRNAVAL.02.1.
DR   EnsemblGenomes-Tr; SPATRNAVAL.03.1.
DR   EnsemblGenomes-Tr; SPATRNAVAL.04.1.
DR   EnsemblGenomes-Tr; SPNCRNA.01.1.
DR   EnsemblGenomes-Tr; SPNCRNA.03.1.
DR   EnsemblGenomes-Tr; SPNCRNA.05.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1000.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1001.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1002.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1003.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1004.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1005.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1006.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1007.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1008.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1009.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1010.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1011.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1012.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1013.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1014.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1015.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1016.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1017.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1018.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1019.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1020.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1021.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1022.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1023.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1024.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1025.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1026.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1027.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1028.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1029.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1030.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1031.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1032.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1033.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1034.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1035.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1036.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1037.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1038.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1039.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1040.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1041.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1042.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1043.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1044.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1045.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1046.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1047.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1048.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1049.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1050.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1051.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1052.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1053.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1054.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1055.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1056.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1057.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1058.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1059.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1060.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1061.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1062.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1063.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1064.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1065.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1066.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1067.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1068.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1069.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1070.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1071.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1072.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1073.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1074.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1075.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1076.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1077.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1078.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1079.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1080.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1081.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1082.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1083.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1084.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1085.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1086.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1087.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1088.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1089.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1090.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1091.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1092.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1093.1.
DR   EnsemblGenomes-Tr; SPNCRNA.12.1.
DR   EnsemblGenomes-Tr; SPNCRNA.124.1.
DR   EnsemblGenomes-Tr; SPNCRNA.13.1.
DR   EnsemblGenomes-Tr; SPNCRNA.130.1.
DR   EnsemblGenomes-Tr; SPNCRNA.136.1.
DR   EnsemblGenomes-Tr; SPNCRNA.137.1.
DR   EnsemblGenomes-Tr; SPNCRNA.138.1.
DR   EnsemblGenomes-Tr; SPNCRNA.139.1.
DR   EnsemblGenomes-Tr; SPNCRNA.14.1.
DR   EnsemblGenomes-Tr; SPNCRNA.141.1.
DR   EnsemblGenomes-Tr; SPNCRNA.142.1.
DR   EnsemblGenomes-Tr; SPNCRNA.143.1.
DR   EnsemblGenomes-Tr; SPNCRNA.144.1.
DR   EnsemblGenomes-Tr; SPNCRNA.145.1.
DR   EnsemblGenomes-Tr; SPNCRNA.147.1.
DR   EnsemblGenomes-Tr; SPNCRNA.148.1.
DR   EnsemblGenomes-Tr; SPNCRNA.154.1.
DR   EnsemblGenomes-Tr; SPNCRNA.155.1.
DR   EnsemblGenomes-Tr; SPNCRNA.156.1.
DR   EnsemblGenomes-Tr; SPNCRNA.158.1.
DR   EnsemblGenomes-Tr; SPNCRNA.159.1.
DR   EnsemblGenomes-Tr; SPNCRNA.160.1.
DR   EnsemblGenomes-Tr; SPNCRNA.163.1.
DR   EnsemblGenomes-Tr; SPNCRNA.164.1.
DR   EnsemblGenomes-Tr; SPNCRNA.166.1.
DR   EnsemblGenomes-Tr; SPNCRNA.168.1.
DR   EnsemblGenomes-Tr; SPNCRNA.169.1.
DR   EnsemblGenomes-Tr; SPNCRNA.171.1.
DR   EnsemblGenomes-Tr; SPNCRNA.173.1.
DR   EnsemblGenomes-Tr; SPNCRNA.174.1.
DR   EnsemblGenomes-Tr; SPNCRNA.175.1.
DR   EnsemblGenomes-Tr; SPNCRNA.177.1.
DR   EnsemblGenomes-Tr; SPNCRNA.178.1.
DR   EnsemblGenomes-Tr; SPNCRNA.181.1.
DR   EnsemblGenomes-Tr; SPNCRNA.182.1.
DR   EnsemblGenomes-Tr; SPNCRNA.184.1.
DR   EnsemblGenomes-Tr; SPNCRNA.185.1.
DR   EnsemblGenomes-Tr; SPNCRNA.186.1.
DR   EnsemblGenomes-Tr; SPNCRNA.187.1.
DR   EnsemblGenomes-Tr; SPNCRNA.188.1.
DR   EnsemblGenomes-Tr; SPNCRNA.189.1.
DR   EnsemblGenomes-Tr; SPNCRNA.19.1.
DR   EnsemblGenomes-Tr; SPNCRNA.190.1.
DR   EnsemblGenomes-Tr; SPNCRNA.192.1.
DR   EnsemblGenomes-Tr; SPNCRNA.194.1.
DR   EnsemblGenomes-Tr; SPNCRNA.195.1.
DR   EnsemblGenomes-Tr; SPNCRNA.197.1.
DR   EnsemblGenomes-Tr; SPNCRNA.198.1.
DR   EnsemblGenomes-Tr; SPNCRNA.199.1.
DR   EnsemblGenomes-Tr; SPNCRNA.200.1.
DR   EnsemblGenomes-Tr; SPNCRNA.201.1.
DR   EnsemblGenomes-Tr; SPNCRNA.202.1.
DR   EnsemblGenomes-Tr; SPNCRNA.204.1.
DR   EnsemblGenomes-Tr; SPNCRNA.205.1.
DR   EnsemblGenomes-Tr; SPNCRNA.208.1.
DR   EnsemblGenomes-Tr; SPNCRNA.209.1.
DR   EnsemblGenomes-Tr; SPNCRNA.21.1.
DR   EnsemblGenomes-Tr; SPNCRNA.210.1.
DR   EnsemblGenomes-Tr; SPNCRNA.212.1.
DR   EnsemblGenomes-Tr; SPNCRNA.213.1.
DR   EnsemblGenomes-Tr; SPNCRNA.214.1.
DR   EnsemblGenomes-Tr; SPNCRNA.215.1.
DR   EnsemblGenomes-Tr; SPNCRNA.216.1.
DR   EnsemblGenomes-Tr; SPNCRNA.217.1.
DR   EnsemblGenomes-Tr; SPNCRNA.218.1.
DR   EnsemblGenomes-Tr; SPNCRNA.219.1.
DR   EnsemblGenomes-Tr; SPNCRNA.220.1.
DR   EnsemblGenomes-Tr; SPNCRNA.222.1.
DR   EnsemblGenomes-Tr; SPNCRNA.226.1.
DR   EnsemblGenomes-Tr; SPNCRNA.227.1.
DR   EnsemblGenomes-Tr; SPNCRNA.228.1.
DR   EnsemblGenomes-Tr; SPNCRNA.229.1.
DR   EnsemblGenomes-Tr; SPNCRNA.230.1.
DR   EnsemblGenomes-Tr; SPNCRNA.231.1.
DR   EnsemblGenomes-Tr; SPNCRNA.232.1.
DR   EnsemblGenomes-Tr; SPNCRNA.233.1.
DR   EnsemblGenomes-Tr; SPNCRNA.234.1.
DR   EnsemblGenomes-Tr; SPNCRNA.236.1.
DR   EnsemblGenomes-Tr; SPNCRNA.237.1.
DR   EnsemblGenomes-Tr; SPNCRNA.239.1.
DR   EnsemblGenomes-Tr; SPNCRNA.240.1.
DR   EnsemblGenomes-Tr; SPNCRNA.242.1.
DR   EnsemblGenomes-Tr; SPNCRNA.243.1.
DR   EnsemblGenomes-Tr; SPNCRNA.244.1.
DR   EnsemblGenomes-Tr; SPNCRNA.246.1.
DR   EnsemblGenomes-Tr; SPNCRNA.247.1.
DR   EnsemblGenomes-Tr; SPNCRNA.248.1.
DR   EnsemblGenomes-Tr; SPNCRNA.249.1.
DR   EnsemblGenomes-Tr; SPNCRNA.253.1.
DR   EnsemblGenomes-Tr; SPNCRNA.254.1.
DR   EnsemblGenomes-Tr; SPNCRNA.255.1.
DR   EnsemblGenomes-Tr; SPNCRNA.256.1.
DR   EnsemblGenomes-Tr; SPNCRNA.257.1.
DR   EnsemblGenomes-Tr; SPNCRNA.258.1.
DR   EnsemblGenomes-Tr; SPNCRNA.260.1.
DR   EnsemblGenomes-Tr; SPNCRNA.261.1.
DR   EnsemblGenomes-Tr; SPNCRNA.263.1.
DR   EnsemblGenomes-Tr; SPNCRNA.264.1.
DR   EnsemblGenomes-Tr; SPNCRNA.265.1.
DR   EnsemblGenomes-Tr; SPNCRNA.266.1.
DR   EnsemblGenomes-Tr; SPNCRNA.267.1.
DR   EnsemblGenomes-Tr; SPNCRNA.268.1.
DR   EnsemblGenomes-Tr; SPNCRNA.269.1.
DR   EnsemblGenomes-Tr; SPNCRNA.27.1.
DR   EnsemblGenomes-Tr; SPNCRNA.270.1.
DR   EnsemblGenomes-Tr; SPNCRNA.271.1.
DR   EnsemblGenomes-Tr; SPNCRNA.272.1.
DR   EnsemblGenomes-Tr; SPNCRNA.273.1.
DR   EnsemblGenomes-Tr; SPNCRNA.274.1.
DR   EnsemblGenomes-Tr; SPNCRNA.275.1.
DR   EnsemblGenomes-Tr; SPNCRNA.276.1.
DR   EnsemblGenomes-Tr; SPNCRNA.277.1.
DR   EnsemblGenomes-Tr; SPNCRNA.278.1.
DR   EnsemblGenomes-Tr; SPNCRNA.279.1.
DR   EnsemblGenomes-Tr; SPNCRNA.28.1.
DR   EnsemblGenomes-Tr; SPNCRNA.280.1.
DR   EnsemblGenomes-Tr; SPNCRNA.281.1.
DR   EnsemblGenomes-Tr; SPNCRNA.282.1.
DR   EnsemblGenomes-Tr; SPNCRNA.283.1.
DR   EnsemblGenomes-Tr; SPNCRNA.284.1.
DR   EnsemblGenomes-Tr; SPNCRNA.286.1.
DR   EnsemblGenomes-Tr; SPNCRNA.30.1.
DR   EnsemblGenomes-Tr; SPNCRNA.306.1.
DR   EnsemblGenomes-Tr; SPNCRNA.31.1.
DR   EnsemblGenomes-Tr; SPNCRNA.310.1.
DR   EnsemblGenomes-Tr; SPNCRNA.311.1.
DR   EnsemblGenomes-Tr; SPNCRNA.326.1.
DR   EnsemblGenomes-Tr; SPNCRNA.333.1.
DR   EnsemblGenomes-Tr; SPNCRNA.341.1.
DR   EnsemblGenomes-Tr; SPNCRNA.37.1.
DR   EnsemblGenomes-Tr; SPNCRNA.396.1.
DR   EnsemblGenomes-Tr; SPNCRNA.43.1.
DR   EnsemblGenomes-Tr; SPNCRNA.432.1.
DR   EnsemblGenomes-Tr; SPNCRNA.46.1.
DR   EnsemblGenomes-Tr; SPNCRNA.47.1.
DR   EnsemblGenomes-Tr; SPNCRNA.499.1.
DR   EnsemblGenomes-Tr; SPNCRNA.50.1.
DR   EnsemblGenomes-Tr; SPNCRNA.507.1.
DR   EnsemblGenomes-Tr; SPNCRNA.510.1.
DR   EnsemblGenomes-Tr; SPNCRNA.52.1.
DR   EnsemblGenomes-Tr; SPNCRNA.524.1.
DR   EnsemblGenomes-Tr; SPNCRNA.525.1.
DR   EnsemblGenomes-Tr; SPNCRNA.528.1.
DR   EnsemblGenomes-Tr; SPNCRNA.529.1.
DR   EnsemblGenomes-Tr; SPNCRNA.53.1.
DR   EnsemblGenomes-Tr; SPNCRNA.530.1.
DR   EnsemblGenomes-Tr; SPNCRNA.54.1.
DR   EnsemblGenomes-Tr; SPNCRNA.551.1.
DR   EnsemblGenomes-Tr; SPNCRNA.552.1.
DR   EnsemblGenomes-Tr; SPNCRNA.553.1.
DR   EnsemblGenomes-Tr; SPNCRNA.554.1.
DR   EnsemblGenomes-Tr; SPNCRNA.555.1.
DR   EnsemblGenomes-Tr; SPNCRNA.556.1.
DR   EnsemblGenomes-Tr; SPNCRNA.557.1.
DR   EnsemblGenomes-Tr; SPNCRNA.558.1.
DR   EnsemblGenomes-Tr; SPNCRNA.559.1.
DR   EnsemblGenomes-Tr; SPNCRNA.56.1.
DR   EnsemblGenomes-Tr; SPNCRNA.560.1.
DR   EnsemblGenomes-Tr; SPNCRNA.561.1.
DR   EnsemblGenomes-Tr; SPNCRNA.562.1.
DR   EnsemblGenomes-Tr; SPNCRNA.563.1.
DR   EnsemblGenomes-Tr; SPNCRNA.564.1.
DR   EnsemblGenomes-Tr; SPNCRNA.57.1.
DR   EnsemblGenomes-Tr; SPNCRNA.58.1.
DR   EnsemblGenomes-Tr; SPNCRNA.59.1.
DR   EnsemblGenomes-Tr; SPNCRNA.600.1.
DR   EnsemblGenomes-Tr; SPNCRNA.601.1.
DR   EnsemblGenomes-Tr; SPNCRNA.602.1.
DR   EnsemblGenomes-Tr; SPNCRNA.603.1.
DR   EnsemblGenomes-Tr; SPNCRNA.604.1.
DR   EnsemblGenomes-Tr; SPNCRNA.605.1.
DR   EnsemblGenomes-Tr; SPNCRNA.606.1.
DR   EnsemblGenomes-Tr; SPNCRNA.607.1.
DR   EnsemblGenomes-Tr; SPNCRNA.608.1.
DR   EnsemblGenomes-Tr; SPNCRNA.609.1.
DR   EnsemblGenomes-Tr; SPNCRNA.61.1.
DR   EnsemblGenomes-Tr; SPNCRNA.610.1.
DR   EnsemblGenomes-Tr; SPNCRNA.611.1.
DR   EnsemblGenomes-Tr; SPNCRNA.612.1.
DR   EnsemblGenomes-Tr; SPNCRNA.613.1.
DR   EnsemblGenomes-Tr; SPNCRNA.614.1.
DR   EnsemblGenomes-Tr; SPNCRNA.615.1.
DR   EnsemblGenomes-Tr; SPNCRNA.616.1.
DR   EnsemblGenomes-Tr; SPNCRNA.617.1.
DR   EnsemblGenomes-Tr; SPNCRNA.618.1.
DR   EnsemblGenomes-Tr; SPNCRNA.619.1.
DR   EnsemblGenomes-Tr; SPNCRNA.620.1.
DR   EnsemblGenomes-Tr; SPNCRNA.621.1.
DR   EnsemblGenomes-Tr; SPNCRNA.622.1.
DR   EnsemblGenomes-Tr; SPNCRNA.623.1.
DR   EnsemblGenomes-Tr; SPNCRNA.624.1.
DR   EnsemblGenomes-Tr; SPNCRNA.625.1.
DR   EnsemblGenomes-Tr; SPNCRNA.626.1.
DR   EnsemblGenomes-Tr; SPNCRNA.627.1.
DR   EnsemblGenomes-Tr; SPNCRNA.628.1.
DR   EnsemblGenomes-Tr; SPNCRNA.629.1.
DR   EnsemblGenomes-Tr; SPNCRNA.630.1.
DR   EnsemblGenomes-Tr; SPNCRNA.631.1.
DR   EnsemblGenomes-Tr; SPNCRNA.632.1.
DR   EnsemblGenomes-Tr; SPNCRNA.633.1.
DR   EnsemblGenomes-Tr; SPNCRNA.634.1.
DR   EnsemblGenomes-Tr; SPNCRNA.635.1.
DR   EnsemblGenomes-Tr; SPNCRNA.636.1.
DR   EnsemblGenomes-Tr; SPNCRNA.637.1.
DR   EnsemblGenomes-Tr; SPNCRNA.638.1.
DR   EnsemblGenomes-Tr; SPNCRNA.639.1.
DR   EnsemblGenomes-Tr; SPNCRNA.640.1.
DR   EnsemblGenomes-Tr; SPNCRNA.641.1.
DR   EnsemblGenomes-Tr; SPNCRNA.642.1.
DR   EnsemblGenomes-Tr; SPNCRNA.643.1.
DR   EnsemblGenomes-Tr; SPNCRNA.644.1.
DR   EnsemblGenomes-Tr; SPNCRNA.645.1.
DR   EnsemblGenomes-Tr; SPNCRNA.646.1.
DR   EnsemblGenomes-Tr; SPNCRNA.647.1.
DR   EnsemblGenomes-Tr; SPNCRNA.648.1.
DR   EnsemblGenomes-Tr; SPNCRNA.649.1.
DR   EnsemblGenomes-Tr; SPNCRNA.650.1.
DR   EnsemblGenomes-Tr; SPNCRNA.651.1.
DR   EnsemblGenomes-Tr; SPNCRNA.652.1.
DR   EnsemblGenomes-Tr; SPNCRNA.653.1.
DR   EnsemblGenomes-Tr; SPNCRNA.654.1.
DR   EnsemblGenomes-Tr; SPNCRNA.655.1.
DR   EnsemblGenomes-Tr; SPNCRNA.656.1.
DR   EnsemblGenomes-Tr; SPNCRNA.657.1.
DR   EnsemblGenomes-Tr; SPNCRNA.658.1.
DR   EnsemblGenomes-Tr; SPNCRNA.659.1.
DR   EnsemblGenomes-Tr; SPNCRNA.660.1.
DR   EnsemblGenomes-Tr; SPNCRNA.661.1.
DR   EnsemblGenomes-Tr; SPNCRNA.662.1.
DR   EnsemblGenomes-Tr; SPNCRNA.663.1.
DR   EnsemblGenomes-Tr; SPNCRNA.664.1.
DR   EnsemblGenomes-Tr; SPNCRNA.665.1.
DR   EnsemblGenomes-Tr; SPNCRNA.666.1.
DR   EnsemblGenomes-Tr; SPNCRNA.667.1.
DR   EnsemblGenomes-Tr; SPNCRNA.668.1.
DR   EnsemblGenomes-Tr; SPNCRNA.669.1.
DR   EnsemblGenomes-Tr; SPNCRNA.670.1.
DR   EnsemblGenomes-Tr; SPNCRNA.671.1.
DR   EnsemblGenomes-Tr; SPNCRNA.672.1.
DR   EnsemblGenomes-Tr; SPNCRNA.673.1.
DR   EnsemblGenomes-Tr; SPNCRNA.674.1.
DR   EnsemblGenomes-Tr; SPNCRNA.675.1.
DR   EnsemblGenomes-Tr; SPNCRNA.676.1.
DR   EnsemblGenomes-Tr; SPNCRNA.677.1.
DR   EnsemblGenomes-Tr; SPNCRNA.678.1.
DR   EnsemblGenomes-Tr; SPNCRNA.679.1.
DR   EnsemblGenomes-Tr; SPNCRNA.680.1.
DR   EnsemblGenomes-Tr; SPNCRNA.681.1.
DR   EnsemblGenomes-Tr; SPNCRNA.682.1.
DR   EnsemblGenomes-Tr; SPNCRNA.683.1.
DR   EnsemblGenomes-Tr; SPNCRNA.684.1.
DR   EnsemblGenomes-Tr; SPNCRNA.685.1.
DR   EnsemblGenomes-Tr; SPNCRNA.686.1.
DR   EnsemblGenomes-Tr; SPNCRNA.687.1.
DR   EnsemblGenomes-Tr; SPNCRNA.688.1.
DR   EnsemblGenomes-Tr; SPNCRNA.689.1.
DR   EnsemblGenomes-Tr; SPNCRNA.690.1.
DR   EnsemblGenomes-Tr; SPNCRNA.691.1.
DR   EnsemblGenomes-Tr; SPNCRNA.692.1.
DR   EnsemblGenomes-Tr; SPNCRNA.693.1.
DR   EnsemblGenomes-Tr; SPNCRNA.694.1.
DR   EnsemblGenomes-Tr; SPNCRNA.695.1.
DR   EnsemblGenomes-Tr; SPNCRNA.696.1.
DR   EnsemblGenomes-Tr; SPNCRNA.697.1.
DR   EnsemblGenomes-Tr; SPNCRNA.698.1.
DR   EnsemblGenomes-Tr; SPNCRNA.699.1.
DR   EnsemblGenomes-Tr; SPNCRNA.70.1.
DR   EnsemblGenomes-Tr; SPNCRNA.700.1.
DR   EnsemblGenomes-Tr; SPNCRNA.701.1.
DR   EnsemblGenomes-Tr; SPNCRNA.702.1.
DR   EnsemblGenomes-Tr; SPNCRNA.703.1.
DR   EnsemblGenomes-Tr; SPNCRNA.704.1.
DR   EnsemblGenomes-Tr; SPNCRNA.705.1.
DR   EnsemblGenomes-Tr; SPNCRNA.706.1.
DR   EnsemblGenomes-Tr; SPNCRNA.707.1.
DR   EnsemblGenomes-Tr; SPNCRNA.708.1.
DR   EnsemblGenomes-Tr; SPNCRNA.709.1.
DR   EnsemblGenomes-Tr; SPNCRNA.71.1.
DR   EnsemblGenomes-Tr; SPNCRNA.710.1.
DR   EnsemblGenomes-Tr; SPNCRNA.711.1.
DR   EnsemblGenomes-Tr; SPNCRNA.712.1.
DR   EnsemblGenomes-Tr; SPNCRNA.713.1.
DR   EnsemblGenomes-Tr; SPNCRNA.714.1.
DR   EnsemblGenomes-Tr; SPNCRNA.715.1.
DR   EnsemblGenomes-Tr; SPNCRNA.716.1.
DR   EnsemblGenomes-Tr; SPNCRNA.717.1.
DR   EnsemblGenomes-Tr; SPNCRNA.718.1.
DR   EnsemblGenomes-Tr; SPNCRNA.719.1.
DR   EnsemblGenomes-Tr; SPNCRNA.72.1.
DR   EnsemblGenomes-Tr; SPNCRNA.720.1.
DR   EnsemblGenomes-Tr; SPNCRNA.721.1.
DR   EnsemblGenomes-Tr; SPNCRNA.722.1.
DR   EnsemblGenomes-Tr; SPNCRNA.723.1.
DR   EnsemblGenomes-Tr; SPNCRNA.724.1.
DR   EnsemblGenomes-Tr; SPNCRNA.725.1.
DR   EnsemblGenomes-Tr; SPNCRNA.726.1.
DR   EnsemblGenomes-Tr; SPNCRNA.727.1.
DR   EnsemblGenomes-Tr; SPNCRNA.728.1.
DR   EnsemblGenomes-Tr; SPNCRNA.729.1.
DR   EnsemblGenomes-Tr; SPNCRNA.73.1.
DR   EnsemblGenomes-Tr; SPNCRNA.730.1.
DR   EnsemblGenomes-Tr; SPNCRNA.731.1.
DR   EnsemblGenomes-Tr; SPNCRNA.732.1.
DR   EnsemblGenomes-Tr; SPNCRNA.733.1.
DR   EnsemblGenomes-Tr; SPNCRNA.734.1.
DR   EnsemblGenomes-Tr; SPNCRNA.735.1.
DR   EnsemblGenomes-Tr; SPNCRNA.736.1.
DR   EnsemblGenomes-Tr; SPNCRNA.737.1.
DR   EnsemblGenomes-Tr; SPNCRNA.738.1.
DR   EnsemblGenomes-Tr; SPNCRNA.739.1.
DR   EnsemblGenomes-Tr; SPNCRNA.74.1.
DR   EnsemblGenomes-Tr; SPNCRNA.740.1.
DR   EnsemblGenomes-Tr; SPNCRNA.741.1.
DR   EnsemblGenomes-Tr; SPNCRNA.742.1.
DR   EnsemblGenomes-Tr; SPNCRNA.743.1.
DR   EnsemblGenomes-Tr; SPNCRNA.744.1.
DR   EnsemblGenomes-Tr; SPNCRNA.745.1.
DR   EnsemblGenomes-Tr; SPNCRNA.746.1.
DR   EnsemblGenomes-Tr; SPNCRNA.747.1.
DR   EnsemblGenomes-Tr; SPNCRNA.748.1.
DR   EnsemblGenomes-Tr; SPNCRNA.749.1.
DR   EnsemblGenomes-Tr; SPNCRNA.750.1.
DR   EnsemblGenomes-Tr; SPNCRNA.751.1.
DR   EnsemblGenomes-Tr; SPNCRNA.752.1.
DR   EnsemblGenomes-Tr; SPNCRNA.753.1.
DR   EnsemblGenomes-Tr; SPNCRNA.754.1.
DR   EnsemblGenomes-Tr; SPNCRNA.755.1.
DR   EnsemblGenomes-Tr; SPNCRNA.756.1.
DR   EnsemblGenomes-Tr; SPNCRNA.757.1.
DR   EnsemblGenomes-Tr; SPNCRNA.758.1.
DR   EnsemblGenomes-Tr; SPNCRNA.759.1.
DR   EnsemblGenomes-Tr; SPNCRNA.760.1.
DR   EnsemblGenomes-Tr; SPNCRNA.761.1.
DR   EnsemblGenomes-Tr; SPNCRNA.762.1.
DR   EnsemblGenomes-Tr; SPNCRNA.763.1.
DR   EnsemblGenomes-Tr; SPNCRNA.764.1.
DR   EnsemblGenomes-Tr; SPNCRNA.765.1.
DR   EnsemblGenomes-Tr; SPNCRNA.766.1.
DR   EnsemblGenomes-Tr; SPNCRNA.767.1.
DR   EnsemblGenomes-Tr; SPNCRNA.768.1.
DR   EnsemblGenomes-Tr; SPNCRNA.769.1.
DR   EnsemblGenomes-Tr; SPNCRNA.770.1.
DR   EnsemblGenomes-Tr; SPNCRNA.771.1.
DR   EnsemblGenomes-Tr; SPNCRNA.772.1.
DR   EnsemblGenomes-Tr; SPNCRNA.773.1.
DR   EnsemblGenomes-Tr; SPNCRNA.774.1.
DR   EnsemblGenomes-Tr; SPNCRNA.775.1.
DR   EnsemblGenomes-Tr; SPNCRNA.776.1.
DR   EnsemblGenomes-Tr; SPNCRNA.777.1.
DR   EnsemblGenomes-Tr; SPNCRNA.778.1.
DR   EnsemblGenomes-Tr; SPNCRNA.779.1.
DR   EnsemblGenomes-Tr; SPNCRNA.780.1.
DR   EnsemblGenomes-Tr; SPNCRNA.781.1.
DR   EnsemblGenomes-Tr; SPNCRNA.782.1.
DR   EnsemblGenomes-Tr; SPNCRNA.783.1.
DR   EnsemblGenomes-Tr; SPNCRNA.784.1.
DR   EnsemblGenomes-Tr; SPNCRNA.785.1.
DR   EnsemblGenomes-Tr; SPNCRNA.786.1.
DR   EnsemblGenomes-Tr; SPNCRNA.787.1.
DR   EnsemblGenomes-Tr; SPNCRNA.788.1.
DR   EnsemblGenomes-Tr; SPNCRNA.789.1.
DR   EnsemblGenomes-Tr; SPNCRNA.79.1.
DR   EnsemblGenomes-Tr; SPNCRNA.790.1.
DR   EnsemblGenomes-Tr; SPNCRNA.791.1.
DR   EnsemblGenomes-Tr; SPNCRNA.792.1.
DR   EnsemblGenomes-Tr; SPNCRNA.793.1.
DR   EnsemblGenomes-Tr; SPNCRNA.794.1.
DR   EnsemblGenomes-Tr; SPNCRNA.795.1.
DR   EnsemblGenomes-Tr; SPNCRNA.796.1.
DR   EnsemblGenomes-Tr; SPNCRNA.797.1.
DR   EnsemblGenomes-Tr; SPNCRNA.798.1.
DR   EnsemblGenomes-Tr; SPNCRNA.799.1.
DR   EnsemblGenomes-Tr; SPNCRNA.80.1.
DR   EnsemblGenomes-Tr; SPNCRNA.800.1.
DR   EnsemblGenomes-Tr; SPNCRNA.801.1.
DR   EnsemblGenomes-Tr; SPNCRNA.802.1.
DR   EnsemblGenomes-Tr; SPNCRNA.803.1.
DR   EnsemblGenomes-Tr; SPNCRNA.804.1.
DR   EnsemblGenomes-Tr; SPNCRNA.805.1.
DR   EnsemblGenomes-Tr; SPNCRNA.806.1.
DR   EnsemblGenomes-Tr; SPNCRNA.807.1.
DR   EnsemblGenomes-Tr; SPNCRNA.808.1.
DR   EnsemblGenomes-Tr; SPNCRNA.809.1.
DR   EnsemblGenomes-Tr; SPNCRNA.81.1.
DR   EnsemblGenomes-Tr; SPNCRNA.810.1.
DR   EnsemblGenomes-Tr; SPNCRNA.811.1.
DR   EnsemblGenomes-Tr; SPNCRNA.812.1.
DR   EnsemblGenomes-Tr; SPNCRNA.813.1.
DR   EnsemblGenomes-Tr; SPNCRNA.814.1.
DR   EnsemblGenomes-Tr; SPNCRNA.815.1.
DR   EnsemblGenomes-Tr; SPNCRNA.816.1.
DR   EnsemblGenomes-Tr; SPNCRNA.818.1.
DR   EnsemblGenomes-Tr; SPNCRNA.819.1.
DR   EnsemblGenomes-Tr; SPNCRNA.82.1.
DR   EnsemblGenomes-Tr; SPNCRNA.820.1.
DR   EnsemblGenomes-Tr; SPNCRNA.821.1.
DR   EnsemblGenomes-Tr; SPNCRNA.822.1.
DR   EnsemblGenomes-Tr; SPNCRNA.823.1.
DR   EnsemblGenomes-Tr; SPNCRNA.824.1.
DR   EnsemblGenomes-Tr; SPNCRNA.825.1.
DR   EnsemblGenomes-Tr; SPNCRNA.826.1.
DR   EnsemblGenomes-Tr; SPNCRNA.827.1.
DR   EnsemblGenomes-Tr; SPNCRNA.828.1.
DR   EnsemblGenomes-Tr; SPNCRNA.829.1.
DR   EnsemblGenomes-Tr; SPNCRNA.830.1.
DR   EnsemblGenomes-Tr; SPNCRNA.831.1.
DR   EnsemblGenomes-Tr; SPNCRNA.832.1.
DR   EnsemblGenomes-Tr; SPNCRNA.833.1.
DR   EnsemblGenomes-Tr; SPNCRNA.834.1.
DR   EnsemblGenomes-Tr; SPNCRNA.835.1.
DR   EnsemblGenomes-Tr; SPNCRNA.836.1.
DR   EnsemblGenomes-Tr; SPNCRNA.837.1.
DR   EnsemblGenomes-Tr; SPNCRNA.838.1.
DR   EnsemblGenomes-Tr; SPNCRNA.839.1.
DR   EnsemblGenomes-Tr; SPNCRNA.84.1.
DR   EnsemblGenomes-Tr; SPNCRNA.840.1.
DR   EnsemblGenomes-Tr; SPNCRNA.841.1.
DR   EnsemblGenomes-Tr; SPNCRNA.842.1.
DR   EnsemblGenomes-Tr; SPNCRNA.843.1.
DR   EnsemblGenomes-Tr; SPNCRNA.844.1.
DR   EnsemblGenomes-Tr; SPNCRNA.845.1.
DR   EnsemblGenomes-Tr; SPNCRNA.846.1.
DR   EnsemblGenomes-Tr; SPNCRNA.847.1.
DR   EnsemblGenomes-Tr; SPNCRNA.848.1.
DR   EnsemblGenomes-Tr; SPNCRNA.849.1.
DR   EnsemblGenomes-Tr; SPNCRNA.850.1.
DR   EnsemblGenomes-Tr; SPNCRNA.851.1.
DR   EnsemblGenomes-Tr; SPNCRNA.852.1.
DR   EnsemblGenomes-Tr; SPNCRNA.853.1.
DR   EnsemblGenomes-Tr; SPNCRNA.854.1.
DR   EnsemblGenomes-Tr; SPNCRNA.855.1.
DR   EnsemblGenomes-Tr; SPNCRNA.856.1.
DR   EnsemblGenomes-Tr; SPNCRNA.857.1.
DR   EnsemblGenomes-Tr; SPNCRNA.858.1.
DR   EnsemblGenomes-Tr; SPNCRNA.859.1.
DR   EnsemblGenomes-Tr; SPNCRNA.86.1.
DR   EnsemblGenomes-Tr; SPNCRNA.860.1.
DR   EnsemblGenomes-Tr; SPNCRNA.861.1.
DR   EnsemblGenomes-Tr; SPNCRNA.862.1.
DR   EnsemblGenomes-Tr; SPNCRNA.863.1.
DR   EnsemblGenomes-Tr; SPNCRNA.864.1.
DR   EnsemblGenomes-Tr; SPNCRNA.865.1.
DR   EnsemblGenomes-Tr; SPNCRNA.866.1.
DR   EnsemblGenomes-Tr; SPNCRNA.867.1.
DR   EnsemblGenomes-Tr; SPNCRNA.868.1.
DR   EnsemblGenomes-Tr; SPNCRNA.869.1.
DR   EnsemblGenomes-Tr; SPNCRNA.87.1.
DR   EnsemblGenomes-Tr; SPNCRNA.870.1.
DR   EnsemblGenomes-Tr; SPNCRNA.871.1.
DR   EnsemblGenomes-Tr; SPNCRNA.872.1.
DR   EnsemblGenomes-Tr; SPNCRNA.873.1.
DR   EnsemblGenomes-Tr; SPNCRNA.874.1.
DR   EnsemblGenomes-Tr; SPNCRNA.875.1.
DR   EnsemblGenomes-Tr; SPNCRNA.876.1.
DR   EnsemblGenomes-Tr; SPNCRNA.877.1.
DR   EnsemblGenomes-Tr; SPNCRNA.878.1.
DR   EnsemblGenomes-Tr; SPNCRNA.879.1.
DR   EnsemblGenomes-Tr; SPNCRNA.88.1.
DR   EnsemblGenomes-Tr; SPNCRNA.880.1.
DR   EnsemblGenomes-Tr; SPNCRNA.881.1.
DR   EnsemblGenomes-Tr; SPNCRNA.882.1.
DR   EnsemblGenomes-Tr; SPNCRNA.883.1.
DR   EnsemblGenomes-Tr; SPNCRNA.885.1.
DR   EnsemblGenomes-Tr; SPNCRNA.886.1.
DR   EnsemblGenomes-Tr; SPNCRNA.887.1.
DR   EnsemblGenomes-Tr; SPNCRNA.888.1.
DR   EnsemblGenomes-Tr; SPNCRNA.889.1.
DR   EnsemblGenomes-Tr; SPNCRNA.890.1.
DR   EnsemblGenomes-Tr; SPNCRNA.891.1.
DR   EnsemblGenomes-Tr; SPNCRNA.892.1.
DR   EnsemblGenomes-Tr; SPNCRNA.893.1.
DR   EnsemblGenomes-Tr; SPNCRNA.894.1.
DR   EnsemblGenomes-Tr; SPNCRNA.895.1.
DR   EnsemblGenomes-Tr; SPNCRNA.896.1.
DR   EnsemblGenomes-Tr; SPNCRNA.897.1.
DR   EnsemblGenomes-Tr; SPNCRNA.898.1.
DR   EnsemblGenomes-Tr; SPNCRNA.899.1.
DR   EnsemblGenomes-Tr; SPNCRNA.90.1.
DR   EnsemblGenomes-Tr; SPNCRNA.900.1.
DR   EnsemblGenomes-Tr; SPNCRNA.901.1.
DR   EnsemblGenomes-Tr; SPNCRNA.902.1.
DR   EnsemblGenomes-Tr; SPNCRNA.903.1.
DR   EnsemblGenomes-Tr; SPNCRNA.904.1.
DR   EnsemblGenomes-Tr; SPNCRNA.905.1.
DR   EnsemblGenomes-Tr; SPNCRNA.906.1.
DR   EnsemblGenomes-Tr; SPNCRNA.907.1.
DR   EnsemblGenomes-Tr; SPNCRNA.908.1.
DR   EnsemblGenomes-Tr; SPNCRNA.909.1.
DR   EnsemblGenomes-Tr; SPNCRNA.91.1.
DR   EnsemblGenomes-Tr; SPNCRNA.910.1.
DR   EnsemblGenomes-Tr; SPNCRNA.911.1.
DR   EnsemblGenomes-Tr; SPNCRNA.912.1.
DR   EnsemblGenomes-Tr; SPNCRNA.913.1.
DR   EnsemblGenomes-Tr; SPNCRNA.914.1.
DR   EnsemblGenomes-Tr; SPNCRNA.915.1.
DR   EnsemblGenomes-Tr; SPNCRNA.916.1.
DR   EnsemblGenomes-Tr; SPNCRNA.917.1.
DR   EnsemblGenomes-Tr; SPNCRNA.918.1.
DR   EnsemblGenomes-Tr; SPNCRNA.919.1.
DR   EnsemblGenomes-Tr; SPNCRNA.92.1.
DR   EnsemblGenomes-Tr; SPNCRNA.920.1.
DR   EnsemblGenomes-Tr; SPNCRNA.921.1.
DR   EnsemblGenomes-Tr; SPNCRNA.922.1.
DR   EnsemblGenomes-Tr; SPNCRNA.923.1.
DR   EnsemblGenomes-Tr; SPNCRNA.924.1.
DR   EnsemblGenomes-Tr; SPNCRNA.925.1.
DR   EnsemblGenomes-Tr; SPNCRNA.926.1.
DR   EnsemblGenomes-Tr; SPNCRNA.927.1.
DR   EnsemblGenomes-Tr; SPNCRNA.928.1.
DR   EnsemblGenomes-Tr; SPNCRNA.929.1.
DR   EnsemblGenomes-Tr; SPNCRNA.93.1.
DR   EnsemblGenomes-Tr; SPNCRNA.930.1.
DR   EnsemblGenomes-Tr; SPNCRNA.931.1.
DR   EnsemblGenomes-Tr; SPNCRNA.932.1.
DR   EnsemblGenomes-Tr; SPNCRNA.933.1.
DR   EnsemblGenomes-Tr; SPNCRNA.934.1.
DR   EnsemblGenomes-Tr; SPNCRNA.935.1.
DR   EnsemblGenomes-Tr; SPNCRNA.936.1.
DR   EnsemblGenomes-Tr; SPNCRNA.937.1.
DR   EnsemblGenomes-Tr; SPNCRNA.938.1.
DR   EnsemblGenomes-Tr; SPNCRNA.939.1.
DR   EnsemblGenomes-Tr; SPNCRNA.94.1.
DR   EnsemblGenomes-Tr; SPNCRNA.940.1.
DR   EnsemblGenomes-Tr; SPNCRNA.941.1.
DR   EnsemblGenomes-Tr; SPNCRNA.942.1.
DR   EnsemblGenomes-Tr; SPNCRNA.943.1.
DR   EnsemblGenomes-Tr; SPNCRNA.944.1.
DR   EnsemblGenomes-Tr; SPNCRNA.945.1.
DR   EnsemblGenomes-Tr; SPNCRNA.946.1.
DR   EnsemblGenomes-Tr; SPNCRNA.947.1.
DR   EnsemblGenomes-Tr; SPNCRNA.948.1.
DR   EnsemblGenomes-Tr; SPNCRNA.949.1.
DR   EnsemblGenomes-Tr; SPNCRNA.95.1.
DR   EnsemblGenomes-Tr; SPNCRNA.950.1.
DR   EnsemblGenomes-Tr; SPNCRNA.952.1.
DR   EnsemblGenomes-Tr; SPNCRNA.953.1.
DR   EnsemblGenomes-Tr; SPNCRNA.954.1.
DR   EnsemblGenomes-Tr; SPNCRNA.955.1.
DR   EnsemblGenomes-Tr; SPNCRNA.956.1.
DR   EnsemblGenomes-Tr; SPNCRNA.957.1.
DR   EnsemblGenomes-Tr; SPNCRNA.959.1.
DR   EnsemblGenomes-Tr; SPNCRNA.96.1.
DR   EnsemblGenomes-Tr; SPNCRNA.960.1.
DR   EnsemblGenomes-Tr; SPNCRNA.961.1.
DR   EnsemblGenomes-Tr; SPNCRNA.962.1.
DR   EnsemblGenomes-Tr; SPNCRNA.963.1.
DR   EnsemblGenomes-Tr; SPNCRNA.964.1.
DR   EnsemblGenomes-Tr; SPNCRNA.965.1.
DR   EnsemblGenomes-Tr; SPNCRNA.966.1.
DR   EnsemblGenomes-Tr; SPNCRNA.967.1.
DR   EnsemblGenomes-Tr; SPNCRNA.968.1.
DR   EnsemblGenomes-Tr; SPNCRNA.969.1.
DR   EnsemblGenomes-Tr; SPNCRNA.970.1.
DR   EnsemblGenomes-Tr; SPNCRNA.971.1.
DR   EnsemblGenomes-Tr; SPNCRNA.972.1.
DR   EnsemblGenomes-Tr; SPNCRNA.973.1.
DR   EnsemblGenomes-Tr; SPNCRNA.974.1.
DR   EnsemblGenomes-Tr; SPNCRNA.975.1.
DR   EnsemblGenomes-Tr; SPNCRNA.976.1.
DR   EnsemblGenomes-Tr; SPNCRNA.977.1.
DR   EnsemblGenomes-Tr; SPNCRNA.978.1.
DR   EnsemblGenomes-Tr; SPNCRNA.979.1.
DR   EnsemblGenomes-Tr; SPNCRNA.98.1.
DR   EnsemblGenomes-Tr; SPNCRNA.980.1.
DR   EnsemblGenomes-Tr; SPNCRNA.981.1.
DR   EnsemblGenomes-Tr; SPNCRNA.982.1.
DR   EnsemblGenomes-Tr; SPNCRNA.983.1.
DR   EnsemblGenomes-Tr; SPNCRNA.984.1.
DR   EnsemblGenomes-Tr; SPNCRNA.985.1.
DR   EnsemblGenomes-Tr; SPNCRNA.986.1.
DR   EnsemblGenomes-Tr; SPNCRNA.987.1.
DR   EnsemblGenomes-Tr; SPNCRNA.988.1.
DR   EnsemblGenomes-Tr; SPNCRNA.989.1.
DR   EnsemblGenomes-Tr; SPNCRNA.99.1.
DR   EnsemblGenomes-Tr; SPNCRNA.990.1.
DR   EnsemblGenomes-Tr; SPNCRNA.991.1.
DR   EnsemblGenomes-Tr; SPNCRNA.992.1.
DR   EnsemblGenomes-Tr; SPNCRNA.993.1.
DR   EnsemblGenomes-Tr; SPNCRNA.995.1.
DR   EnsemblGenomes-Tr; SPNCRNA.996.1.
DR   EnsemblGenomes-Tr; SPNCRNA.997.1.
DR   EnsemblGenomes-Tr; SPNCRNA.998.1.
DR   EnsemblGenomes-Tr; SPNCRNA.999.1.
DR   EnsemblGenomes-Tr; SPRRNA.10.1.
DR   EnsemblGenomes-Tr; SPRRNA.11.1.
DR   EnsemblGenomes-Tr; SPRRNA.12.1.
DR   EnsemblGenomes-Tr; SPRRNA.13.1.
DR   EnsemblGenomes-Tr; SPRRNA.14.1.
DR   EnsemblGenomes-Tr; SPRRNA.15.1.
DR   EnsemblGenomes-Tr; SPRRNA.16.1.
DR   EnsemblGenomes-Tr; SPRRNA.17.1.
DR   EnsemblGenomes-Tr; SPRRNA.18.1.
DR   EnsemblGenomes-Tr; SPRRNA.19.1.
DR   EnsemblGenomes-Tr; SPRRNA.20.1.
DR   EnsemblGenomes-Tr; SPRRNA.53.1.
DR   EnsemblGenomes-Tr; SPSNORNA.01.1.
DR   EnsemblGenomes-Tr; SPSNORNA.02.1.
DR   EnsemblGenomes-Tr; SPSNORNA.03.1.
DR   EnsemblGenomes-Tr; SPSNORNA.04.1.
DR   EnsemblGenomes-Tr; SPSNORNA.05.1.
DR   EnsemblGenomes-Tr; SPSNORNA.06.1.
DR   EnsemblGenomes-Tr; SPSNORNA.07.1.
DR   EnsemblGenomes-Tr; SPSNORNA.08.1.
DR   EnsemblGenomes-Tr; SPSNORNA.09.1.
DR   EnsemblGenomes-Tr; SPSNORNA.10.1.
DR   EnsemblGenomes-Tr; SPSNORNA.11.1.
DR   EnsemblGenomes-Tr; SPSNORNA.12.1.
DR   EnsemblGenomes-Tr; SPSNORNA.13.1.
DR   EnsemblGenomes-Tr; SPSNORNA.14.1.
DR   EnsemblGenomes-Tr; SPSNORNA.15.1.
DR   EnsemblGenomes-Tr; SPSNORNA.16.1.
DR   EnsemblGenomes-Tr; SPSNORNA.17.1.
DR   EnsemblGenomes-Tr; SPSNORNA.18.1.
DR   EnsemblGenomes-Tr; SPSNORNA.19.1.
DR   EnsemblGenomes-Tr; SPSNORNA.20.1.
DR   EnsemblGenomes-Tr; SPSNORNA.29.1.
DR   EnsemblGenomes-Tr; SPSNORNA.30.1.
DR   EnsemblGenomes-Tr; SPSNORNA.31.1.
DR   EnsemblGenomes-Tr; SPSNORNA.42.1.
DR   EnsemblGenomes-Tr; SPSNORNA.43.1.
DR   EnsemblGenomes-Tr; SPSNORNA.48.1.
DR   EnsemblGenomes-Tr; SPSNORNA.49.1.
DR   EnsemblGenomes-Tr; SPSNORNA.50.1.
DR   EnsemblGenomes-Tr; SPSNORNA.52.1.
DR   EnsemblGenomes-Tr; SPSNORNA.53.1.
DR   EnsemblGenomes-Tr; SPSNORNA.54.1.
DR   EnsemblGenomes-Tr; SPSNRNA.02.1.
DR   EnsemblGenomes-Tr; SPSNRNA.03.1.
DR   EnsemblGenomes-Tr; SPSNRNA.06.1.
DR   EuropePMC; PMC2794173; 19815668.
DR   EuropePMC; PMC4381506; 25834639.
DR   EuropePMC; PMC5063382; 27736907.
DR   EuropePMC; PMC6168568; 30279451.
DR   EuropePMC; PMC6275460; 30192951.
DR   GOA; O13716.
DR   GOA; P0CU22.
DR   GOA; P0CU23.
DR   GOA; P0CU25.
DR   InterPro; IPR005197; Glyco_hydro_71.
DR   PomBase; ENSRNA049630661; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630661-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630718; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630718-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630773; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630773-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630825; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630825-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630868; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630868-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630944; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630944-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630991; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630991-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631028; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631028-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631077; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631077-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631116; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631116-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631187; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631187-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631250; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631250-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631317; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631317-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631359; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631359-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631425; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631425-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631467; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631467-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631524; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631524-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631591; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631591-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631624; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631624-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631682; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631682-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631718; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631718-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631780; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631780-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631827; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631827-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631884; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631884-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631945; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631945-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631987; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049631987-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632025; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632025-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632057; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632057-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632115; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632115-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632161; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632161-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632208; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632208-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632230; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632230-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632274; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632274-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632300; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632300-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632350; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632350-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632393; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632393-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632447; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632447-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632499; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632499-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632545; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632545-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632595; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632595-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632641; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632641-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632671; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632671-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632703; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632703-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632767; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632767-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632801; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632801-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632852; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632852-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632915; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632915-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632972; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049632972-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633034; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633034-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633085; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633085-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633127; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633127-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633163; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633163-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633212; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633212-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633274; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633274-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633334; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049633334-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676222; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676222-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676244; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676244-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676282; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676282-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676312; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676312-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676348; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676348-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676374; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676374-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676412; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676412-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676459; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676459-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676491; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676491-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676517; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676517-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676538; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676538-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676559; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676559-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676580; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676580-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676599; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676599-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676636; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676636-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676666; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676666-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676691; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676691-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676707; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676707-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676723; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676723-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676761; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676761-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676787; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676787-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676807; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676807-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676829; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676829-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676882; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676882-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676922; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676922-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676952; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049676952-T1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC110.05; Schizosaccharomyces_pombe.
DR   PomBase; SPAC110.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC13G6.04; Schizosaccharomyces_pombe.
DR   PomBase; SPAC13G6.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC1556.06.2; Schizosaccharomyces_pombe.
DR   PomBase; SPAC1D4.08; Schizosaccharomyces_pombe.
DR   PomBase; SPAC1D4.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.05c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.05c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.07c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.07c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.09c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.09c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.10; Schizosaccharomyces_pombe.
DR   PomBase; SPAC212.10.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC22F3.11c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC22F3.11c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC23A1.20; Schizosaccharomyces_pombe.
DR   PomBase; SPAC23A1.20.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC23D3.05c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC23D3.05c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC29E6.04; Schizosaccharomyces_pombe.
DR   PomBase; SPAC29E6.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC2E12.05; Schizosaccharomyces_pombe.
DR   PomBase; SPAC2E12.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC2F3.13c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC2F3.13c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC5H10.06c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC5H10.06c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC823.17; Schizosaccharomyces_pombe.
DR   PomBase; SPAC823.17.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC977.01; Schizosaccharomyces_pombe.
DR   PomBase; SPAC977.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAC977.13c; Schizosaccharomyces_pombe.
DR   PomBase; SPAC977.13c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPAPB24D3.05c; Schizosaccharomyces_pombe.
DR   PomBase; SPAPB24D3.05c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.05; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.06; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAALA.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAARG.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAARG.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAARG.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAARG.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAARG.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAARG.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAASP.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAASP.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAASP.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAASP.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNACYS.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNACYS.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNACYS.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNACYS.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNACYS.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNACYS.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLU.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLY.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLY.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLY.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAGLY.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAILE.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALEU.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.05; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNALYS.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAMET.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAMET.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAMET.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAMET.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAMET.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAMET.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPHE.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPHE.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPHE.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPHE.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPRO.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPRO.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPRO.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPRO.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPRO.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAPRO.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNASER.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.05; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATHR.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATRP.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATRP.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATYR.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNATYR.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.01; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.02; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.03; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.04; Schizosaccharomyces_pombe.
DR   PomBase; SPATRNAVAL.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.01; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.03; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.05; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1000; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1000.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1001; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1001.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1002; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1002.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1003; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1003.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1004; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1004.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1005; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1005.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1006; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1006.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1007; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1007.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1008; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1008.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1009; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1009.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1010; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1010.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1011; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1011.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1012; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1012.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1013; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1013.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1014; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1014.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1015; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1015.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1016; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1016.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1017; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1017.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1018; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1018.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1019; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1019.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1020; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1020.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1021; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1021.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1022; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1022.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1023; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1023.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1024; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1024.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1025; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1025.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1026; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1026.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1027; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1027.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1028; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1028.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1029; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1029.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1030; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1030.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1031; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1031.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1032; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1032.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1033; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1033.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1034; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1034.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1035; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1035.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1036; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1036.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1037; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1037.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1038; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1038.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1039; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1039.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1040; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1040.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1041; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1041.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1042; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1042.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1043; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1043.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1044; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1044.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1045; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1045.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1046; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1046.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1047; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1047.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1048; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1048.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1049; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1049.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1050; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1050.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1051; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1051.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1052; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1052.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1053; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1053.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1054; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1054.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1055; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1055.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1056; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1056.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1057; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1057.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1058; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1058.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1059; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1059.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1060; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1060.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1061; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1061.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1062; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1062.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1063; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1063.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1064; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1064.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1065; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1065.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1066; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1066.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1067; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1067.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1068; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1068.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1069; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1069.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1070; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1070.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1071; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1071.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1072; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1072.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1073; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1073.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1074; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1074.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1075; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1075.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1076; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1076.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1077; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1077.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1078; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1078.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1079; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1079.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1080; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1080.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1081; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1081.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1082; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1082.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1083; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1083.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1084; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1084.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1085; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1085.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1086; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1086.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1087; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1087.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1088; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1088.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1089; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1089.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1090; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1090.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1091; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1091.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1092; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1092.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1093; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1093.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.12; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.12.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.124; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.124.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.13; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.13.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.130; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.130.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.136; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.136.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.137; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.137.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.138; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.138.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.139; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.139.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.14; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.14.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.141; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.141.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.142; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.142.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.143; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.143.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.144; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.144.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.145; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.145.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.147; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.147.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.148; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.148.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.154; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.154.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.155; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.155.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.156; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.156.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.158; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.158.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.159; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.159.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.160; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.160.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.163; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.163.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.164; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.164.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.166; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.166.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.168; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.168.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.169; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.169.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.171; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.171.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.173; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.173.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.174; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.174.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.175; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.175.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.177; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.177.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.178; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.178.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.181; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.181.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.182; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.182.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.184; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.184.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.185; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.185.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.186; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.186.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.187; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.187.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.188; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.188.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.189; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.189.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.19; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.19.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.190; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.190.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.192; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.192.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.194; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.194.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.195; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.195.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.197; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.197.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.198; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.198.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.199; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.199.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.200; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.200.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.201; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.201.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.202; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.202.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.204; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.204.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.205; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.205.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.208; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.208.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.209; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.209.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.21; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.21.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.210; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.210.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.212; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.212.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.213; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.213.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.214; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.214.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.215; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.215.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.216; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.216.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.217; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.217.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.218; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.218.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.219; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.219.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.220; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.220.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.222; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.222.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.226; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.226.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.227; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.227.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.228; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.228.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.229; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.229.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.230; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.230.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.231; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.231.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.232; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.232.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.233; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.233.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.234; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.234.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.236; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.236.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.237; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.237.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.239; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.239.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.240; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.240.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.242; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.242.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.243; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.243.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.244; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.244.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.246; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.246.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.247; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.247.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.248; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.248.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.249; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.249.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.253; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.253.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.254; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.254.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.255; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.255.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.256; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.256.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.257; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.257.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.258; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.258.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.260; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.260.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.261; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.261.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.263; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.263.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.264; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.264.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.265; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.265.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.266; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.266.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.267; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.267.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.268; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.268.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.269; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.269.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.27; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.27.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.270; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.270.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.271; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.271.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.272; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.272.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.273; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.273.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.274; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.274.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.275; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.275.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.276; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.276.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.277; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.277.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.278; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.278.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.279; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.279.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.28; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.28.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.280; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.280.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.281; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.281.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.282; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.282.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.283; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.283.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.284; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.284.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.286; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.286.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.30; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.30.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.306; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.306.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.31; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.31.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.310; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.310.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.311; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.311.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.326; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.326.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.333; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.333.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.341; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.341.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.37; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.37.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.396; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.396.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.43; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.43.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.432; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.432.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.46; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.46.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.47; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.47.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.499; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.499.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.50; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.50.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.507; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.507.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.510; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.510.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.52; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.52.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.524; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.524.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.525; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.525.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.528; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.528.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.529; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.529.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.53; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.53.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.530; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.530.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.54; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.54.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.551; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.551.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.552; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.552.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.553; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.553.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.554; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.554.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.555; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.555.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.556; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.556.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.557; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.557.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.558; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.558.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.559; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.559.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.56; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.56.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.560; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.560.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.561; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.561.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.562; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.562.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.563; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.563.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.564; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.564.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.57; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.57.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.58; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.58.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.59; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.59.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.600; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.600.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.601; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.601.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.602; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.602.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.603; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.603.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.604; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.604.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.605; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.605.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.606; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.606.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.607; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.607.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.608; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.608.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.609; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.609.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.61; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.61.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.610; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.610.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.611; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.611.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.612; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.612.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.613; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.613.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.614; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.614.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.615; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.615.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.616; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.616.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.617; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.617.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.618; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.618.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.619; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.619.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.620; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.620.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.621; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.621.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.622; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.622.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.623; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.623.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.624; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.624.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.625; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.625.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.626; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.626.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.627; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.627.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.628; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.628.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.629; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.629.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.630; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.630.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.631; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.631.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.632; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.632.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.633; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.633.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.634; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.634.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.635; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.635.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.636; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.636.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.637; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.637.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.638; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.638.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.639; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.639.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.640; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.640.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.641; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.641.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.642; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.642.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.643; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.643.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.644; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.644.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.645; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.645.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.646; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.646.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.647; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.647.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.648; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.648.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.649; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.649.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.650; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.650.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.651; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.651.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.652; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.652.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.653; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.653.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.654; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.654.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.655; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.655.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.656; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.656.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.657; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.657.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.658; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.658.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.659; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.659.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.660; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.660.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.661; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.661.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.662; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.662.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.663; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.663.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.664; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.664.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.665; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.665.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.666; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.666.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.667; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.667.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.668; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.668.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.669; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.669.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.670; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.670.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.671; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.671.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.672; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.672.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.673; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.673.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.674; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.674.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.675; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.675.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.676; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.676.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.677; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.677.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.678; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.678.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.679; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.679.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.680; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.680.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.681; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.681.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.682; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.682.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.683; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.683.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.684; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.684.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.685; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.685.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.686; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.686.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.687; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.687.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.688; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.688.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.689; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.689.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.690; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.690.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.691; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.691.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.692; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.692.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.693; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.693.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.694; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.694.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.695; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.695.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.696; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.696.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.697; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.697.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.698; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.698.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.699; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.699.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.70; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.70.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.700; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.700.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.701; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.701.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.702; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.702.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.703; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.703.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.704; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.704.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.705; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.705.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.706; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.706.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.707; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.707.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.708; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.708.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.709; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.709.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.71; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.71.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.710; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.710.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.711; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.711.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.712; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.712.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.713; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.713.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.714; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.714.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.715; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.715.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.716; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.716.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.717; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.717.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.718; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.718.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.719; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.719.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.72; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.72.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.720; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.720.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.721; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.721.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.722; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.722.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.723; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.723.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.724; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.724.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.725; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.725.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.726; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.726.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.727; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.727.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.728; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.728.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.729; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.729.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.73; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.73.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.730; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.730.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.731; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.731.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.732; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.732.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.733; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.733.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.734; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.734.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.735; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.735.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.736; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.736.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.737; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.737.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.738; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.738.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.739; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.739.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.74; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.74.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.740; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.740.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.741; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.741.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.742; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.742.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.743; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.743.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.744; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.744.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.745; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.745.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.746; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.746.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.747; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.747.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.748; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.748.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.749; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.749.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.750; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.750.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.751; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.751.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.752; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.752.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.753; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.753.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.754; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.754.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.755; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.755.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.756; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.756.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.757; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.757.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.758; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.758.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.759; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.759.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.760; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.760.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.761; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.761.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.762; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.762.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.763; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.763.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.764; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.764.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.765; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.765.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.766; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.766.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.767; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.767.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.768; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.768.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.769; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.769.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.770; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.770.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.771; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.771.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.772; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.772.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.773; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.773.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.774; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.774.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.775; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.775.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.776; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.776.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.777; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.777.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.778; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.778.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.779; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.779.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.780; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.780.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.781; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.781.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.782; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.782.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.783; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.783.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.784; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.784.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.785; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.785.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.786; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.786.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.787; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.787.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.788; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.788.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.789; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.789.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.79; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.79.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.790; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.790.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.791; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.791.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.792; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.792.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.793; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.793.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.794; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.794.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.795; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.795.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.796; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.796.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.797; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.797.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.798; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.798.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.799; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.799.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.80; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.80.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.800; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.800.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.801; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.801.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.802; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.802.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.803; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.803.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.804; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.804.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.805; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.805.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.806; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.806.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.807; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.807.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.808; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.808.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.809; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.809.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.81; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.81.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.810; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.810.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.811; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.811.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.812; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.812.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.813; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.813.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.814; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.814.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.815; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.815.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.816; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.816.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.818; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.818.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.819; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.819.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.82; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.82.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.820; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.820.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.821; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.821.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.822; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.822.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.823; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.823.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.824; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.824.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.825; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.825.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.826; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.826.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.827; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.827.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.828; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.828.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.829; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.829.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.830; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.830.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.831; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.831.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.832; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.832.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.833; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.833.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.834; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.834.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.835; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.835.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.836; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.836.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.837; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.837.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.838; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.838.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.839; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.839.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.84; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.84.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.840; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.840.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.841; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.841.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.842; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.842.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.843; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.843.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.844; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.844.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.845; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.845.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.846; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.846.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.847; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.847.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.848; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.848.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.849; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.849.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.850; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.850.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.851; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.851.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.852; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.852.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.853; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.853.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.854; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.854.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.855; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.855.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.856; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.856.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.857; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.857.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.858; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.858.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.859; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.859.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.86; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.86.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.860; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.860.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.861; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.861.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.862; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.862.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.863; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.863.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.864; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.864.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.865; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.865.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.866; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.866.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.867; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.867.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.868; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.868.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.869; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.869.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.87; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.87.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.870; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.870.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.871; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.871.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.872; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.872.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.873; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.873.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.874; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.874.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.875; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.875.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.876; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.876.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.877; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.877.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.878; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.878.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.879; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.879.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.88; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.88.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.880; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.880.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.881; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.881.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.882; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.882.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.883; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.883.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.885; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.885.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.886; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.886.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.887; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.887.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.888; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.888.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.889; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.889.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.890; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.890.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.891; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.891.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.892; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.892.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.893; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.893.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.894; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.894.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.895; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.895.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.896; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.896.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.897; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.897.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.898; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.898.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.899; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.899.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.90; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.90.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.900; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.900.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.901; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.901.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.902; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.902.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.903; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.903.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.904; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.904.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.905; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.905.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.906; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.906.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.907; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.907.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.908; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.908.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.909; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.909.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.91; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.91.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.910; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.910.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.911; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.911.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.912; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.912.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.913; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.913.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.914; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.914.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.915; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.915.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.916; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.916.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.917; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.917.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.918; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.918.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.919; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.919.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.92; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.92.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.920; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.920.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.921; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.921.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.922; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.922.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.923; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.923.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.924; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.924.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.925; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.925.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.926; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.926.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.927; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.927.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.928; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.928.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.929; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.929.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.93; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.93.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.930; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.930.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.931; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.931.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.932; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.932.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.933; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.933.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.934; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.934.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.935; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.935.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.936; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.936.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.937; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.937.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.938; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.938.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.939; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.939.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.94; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.94.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.940; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.940.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.941; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.941.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.942; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.942.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.943; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.943.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.944; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.944.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.945; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.945.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.946; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.946.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.947; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.947.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.948; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.948.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.949; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.949.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.95; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.95.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.950; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.950.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.952; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.952.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.953; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.953.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.954; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.954.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.955; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.955.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.956; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.956.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.957; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.957.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.959; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.959.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.96; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.96.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.960; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.960.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.961; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.961.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.962; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.962.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.963; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.963.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.964; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.964.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.965; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.965.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.966; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.966.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.967; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.967.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.968; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.968.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.969; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.969.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.970; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.970.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.971; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.971.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.972; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.972.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.973; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.973.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.974; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.974.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.975; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.975.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.976; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.976.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.977; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.977.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.978; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.978.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.979; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.979.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.98; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.98.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.980; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.980.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.981; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.981.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.982; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.982.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.983; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.983.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.984; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.984.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.985; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.985.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.986; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.986.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.987; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.987.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.988; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.988.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.989; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.989.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.99; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.99.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.990; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.990.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.991; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.991.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.992; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.992.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.993; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.993.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.995; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.995.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.996; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.996.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.997; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.997.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.998; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.998.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.999; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.999.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.10; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.10.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.11; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.11.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.12; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.12.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.13; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.13.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.14; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.14.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.15; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.15.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.16; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.16.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.17; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.17.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.18; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.18.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.19; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.19.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.20; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.20.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.53; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.53.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.01; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.02; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.03; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.04; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.05; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.06; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.07; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.08; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.09; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.09.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.10; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.10.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.11; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.11.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.12; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.12.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.13; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.13.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.14; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.14.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.15; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.15.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.16; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.16.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.17; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.17.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.18; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.18.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.19; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.19.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.20; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.20.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.29; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.29.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.30; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.30.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.31; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.31.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.42; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.42.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.43; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.43.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.48; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.48.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.49; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.49.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.50; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.50.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.52; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.52.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.53; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.53.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.54; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.54.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.02; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.03; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.06; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.06.1; Schizosaccharomyces_pombe.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00026; U6.
DR   RFAM; RF00030; RNase_MRP.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00134; snoZ196.
DR   RFAM; RF00335; snoZ13_snr52.
DR   RFAM; RF00475; snosnR69.
DR   RFAM; RF01176; snR78.
DR   RFAM; RF01184; snR79.
DR   RFAM; RF01185; snR75.
DR   RFAM; RF01188; snR56.
DR   RFAM; RF01207; snR73.
DR   RFAM; RF01442; S_pombe_snR90.
DR   RFAM; RF01443; S_pombe_snR91.
DR   RFAM; RF01447; S_pombe_snR98.
DR   RFAM; RF01450; S_pombe_snR96.
DR   RFAM; RF01451; S_pombe_snR97.
DR   RFAM; RF01846; Fungi_U3.
DR   RFAM; RF01848; ACEA_U3.
DR   RFAM; RF01860; Afu_455.
DR   StrainInfo; 579442; 0.
DR   UniProtKB/Swiss-Prot; O13716; AGN1_SCHPO.
DR   UniProtKB/Swiss-Prot; P0CU22; YKBH_SCHPO.
DR   UniProtKB/Swiss-Prot; P0CU23; YKN6_SCHPO.
DR   UniProtKB/Swiss-Prot; P0CU24; YAOK_SCHPO.
DR   UniProtKB/Swiss-Prot; P0CU25; YDPL_SCHPO.
DR   UniProtKB/Swiss-Prot; Q3HKA4; YF2F_SCHPO.
XX
CC   Notes:
CC
CC   S. pombe (fission yeast) sequence and annotation are available from:
CC   (URL, http://www.genedb.org/genedb/pombe/index.jsp)
CC   (URL, http://www.sanger.ac.uk/Projects/S_pombe/)
CC
CC   CDS are numbered using the following system eg SPAC5H10.01c.
CC   SP (S. pombe), A (chromosome 1), c5H10 (cosmid name),
CC   .01 (first CDS), c (complementary strand). However, clones may have
CC   been reorientated since the original submission, therefore the
CC   complementary strand notation may be invalid for strand inference.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5579133
FT                   /organism="Schizosaccharomyces pombe"
FT                   /chromosome="I"
FT                   /strain="972h-"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4896"
FT   CDS_pept        complement(<1..5662)
FT                   /transl_table=1
FT                   /gene="tlh1"
FT                   /locus_tag="SPAC212.11"
FT                   /product="RecQ type DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC212.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC212.11.1"
FT                   /db_xref="GOA:P0CT33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC212.11"
FT                   /db_xref="PomBase:SPAC212.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT33"
FT                   /protein_id="CAC05745.1"
FT                   /translation="MVVASEIAKVASKTARDIAGCFTCQCGTQFDNVERIVQHFKECRY
FT                   RDETCKDDDIVVYEPSSFVQDEKKDKPIIVEAASEATSEEACNSSKERQLPALSALSAL
FT                   STLTTSANDDLWTARLIWQSTNDTKLDNSPSSNYTDLNHKLANYGLSILSIHALMCVEC
FT                   ECLLNVIHTAQHMQIVHKLELNEDLLWFQELRTLKLKSPTNVLQTHSSQTHVYPYIRGL
FT                   PVLLNGYECVPCTKNGTGFVHAIMDTFRHHVRRTHGKVIKLENCIRRTALQTVKNKYAQ
FT                   RCQFFKVDYVPLNGGEEEEEEEGEEKEDAQNIKERMVDFCFSKFMEKNQQRREQQDKGE
FT                   NKKRQDDVDQATDNNTNTILEDDEKDNDEEEEEEIVNAREKNLLNQQFNWTAIVKKLGE
FT                   NWDQLVRFEYTNGIVTLDTIVNQLIRYYYRGFRHLSGMTMGMRRMFTQGGSYSAQERGL
FT                   CRLEQKDTVVRYAQSAALYLIFLLRRPSADSGIRRHLEAMCGATVERKEGGSNSSSNIS
FT                   NVANFDSAEDDNDNDNDNDRDSNNNNNNNNTNTDDDDKLAYLELHEALKLAFLQQYDFS
FT                   KNVQDLEIMEFLACMSLHKDGTSKYAYEISACFAPLIYTCRLVAACELQRLIDEKQIDL
FT                   LSIPSFQTAGSIAYAHVFCFITLGQRNLYDVLYETQKVVRDIIRTEGYANTLQGLSPST
FT                   VLFQPRSNSMYPCIGDAFNNMVRLDLSELTALYEGMFAKVQDLLKELCFDMNVEKLLPI
FT                   SLLRSIGDDINNSKLGYSFFKESIEIRSSHSVLLRTILKNSELCHRFFPSMSKKDLTKL
FT                   FGGVSDQQRNECDNYSNHYNDNSNDNDNDVFLKLHWSKSAIKKYETKASIFNELLFCLV
FT                   YISAGQPARAQEMVYWTLRNGKYKTRELYLMFGRLMIYSRYDKTRNMKFAEKPIPRFLS
FT                   EPLSILALRYYVLVRPLEALMKYVTTADRSKVAVYLDFMFVIAGERLQRDLPYRIFPKA
FT                   TYQCIQKPLGFRNYRHIAHYFKEKNIEEEMTRESYFDLQAGHTRNTALYIYGRTMDNLH
FT                   YLPSDYFANFFRASYKWQELLQIRDNPTHGLLVETKHPFIKRVDQLEEALNEKLARLVG
FT                   EQMVEGDKEKDKTNEEKNKDEVKAEMTQPVVNQDSHDLQDQLATTPTAPTAFHYRPGLL
FT                   QPSQTSVQHCCWALSQYYGLEAKFRSLKQFQSVYFSLLNRMNLITVLPTGGGKSLSFLI
FT                   PALIEKKRQTPGKVMNMVTLVLVPMMSLRQDMMLRVNEKGLLVCSGNWTAFKDVRLTLE
FT                   TQLPDLFILTYESALTNSGLRFFESLATLGRLARVVIDEAHLLLTSGAWRTALSRASRL
FT                   SGLYAPLHLLSATFPRQLEMVARQTFCTNFYVLRETSTARENIFYFLHPYDNTEFLLDL
FT                   RTLMKRTKVFEGDGRAIIFCRTKKDVEYIHRRLHQSDLFAHTHVTIYTGDVSDEERQMN
FT                   FDAFRNANGKTRIMIATKAFGLGINYMGVRLVVHYGLPASSMDYVQETGRAGRDGKYAI
FT                   AALFYEKYDSTWSSYVEDSMKNFLNDNTMCVRSFLASEMDGECVCCASFANCVYCSRCS
FT                   DSLLGEESTVSTMYGVKPTLPETPKPAIATHSRYNASFSSSPPPQPGNSSGMSAMNTNT
FT                   TSTTPVSLSELSEITLFPSSVSPTWKKSFGNANTNLKYGLEDMSLSHRRGHKRTYDEHL
FT                   NNVQQGVNHDMNRVHGSVGGMSGIVGIGIGIGDGDGDGDVDSRTIHFAEYKSRVQAVKK
FT                   QWVDSTDISAQLERFFRVYKDECLSCTLGNPDTEIRAHTGKACPVRLSTCYKCGKADHN
FT                   LRECKLRIRFQGLCLFCGLTKFEHADSDMAYTSDCRSWARKANLISLVYYAWNNVQYRR
FT                   TIADKFLQGDVRD"
FT   CDS_pept        complement(5726..6331)
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.10"
FT                   /product="pseudogene malic acid transport protein"
FT                   /db_xref="PSEUDO:CAO77628.1"
FT   repeat_region   complement(6360..6755)
FT   repeat_region   7548..12710
FT   CDS_pept        7619..9274
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.09c"
FT                   /product="pseudogene"
FT   misc_RNA        complement(11027..11556)
FT                   /locus_tag="SPNCRNA.70"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           11784..12157
FT                   /locus_tag="SPAC212.08c"
FT   CDS_pept        12158..12994
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.08c"
FT                   /product="GPI anchored protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC212.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC212.08c.1"
FT                   /db_xref="GOA:Q9HGP7"
FT                   /db_xref="PomBase:SPAC212.08c"
FT                   /db_xref="PomBase:SPAC212.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGP7"
FT                   /protein_id="CAC05742.1"
FT                   /translation="MSPLIVGTLIIILLSGLATAFYVTWQGRLICAGVGLILEQAYEGG
FT                   QMFNTLMAHCFETYNGVEKSGTQCVADWLKVGLLAVTFGAGGPRLVNTLGGTFLTSPTA
FT                   KRSNLYCDDFTGADYFSCELETLRPYTLMRKSLPYGNIHDVWINTTDTHQMIGVHMTLN
FT                   GTDMIHYYNKTYVINYSGLKLNSSAINKRSYFYPQDSFLVSHAEWQDGNGIWTDTDYFA
FT                   AMADCDFLGQNLGFWLASSYPNAYKWETQLWRTVGINLNGNIIYPGQLIMQTFNGS"
FT   CDS_pept        13665..14555
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.07c"
FT                   /product="pseudogene"
FT   repeat_region   15829..22113
FT   CDS_pept        15855..16226
FT                   /transl_table=1
FT                   /gene_synonym="SPNG7"
FT                   /locus_tag="SPAC212.12"
FT                   /product="S. pombe specific GPI anchored protein family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC212.12"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC750.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC212.12.1"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC750.07c.1"
FT                   /db_xref="GOA:C6Y4B5"
FT                   /db_xref="PomBase:SPAC212.12"
FT                   /db_xref="PomBase:SPAC212.12.1"
FT                   /db_xref="PomBase:SPAC750.07c"
FT                   /db_xref="PomBase:SPAC750.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6Y4B5"
FT                   /protein_id="CBA11488.2"
FT                   /translation="MSPLIVGTLIIILLSGLATAFYVTWQGRLICAGVGLILEQAYEGG
FT                   QMFNTLMAHCFETYNGVEKSGTQCVADWLKVGLLAVTFGAGGPRLVNTLGGSSPTTKRV
FT                   IYIVMILLVLITLAVNLKH"
FT   5'UTR           18042..18071
FT                   /locus_tag="SPAC212.06c"
FT   CDS_pept        join(18072..18306,18349..18557)
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.06c"
FT                   /product="DNA helicase in rearranged telomeric region,
FT                   truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC212.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC212.06c.1"
FT                   /db_xref="GOA:G2TRN7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC212.06c"
FT                   /db_xref="PomBase:SPAC212.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRN7"
FT                   /protein_id="CAO77631.2"
FT                   /translation="MGVRLVVHYRLPASSMDYVQETGRAGRDGKYAIAALFYEKYDSTW
FT                   SSYVEDSMKNFLNDNTMCVRSFLASEMDGECVCYSLLGEESTVSTMYGVKPTLPETPKP
FT                   AIATHSRYNASFSSSPPPQPGSSSGMSAMNTNTTSTTPVSGKT"
FT   3'UTR           18558..18974
FT                   /locus_tag="SPAC212.06c"
FT   CDS_pept        20824..21015
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.05c"
FT                   /product="pseudogene"
FT   repeat_region   20859..29663
FT   repeat_region   21035..21329
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           21381..21586
FT                   /locus_tag="SPAC212.04c"
FT   CDS_pept        join(21587..22076,22132..22508)
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.04c"
FT                   /product="S. pombe specific DUF999 family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC212.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC212.04c.1"
FT                   /db_xref="GOA:Q9HGP8"
FT                   /db_xref="InterPro:IPR009340"
FT                   /db_xref="PomBase:SPAC212.04c"
FT                   /db_xref="PomBase:SPAC212.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGP8"
FT                   /protein_id="CAC05738.1"
FT                   /translation="MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQ
FT                   SQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPNGRISTQDK
FT                   SRWVLLIIWSIITILTIDKKFKIKESYLEWIGENQSHSEIWGPIVIYVGLFILLLSAFN
FT                   YCSKLIIKALPLISMVIAWVGVVIAAFSVIITATIAGVIAAFSVIITATIAGVIAAMVG
FT                   ILYFGHWLVYKILILAFGFKIVTSGDVCVSNTLPTHNGETALHSDATVGSDIEQIELQN
FT                   MPTPVKK"
FT   3'UTR           22509..23050
FT                   /locus_tag="SPAC212.04c"
FT   CDS_pept        complement(23589..23978)
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.03"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC212.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC212.03.1"
FT                   /db_xref="GOA:Q9HGP9"
FT                   /db_xref="PomBase:SPAC212.03"
FT                   /db_xref="PomBase:SPAC212.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGP9"
FT                   /protein_id="CAC05737.1"
FT                   /translation="MSIEFDDSSRHNMNMTQLMQLGAFDRRSGDDFMVQDFKNGIRDCS
FT                   GIPVNNRNLAFKAYDAVKQKCDSSIKVFNIQDITIKGATWQHHNCQSTGKWYSQLYDYQ
FT                   NTFIGKQEYNILFDCYSYLKYNLNG"
FT   5'UTR           complement(23979..24054)
FT                   /locus_tag="SPAC212.03"
FT   repeat_region   complement(24281..24445)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(24581..24876)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(25997..26339)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   CDS_pept        complement(27353..27763)
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.02"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC212.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC212.02.1"
FT                   /db_xref="GOA:Q9HGQ0"
FT                   /db_xref="PomBase:SPAC212.02"
FT                   /db_xref="PomBase:SPAC212.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGQ0"
FT                   /protein_id="CAC05736.1"
FT                   /translation="MTALMNHIYIDNPLISNSTNNVTHELLIDLHELYNDGEISRIVLL
FT                   RTLVTQSADDATWIINLTDDVLNGLPLLKKRDRYTTQCHSTNMASTYDCDTGANAVGAR
FT                   GGATLAADYRGDWGGGVMLYKPLVVKACLTEI"
FT   repeat_region   28124..28480
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   CDS_pept        join(28738..29227,29286..29638)
FT                   /transl_table=1
FT                   /locus_tag="SPAC212.01c"
FT                   /product="S. pombe specific DUF999 family protein 2"
FT                   /db_xref="GOA:P0CT98"
FT                   /db_xref="InterPro:IPR009340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT98"
FT                   /protein_id="CAC05735.1"
FT                   /translation="MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQ
FT                   SQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRISTRSN
FT                   FRWPLLIIWSIIIVFAVDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLMLLSLI
FT                   FFAEFAVLALRVTGVIIAVLGAVLGMIIAVLGMIIAALGMIIAALGATITGLLYFGHWA
FT                   LYKLVILSLGFKIVTPGDVCVSNTLPTHNGETALHSETTVGSDIEQIELQNMPTPVKK"
FT   3'UTR           29639..29657
FT                   /locus_tag="SPAC212.01c"
FT   gap             29664..29763
FT                   /estimated_length=unknown
FT   CDS_pept        <29764..30716
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.01"
FT                   /product="S. pombe specific 5Tm protein family"
FT                   /db_xref="GOA:P0CU16"
FT                   /db_xref="InterPro:IPR018291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU16"
FT                   /protein_id="CAB69623.1"
FT                   /translation="SFAYSGNSESVWTGENITSIWKTILINETGSYCVAARPMTMDGAE
FT                   FNLDLMGYSVSEDQINNDEIGIWNYISVAEMGGVLLFLSYWIWTCLHFSKIIFPAQKVI
FT                   CLYIFLFALNQTLQECIEEYVFSSECIKYRQFYSVYEIIDFLRTNFYRLFVIYCALGFG
FT                   ITRTVPKYLMIKGISIVIALCSVYWISLYKDVYVVSEIFDMIQYEVSPAIWVYSICHLL
FT                   KQCTSVTTYENASKARFFRRMLNAFIFIFCASPMLHYLSNIIFGNFDYRLSVIIGDLFT
FT                   FMEKIAFPCYIMFPTHNEALAYNRNVAEEAQEKMI"
FT   3'UTR           30717..31069
FT                   /locus_tag="SPAC977.01"
FT   3'UTR           complement(31140..31326)
FT                   /locus_tag="SPAC977.18"
FT   CDS_pept        complement(join(31327..31557,31768..31913,32163..32187))
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.18"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.18"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.18.1"
FT                   /db_xref="GOA:G2TRM1"
FT                   /db_xref="PomBase:SPAC977.18"
FT                   /db_xref="PomBase:SPAC977.18.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRM1"
FT                   /protein_id="CCD31307.1"
FT                   /translation="MFYLRVLCVQRRLVREINKLSSFESNWLFLLFLVRVCRQLKTVTV
FT                   LIVPVLPVYTNKVLRCSQCDWHEPANLDSIYQRSSHDDDLPTIKGSDASTQQYERKTYI
FT                   TDASPESQNLFLSKSKEEGVIFLCIQVSF"
FT   5'UTR           32034..32229
FT                   /locus_tag="SPAC977.02"
FT   5'UTR           complement(32188..32345)
FT                   /locus_tag="SPAC977.18"
FT   CDS_pept        32230..32670
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.02"
FT                   /product="S. pombe specific 5Tm protein family"
FT                   /db_xref="GOA:P0CU07"
FT                   /db_xref="InterPro:IPR018291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU07"
FT                   /protein_id="CAB69624.1"
FT                   /translation="MALLKKINTQVNRIMKNSSLVQNICFDRVPLFIPRLSLTVKYCLA
FT                   VKLLIYLLYCWYIYSEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTHSINSIRTFSKFQ
FT                   VIILFSIEKVTRSESKNHSYSKTDISDLHQGYNNPPSRFISR"
FT   3'UTR           32671..33012
FT                   /locus_tag="SPAC977.02"
FT   repeat_region   complement(32863..33057)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   CDS_pept        33835..34272
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.03"
FT                   /product="methyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.03.1"
FT                   /db_xref="GOA:Q9P7U5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="PomBase:SPAC977.03"
FT                   /db_xref="PomBase:SPAC977.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7U5"
FT                   /protein_id="CAB69625.1"
FT                   /translation="MNLVQLGKLHENVLDAGCEPNRNARYLASLGYKVVGIDISERAIS
FT                   KAIDKTSSEKSNVNFNQRDFSRLNEFKGHFDTVIDIGCFHSILNSDHEPHTASLSHICH
FT                   SDSSVFLRAFSETNKSRYRRWQGHKRYSLALKRNNVKKLSL"
FT   5'UTR           34298..34348
FT                   /locus_tag="SPAC977.04"
FT   CDS_pept        34349..34816
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.04"
FT                   /product="truncated C terminal region of membrane
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.04.1"
FT                   /db_xref="GOA:G2TRN8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPAC977.04"
FT                   /db_xref="PomBase:SPAC977.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRN8"
FT                   /protein_id="CAO77633.2"
FT                   /translation="MPINQKFYSYLVKRNGGEGEPEFRLPMGFIGITLFEIGILLFGWT
FT                   ARYKIFWFVPTIGSAIMGGGYIMTSNPLNMYVVDSYGIYSASASAGVKIFQLLLGAIFP
FT                   LFAESLFRRLNYGWGCTLLAFILLACGCSLPILFKYGKQIRNLRPFDPSKY"
FT   3'UTR           34817..34978
FT                   /locus_tag="SPAC977.04"
FT   CDS_pept        complement(35768..36382)
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.05c"
FT                   /product="conserved fungal family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.05c.1"
FT                   /db_xref="GOA:Q9P7U4"
FT                   /db_xref="InterPro:IPR019435"
FT                   /db_xref="PomBase:SPAC977.05c"
FT                   /db_xref="PomBase:SPAC977.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7U4"
FT                   /protein_id="CAB69627.1"
FT                   /translation="MIFKNLISLFFIGLATAIRFNLTDLECSRLRGPHCGTYLLKVVGT
FT                   NATYVGEKSFIGLDALTESKGEFFQRMLEQEPRLIPRLFTIAENDTANFTPLTFTTYLK
FT                   TCNPQSIENAMIPFVNTVTSEISFDAWAYTAQNSSRITGLSNQLMNSTLYNVQVATCTP
FT                   GFSALLLDSPTINVFNNEEGMPSWCQPIELIPVCPLDEGFN"
FT   5'UTR           39416..39430
FT                   /locus_tag="SPAC977.06"
FT   CDS_pept        join(39431..39848,39899..40050)
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.06"
FT                   /product="S. pombe specific DUF999 family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.06.1"
FT                   /db_xref="GOA:Q9P7U3"
FT                   /db_xref="InterPro:IPR009340"
FT                   /db_xref="PomBase:SPAC977.06"
FT                   /db_xref="PomBase:SPAC977.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7U3"
FT                   /protein_id="CAB69628.1"
FT                   /translation="MVRDTRNVDLERGLELCKPEKVNKQNLFTNIIKPQKDKINIKTDK
FT                   IKFFLNNLFTEFSKFHDSCYPDGRISTRSKLRWPLLIIWCILIVFAIDKNFEVKDFLSI
FT                   WINESFINENRFYSEIWGPIAIYICLFVLLLLGLIYCSKIVVKAIPLISIVIAAVVVII
FT                   AVAMVKILYICHWLLQNFNFGFRHKS"
FT   3'UTR           40051..40072
FT                   /locus_tag="SPAC977.06"
FT   misc_RNA        40795..41489
FT                   /gene_synonym="SPNG12"
FT                   /locus_tag="SPNCRNA.136"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(40916..41770)
FT                   /locus_tag="SPNCRNA.601"
FT                   /product="intergenic RNA (predicted)"
FT   CDS_pept        complement(42057..43307)
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.07c"
FT                   /product="cell surface glycoprotein (predicted)"
FT                   /db_xref="GOA:P0CU05"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU05"
FT                   /protein_id="CAB69629.1"
FT                   /translation="MNFFLYFRTIFLIQLYFFNYSTFGCSASSTSVQSDTTNQVSVSCP
FT                   KYTTIYTSGTSPDTKTIYPESTSTKSITTSTQSHSSPVIVVSTVGTVTETTISGSTEYT
FT                   TTIPAEGITSGTVEIVEPTAGTVTETITSGTLPFTTTLAQASGTVSGTVEIVSPKNNPT
FT                   TVYSGTVATTETFSSSTVVVIPTAICDGVRGLEYAVYDYTISSSMNEFCYPKNGQTDVF
FT                   AFNEPAYFGSSDLDQSSPLFTGVFSSTDDIPEWASSWYLPPYPPQASDMASTYCACKVI
FT                   VYQFFLRIPETDTYTLVVNNVDDVFFGWFGDKAISGWSNNNFDAYSYWHESPNMGLGTV
FT                   GMGNFTVGNYPEGYFLPVRFVVANGAYIGGFDFYFTSDSTGPLATTSYSYTKTCTQQFL
FT                   PFGQGNGGVNGPTEKLS"
FT   repeat_region   43336..43366
FT   5'UTR           44644..44703
FT                   /locus_tag="SPAC977.08"
FT   CDS_pept        44704..45414
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.08"
FT                   /product="short chain dehydrogenase (predicted)"
FT                   /db_xref="GOA:P0CU00"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU00"
FT                   /protein_id="CAB69630.1"
FT                   /translation="MREPKNAKVLSRLENVLVTQLDVNNFSSIKKSVEKAISHFGRIDV
FT                   LLNNAGYSVYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFRSQHNGMIINVSSIGG
FT                   KMTFPLGCLYYGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATEFRVEEGAGKHYAE
FT                   YDNLKQKLYEDLLPKLKTATPPQKIAEVILQAATDESDELRYPTGDYVVEWMALRSKVD
FT                   DATFLATHRKQMGL"
FT   3'UTR           45415..45468
FT                   /locus_tag="SPAC977.08"
FT   3'UTR           complement(45875..46074)
FT                   /locus_tag="SPAC977.09c"
FT   CDS_pept        complement(join(46075..46143,46208..48160))
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.09c"
FT                   /product="phospholipase (predicted)"
FT                   /EC_number="3.1.1.5"
FT                   /db_xref="GOA:P0CU02"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU02"
FT                   /protein_id="CAB69631.1"
FT                   /translation="MYVNYIGLFAFVQISLTLAYPPGRVEISEIYDFEESSSYKGQDID
FT                   TSVLYTLSKRKPALVKRSTDASYAPFNVTCSNDNLLRPASEGLNEGEQSYINKRISKVN
FT                   SELRSFISKTGLNVDLDKVVNSSDGPRLGIAFSGGGLRAMVNGGGAFNAFDSRFESDSP
FT                   LSGLLQSAMYISGLSGGSWLVGSVAINNFTNITYLRDNVWNLEHSVFAPHGDNVIENLN
FT                   YYNDLRKEIDQKKHAGFDCSLTDLWGRALSRKLVDAERGGPGITYSSMRNQSWFQNADY
FT                   PYPIIVADSRLEEETAIPANTSIFEFTAYEFGTWDNGIKAFIPMEYVGTHLLDGVPPDK
FT                   SCIHNYDNAGFVMGTSATLFNSFLLDWNENVKKNDTYYDILHAILEDLSKHQDDIAPYP
FT                   NPYQNYTTSNTSVVNAFEPYDTIDLVDGGEDRENIPLWPLLHPQRFVDVVFAIDSTYND
FT                   PYGWPLGSSIVATYERVVTFNANKSVDVRGFPYIPDENTIISLGLNTRPTFFGCDGKNT
FT                   TAGNHDVDNNTPPLLVYFPNYPWTYYSNISTFTMSMDDKMANGILENAFMSTTQNNNES
FT                   FAVCLACAIIQRSLERKKLSTPTQCSSCFQEYCWDGTLATSTASVYDPTVMSAATTSRA
FT                   PSGTTSGTASSTTSSSVASATPTHKHWWDSIFEAKENP"
FT   intron          complement(46144..46207)
FT                   /locus_tag="SPAC977.09c"
FT   5'UTR           complement(48161..48399)
FT                   /locus_tag="SPAC977.09c"
FT   misc_RNA        complement(50851..51545)
FT                   /locus_tag="SPNCRNA.602"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           50946..51891
FT                   /gene="sod2"
FT                   /locus_tag="SPAC977.10"
FT   misc_RNA        51158..51583
FT                   /gene="prl19"
FT                   /locus_tag="SPNCRNA.19"
FT                   /product="non-coding RNA, poly(A)-bearing RNA (predicted)"
FT   CDS_pept        join(52117..52240,52318..53600)
FT                   /transl_table=1
FT                   /gene="sod2"
FT                   /locus_tag="SPAC977.10"
FT                   /product="plasma membrane sodium ion/proton antiporter
FT                   Sod2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.10.1"
FT                   /db_xref="GOA:P36606"
FT                   /db_xref="InterPro:IPR004712"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="PDB:2M7X"
FT                   /db_xref="PomBase:SPAC977.10"
FT                   /db_xref="PomBase:SPAC977.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36606"
FT                   /protein_id="CAB69632.1"
FT                   /translation="MGWRQLDIDKVHLALIVAGGFITFFCYFSEVFRKKLLVGEAVLGS
FT                   ITGLIFGPHAAKLVDPFSWGDHGDYLTVEICRIVLDVRVFASAIELPGAYFQHNFRSII
FT                   VMLLPVMAYGWLVTAGFAYALFPQINFLGSLLIAGCITSTDPVLSALIVGEGPLAKKTP
FT                   ERIRSLLIAESGCNDGMAVPFFYFAIKLLTVKPSRNAGRDWVLLVVLYECAFGIFFGCV
FT                   IGYLLSFILKHAQKYRLIDAISYYSLPLAIPLLCSGIGTIIGVDDLLMSFFAGILFNWN
FT                   DLFSKNISACSVPAFIDQTFSLLFFTYYGTIIPWNNFNWSVEGLPVWRLIVFSILTLVC
FT                   RRLPVVFSVKPLVPDIKTWKEALFVGHFGPIGVCAVYMAFLAKLLLSPDEIEKSIYEST
FT                   TVFSTLNEIIWPIISFVILSSIIVHGFSIHVLVIWGKLKSLYLNRKVTKSDSDLELQVI
FT                   GVDKSQEDYV"
FT   3'UTR           53601..53858
FT                   /gene="sod2"
FT                   /locus_tag="SPAC977.10"
FT   repeat_region   54499..54854
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           55059..55273
FT                   /locus_tag="SPAC977.11"
FT   repeat_region   55264..57914
FT   CDS_pept        55274..56209
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.11"
FT                   /product="CRCB domain protein"
FT                   /db_xref="GOA:P0CU19"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU19"
FT                   /protein_id="CAB69633.1"
FT                   /translation="MLLTQSYFCIMSMLGTLARLGLTALNTYPGAPFSGLLWVQFVGCV
FT                   IMGFCQTESVFFPRPKHNATFLLAITTGFCGSLTTFSSWMLQMFTGMANLDPFERRGRG
FT                   YSFLSVVSDFMVTMCIAMSSLIWGKQIGKTTGQWRIGKVAFAWPIPAHTHIVVRVLLLL
FT                   LSICFFVGAAFYTAYTTNVTHRGIGFSLIFSPFAALTRLYLARFLNSPQYFIPYGTLCA
FT                   NVFATLLLSIMYMIPQITHCTPVSRSVMYGIQNGFCAVLSTLSTFSNELHTMPIKRAYI
FT                   YCIISVAISFSICVIVDGATAWGHGYTEKY"
FT   3'UTR           56210..56308
FT                   /locus_tag="SPAC977.11"
FT   5'UTR           56373..56491
FT                   /locus_tag="SPAC977.12"
FT   CDS_pept        56492..57562
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.12"
FT                   /product="L-asparaginase (predicted)"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.12.1"
FT                   /db_xref="GOA:Q9UTS7"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="PomBase:SPAC977.12"
FT                   /db_xref="PomBase:SPAC977.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTS7"
FT                   /protein_id="CAB69634.1"
FT                   /translation="MWGFIVTCGIFLVLLCQLRLLSKRKSKSTPYNALLPNVTVFAMGG
FT                   TIAGCANSSLEIVNYIPGSVGIEKLIEAVPAIKAIANINGVQVTNMGSENLTPADVLKL
FT                   AKLILAEVAKPNVHGIVITHGTDSLEETAMFLDLTISTAKPIVVVGAMRPSTAIGADGP
FT                   MNLLNAVAVASSNQSMGRGTLVLLNDRIGSAFYTTKTNGNTLDTFKSYEAGSLGIVLNQ
FT                   KPFYFFSPAVPTGKVFFDIYNIKQLPRVDILYGYQGLNPKLAESAVHLGAKGLVLAAMG
FT                   ATSWTDDGNEVISSLIREHNIPVVYSHRTAEGYSSNSCLGIPSYFLNPQKARYMLMLAI
FT                   SSGYSIRDIEDLFSIK"
FT   3'UTR           57563..57736
FT                   /locus_tag="SPAC977.12"
FT   CDS_pept        complement(58277..59105)
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.13c"
FT                   /product="hydrolase, pseudogene"
FT   repeat_region   59436..59486
FT   repeat_region   complement(59604..60792)
FT   3'UTR           complement(59614..59714)
FT                   /locus_tag="SPAC977.14c"
FT   CDS_pept        complement(59715..60770)
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.14c"
FT                   /product="aldo/keto reductase, unknown biological role"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.14c.1"
FT                   /db_xref="GOA:Q9P7U2"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="PomBase:SPAC977.14c"
FT                   /db_xref="PomBase:SPAC977.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7U2"
FT                   /protein_id="CAB69636.1"
FT                   /translation="MSSLSPELYGCLGNSGLKVSKLILGCMSYGKKEYWEDWVLEDEEE
FT                   VFKIMKAAYDAGIRTFDTANCYSAGVSEELVGKFIRKYEIPRSSIVILSKCFFPVRKDL
FT                   IKIFGDLSSRGVHFLDSPELANQCGLSRKHIFDAVEDSVKRLGTYIDVLQIHRYDPHVS
FT                   AEEVMRALNDVVESGKVRYIGASTMRCYQFIELQNTAEKHGWHKFISMQNYHNLLYREE
FT                   EREMIPYCQKTGVGLIPWSPLARGLLTRSIDANEETIRSKTDLYTRALEFGAGYKAILS
FT                   RVEELAKKYNVSMATLATAWSLHKGDYPIVGISKVERLKDALAAVELKLSEEDIKYLEE
FT                   PYCPVPIQGEI"
FT   5'UTR           complement(60771..60907)
FT                   /locus_tag="SPAC977.14c"
FT   5'UTR           62961..62988
FT                   /locus_tag="SPAC977.15"
FT   CDS_pept        62989..63732
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.15"
FT                   /product="dienelactone hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.15.1"
FT                   /db_xref="GOA:Q9P7U1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PomBase:SPAC977.15"
FT                   /db_xref="PomBase:SPAC977.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7U1"
FT                   /protein_id="CAB69637.1"
FT                   /translation="MPCCPTKSGAAPTNRNYELQGEMLKDIGGMQTYFTGKRSSKVVLI
FT                   GFMDVFGLSKQIKEGADQLANHELAIYLPDFLNGETASIEMIDPKTIEQKEARSKFMEK
FT                   ISSPLHWPKLTKVIEDIERIHGQDVKIGAYGFCWGAKVLITYPNKERFLRIGCAHPSLL
FT                   DPVDAKHVHCPVCFLCSKDEDPEEVDAWKKSFENSPYFSESYFETFGKMHHGWMAARAN
FT                   LSDPENRKYFDLGYQIFLKFFKELF"
FT   3'UTR           63733..63862
FT                   /locus_tag="SPAC977.15"
FT   3'UTR           complement(64559..64903)
FT                   /gene="dak2"
FT                   /locus_tag="SPAC977.16c"
FT   CDS_pept        complement(64904..66679)
FT                   /transl_table=1
FT                   /gene="dak2"
FT                   /locus_tag="SPAC977.16c"
FT                   /product="dihydroxyacetone kinase Dak2"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="GOA:O74215"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74215"
FT                   /protein_id="CAB69638.1"
FT                   /translation="MSVKQFVSDGHIVRPYLLGLARSNPGLTVIEHDRVIYRTASAPGS
FT                   GDLPKVTLVSGGGSGHEPTHAGFVGDGALDAVACGDIFASPSTKQIYSALKAVASPKGT
FT                   LIIVKNYTGDIIHFGLAAERAKAAGMNVELVAVGDDVSVGKKRGALVGRRGLGATVLVH
FT                   KIAGSAAALGLDLHQVAQVAQSVIDNAATIAASLDHCAVPGRKFETNLGPDEYEIGMGI
FT                   HNEPGTFKSSPLPSIPELVTEMLSILFGEKNPDNSFVEFSSKDDVILLVNNMGGMSNLE
FT                   LGYATEVVSEQLAKRGIIPKRTMSGTFVTALNGPGFGITLVNASKATPDIFKYFDLPTT
FT                   ASGWNVSYHNAKDWEVLADGKVPTAPALEHTRNEKHSGVKADPKMFTKILKAAVDAINE
FT                   FEPKTTWYDTIAGDGDCGTTLVNGGEAITKAINDKSIRLDDGVNGIDDLAYIVEDSMGG
FT                   TSGGLYSIYLSALAKGVHESGDSELSVHTFAFASKYALDALFKYTRARKGFRTLIDAIQ
FT                   PFVETLNEGKGLDAAAKAATEGSEQTRKMDAVVGRASYVAKEELHKLDSEGGLPDPGAF
FT                   ALAAILNAIVEASEH"
FT   5'UTR           66219..67142
FT                   /locus_tag="SPAC977.17"
FT   5'UTR           complement(66848..66980)
FT                   /gene="dak2"
FT                   /locus_tag="SPAC977.16c"
FT   CDS_pept        67143..68939
FT                   /transl_table=1
FT                   /locus_tag="SPAC977.17"
FT                   /product="MIP water channel (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC977.17"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC977.17.1"
FT                   /db_xref="GOA:Q9P7T9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="PomBase:SPAC977.17"
FT                   /db_xref="PomBase:SPAC977.17.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7T9"
FT                   /protein_id="CAB69639.1"
FT                   /translation="MSVPLRFSTPSSSPSASDNESVHDDGPTTELDTFNTTDVPRRVNT
FT                   TKARQMRPKNTLKVAFSSPNLKGLDNTADSDSQPWLGGYLAGRLEDISGQSRRNYVDPY
FT                   YEELNAGRRPNKPVWSLNGPLPHVLGNSVVEKISQKNQEARSRANSRVNSRANSRANSS
FT                   VSLAGMDGSPNWKRKMKSAVFGSRVKLNDEEAQLPRNKSSVSIAEQAASRPKVSFSLQS
FT                   SRQPSIAEEQPQTQRKSSAITVEHAENAEPETPRNNVSFSRKPSIAEQDSSQDITMPPN
FT                   EIIAEESLDSGSDTETLYLNYWCKIRHFFREGFAEFLGTLVLVVFGVGSNLQATVTNGA
FT                   GGSFESLSFAWGFGCMLGVYIAGGISGGHVNPAVTISLAIFRKFPWYKVPIYIFFQIWG
FT                   AFFGGALAYGYHWSSITEFEGGKDIRTPATGGCLYTNPKPYVTWRNAFFDEFIGTAVLV
FT                   GCLFAILDDTNSPPTQGMTAFIVGLLIAAIGMALGYQTSFTLNPARDLGPRMFAWWIGY
FT                   GPHSFHLYHWWWTWGAWGGTIGGGIAGGLIYDLVIFTGPESPLNYPDNGFIDKKVHQIT
FT                   AKFEKEEEVENLEKTDSPIENN"
FT   3'UTR           68940..69821
FT                   /locus_tag="SPAC977.17"
FT   misc_RNA        71030..71470
FT                   /gene_synonym="SPNG19"
FT                   /locus_tag="SPNCRNA.137"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(71982..72380)
FT                   /gene="prl37"
FT                   /locus_tag="SPNCRNA.37"
FT                   /product="non-coding RNA,poly(A)-bearing (predicted)"
FT   misc_RNA        72344..72414
FT                   /locus_tag="SPNCRNA.83"
FT                   /product="non-coding RNA (predicted)"
FT   repeat_region   complement(73709..73977)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   73945..74282
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   3'UTR           complement(74452..75697)
FT                   /locus_tag="SPAPJ695.02"
FT   CDS_pept        complement(75698..75910)
FT                   /transl_table=1
FT                   /locus_tag="SPAPJ695.02"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAPJ695.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAPJ695.02.1"
FT                   /db_xref="GOA:G2TRM2"
FT                   /db_xref="PomBase:SPAPJ695.02"
FT                   /db_xref="PomBase:SPAPJ695.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRM2"
FT                   /protein_id="CCD31308.1"
FT                   /translation="MSDFNLRRYYTSNQLLKFSNEYPKSMTEIKKGELKGYDIFTSSTI
FT                   NMVVGNLLRDVQNRIDQADQIEKRS"
FT   5'UTR           complement(75911..76721)
FT                   /locus_tag="SPAPJ695.02"
FT   3'UTR           complement(77480..77577)
FT                   /locus_tag="SPAPJ695.01c"
FT   CDS_pept        complement(77578..77931)
FT                   /transl_table=1
FT                   /locus_tag="SPAPJ695.01c"
FT                   /product="S. pombe specific UPF0321 family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAPJ695.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAPJ695.01c.1"
FT                   /db_xref="GOA:Q9URW1"
FT                   /db_xref="InterPro:IPR019445"
FT                   /db_xref="PomBase:SPAPJ695.01c"
FT                   /db_xref="PomBase:SPAPJ695.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URW1"
FT                   /protein_id="CAB61210.1"
FT                   /translation="MLLLLYICCLFLKFILANVDLTFVEYAKLPSKYAELLANATNQQG
FT                   VMLFSTGDIRIGAYNYLVNNVTEINNDTDAYLCQLLTGQYTTDCYIFDTNSDDKPETFN
FT                   SSIHLLNSDLDPK"
FT   5'UTR           complement(77932..78066)
FT                   /locus_tag="SPAPJ695.01c"
FT   misc_RNA        79209..79317
FT                   /gene_synonym="SPNG23"
FT                   /locus_tag="SPNCRNA.138"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        79543..79628
FT                   /locus_tag="SPNCRNA.76"
FT                   /product="non-coding RNA (predicted)"
FT   repeat_region   complement(79680..79768)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        complement(81468..82345)
FT                   /locus_tag="SPNCRNA.603"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           82746..82935
FT                   /gene="ght3"
FT                   /locus_tag="SPAC1F8.01"
FT   CDS_pept        82936..84603
FT                   /transl_table=1
FT                   /gene="ght3"
FT                   /locus_tag="SPAC1F8.01"
FT                   /product="hexose transporter Ght3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.01.1"
FT                   /db_xref="GOA:Q92339"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPAC1F8.01"
FT                   /db_xref="PomBase:SPAC1F8.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92339"
FT                   /protein_id="CAB03595.1"
FT                   /translation="MNRFITSILVVFISMSGWLQGADTGSISGILGMRDFQSRFADRYN
FT                   PISNSYSYSAWRQALLTGTINAGCLFGAMLSSPFTERIGKKYSICFFSGVYIIAELLLV
FT                   TAVPSWIQVLVGKILAGVGIGALSVLSPGYQSEVAPPQIRGAVVATYQIFSTGAALVAA
FT                   CINMGTHKLRKTASWRTSFGINMLWGILLMVGVLFLPESPRYLIYKGRDEEALRIMCNM
FT                   AELSPESEIIQTNFNTIKSDIEIEMAGGKARWIEIFGKDIRYRTCLGFLVMLFRELIGN
FT                   NYYFYYATQVFKGTGMTDIFLPAVILGAINFGTTFGALYTIDNLGRRNPLIFGAAFQSI
FT                   CFFIYAAVGDRKLIYKNGTSDHRAGSVMIVFSCLFLFSYCCSWGPMGWVIVGETFPIRY
FT                   RSKCASVATSGNWLGNFMISFFTPFINNAIGFKLGYIYACINLFSSFMIFFLAKETKGL
FT                   TLEEVNDLYMSNIKPWESYKYVREIESHRIHFSKEEEKREREKSKGIRGQEEEFIENAD
FT                   EDNNDSSSSSGSVVSAVKPRRSAVSNDRFSEDSHPTYI"
FT   3'UTR           84604..84786
FT                   /gene="ght3"
FT                   /locus_tag="SPAC1F8.01"
FT   3'UTR           complement(85566..85597)
FT                   /locus_tag="SPAC1F8.02c"
FT   CDS_pept        complement(85598..86278)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F8.02c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.02c.1"
FT                   /db_xref="GOA:Q92340"
FT                   /db_xref="PomBase:SPAC1F8.02c"
FT                   /db_xref="PomBase:SPAC1F8.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92340"
FT                   /protein_id="CAB03596.1"
FT                   /translation="MISLKIYFVLIFLFLKGINSAYVSNEEGETVDFTFSGFYANLTYP
FT                   NEISELNYVEGNYLSTRIVRFNGSFYCDTTILSETNNVTGSCYVANCANDTVLEICDSG
FT                   KEVHFTDMSGTTWSADTFTENLYWFCGGDGNKPNMTTAAAMNSDIDSYYVYGNWTIDTA
FT                   DSTVADYTCNYTHFQEAGDIEKGDVYTASADSSDSSSASSTIFKPSYFISCLLSVGLYL
FT                   VLNF"
FT   5'UTR           complement(86279..86324)
FT                   /locus_tag="SPAC1F8.02c"
FT   3'UTR           complement(88201..88366)
FT                   /gene="str3"
FT                   /locus_tag="SPAC1F8.03c"
FT   CDS_pept        complement(88367..90259)
FT                   /transl_table=1
FT                   /gene="str3"
FT                   /locus_tag="SPAC1F8.03c"
FT                   /product="siderophore-iron transporter Str3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.03c.1"
FT                   /db_xref="GOA:Q92341"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPAC1F8.03c"
FT                   /db_xref="PomBase:SPAC1F8.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92341"
FT                   /protein_id="CAB03597.1"
FT                   /translation="MEAKETHSISDHEVELQDAKPEEKSENGNFVFEKAFSSDEEKGSG
FT                   YNTNETYSKMDNSLQHRGVSKIEAVRDSIYQNKRGMYLAYAFGIAILACSWASAIQSST
FT                   TYSYQVYATASFNRTSMISTLEIATAIISSVCKPILGKFSDITSRPMTYTLVLLFYVIG
FT                   FIVVASSSTISAYVIGSVFISIGSSGLDYLNTLVVGDLTSLKWRGFMTALLSTPYIATV
FT                   WFTGFIVQGIIDSNWRWGYGMFAIIMPAVMTPAVIILMYLERQANKDENIKKIINYQTE
FT                   EKNKNKQSKWQKLWKAVLEVDLFGLILLGVGWSILLLPFSLTSYAKNGWKNPSMIAMMV
FT                   VGGVILIAYSGYEMFIAPYPSCPRRVMNRTFITAVIIDFFYYLAGYLQSMYFTTYTWIL
FT                   YDWSYRDWTYFNNTMTIALCVFGVFAGAMHRVFHRYKYLQIIGLVIKIVGYGILIRPNF
FT                   AATGKVDLAWSLILIGMGGSFSVVGSQVSCQASVPHQDLAIASSLLPLYTNIGGAIGAA
FT                   IASPIFSNKVPKYLREYLPSSINDTQVYNFYSDSSLIREYPVGTEIRDGAIKAYSRSMF
FT                   FLLVPAVSLSFIPLAAAFWQSNFYLGNQQNAVEGDQDHKKKGDKETTQEEKIII"
FT   5'UTR           complement(90260..90300)
FT                   /gene="str3"
FT                   /locus_tag="SPAC1F8.03c"
FT   misc_RNA        complement(90681..91753)
FT                   /locus_tag="SPNCRNA.604"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        90868..91753
FT                   /gene_synonym="SPNG25"
FT                   /locus_tag="SPNCRNA.139"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        90949..94038
FT                   /locus_tag="SPNCRNA.605"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(92387..92479)
FT                   /locus_tag="SPAC1F8.04c"
FT   CDS_pept        complement(92480..93871)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F8.04c"
FT                   /product="hydrolase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.04c.1"
FT                   /db_xref="GOA:Q92342"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PomBase:SPAC1F8.04c"
FT                   /db_xref="PomBase:SPAC1F8.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92342"
FT                   /protein_id="CAB03598.1"
FT                   /translation="MLYTHANIITVNPTRDILIDGAILVKDGSNTIDDIGKTDRLVSIY
FT                   PNEKHKSLEGHIVMPGLISLHVHLAQSLLRSAADDLPLISWLCDTVWKMQGNFTQEDGY
FT                   VASQLTIAEMLKSGTTTFVEALFAQRYGIEGAVKAVIESGIRGCIGKVVMDQPRYATQT
FT                   GVSMHEGLIENSNSLNQAVESHSKFHGKGNGRVEIWFGARTPGGVSEELYRKMVKIARA
FT                   NNIGITMHCAEVKADREFFASKEHTPMTYCKDLGLLGPKTVLAHMVHLDTQDLEILEKH
FT                   GNGTSVAHCPVSNSKLGSGIAPLKEMLEKSIIVGIGCDGCPCNNTMDLLQEMKMASLLP
FT                   KALHGDPSIVPAEKIVEMATINGAKALGRDDLGSLEVGKKADFISLDLSNKLYAQPLRD
FT                   LVSAVVYIATGADVATVVIDGKLIVEDHVLLTIDEPKLIDKAKKHGKKLQERAKVDVKG
FT                   RWKEI"
FT   5'UTR           complement(93872..93931)
FT                   /locus_tag="SPAC1F8.04c"
FT   misc_RNA        complement(95159..96525)
FT                   /locus_tag="SPNCRNA.606"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           95961..95999
FT                   /gene="isp3"
FT                   /gene_synonym="meu4"
FT                   /locus_tag="SPAC1F8.05"
FT   CDS_pept        96000..96548
FT                   /transl_table=1
FT                   /gene="isp3"
FT                   /gene_synonym="meu4"
FT                   /locus_tag="SPAC1F8.05"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.05.1"
FT                   /db_xref="GOA:P40899"
FT                   /db_xref="PomBase:SPAC1F8.05"
FT                   /db_xref="PomBase:SPAC1F8.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40899"
FT                   /protein_id="CAB03599.1"
FT                   /translation="MGLGNLCSYKQDDSLDILQKKVLIDAFNKVTIDGKPNVQHQQPTY
FT                   WYPPPPPRHHKEHKKSHHHWEYSSDDDSSDDEESCEKKKPKCCEKKKPKCCESEQNNGC
FT                   GRRNQLARRLAFLGSFGDGDCDGCNEAFTVTGPITYFRTCPDPLTGITPAVAAAAATPA
FT                   AAATPATPAAAATPAAPAA"
FT   3'UTR           96549..96966
FT                   /gene="isp3"
FT                   /gene_synonym="meu4"
FT                   /locus_tag="SPAC1F8.05"
FT   repeat_region   98631..98942
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(98988..99228)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        complement(99046..101140)
FT                   /locus_tag="SPNCRNA.607"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           99871..100010
FT                   /gene="fta5"
FT                   /gene_synonym="sma5"
FT                   /locus_tag="SPAC1F8.06"
FT   CDS_pept        100011..101168
FT                   /transl_table=1
FT                   /gene="fta5"
FT                   /gene_synonym="sma5"
FT                   /locus_tag="SPAC1F8.06"
FT                   /product="cell surface glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.06.1"
FT                   /db_xref="GOA:Q92344"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="PomBase:SPAC1F8.06"
FT                   /db_xref="PomBase:SPAC1F8.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92344"
FT                   /protein_id="CAB03600.1"
FT                   /translation="MNSYISLIFTLLFFTSAARSSSVSVETGSCVRYTTIYSSGSSEFT
FT                   STITPETPSSSSSTFVPISTHTSSATNTTSGQLSISSSSSTSSEYSSSSIPITTVSSSD
FT                   SFIPSSSQTISASSSTTDNVIVSSSISSTVSSTPVSTIYSGTSGTTFVSSSTTYQVIPT
FT                   QICDGVRGLEYAVYNYDLPSESTFCHPSNGYTEVSTFNKPAYFGSKDLKQSAPLFTGIF
FT                   SSLDDIPTYSASDYLPAYPPNPEGMSSTSSSCKTIVYQFFFRVPATDNWSLFVKNVDDA
FT                   FFGWFGDKAISGWSNVNYDAYAHWRIGAYGMGTFDLGYLEQDSFVPVRFVLANGAYIGG
FT                   FDFAFNSSSTGPVRTTSYSYTSTCDKSFLPFGKGNGGLDEGTANV"
FT   3'UTR           101169..101431
FT                   /gene="fta5"
FT                   /gene_synonym="sma5"
FT                   /locus_tag="SPAC1F8.06"
FT   3'UTR           complement(101715..101835)
FT                   /locus_tag="SPAC1F8.07c"
FT   CDS_pept        complement(join(101836..101869,101872..103544))
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F8.07c"
FT                   /product="pyruvate decarboxylase (predicted)"
FT                   /EC_number="4.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.07c.1"
FT                   /db_xref="GOA:Q92345"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="PomBase:SPAC1F8.07c"
FT                   /db_xref="PomBase:SPAC1F8.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92345"
FT                   /protein_id="CAB03601.3"
FT                   /translation="MTKDAESTMTVGTYLAQRLVEIGIKNHFVVPGDYNLRLLDFLEYY
FT                   PGLSEIGCCNELNCAFAAEGYARSNGIACAVVTYSVGALTAFDGIGGAYAENLPVILVS
FT                   GSPNTNDLSSGHLLHHTLGTHDFEYQMEIAKKLTCAAVAIKRAEDAPVMIDHAIRQAIL
FT                   QHKPVYIEIPTNMANQPCPVPGPISAVISPEISDKESLEKATDIAAELISKKEKPILLA
FT                   GPKLRAAGAESAFVKLAEALNCAAFIMPAAKGFYSEEHKNYAGVYWGEVSSSETTKAVY
FT                   ESSDLVIGAGVLFNDYSTVGWRAAPNPNILLNSDYTSVSIPGYVFSRVYMAEFLELLAK
FT                   KVSKKPATLEAYNKARPQTVVPKAAEPKAALNRVEVMRQIQGLVDSNTTLYAETGDSWF
FT                   NGLQMKLPAGAKFEVEMQWGHIGWSVPSAMGYAVAAPERRTIVMVGDGSFQLTGQEISQ
FT                   MIRHKLPVLIFLLNNRGYTIEIQIHDGPYNRIQNWDFAAFCESLNGETGKAKGLHAKTG
FT                   EELTSAIKVALQNKEGPTLIECAIDTDDCTQELVDWGKAVAANARPPTADN"
FT   5'UTR           complement(103545..103594)
FT                   /locus_tag="SPAC1F8.07c"
FT   CDS_pept        103941..104303
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F8.08"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F8.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F8.08.1"
FT                   /db_xref="GOA:Q9C113"
FT                   /db_xref="PomBase:SPAC1F8.08"
FT                   /db_xref="PomBase:SPAC1F8.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C113"
FT                   /protein_id="CAC34960.1"
FT                   /translation="MSTSGMLFIFATFCPCFLSCCAFMSHWKLKDFSFRFLRMCGERSL
FT                   VVCYPLKLLKQIRSLFSIAIGHLSLMLIEGSANLLSLEEISRTLLRILDFVGNKNMRTY
FT                   LEVPLCRWHISQARPN"
FT   3'UTR           104304..104953
FT                   /locus_tag="SPAC1F8.08"
FT   repeat_region   106349..106684
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           106893..106964
FT                   /locus_tag="SPAC11D3.19"
FT   CDS_pept        106965..107198
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.19"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.19"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.19.1"
FT                   /db_xref="GOA:G2TRM3"
FT                   /db_xref="PomBase:SPAC11D3.19"
FT                   /db_xref="PomBase:SPAC11D3.19.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRM3"
FT                   /protein_id="CCD31309.1"
FT                   /translation="MVPYTETSICLTNVPCGYMNVSGCFKGADALTILHECDEANVYTA
FT                   TFWSTSSGTRRNSAVICTLIANLMAFFMLLTM"
FT   3'UTR           107199..108361
FT                   /locus_tag="SPAC11D3.19"
FT   3'UTR           complement(108732..108907)
FT                   /locus_tag="SPAC11D3.01c"
FT   CDS_pept        complement(108908..109147)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.01c"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.01c.1"
FT                   /db_xref="GOA:Q10080"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="PomBase:SPAC11D3.01c"
FT                   /db_xref="PomBase:SPAC11D3.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10080"
FT                   /protein_id="CAA92302.1"
FT                   /translation="MPNPGNVIGGHKAALHNPNVSEETKQREKEYLEEHEGEVGEEHQK
FT                   NTGNVRGGYKAAMHNPNVSGEAKQRAQEELENLE"
FT   5'UTR           complement(109148..109195)
FT                   /locus_tag="SPAC11D3.01c"
FT   misc_RNA        109628..112377
FT                   /locus_tag="SPNCRNA.608"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(109829..110281)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.02c"
FT                   /product="ELLA family acetyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.02c.1"
FT                   /db_xref="GOA:Q10081"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PomBase:SPAC11D3.02c"
FT                   /db_xref="PomBase:SPAC11D3.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10081"
FT                   /protein_id="CAA92303.1"
FT                   /translation="MSNLEFVYKYFNSLDVKELYDIYLLRTNVFVVEQKCAYPEVDEID
FT                   LKCGHLMLRNANGKLVAYARLIPEQQQTVRIGRVVVDPDERKNGYGRKLMLQALETSKQ
FT                   EFSSSKTFVLSSQEYAQPLYRSVGFKKCSDAYLEDGIPHVEMRLEL"
FT   5'UTR           complement(110282..110455)
FT                   /locus_tag="SPAC11D3.02c"
FT   3'UTR           complement(110904..111004)
FT                   /locus_tag="SPAC11D3.03c"
FT   CDS_pept        complement(111005..111913)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.03c"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.03c.1"
FT                   /db_xref="GOA:Q10082"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="PomBase:SPAC11D3.03c"
FT                   /db_xref="PomBase:SPAC11D3.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10082"
FT                   /protein_id="CAA92304.1"
FT                   /translation="MTEISELASSSQKPEKTKYNLPKPLPAYYPHPGSPLYADKELYAR
FT                   IANAPKKLVGRHVCQPRTGLAVKIPQKSIFSIVVPEGPQVCDLNIWNFHNPRERFWAAR
FT                   TRQIHSAHVSTYDRLWSTLPYLRPLVTIIGDSLQARHDEWGGRVHDTLGTRCDPYIDKL
FT                   ISGKDNDLHCHSNLTRAIMPYGLTEFDVHDVLNVFQVTGLNEYDQYFMETCPATSKDYF
FT                   QCFAEQDLLVAISACPGGDLSNWGWGEDATDVESSKMVDCCRPLAIEVYELEDEENSLK
FT                   GWVPPQVVNYTGNHGLKAPSS"
FT   5'UTR           complement(join(111914..112046,112098..112333,
FT                   112378..112499))
FT                   /locus_tag="SPAC11D3.03c"
FT   3'UTR           complement(112514..112916)
FT                   /locus_tag="SPAC11D3.04c"
FT   CDS_pept        complement(112917..113309)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.04c"
FT                   /product="SnoaL"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.04c.1"
FT                   /db_xref="GOA:Q10083"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PomBase:SPAC11D3.04c"
FT                   /db_xref="PomBase:SPAC11D3.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10083"
FT                   /protein_id="CAA92305.1"
FT                   /translation="MSQDSESFIRQLFKAFTDFSTDVESLRGFLTPDYRQLVDGRELTL
FT                   DDFISHAKALRTHLHRLDINVQQIVCQGNKAATVHIAHAIRSSGESSRIKVIAFYSFKD
FT                   GRISLIDELTYVLEGGNADRELGSVQ"
FT   5'UTR           complement(join(113310..113367,113435..114445))
FT                   /locus_tag="SPAC11D3.04c"
FT   5'UTR           113950..114079
FT                   /gene="mfs2"
FT                   /locus_tag="SPAC11D3.05"
FT   CDS_pept        114080..115720
FT                   /transl_table=1
FT                   /gene="mfs2"
FT                   /locus_tag="SPAC11D3.05"
FT                   /product="MFS family membrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.05.1"
FT                   /db_xref="GOA:Q10084"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPAC11D3.05"
FT                   /db_xref="PomBase:SPAC11D3.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10084"
FT                   /protein_id="CAA92306.1"
FT                   /translation="MDLLSLITGKKFEKHYSKVGSRFSDESLNGLEKQLSNGADAAIDT
FT                   TADDRGSVVSLGASLPLSQGRPAKSKNILNDTLLAEDQYLVTWDGPDDPLNPRNWSHSY
FT                   KWWIVIQVSVITIVVTFASSVYSSGIIDIASELHSSIPVSTLGSCTFLVGFGVGSLPFA
FT                   PLSDIYGRFIIYFVTLLIFTIFQVGGGCAHNVWTLAIVRFFQGVFGSTPLANAGGTISD
FT                   LFTPVQRTYVLPGFCTFPYLGPIIGPIIGDFITQSYLEWRWTFWINMIWAAAVIVFVFI
FT                   FFPETHEDTILDYKAKYLRKTTGNTAYYTIHERERDPKNAMIQAATQAVSLIFTEPIVV
FT                   CFTLYLTVVYIINYINFEGYPIVFAKYGFNKGEQGLSFIGVGVGIVCAGLCTPFIYWHY
FT                   LKVNKKRNGVICPEDRLYPLFIGCFLLPISMFWFAWTCYPHHIHWIVPIIASAFFGFSL
FT                   LIVFFVSYNYIIDSYQHMAPSALAAATLVRYSASGGISMVARPMYLNLGDHWATSVLGF
FT                   ISVAMVPIPFIFYRFGKSIRAWSKNAYKL"
FT   3'UTR           115721..115962
FT                   /gene="mfs2"
FT                   /locus_tag="SPAC11D3.05"
FT   3'UTR           complement(116054..118194)
FT                   /locus_tag="SPAC11D3.07c"
FT   5'UTR           116331..116692
FT                   /locus_tag="SPAC11D3.06"
FT   CDS_pept        116693..118060
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.06"
FT                   /product="MatE family transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.06.1"
FT                   /db_xref="GOA:Q10085"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="PomBase:SPAC11D3.06"
FT                   /db_xref="PomBase:SPAC11D3.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10085"
FT                   /protein_id="CAA92307.1"
FT                   /translation="MGRPLTEVKYLLINSAPVILGYALQNSLQTSSVIVTGRLGPSELS
FT                   VAAFAYMFAMSTGWLIALGGTTAFDTLGSNLWGAGKKQELGILLQTGFIVLSILYLPIC
FT                   LVWWYSKPILIFLHQTPELAEASQKFLRYLIPGGLGYVCFELLKKFLQTQEITRAGSYI
FT                   LLVTSPLNVALNFLLVHYYGLGLKGAPLATGLSYWLSFILLTQYAKYVKGAEAWNGWNK
FT                   RCLENFGPFVKLSLLGIVMVGTEWWAFEIVALVAGKLGAVPLAAQSVIMTTDQLLNTIP
FT                   FGLGIITSNRVAYYLGAGLPDNASLTAKVAAIVGVAVGSVIMITMIAVRNIYGRIFTND
FT                   PDVIQLVALVMPLVAAFQISDSLNGTMGGALRGTGRQKVGAIVNITAYYLFALPLGIYL
FT                   AFHGKGLVGLWIGQVIALSIVGILELKIVMATDWISQSRKAISRFGDSSELTALLN"
FT   3'UTR           118061..118189
FT                   /locus_tag="SPAC11D3.06"
FT   CDS_pept        complement(118195..120108)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.07c"
FT                   /product="transcription factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.07c.1"
FT                   /db_xref="GOA:Q10086"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPAC11D3.07c"
FT                   /db_xref="PomBase:SPAC11D3.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10086"
FT                   /protein_id="CAA92308.3"
FT                   /translation="MSQNKACDLCRLKKIKCSRGQPRCQTCTLFQADCHYSNRARRKRL
FT                   VQRSKETFGGITLPVFDYAAGINGNEPEPSDHSIPNQENFALTTNGTISKNIEKPEDGE
FT                   ESVQRRLKLLEEKIDLLLDIATETSEFKRENKAIELPSLVTQIKDAESIVIKHRQGSPV
FT                   DNTPTRILNVESLFPPQLPDWEKAFHDIPKKEVAHELVTSYFQHVNWWWPTFVYNDFMY
FT                   EFERLYAFGFHSNNAWLISFYSILALSSIRKRLGNSKTLAESLFSTAWVFVQKSDFFLT
FT                   PSIDKVQALIVMTQYAAYLSSSSLCRTLCGQACLMAQQLNLHRKQSTDVEPEKAESWKR
FT                   IFWMCYILDKNISLIFGTPSVFNDKDIDCNLPDSKYELLFGVQSGGDLIFVPTVSLTII
FT                   QSEIRNRLYSVKSPTQMAAREKIIIPIHQKLKAWEENLPSEIKMYHEMLLNNTFSPTIS
FT                   LSDRFEFLTFAGMEVYFSYLNTLIILHRPSSSTENRRICINAAREAVQLLKNRLNIDLR
FT                   VNVKADPLWIFLYCPFTPFLIIFNNLVHETDTETDSETLLNDLDLLHVIYDFFMEMEPV
FT                   SDVALELVKIADKLLRVAKEVCSAKNNDVTDSTFKDIVEGFELNDLNSWDFDRVTNVMR
FT                   NL"
FT   5'UTR           complement(120109..120309)
FT                   /locus_tag="SPAC11D3.07c"
FT   3'UTR           complement(120321..120555)
FT                   /locus_tag="SPAC11D3.08c"
FT   CDS_pept        complement(120556..122208)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.08c"
FT                   /product="amino acid permease, unknown 1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.08c.1"
FT                   /db_xref="GOA:Q10087"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="PomBase:SPAC11D3.08c"
FT                   /db_xref="PomBase:SPAC11D3.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10087"
FT                   /protein_id="CAA92309.1"
FT                   /translation="MSDIDKESLKQNQKQWENEVELGESREANQDDELLMSLGYKPEFT
FT                   REFSYVSIFGQSFGSMGLCPAMAGSLIFSMNCGGGGMVWSWIIGCICLIPVSISLGELA
FT                   SSMPTSGGLYFWIFTLASPSSRAFLCWVCGYVSVLGYATIYASTVYSASSMVQALAVIG
FT                   SPSYSPTKYEQYGIYAALLFVISAMTAIPSRVIAKVNIINITFQFLVSIILIIALAAGS
FT                   DSTTRNSGSFIFGDFTNYSGWSNMGWAFILSFTTPVWVVSGFESSAAVAEESTNAAKAA
FT                   PFAMISSLGVATILGWCIVITVVATMGHDFNAILGSSLGQPVAQVLVNNVGNKGALGIF
FT                   SLLVIALCLNCISLLIAASREVFAFCRDGGIPGSRYLRLLTKQKVPLNAILLVLLYSLL
FT                   VGLLILVNVTAISSVFNLAIIALYIAYSGPLMCRFVYNKFQPGVFYVGKWSKPAALWSL
FT                   VWMWFMILMLLFPQYQKPNQDEMNWAIVVLGFVMVFCVVYYYLPKIGGKTFFTGPIPTV
FT                   QQENEYISGVPLNELSLSSLPLPKDFDQKQITE"
FT   5'UTR           122187..122844
FT                   /locus_tag="SPAC11D3.09"
FT   5'UTR           complement(122209..123785)
FT                   /locus_tag="SPAC11D3.08c"
FT   CDS_pept        122845..124029
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.09"
FT                   /product="agmatinase (predicted)"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.09.1"
FT                   /db_xref="GOA:Q10088"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="PomBase:SPAC11D3.09"
FT                   /db_xref="PomBase:SPAC11D3.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10088"
FT                   /protein_id="CAA92310.1"
FT                   /translation="MALQSLFLILLAGAAQLAQAHPKIFEQSRANAVETFDDAFPGDGE
FT                   TQADSVFSGIATFGRLPYWKCLNDKSQSFDIAFLGAPFDTGTSYRPGARFGPSGIREGS
FT                   RRLNLYGGYNVPMETNPFNNWAKIVDCGDIPLTSYDNAVAIKQIENGHFELLTRKPTSY
FT                   SEKDGYALDGSVLPRVITLGGDHTIVLPILRSVSRAYGPVSIIHFDSHLDSWKPKVFGG
FT                   GKSSVGSINHGTYFYHASQEGLVSNDSNIHAGIRTTLSGLSDYDNDADCGFEIIEAREI
FT                   DTIGIDAIIKRIRDRVGDGIAYLSIDIDVLDPAYAPATGTPESAGWTTRELRTILRGLD
FT                   GIKLVGADIVEVAPAYDFAEVTTLAAADILFEVMSIMVKTPVYKEQAKQQSRFY"
FT   3'UTR           124030..124116
FT                   /locus_tag="SPAC11D3.09"
FT   5'UTR           124907..125581
FT                   /locus_tag="SPAC11D3.10"
FT   CDS_pept        125582..126886
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.10"
FT                   /product="nifs homolog, possible cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.10.1"
FT                   /db_xref="GOA:Q10089"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PomBase:SPAC11D3.10"
FT                   /db_xref="PomBase:SPAC11D3.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10089"
FT                   /protein_id="CAA92311.1"
FT                   /translation="MNALAKIKAFRSYVPLLQGNTKTIYLNQSFQAPMNMLVSTALQGY
FT                   INEGLYNPHPKPMWKERTEETRSLLAKLLNASTKDSITFTRDTTEGLNLFQRSLKWKPG
FT                   DNVVILDNEHPNQGFGWIALQNDGLEVRLVPNEGQYHANASTFAPYVDSRTKAIGLSSV
FT                   MFHSGQKNDVKDIANAFRPKGIHVLADLTQQVGLSKIDVQDLNVSACAFSCHKGLGCPT
FT                   GLGVLYVSPLAISELRSTPPFVGGGAVEDFKEDLKLKLNAKYHQSALRYEHTNNAYMLI
FT                   TALRAYLKFLLKVGISNVERYLQGLGKDLIKELESLNVSVIGYKDFDKHSSHSYVLKIL
FT                   NPEWFDFLRQQGVCVSRFESGIRVSFGLYNTSKDIIKFISVIRKGLALNIPLNIRPPQR
FT                   IAVMDNPLVGISDEAIAAMKLPANTLSNRPLAANI"
FT   3'UTR           126887..129053
FT                   /locus_tag="SPAC11D3.10"
FT   3'UTR           complement(126951..128024)
FT                   /locus_tag="SPAC11D3.11c"
FT   CDS_pept        complement(join(128025..129059,129103..129127,
FT                   129172..129185))
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.11c"
FT                   /product="zinc finger protein, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.11c.1"
FT                   /db_xref="GOA:G2TRN9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPAC11D3.11c"
FT                   /db_xref="PomBase:SPAC11D3.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRN9"
FT                   /protein_id="CAO77635.2"
FT                   /translation="MRSLSCIVCRQKKIKCDRKNPCTNCEQAGEKCMFKEYDSRKIRHP
FT                   HSYVKALETRLAGLEAFWKRVKYAPVNEKLELLKTISFNDHLSPDISVSKTDTTFEFPV
FT                   SLDIRGPNTIAFYGPTNVYGPPLTPSSPETPSFPPQNPSFSPLITDCLKLFFKWQYPQF
FT                   LFINREAFLVDYYYRYHEGRYCSEHLLYAMCAIGSRMSVDPNIAALAKNFYQIAWNKII
FT                   EYGLGKSHITSIQCLLCLGYFNIGMGNTSLGWMLSGMAFRMGQDLGFQLNPRNWSVNDH
FT                   PVVSPADAAVRSRIYWGSYVTDIFISFVLGRPTTLKKSDTSIPDSESLPDFDGVNEYRV
FT                   NNALLLKEYLCIQSSVY"
FT   5'UTR           complement(129186..129316)
FT                   /locus_tag="SPAC11D3.11c"
FT   5'UTR           130148..130328
FT                   /locus_tag="SPAC11D3.13"
FT   CDS_pept        130329..130997
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.13"
FT                   /product="ThiJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.13.1"
FT                   /db_xref="GOA:Q10092"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PomBase:SPAC11D3.13"
FT                   /db_xref="PomBase:SPAC11D3.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10092"
FT                   /protein_id="CAA92314.1"
FT                   /translation="MVLFMKTVQRPEHISLKSCIPFKSLQRQGIVFRLSVRMVMLADDH
FT                   SISDSALSDSDKNAFKDKNNDFWKAIKNAKNASDINFSDYSIFFAAGGHGTLFDFPSAT
FT                   NLHKGAAKIYSMGGVIAAVCHGPVILPCIKDSTGFSIVKGKTVTAFNEIAEQQMNLMPT
FT                   FEKYHFKTLNKLFQEAGSNFVDPQEPFDDFVKTDGKLVTGANPASAASTAKAALNSLNS
FT                   "
FT   3'UTR           130998..131268
FT                   /locus_tag="SPAC11D3.13"
FT   3'UTR           complement(131190..131318)
FT                   /locus_tag="SPAC11D3.14c"
FT   misc_RNA        131203..135541
FT                   /locus_tag="SPNCRNA.609"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   CDS_pept        complement(131319..135101)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.14c"
FT                   /product="oxoprolinase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.14c.1"
FT                   /db_xref="GOA:Q10093"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="PomBase:SPAC11D3.14c"
FT                   /db_xref="PomBase:SPAC11D3.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10093"
FT                   /protein_id="CAA92315.1"
FT                   /translation="MKQDVRIAIDRGGTFTDVYYKISGWREQEGIFKLLSVNPKLYDDA
FT                   PTEGIRRVLCYASGEEIPRKVPLDLTRVSSIRMGTTVATNALLERKGEKTAFIITEGFR
FT                   NLVEIGNQARPDLFDLTVSRPSPLYQRVIEAKERVVLENQFSKTAGIVQGITGEFLRVE
FT                   KKLDEEALYQDLKELYNEGFRSISVSLMHSYTYPLHEEVVEKIAKRIGFTDISLSSKLT
FT                   PMVKIVPRAVSAIIDAYLSSTLRYYLDSFKKNFYNVKPNTIQFMKSDGGLVDIDNFTAI
FT                   SAIMSGPAAGTVGFAKTSSLHADDKTPAIGFDMGGTSTDVSRYDGKFEHIYEANIFGLY
FT                   IQSPQLDIQTVAAGGGSRLFWRNQLFSVGPESAGAFPGPACYLNGGPLTVTDANVLLGR
FT                   IIPDFFPKIFGPKENESMNKDIVIEKFSELRDIINIDIEKEKTIEEIAMGFIQVANETM
FT                   CRPIRKLTESRGLDLSAHHLAVFGGAGGQHACAIASLLNIEKIIIHKYSSVLSAYGLAL
FT                   AHVTHEEQMPCLSVLDEDNLPLIQSKFDVLDKKAVSFLENEGYLESQISTELFANLRYE
FT                   GNDTTMMIAKPKDSWDFKTLFEESYKNQFGFSLIDRKIMVEDIRIRAIARASNQSEVDT
FT                   VFASETENENTVFIRDNKPTMYTPVYFAEVGKVNCHVYQLSSLPVHSLITGPAVIVDTT
FT                   QTLLIEPSFTAKIFARHVLLEKTKSTLVVKKNVDLDPITMTIFANRFMSISEQMGQVLQ
FT                   KTAVSVNVKERLDYSCALFSPDGGLVANAPHVPAMLGSMQTAVKWQHNYWKGKLVPGDV
FT                   LLSNHPIAGGVHLPDLTVVTPVFDNNKDIIFYCAARGHMVDVGGITPGSMPSNSKAIYE
FT                   EGAAIKTFKVVKAGTFDEKGLTQLLFDEPAKYPDCSGSRTLRDNISDVKAMLSACHRGR
FT                   SMVEKLVVEYGLDIVQRSMYGIQAAAEKAVRDVLKAFSVQNSQKPLKAIDYMDDGTPLQ
FT                   LEVKIDPETGDAVFDFEGTGPEVYGNWNAPIAITYSSVIYCLRSIINQDIPLNEGCLKP
FT                   IEIRIPPSCFLNPSETAAVVGGNVLTSQRITDVILKAFSICAASQGCMNNLTFGYDGEN
FT                   GEEGFAMYETIAGGAGAGPTWNGTSGVHTHMTNTRITDPEVVERRAPVILRRFCLRENS
FT                   GGKGEYHGGDGVIRHFEFRRSMHCSILSERRSRAPYGMNGGEDGAMGVNTWIDCSNPDF
FT                   PRYVNLGGKNHVLMGKGDHIVIETPGGGGYGAVSI"
FT   5'UTR           complement(135102..135736)
FT                   /locus_tag="SPAC11D3.14c"
FT   misc_RNA        135569..135926
FT                   /gene_synonym="SPNG30"
FT                   /locus_tag="SPNCRNA.147"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           136139..136330
FT                   /locus_tag="SPAC11D3.15"
FT   misc_RNA        complement(136274..137355)
FT                   /locus_tag="SPNCRNA.610"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        136331..140284
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.15"
FT                   /product="5-oxoprolinase (ATP-hydrolizing) (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.15.1"
FT                   /db_xref="GOA:Q10094"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="PomBase:SPAC11D3.15"
FT                   /db_xref="PomBase:SPAC11D3.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10094"
FT                   /protein_id="CAA92316.1"
FT                   /translation="MSVKIHIDRGGTFTDAIATFADESRPPIVIKLLSEDPSNYKDASI
FT                   EAVRRILEIVQGKSIPRTEKLDTSCINHLRCGTTVATNALLERKGERCAFITTKGFKDG
FT                   LLIGNQSRPNIFELGIRRPEVLYSKVIEVDERVTLEDYVEDPMKVKTTIDGSDPSLVVG
FT                   RSGEVVRIMKKVDCDALRKDLQALYDEGFTSIAVCLAHSFTFPDHELLVGKIAEEVGFS
FT                   NISLSTKLMPMIKYVPRATSATADAYLSPVVRRYLAGFQSGFLHGLKTKDNSKGVRCEF
FT                   MQSDGGLVDVNKFSGLHAILSGPAGGVVGFALTSYDEDVKIPVIGFDMGGTSTDVSRYG
FT                   GSYEHVFETTTAGVTIQSPQLDINTVAAGGGSRLFWKNGLFVVGPESAGAHPGPVCYRK
FT                   GGYLTVTDANLLLGRLLPESFPKIFGPNEDESLDVESTRKEFEKLTAEINSGLEKERQM
FT                   TADEVAFGFIKIANETMARPIRALTEAKGHDISIHRLTSFGGAGGQHCAAIAKSLGITQ
FT                   VLVHKYSSILSAYGMALADVVSEVQEPSSFTLDDSNTESIKKRFDSLKEEAKANLEEQG
FT                   FTESQISYELFLNCRYQGTDSTLMISKPLESWDFKQSFFDKHKQEFGFIFENKDIIIDD
FT                   IRIRASGKSFQSKEPSVDAQLKELKFEPVQKSLATCVKDIYFEGGRVPSEVYSLDNLPV
FT                   GTIVNGPSLIVDKTQTIVVPPKAVARILHTHVVIDISHGNEYTANDSLAKASTIDPIYL
FT                   SVFGSRFMAVAEQMGRALQKTSVSTNVKERLDYSCALFDAKGNLVANAPHMPVHLGSMS
FT                   TCVRTQAKIHEGKLKPGDVLVTNHPSYGGTHLPDITTITPHFEGDEIMFYVAARAHHAD
FT                   IGGILPGSMPSSSKELSEEGATIKSEKLVVDGVFQEERMIDLLYNEPAKVEGGSGSRCL
FT                   RDNLNDLKAQVSANQKGINLITSLIKEYGKNSVLRYMKAIQENAESAVRQLLLGVRERF
FT                   LGEDLYAEDHMDDGSKICLRITIDEENGDAIFDFTGTTEEIYGNINAPEAVTYSAIIYC
FT                   LRVLISENIPLNQGCLLPIKVIIPDNCFLKPSETAAVVGGNVLTSQRITDTILKAFQAC
FT                   AASQGDTNNLTFGIGGKDPETGEVKPGFGYYETICGGSGAIDGLDGTSGVHTHMTNTRI
FT                   TDLEVLERRYPVILRKFIIRENSGGAGKYKGGDGVIRDIEFRIPVTLSILSERRAYHPY
FT                   GMKGGKDAECGKNIWIRKDILPSGEQRVRQINVGGKNTCHMQAGDHIVIMTPGGGGYGP
FT                   PSERVDTVKKANGVQHFRANGTISQLQEIQHTN"
FT   3'UTR           140285..140365
FT                   /locus_tag="SPAC11D3.15"
FT   3'UTR           complement(140381..140804)
FT                   /locus_tag="SPAC11D3.16c"
FT   CDS_pept        complement(140805..141200)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.16c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.16c.1"
FT                   /db_xref="GOA:Q10095"
FT                   /db_xref="PomBase:SPAC11D3.16c"
FT                   /db_xref="PomBase:SPAC11D3.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10095"
FT                   /protein_id="CAA92317.1"
FT                   /translation="MTTLKVDEDLECALMEQFIEALHQRCTDIPRTQLCVLAISFNRFI
FT                   LHKSPDIFTYIQYYQQKLNSYGFPLPPVVLKSLQMPLTSPEPDADERFRDGDTEFDTAG
FT                   VTASSCFPVDVKSPSVRAFGNVTFQSD"
FT   5'UTR           join(141199..141510,141559..142674)
FT                   /locus_tag="SPAC11D3.17"
FT   5'UTR           complement(141201..141653)
FT                   /locus_tag="SPAC11D3.16c"
FT   CDS_pept        142675..144432
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.17"
FT                   /product="zf-C2H2 type zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.17"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.17.1"
FT                   /db_xref="GOA:Q10096"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PomBase:SPAC11D3.17"
FT                   /db_xref="PomBase:SPAC11D3.17.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10096"
FT                   /protein_id="CAA92318.1"
FT                   /translation="MVDHVSENSTNVLSAKRKLTEPSLIDSKRVFPCDQCAKRFTRHEN
FT                   LTRHKACHSKAEPIPCPYCEIKCKRKDLLKRHIQRFHNDKSVIEEGSKDVLDVKAAASQ
FT                   QEDNMKIVLPSFDAIDVPKAYHPSLRPYFTILPLIPSDFLEHYIEGYFEWFHPVFPFIH
FT                   QASFNSENVAASFLRSLVVIACLCTGIESDFSMALLFWDSGFHVLQLYLQGDPERVKKA
FT                   WVFQSRLLFCTASLFEKTACFSGIGHVLLKDLVHESRTFGWTKLNWSVEGDTDISNLID
FT                   LECIRRSVFCLYILEWFLALIFNKPPSLSVLELQMPLPISSALWSSKELLSKDYWRPNP
FT                   LNPRDALSILVNGPLLLEETNISGFVLLFAIFEFIRDEAKLSMIGLPRQPNRSYEIMLQ
FT                   HLKVSMELSNPCAKTSSIFLCLWHLVLTYYYLPDPLFLRSITLTDLESATSYFKDDSWM
FT                   DDDYISPCMTTYNLTMGWENVIWGLRYAETELTKFKFDLPVPHLTLFRIFLQGLYALRD
FT                   FDQISTSSLQTFTMLWKKLSTSLNMKEDAQNTAPSTCVKEFSAFVASALDVEGGWGIGP
FT                   LLTKAFRPT"
FT   3'UTR           144433..144768
FT                   /locus_tag="SPAC11D3.17"
FT   misc_RNA        144733..146501
FT                   /locus_tag="SPNCRNA.611"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   3'UTR           complement(144819..144861)
FT                   /locus_tag="SPAC11D3.18c"
FT   CDS_pept        complement(144862..146358)
FT                   /transl_table=1
FT                   /locus_tag="SPAC11D3.18c"
FT                   /product="nicotinic acid plasma membrane transporter
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC11D3.18c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC11D3.18c.1"
FT                   /db_xref="GOA:Q10097"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPAC11D3.18c"
FT                   /db_xref="PomBase:SPAC11D3.18c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10097"
FT                   /protein_id="CAA92319.1"
FT                   /translation="MSDQSEYKISKDDEHSIYASEINKEKLQNTASPDVDYGDTASLKI
FT                   DPKVEKKLLLKMDLVISPIIGFLYLMAFLDRSNIGNAAVAGMTEALSLYGERLNVAVSI
FT                   FYVLYILVETPSVVLVKRIKASRMLAFISFAWSMTVLFSGFMSSYGGLIATRLILGLLE
FT                   GCLFPALNLYLTTHYTRKEQCQRLSYLFASAGLAGAFGGLFAYALEQVHAGNKEGWQWI
FT                   YIVEGLVSFIGVPLCLFALPDKMENAWFLTREEREVAIIRRDINARYHGEQHFEWSEVR
FT                   KAFKDPKVYVSATSQFCADMVLYGFSSFLPVIIKGLGFVGLQTNYMTIPVYIAGVISFL
FT                   FVAWLSDRTQLRAVYLISASTVVAVGYIIMLASDSNAAKYTATYIIAIGCYIGPGLNLG
FT                   WLNNNVAGHYKRATAIGIQQTLANSSGIVAGQIYRSKNAPKYILGNAFTLGCVIVGGLA
FT                   YVVMFFSLRYVNKKRDERCARGEFDPSAIGDFADDFRYYL"
FT   5'UTR           complement(join(146359..146869,146912..146935))
FT                   /locus_tag="SPAC11D3.18c"
FT   misc_RNA        complement(146871..148041)
FT                   /locus_tag="SPNCRNA.612"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   CDS_pept        146974..147879
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.01"
FT                   /product="DUF1445 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.01.1"
FT                   /db_xref="GOA:Q09674"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="PomBase:SPAC5H10.01"
FT                   /db_xref="PomBase:SPAC5H10.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09674"
FT                   /protein_id="CAA89951.1"
FT                   /translation="MTTTSIDPPVYATVDVIREPKAYDGMPKKDECRLPSYSERAITKP
FT                   VEARKLIRNRLMTKSTTGWCEGYIQANLLVLPAKYRDDFVNLCVRNPVPCPLLGETEIG
FT                   KPTEFKPEALAKQSNVATDIPFYCEYINGKFSRELENISKEWTEDYVGFLIGCSFSFEA
FT                   ALVAENFIPRHLPTGDAPPMFITNIPLCASGVFTGTFVVSMRPYPEKDLERIRKITSAY
FT                   TNCHGEPVAWGWDGAKKIGVKDCGKPDFGVPVEFKEGEIPIFWGCGVTPQNVVMMSKLP
FT                   EPVYSHKPGYMYLTDLTHNC"
FT   3'UTR           147880..148055
FT                   /locus_tag="SPAC5H10.01"
FT   3'UTR           complement(148038..148212)
FT                   /locus_tag="SPAC5H10.02c"
FT   CDS_pept        complement(148213..148935)
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.02c"
FT                   /product="ThiJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.02c.1"
FT                   /db_xref="GOA:Q09675"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PomBase:SPAC5H10.02c"
FT                   /db_xref="PomBase:SPAC5H10.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09675"
FT                   /protein_id="CAA89952.1"
FT                   /translation="MSIAKGKNALLVASSYYGPFYPDGKNTGVHFSELLIPYNVFKKAG
FT                   FNVQFVSENGSYKFDDHSIEESKLGDFERKVFNDKNDDFWTNLNNMKKASDIVGKDYQL
FT                   LFVAGGHAAMFDLPKATNLQAVAREVFTNGGVLSAVCHGPVLLANVKNPQSVEGKTVVY
FT                   HKHVTAFNKAGEEKMGVMDELKKRGMKSLNEIFAEAGATFIDPPNPNVNFTQIDGKIVT
FT                   GVNPQSAKSTAEAAVSAL"
FT   misc_RNA        148362..149005
FT                   /locus_tag="SPNCRNA.613"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(148936..150331)
FT                   /locus_tag="SPAC5H10.02c"
FT   5'UTR           149446..151912
FT                   /locus_tag="SPAC5H10.03"
FT   rRNA            149658..149776
FT                   /locus_tag="SPRRNA.10"
FT                   /product="5S rRNA"
FT   CDS_pept        151913..152572
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.03"
FT                   /product="phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.03.1"
FT                   /db_xref="GOA:Q09676"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PomBase:SPAC5H10.03"
FT                   /db_xref="PomBase:SPAC5H10.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09676"
FT                   /protein_id="CAA89953.1"
FT                   /translation="MTNNLKKTVYLIRHGQAQHNVGPDEDHNIRDPVLTSEGIEQCEAL
FT                   AKELESKQIPIDGIVCSPMRRTLQTMEIALKKYLAEGGPDKVPVYISPFFQEVGHLPCD
FT                   IGLELDKLNKLYPKYNFQSCQDGIYPEKRDIYASDVTISAIRSKEALEYLAALPQQQIA
FT                   VITHSAFIRFLLKKMVKAADIDFLPPQLSFKNCEFRIYDLVQTTTGELKLVESSSA"
FT   3'UTR           152573..152909
FT                   /locus_tag="SPAC5H10.03"
FT   5'UTR           152851..153386
FT                   /locus_tag="SPAC5H10.04"
FT   3'UTR           complement(153070..154806)
FT                   /locus_tag="SPAC5H10.05c"
FT   CDS_pept        153387..154535
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.04"
FT                   /product="NADPH dehydrogenase (predicted)"
FT                   /EC_number="1.6.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.04.1"
FT                   /db_xref="GOA:Q09670"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PomBase:SPAC5H10.04"
FT                   /db_xref="PomBase:SPAC5H10.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09670"
FT                   /protein_id="CAA89954.1"
FT                   /translation="MNDRGELFKPIKVGNMLLQHRIVHAPMTRLRATDYGKITGLMVEY
FT                   YSQRSMIPGTLLIADATFVGEKSGGFPNNPRCFTKEQAESWIPLVEAVHKNKSFLFIQF
FT                   WPLPGDLKDEYRNDLEKMQKITYSDCPQDPGGLPAGIHSFDAVQGVEVYKKKYMSKRDI
FT                   QEHIQDFVNAADLAVNIAKADGVEIHQVNGFLLDRFVLGGFGDQCDPEYRGSIENRCRF
FT                   PLEVLEAVTRKIGQERVGYRISPFSGWMQKIDFMEVNIYLMSEIAKRFPKLAYIHAIEP
FT                   RKYWSGHKLVSSEQNTSFLQKYWKGPFITAGGYDPETAVQAANERGVLVAFGRNFIANP
FT                   DLVFRIKHHIPLNKWDRSSFYLPKTEKGYTDYPFSKEFLQSK"
FT   3'UTR           154536..155515
FT                   /locus_tag="SPAC5H10.04"
FT   CDS_pept        complement(154807..155397)
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.05c"
FT                   /product="FAD binding oxidoreductase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.05c.1"
FT                   /db_xref="GOA:Q09677"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="PomBase:SPAC5H10.05c"
FT                   /db_xref="PomBase:SPAC5H10.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09677"
FT                   /protein_id="CAA89955.1"
FT                   /translation="MKILLINGAQEFAHSQGKFNKTLHNVAKDTLIQLGHTVQETVVDE
FT                   GYDENTEVEKILWANVIIYQWPGWWMGTPWKLKRYMDEVFTAGYGQLYANDGRSSKNPT
FT                   QNYGKGGLLHEHRYMISCTWNAPAAAFEEVGNFFDGRGVDGTLLTFHKANQFLGMKPLP
FT                   TFMVNDVIKNPKVDIAVCAYKDHLNDVFGSANA"
FT   5'UTR           complement(155398..155583)
FT                   /locus_tag="SPAC5H10.05c"
FT   3'UTR           complement(156430..156547)
FT                   /gene="adh4"
FT                   /locus_tag="SPAC5H10.06c"
FT   CDS_pept        complement(156548..157816)
FT                   /transl_table=1
FT                   /gene="adh4"
FT                   /locus_tag="SPAC5H10.06c"
FT                   /product="alcohol dehydrogenase Adh4"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="GOA:Q09669"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09669"
FT                   /protein_id="CAA89956.1"
FT                   /translation="MSILRSPFRLIRSPARFFPSLFHSSCNQSFTNGLKHQSTSSKAMP
FT                   VSAFYIPSFNLFGKGCLAEAAKQIKMSGFKNTLIVTDPGIIKVGLYDKVKALLEEQSIT
FT                   VHLYDGVQPNPTVGNVNQGLEIVKKENCDSMVSIGGGSAHDCAKGIALLATNGGKIADY
FT                   EGVDKSSKPQLPLIAINTTAGTASEMTRFAIITEETRHIKMAIIDKHTMPILSVNDPET
FT                   MYGLPPSLTAATGMDALTHAVEAYVSTAANPITDACAVKCIELVNKYLKRAVDNGKDEE
FT                   ARDNMAYAEFLGGMAFNNASLGYVHAMAHQLGGFYGIPHGVCNAVLLAHVQKFNSRDPR
FT                   ANARLGDIAFHLGCEEHTAEAALDRISQLVLEVKIRPHLVDLGVKEKDFDVLVDHAMKD
FT                   ACGATNPIQPTHDEVKAIFKSAM"
FT   5'UTR           complement(157817..158279)
FT                   /gene="adh4"
FT                   /locus_tag="SPAC5H10.06c"
FT   5'UTR           158777..159202
FT                   /locus_tag="SPAC5H10.07"
FT   CDS_pept        159203..159472
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.07"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.07.1"
FT                   /db_xref="GOA:Q09678"
FT                   /db_xref="PomBase:SPAC5H10.07"
FT                   /db_xref="PomBase:SPAC5H10.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09678"
FT                   /protein_id="CAA89957.1"
FT                   /translation="MTVLTSYKLYCGPDFPAPLEKKEKREKGKIRNISFLIVLTKGPIW
FT                   KVSSMESTSYNGCIENLDCKFRKSFIEEIIAYEGFGKYIEVINF"
FT   3'UTR           complement(159880..160093)
FT                   /gene="pan6"
FT                   /locus_tag="SPAC5H10.08c"
FT   CDS_pept        complement(160094..160945)
FT                   /transl_table=1
FT                   /gene="pan6"
FT                   /locus_tag="SPAC5H10.08c"
FT                   /product="pantoate-beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.08c.1"
FT                   /db_xref="GOA:Q09673"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="PomBase:SPAC5H10.08c"
FT                   /db_xref="PomBase:SPAC5H10.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09673"
FT                   /protein_id="CAA89958.1"
FT                   /translation="MQVLKEKLLIHQQVDNWRKDGNRIAFVPTMGNLHEGHFSLVREAK
FT                   RHAEKVVVSIFVNPMQFNNPQDLLLYPRTMDQDCSQLQNLGVDLVYAPTVEELYPEGSQ
FT                   DITFVDVPKLSTMLEGASRPGHFRGVTTVVSKLFHIVNPDVACFGEKDFQQVAIIKKMV
FT                   RDLNFFIEIIQVPIVRADDGLALSSRNGYLTSEERKIAPNLYKILKKLAQELSNGNGDL
FT                   EKLIAETNTELSRCRFIPDQLEICDSTTLEPFTAGTKNVVILAAAWLGKARLIDNIQTT
FT                   IN"
FT   CDS_pept        complement(160977..161780)
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.09c"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase
FT                   (predicted)"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.09c.1"
FT                   /db_xref="GOA:Q09672"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="PomBase:SPAC5H10.09c"
FT                   /db_xref="PomBase:SPAC5H10.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09672"
FT                   /protein_id="CAA89959.1"
FT                   /translation="MSLKQITISTLRQWKLANKKFACITAYDASFSRLFAEQGMPVMLV
FT                   GDSLGMTAQGHSTTLPVSVEDIAYHTKSVRRGAPNRLLMADLPFMSYSTWEDACKNAAT
FT                   VMRAGANIVKIEGGGNWIFEIVQRLTERSVPVAGHLGLTPQSVNIFGGYKIQGREQSAA
FT                   ARLIENAQQLEKFGAQLLVLECIPESLAEQITKTISIPTIGIGAGKHTDGQILVMHDAL
FT                   GITGGRPPKFAKNFLSGAGDIRTAIQRYIYEVEQGLYPAEEHSFQ"
FT   misc_RNA        161072..162819
FT                   /locus_tag="SPNCRNA.614"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           complement(161781..161822)
FT                   /locus_tag="SPAC5H10.09c"
FT   misc_RNA        complement(162257..164455)
FT                   /locus_tag="SPNCRNA.615"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           162756..162959
FT                   /locus_tag="SPAC5H10.10"
FT   CDS_pept        162960..164138
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.10"
FT                   /product="NADPH dehydrogenase (predicted)"
FT                   /EC_number="1.6.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.10.1"
FT                   /db_xref="GOA:Q09671"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PomBase:SPAC5H10.10"
FT                   /db_xref="PomBase:SPAC5H10.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09671"
FT                   /protein_id="CAA89960.1"
FT                   /translation="MAVQKLYESQSKLFQPIKVGNMQLQHRMVHAPATRLRCLDNGLVM
FT                   TDLVKEYYKQRSSIPGTLLITESLFSGAKSGGFSNIPCLYNDEHVEAWKPIVQAIHDND
FT                   CFVFIQFWNLPGELKVDYLEDQERLEKVTQGECPMDPTGLPAALGSAYSICGEELYVDK
FT                   FMTKQDIQEHITTYTEAAKRAVFGCGADGVEVHQVNGFLLDKFVLNGYGDKCDPEYCGS
FT                   LENRARFCLELLESVVNAIGQERVGYRISPFSDIWKDKDSFEAHVFMIKKIKERFPNLA
FT                   YLHAIEPRQYWNGHVHITQEKNTLIYKNLWGDPFITAGGHDRDSAIQMAEQENTLVAFG
FT                   RYFLSNPDLPFRLKYNLPLNKWDRATFYTKMSPKGYIDYPFSKEFLDTKKVE"
FT   3'UTR           164139..164635
FT                   /locus_tag="SPAC5H10.10"
FT   5'UTR           164570..164727
FT                   /gene="gmh1"
FT                   /locus_tag="SPAC5H10.11"
FT   CDS_pept        164728..165717
FT                   /transl_table=1
FT                   /gene="gmh1"
FT                   /locus_tag="SPAC5H10.11"
FT                   /product="alpha-1,2-galactosyltransferase Gmh1 (predicted)"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.11.1"
FT                   /db_xref="GOA:Q09679"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="PomBase:SPAC5H10.11"
FT                   /db_xref="PomBase:SPAC5H10.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09679"
FT                   /protein_id="CAA89961.1"
FT                   /translation="MLSFFTKNTLTKRKLIMLALAIVFTFFAFGLYFIPHDEISVFDFK
FT                   LPALQYETTVTSLDNFLIGGSTTLYTATVNHEDLNEPKSHEIVMLLASDGNVGSFESNL
FT                   LDDCFKNRIEYAKLQNYNFEFVNVSSLVVPPVWGKMPAILQTMRKYPSAKWIWWLDQDA
FT                   LIMNKNLSLQELFLSPAMLQKSLLREQPIINSFGEDNFRITPAAYSKEMIEQIQFLISQ
FT                   DHNGLNAGSFLVRNSRSIALLMDLLTDPSLADAGVVRHEQDLIGYFIQKHSQVASMVGI
FT                   LPQRFINAFHEGPPTMQWQEGDLALHFAGCWVENKCAELWTKYKDKII"
FT   3'UTR           165718..166335
FT                   /gene="gmh1"
FT                   /locus_tag="SPAC5H10.11"
FT   3'UTR           complement(165814..166419)
FT                   /locus_tag="SPAC5H10.12c"
FT   CDS_pept        complement(166420..167535)
FT                   /transl_table=1
FT                   /locus_tag="SPAC5H10.12c"
FT                   /product="acetylglucosaminyltransferase (predicted)"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.12c.1"
FT                   /db_xref="GOA:Q09680"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="PomBase:SPAC5H10.12c"
FT                   /db_xref="PomBase:SPAC5H10.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09680"
FT                   /protein_id="CAA89962.1"
FT                   /translation="MSRISLSNFLSLPRYKFLLFSVVLIIVMTTLVFNGHDYKQTLNDR
FT                   LTSLKNNFVEENDNAVLKEEPGKYTYMSLFTMPSTEEDYYFNATRVLIHRLKYHPTTKS
FT                   KYPIHILALRGVDEWKIERFRKDGASVIVIDPIASSDIVYDTSSFSQEISARYEQMFSK
FT                   LRIFEQIQFDKICVIDSDILIMKNIDDIFDTPYMYQQINTLNYTRLPSYTKPDDDTVYH
FT                   FNEDFKEYGASRSEFYPYLLAAVSDRGEHHSIPPEDTPYFNAGLMLIRPSELHFNRILK
FT                   IGRFPYMYENAKMMEQSLLNLAFSLDGWFPWTRLDPYYNGVWPSIDERPLLKTAHGKFW
FT                   NIGSSEFAPVYLADWYAAYGEMLSFHKYETH"
FT   misc_RNA        166583..167280
FT                   /locus_tag="SPNCRNA.616"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(167536..167826)
FT                   /locus_tag="SPAC5H10.12c"
FT   3'UTR           complement(167766..168809)
FT                   /gene="gmh2"
FT                   /locus_tag="SPAC5H10.13c"
FT   CDS_pept        complement(168810..169850)
FT                   /transl_table=1
FT                   /gene="gmh2"
FT                   /locus_tag="SPAC5H10.13c"
FT                   /product="alpha-1,2-galactosyltransferase Gmh2 (predicted)"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC5H10.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC5H10.13c.1"
FT                   /db_xref="GOA:Q09681"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="PomBase:SPAC5H10.13c"
FT                   /db_xref="PomBase:SPAC5H10.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09681"
FT                   /protein_id="CAA89963.1"
FT                   /translation="MALMLSRIPRRFFFLFLTVGLIAGAFLYSLIYFVDVDLVSKVNQL
FT                   YDQQIAPMLSDAIGTPSVNHSFELAPLDSHLVATSTTFHEASYESEPQQNPASQNIVLL
FT                   LVSDGHTSYNNGANTFEEAIQNRVDYSTKQNYNFEYVNVTGLPIPAVWSKMPAVLQTMK
FT                   KYPKAEWIWLLDQDAIITNTHLSLQDSFLKPENLQKTLITNTILTKRPINANGDLRYTP
FT                   SNYSLKDIENLMVIISQDHNGLNAGSILFRNSPATALFLDIWTDPVVAECAKANNEQDM
FT                   LGYLISKHSQLASLVGLIPQRKINAFHEGPENMEWQKGDLVIHFAGCWVENRCDELWQK
FT                   FYALID"
FT   5'UTR           complement(169851..170137)
FT                   /gene="gmh2"
FT                   /locus_tag="SPAC5H10.13c"
FT   misc_RNA        170237..174473
FT                   /locus_tag="SPNCRNA.617"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(170489..170971)
FT                   /gene="rad8"
FT                   /gene_synonym="SPAC5H10.14c"
FT                   /locus_tag="SPAC13G6.01c"
FT   CDS_pept        complement(170972..174373)
FT                   /transl_table=1
FT                   /gene="rad8"
FT                   /gene_synonym="SPAC5H10.14c"
FT                   /locus_tag="SPAC13G6.01c"
FT                   /product="ubiquitin-protein ligase E3 Rad8"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.01c.1"
FT                   /db_xref="GOA:P36607"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="PomBase:SPAC13G6.01c"
FT                   /db_xref="PomBase:SPAC13G6.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36607"
FT                   /protein_id="CAA89964.2"
FT                   /translation="MKRKVQKIIDEAPLEENSPPRFFDSDVEADSKPNDLTAANSIVDL
FT                   KTNSQHENANAAGKEYGDSGVSESWVLDFLSVTGEKTISEFLAQKIWKTSNGDLNVAVD
FT                   MYFDESFNIKNSNPDSESQKDTDASLTQMDQLSNTVSVKDLSINRNTNKKALNAVSPSL
FT                   NLSSNSSVQDVSIDKEEMMKKQSRNALTPLDFIMKKNELMKYIGCFGVEAYSTASGTRT
FT                   LQAGERIYLERQKLSIKSQSRNSRKKSKLLSINSSCYSNIVRFCNSDHHEIGKLPTEVA
FT                   SVISTLMEQGFWSFEAICIYSDNIIRFGSNVTLQVYCFINVNHPSLNRSPFTLATNSMQ
FT                   EEEEHLKASFAQNKRDHLLRLFTWIALEPDLEDCNTKESIHIDDILKTSSLPEARDESN
FT                   SDLTPSSTEDEEDVVSDQLAILYDKVKTSGAELPSAPKPSTFALDLREYQKQALYWMCC
FT                   KEEGVQSDGSAPKLHPLWSRFRFPKDSEFPEFFKCSSDDDNTHFYVNLYTGETTMLFPN
FT                   SMPYHRGGILADEMGLGKTIEVLSLIHSRPCFSTDEIPEAFRHSKPSLPVASRTTLVVA
FT                   PMSLLDQWHSEACKVSQGTKFRSMIYYGSEKPLDLKSCVIDTSTAPLIIITSYGVLLSE
FT                   FSQQSHSSGLFSVHWFRVVLDEGHNIRNRESKTAKACHSISSQNRWVITGTPIVNKLDD
FT                   LYSLIKFMRYEPWCNYTYWQTFVSLPYQSKDVLKALNVVQSILEFLVLRRTKETKDRNG
FT                   NSIVTLPPKTVKIEYLDFSDSERKIYDSLYTKAKSTVNANIVAGTLFRNYTTILGLLLR
FT                   LRQACCDPVLLSNMTINSETFDDFEFSVEQFNSLINQFVVTGKPIPSDILKIDTLKSFE
FT                   ALITECPICCNEPIQNPLLLNCKHACCGDCLSEHIQYQKRRNIIPPLCHTCRQPFNEQD
FT                   VYKPFFVKNNGTQSTLLVGEEVKWKYWNRLQSVKLNGLLGQLRQLTHSSEPEKVVIFSQ
FT                   FTTFLDIIADVLESEKMGYARFDGTMSQQMRSTALETFRNDPDVNVLIISLKAGGVGLN
FT                   LTCANHVFIMDPWWSWSVEAQAIDRIHRLGQEKPVFVTRYIVRDTVEERMLKIQERKNF
FT                   ITGTLGMSEGKQQVQSIEDIKMLFEY"
FT   5'UTR           complement(174374..174701)
FT                   /gene="rad8"
FT                   /gene_synonym="SPAC5H10.14c"
FT                   /locus_tag="SPAC13G6.01c"
FT   3'UTR           complement(174865..175012)
FT                   /gene="rps101"
FT                   /gene_synonym="rps1-1"
FT                   /gene_synonym="rps3a-1"
FT                   /locus_tag="SPAC13G6.02c"
FT   CDS_pept        complement(175013..175771)
FT                   /transl_table=1
FT                   /gene="rps101"
FT                   /gene_synonym="rps1-1"
FT                   /gene_synonym="rps3a-1"
FT                   /locus_tag="SPAC13G6.02c"
FT                   /product="40S ribosomal protein S3a"
FT                   /db_xref="GOA:Q09781"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09781"
FT                   /protein_id="CAA91095.1"
FT                   /translation="MAVGKNKRLSKGKKGIKKRVVDPFSRKDWYDIKAPAFFEVKNVGK
FT                   TLVNRTAGLKNANDSLKGRILEVSLADLQKDEEHSFRKVKLRVEDIQGKSCLTSFNGFD
FT                   MTSDKLRSLVRKWQSTIEANQTIKTTDGYLCRIFVIGFTSRRVNQVKKTTYAQSSQIRA
FT                   IHQKMFQVIQNQANGCSMKELVQKLIPEVIGRAIEKATNNIYPLQNVFVRKVKILKAPK
FT                   HDAQKLLELHGESQDVGSKVISDVAPLESV"
FT   5'UTR           complement(175772..176655)
FT                   /gene="rps101"
FT                   /gene_synonym="rps1-1"
FT                   /gene_synonym="rps3a-1"
FT                   /locus_tag="SPAC13G6.02c"
FT   regulatory      complement(175826..175833)
FT                   /regulatory_class="promoter"
FT   5'UTR           175890..177291
FT                   /gene="gpi7"
FT                   /locus_tag="SPAC13G6.03"
FT   misc_RNA        175923..176736
FT                   /gene_synonym="SPNG40"
FT                   /locus_tag="SPNCRNA.141"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(176878..177943)
FT                   /locus_tag="SPNCRNA.618"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        177292..179568
FT                   /transl_table=1
FT                   /gene="gpi7"
FT                   /locus_tag="SPAC13G6.03"
FT                   /product="GPI anchor biosynthesis protein Gpi7 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.03.1"
FT                   /db_xref="GOA:Q09782"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037674"
FT                   /db_xref="InterPro:IPR039527"
FT                   /db_xref="PomBase:SPAC13G6.03"
FT                   /db_xref="PomBase:SPAC13G6.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09782"
FT                   /protein_id="CAA91096.1"
FT                   /translation="MRFAFFGIFWLQIFGSILFLLGFFPHKNDSTGKAMSNQFSPPAVI
FT                   DQVVFVMVDALRADFVFSKSHNMPFTQSLLYNSTHGIGFSAFARSPTVTMPRLKALTTG
FT                   TIPGFLDVLLNIAESDTGSSIEAQDSWVYQLNSFNKKIEFYGDDTWLKLFPSAFSKFEG
FT                   TTSFFVSDYTEVDNNVTRNFDHALPSSLSHSWDALILHYLGVDHIGHLYGPSSPLLNIK
FT                   LLEIDTIISRIYKYLQEYDEKTNTHSLIVLCGDHGMNEVGNHGGSSSGETTAALSLLFP
FT                   SNELSHINKPILNMDDNPYSILERVEQVDVVPTICLLLGIPIPKGNMGKVLSPVTELWK
FT                   DTKTAKMAALSNLFQLSLLKNPSLTTSELSTQFQDSDLNDIRLALENLQSQMVAQSSSY
FT                   SLDRMLVAISILGACSILSLILFRNLYNYKELLAFAPFVVQNIIIVFSSSFIEEEHVIW
FT                   YFAAVSLSLLQLLNPKTRLAGSLQLFCLSIIKRWNQTGQKYSDLRDIVDDFIAPSTFMK
FT                   TILCVTSAFMPAIRSPSPINFLSSMFIAFYKLMPIISKHLNELPIIASFDYTFFVRIIW
FT                   SLLLISFLSKPTFKQLRCQLSLFILLLTRLENMGLYLLYDIWQRTMPEEGTLASVMYYV
FT                   AEQVAFFSLGNSNSLATVDLSQAYTGLDSYNIFAVGILLFTSVFAGALWWCLHQPKRMM
FT                   DRSVKTFWIMSSISLTFLCISCFIMRHHLFVWSVFSPKLLYNASWASMYFLAKCLISTI
FT                   MVRLR"
FT   3'UTR           179569..180028
FT                   /gene="gpi7"
FT                   /locus_tag="SPAC13G6.03"
FT   5'UTR           180272..180422
FT                   /gene="tim8"
FT                   /locus_tag="SPAC13G6.04"
FT   CDS_pept        join(180423..180528,180586..180721,180890..180911)
FT                   /transl_table=1
FT                   /gene="tim8"
FT                   /locus_tag="SPAC13G6.04"
FT                   /product="TIM22 inner membrane protein import complex
FT                   subunit Tim8 (predicted)"
FT                   /db_xref="GOA:Q09783"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09783"
FT                   /protein_id="CAA91097.2"
FT                   /translation="MADATKNPIADLSESEQLELSKFIESEQQKVKLQQAIHQFTSTCW
FT                   PKCIGNIGNKLDKSEEQCLQNCVERFLDCNFHIIKSLESTRK"
FT   intron          180529..180585
FT                   /gene="tim8"
FT                   /locus_tag="SPAC13G6.04"
FT   3'UTR           complement(180903..181076)
FT                   /gene="trs33"
FT                   /locus_tag="SPAC13G6.05c"
FT   3'UTR           180912..181069
FT                   /gene="tim8"
FT                   /locus_tag="SPAC13G6.04"
FT   CDS_pept        complement(join(181077..181436,181485..181574,
FT                   181632..181749,182001..182194))
FT                   /transl_table=1
FT                   /gene="trs33"
FT                   /locus_tag="SPAC13G6.05c"
FT                   /product="TRAPP complex subunit Trs33 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.05c.1"
FT                   /db_xref="GOA:Q09784"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR037992"
FT                   /db_xref="PomBase:SPAC13G6.05c"
FT                   /db_xref="PomBase:SPAC13G6.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09784"
FT                   /protein_id="CAA91098.4"
FT                   /translation="MIVHQQLPMSVNVASLDFLLIELVHTAKRLAEDRKKKSSSEKSIE
FT                   SDFQMLESIGFQVGRKITERLLLNRNRITETTDVMRFLCRELWPIVFRKPLDNLKTNRR
FT                   GIFVLTDTYFYWFTKMTAMTGTEMAQITTPYFYFPSGFIRGVVYTFGYSAQVIAQCPNL
FT                   PTCIFHVKFSPNPTQTSPGKPSTSESSQTDTSTRPANSQTPTTTRASSYTTLVSTSNQV
FT                   SNEAEASAVETSANQAQNTEDATENEDRLPS"
FT   5'UTR           complement(182195..182254)
FT                   /gene="trs33"
FT                   /locus_tag="SPAC13G6.05c"
FT   3'UTR           complement(182337..182975)
FT                   /gene="gcv2"
FT                   /locus_tag="SPAC13G6.06c"
FT   CDS_pept        complement(182976..186071)
FT                   /transl_table=1
FT                   /gene="gcv2"
FT                   /locus_tag="SPAC13G6.06c"
FT                   /product="glycine cleavage complex subunit P (predicted)"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.06c.1"
FT                   /db_xref="GOA:Q09785"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="PomBase:SPAC13G6.06c"
FT                   /db_xref="PomBase:SPAC13G6.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09785"
FT                   /protein_id="CAA91099.2"
FT                   /translation="MFDSFMKRNQLALIMFRACSKLQYHGVNTSLSRHLFLAKRNLSIS
FT                   SACLEAKNSQKFPALDTFEPRHIGPSKTDQQYQLESLGYKDFDSFLKDVIPDSVRTPES
FT                   QLMAFGSVNPNEKNPPVNYSESEFTTLANNVANQNKLIKSFIGMGYYNVKLPAAIQRNV
FT                   LENPEWYTQYTPYQAEISQGRLESMMNYQTMIADLTGLSISNASLLDEGTAAGEAMVML
FT                   MANDKKKRKTFLVDKNIYPNTLSVLRTRASGFGIKIELDNITPELITKSAKHVFGIFVQ
FT                   YPAADGSIFDYGHLAATARSFNMHVVAATDLLALTILKSPGEWGADVAVGSTQRFGLPM
FT                   GYGGPHAGFFACSEEFKRKIPGRLIGLSKDRLENPAYRLALQTREQHIRREKATSNICT
FT                   AQALLANMSAFYAIYHGPNGLQEIANRIYASTSFLKSALESSGYKIVNKSHFFDTLTIE
FT                   VESADKVLAKALDHGYNLRKVDDSHVGLSLDETVCDKDIQALFSIFNINKSVDQYYMEI
FT                   ATSEPNGNSASTVDNLSICSLPENFRRTTLYLQHPVFNRYHSETELMRYIHHLQSKDLS
FT                   LAHAMTPLGSCTMKLNAVTEMMPITNPLFANIHPYVPEEQAKGYRHVIEDLQLMLTTIT
FT                   GFDAACFQPNSGAAGEYTGLSVIRAYQRSIGQGHRNICLIPVSAHGTNPASAAMAGFTV
FT                   IPVKCLNNGYLDMQDLKEKASKHADKLAAFMVTYPSTFGIFEPDVKEALEVIHEHGGQV
FT                   YFDGANMNAMVGLCKAGDIGADVCHLNLHKTFCIPHGGGGPGVGPICVKKHLADFLPSH
FT                   PVVSCGGKNGITSVSSSPFGSAGILPISWAYMRMMGLAGLRDASKAALLNANYMAKRLS
FT                   SHYKLVYTNKNNLCAHEFILDAREFKATAGVDATDIAKRLQDYSFHAPTLSWPIANTLM
FT                   IEPTESESMYEMDRFCDALISIRQEIREIEEGLQPKDNNLLVNAPHPQKDIASEKWDRP
FT                   YTRERAVYPVPLLKERKFWPSVARLDDAYGDKNLFCTCSPVV"
FT   5'UTR           complement(186072..186358)
FT                   /gene="gcv2"
FT                   /locus_tag="SPAC13G6.06c"
FT   3'UTR           complement(186314..186843)
FT                   /gene="rps601"
FT                   /gene_synonym="rps6-1"
FT                   /locus_tag="SPAC13G6.07c"
FT   CDS_pept        complement(186844..187563)
FT                   /transl_table=1
FT                   /gene="rps601"
FT                   /gene_synonym="rps6-1"
FT                   /locus_tag="SPAC13G6.07c"
FT                   /product="40S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.07c.1"
FT                   /db_xref="GOA:P05752"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="PomBase:SPAC13G6.07c"
FT                   /db_xref="PomBase:SPAC13G6.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05752"
FT                   /protein_id="CAA91100.1"
FT                   /translation="MKLNISYPANGTQKLIEIDDDRRLRVFMEKRMGQEVPGDSVGPEF
FT                   AGYVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQ
FT                   DLAVLALAIIKQGEQDIPGLTDVTVPKRLGPKRASKIRRFFNLSKEDDVRQFVIRREVV
FT                   PKKEGKKPYTKAPKIQRLVTPRTLQHKRHRFALKRRQAEKNREEAAEFAQLMAKRVAEA
FT                   KQKREVVKARRASSLKK"
FT   5'UTR           complement(187564..187683)
FT                   /gene="rps601"
FT                   /gene_synonym="rps6-1"
FT                   /locus_tag="SPAC13G6.07c"
FT   regulatory      complement(187628..187635)
FT                   /regulatory_class="promoter"
FT   5'UTR           187701..188376
FT                   /locus_tag="SPAC13G6.08"
FT   CDS_pept        188377..189984
FT                   /transl_table=1
FT                   /locus_tag="SPAC13G6.08"
FT                   /product="Cdc20/Fizzy subfamily WD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.08.1"
FT                   /db_xref="GOA:Q09786"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC13G6.08"
FT                   /db_xref="PomBase:SPAC13G6.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09786"
FT                   /protein_id="CAA91101.1"
FT                   /translation="MSTLYQVNKIKEILIRFLETIIINGMNSFSSTVYGQNAERSNTPT
FT                   LIDPSNKETANVCPISKNLFQSYPKGSYRNSQRLTSRNGLDRFIPMTSNKDTISLGRHS
FT                   SLSRNLVNKTKNASETYQQLLEYALEVERDDNVFTYAKLQKSDMTQKCPTMVASEKDNK
FT                   GKLNEKKNRSPENLLPFRILDAPELRDDFYTSLLSWSPKGDLAIGLAENIYLWSKELGP
FT                   TRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVPRISIHHPGDIGVLAWKP
FT                   VLETNRLLVGKGNGNIFVYDIIWSESTSKAVLVATITNAHDEQVCGLTWNHDGSQFASG
FT                   GNDNRVCLFKGSDLRQPLYVWQQNAAVKALSFCPWQRSLLATGAGSHDKHIRFYNCFNG
FT                   KKIDELYCGAQITSIHWSPKYREFSVTFGYSLETVQHRFAVYSWPQLECLVSVLPSVPD
FT                   IRCVHSVLTSQLNETTGRCEMTDSIIIASSNETIKFFDLSEESSWHNSRVLTWHGIFDS
FT                   QILEMLEGIDGKIDSHLR"
FT   misc_RNA        complement(188450..190474)
FT                   /locus_tag="SPNCRNA.619"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           189985..190031
FT                   /locus_tag="SPAC13G6.08"
FT   5'UTR           190192..190321
FT                   /locus_tag="SPAC13G6.09"
FT   CDS_pept        join(190322..190584,190730..191291)
FT                   /transl_table=1
FT                   /locus_tag="SPAC13G6.09"
FT                   /product="SSU-rRNA maturation protein Tsr4 homolog 2
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.09.1"
FT                   /db_xref="GOA:Q09787"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="PomBase:SPAC13G6.09"
FT                   /db_xref="PomBase:SPAC13G6.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09787"
FT                   /protein_id="CAA91102.1"
FT                   /translation="MEDVDLGFLSQEKLDEKDYLDIECSRVGGAPLFIRKNDAAFLNES
FT                   LENSFEFLMQLYAPKNSEISYHRILYIFINRDGDSQTAGWTRGVKVFREQARETDEIDF
FT                   QLITSKVTKLIDSSEIEVDAEPKEENKKEIPEKLKNVKVDTENPSAEPYTKAKGDVSFL
FT                   KFQKRLSRAPDQIMRYYHATSNEFPGLWCNNECIPSSIPNCACGAKRQLEFQILPTLIS
FT                   SMNIDHSAKNALDWGILSIYVCSASCDLANCGLAEELCWLQTFSEQGIIAPE"
FT   3'UTR           191292..191947
FT                   /locus_tag="SPAC13G6.09"
FT   3'UTR           complement(191928..192295)
FT                   /gene="asl1"
FT                   /locus_tag="SPAC13G6.10c"
FT   CDS_pept        complement(192296..193888)
FT                   /transl_table=1
FT                   /gene="asl1"
FT                   /locus_tag="SPAC13G6.10c"
FT                   /product="cell wall protein Asl1, predicted O-glucosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.10c.1"
FT                   /db_xref="GOA:Q09788"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="PomBase:SPAC13G6.10c"
FT                   /db_xref="PomBase:SPAC13G6.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09788"
FT                   /protein_id="CAA91103.1"
FT                   /translation="MRTTFATVALAFLSTVGALPYAPNHRHHRRDDDGVLTVYETILET
FT                   VYVTAVPGANSSSSYTSYSTGLASVTESSDDGASTALPTTSTESVVVTTSAPAASSSAT
FT                   SYPATFVSTPLYTMDNVTAPVWSNTSVPVSTPETSATSSSEFFTSYPATSSESSSSYPA
FT                   SSTEVASSYSASSTEVTSSYPASSEVATSTSSYVAPVSSSVASSSEISAGSATSYVPTS
FT                   SSSIALSSVVASASVSAANKGVSTPAVSSAAASSSAVVSSVVSSATSVAASSTISSATS
FT                   SSASASPTSSSVSGKRGLAWIPGTDLGYSDNFVNKGINWYYNWGSYSSGLSSSFEYVLN
FT                   QHDANSLSSASSVFTGGATVIGFNEPDLSAAGNPIDAATAASYYLQYLTPLRESGAIGY
FT                   LGSPAISNVGEDWLSEFMSACSDCKIDFIACHWYGIDFSNLQDYINSLANYGLPIWLTE
FT                   FACTNWDDSNLPSLDEVKTLMTSALGFLDGHGSVERYSWFAPATELGAGVGNNNALISS
FT                   SGGLSEVGEIYIS"
FT   5'UTR           complement(193889..194053)
FT                   /gene="asl1"
FT                   /locus_tag="SPAC13G6.10c"
FT   3'UTR           complement(194099..194118)
FT                   /gene="erg12"
FT                   /locus_tag="SPAC13G6.11c"
FT   CDS_pept        complement(join(194119..195258,195508..195582))
FT                   /transl_table=1
FT                   /gene="erg12"
FT                   /locus_tag="SPAC13G6.11c"
FT                   /product="mevalonate kinase Erg12 (predicted)"
FT                   /EC_number="2.7.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.11c.1"
FT                   /db_xref="GOA:Q09780"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="PomBase:SPAC13G6.11c"
FT                   /db_xref="PomBase:SPAC13G6.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09780"
FT                   /protein_id="CAA91104.1"
FT                   /translation="MSKSLIVSSPGKTILFGEHAVVYGATALAAAVSLRSYCKLQTTNN
FT                   NEIVIVMSDIGTERRWNLQSLPWQHVTVENVQHPASSPNLDLLQGLGELLKNEENGLIH
FT                   SAMLCTLYLFTSLSSPSQGCTLTISSQVPLGAGLGSSATISVVVATSLLLAFGNIEPPS
FT                   SNSLQNNKALALIEAWSFLGECCIHGTPSGIDNAVATNGGLIAFRKATAHQSAMKEFLK
FT                   PKDTLSVMITDTKQPKSTKKLVQGVFELKERLPTVIDSIIDAIDGISKSAVLALTSESD
FT                   KNSSAKKLGEFIVLNQKLLECLGVSHYSIDRVLQATKSIGWTKLTGAGGGGCTITLLTP
FT                   ECKEEEFKLCKESLLAHKNSIYDVQLGGPGVSVVTDSDSFFPQYESDFDFKKLNLLSKF
FT                   NKYYI"
FT   intron          complement(195259..195507)
FT                   /gene="erg12"
FT                   /locus_tag="SPAC13G6.11c"
FT   5'UTR           complement(195583..195626)
FT                   /gene="erg12"
FT                   /locus_tag="SPAC13G6.11c"
FT   3'UTR           complement(195940..196089)
FT                   /gene="chs1"
FT                   /gene_synonym="SPAC24B11.01c"
FT                   /locus_tag="SPAC13G6.12c"
FT   CDS_pept        complement(join(196090..196174,196221..198715))
FT                   /transl_table=1
FT                   /gene="chs1"
FT                   /gene_synonym="SPAC24B11.01c"
FT                   /locus_tag="SPAC13G6.12c"
FT                   /product="chitin synthase I"
FT                   /EC_number="2.4.1.16"
FT                   /db_xref="GOA:P30597"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30597"
FT                   /protein_id="CAA91105.1"
FT                   /translation="MRRWFKKTLPRPPDEEESAGLTNKDIVETNHLYPTITNLSLNSDT
FT                   SSILFDKNKKPLKPKIIIPDKEFDLDYYLKDETESIQSPFEGFTAQPNFSNFNKQGNTM
FT                   NREANFQRTNEKIQRNKSIKRVKLFHGNLILDCPIPKKLLVTLPQQTEREFAYMRYSAA
FT                   TCDPQDFSKSLFTLRQPLFFQPRKTEICIAITMYNEDEVLFARTMHSVMKNISHLCTRK
FT                   NSQVWGKDAWKKVVVCIISDGRTKIHPRTLAYLAAIGVYQDGIAKNQVNDKEVKAHIYE
FT                   YTTQLSIDPNLKFKGSDRGIVPVQMIFCLKEKNQKKLNSHLWFFQAFCPILKPEVCILL
FT                   DAGTRPGDQSIYHLWKSFDLNPQVAGACGEIVVMKGKLGSGLINPLVATQNFEYKMSNI
FT                   LDKPVESVFGFISVLPGAFSAYRFEALQNDSQGNGPLASYFKGELQNTGKSGIFEANMY
FT                   LAEDRILCFELVSKKNEAWILHYVKSAYADTDVPDRIPEFVLQRRRWLNGSFFAAAYAI
FT                   CHYYRFFRTSHTISRKFMLSIEFIYQLATIVFGWFNIGNFFIIFYILTSSLASTSANFL
FT                   PGEILFRIAIWIYASLLVTCFVLALGNRPHGSPNFYLSMVIMYSILMGYLLFCSGWIAY
FT                   RAISDAIHNASSTSSSYTSALLNSNVFINIVISLSSTYGMYLVVSIISFDPWHMFTSFV
FT                   QYIFLSIMYTNVLNVYAFCNTHDVSWGTKGDHFTNNDLGVARLLQKGADVEIAIPTNQS
FT                   DIDAKYEDAVKLLASPSLEFNSPIINHGEQEDFYKNFRTYVVLTWILSNLFLVGIVLSI
FT                   PKINGISISNNETSAYLSFLLWSVVAFSVFRFIGCIFYLFIRLCTGE"
FT   5'UTR           complement(198716..199051)
FT                   /gene="chs1"
FT                   /gene_synonym="SPAC24B11.01c"
FT                   /locus_tag="SPAC13G6.12c"
FT   CDS_pept        198884..199231
FT                   /transl_table=1
FT                   /gene_synonym="SPAC24B11.02"
FT                   /locus_tag="SPAC13G6.13"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.13.1"
FT                   /db_xref="GOA:Q09789"
FT                   /db_xref="PomBase:SPAC13G6.13"
FT                   /db_xref="PomBase:SPAC13G6.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09789"
FT                   /protein_id="CAA91106.1"
FT                   /translation="MFQLPMIVEANDMKIKYYKRRNCYTLLIFKYKESKKINVYKRKKS
FT                   DEVVEDCNKLKCTFFMIEEWHLLAILYDKSKYIKIIICSVLLKLNTTVIIRRNTHTKVY
FT                   VMNKFYQKLKK"
FT   misc_RNA        complement(199874..200587)
FT                   /locus_tag="SPNCRNA.620"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           200121..200234
FT                   /gene="aps1"
FT                   /gene_synonym="SPAC24B11.03"
FT                   /locus_tag="SPAC13G6.14"
FT   CDS_pept        200235..200867
FT                   /transl_table=1
FT                   /gene="aps1"
FT                   /gene_synonym="SPAC24B11.03"
FT                   /locus_tag="SPAC13G6.14"
FT                   /product="diadenosine 5',5'''-p1,p6-hexaphosphate hydrolase
FT                   Aps1"
FT                   /EC_number="3.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.14.1"
FT                   /db_xref="GOA:Q09790"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="PomBase:SPAC13G6.14"
FT                   /db_xref="PomBase:SPAC13G6.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09790"
FT                   /protein_id="CAA91107.1"
FT                   /translation="MLENNGSVILMEPDHLRTAVNRSMTSREGRTKNRFNPITGARLAA
FT                   GVVALSADKRKVLLVSSAKKHPSWVVPKGGWEADESVQQAALREGWEEGGLVGHITRSL
FT                   GSFKDKRPTDTIDRRKKYLKQLMSKSSGNDVSTNTELGAEAEKLLLPPRAECEFFEVIV
FT                   ERLEDNYPEMRKRRRKWMSYQEAKEALTSRKDILAALEKSSIIKEEN"
FT   3'UTR           200868..201517
FT                   /gene="aps1"
FT                   /gene_synonym="SPAC24B11.03"
FT                   /locus_tag="SPAC13G6.14"
FT   3'UTR           complement(201729..202486)
FT                   /gene_synonym="SPAC24B11.04c"
FT                   /locus_tag="SPAC13G6.15c"
FT   CDS_pept        complement(202487..202978)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC24B11.04c"
FT                   /locus_tag="SPAC13G6.15c"
FT                   /product="calcipressin (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13G6.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13G6.15c.1"
FT                   /db_xref="GOA:Q09791"
FT                   /db_xref="InterPro:IPR006931"
FT                   /db_xref="PomBase:SPAC13G6.15c"
FT                   /db_xref="PomBase:SPAC13G6.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09791"
FT                   /protein_id="CAA91108.1"
FT                   /translation="MLVFTTSPDHVDELNEFVQQLNPVAFTRVLRGLGKVLASYNDKAV
FT                   EEDTLKKSSTGSLPSGQQVHCQYVLDDPNHVEGISVDQSLQVPKFEKNWLISPPGSPPV
FT                   GWEPIVEESPNSQHLAHDIQLKLDELGNALLNDHSAGPQIVISEHNNTKETSPSRQFEH
FT                   "
FT   5'UTR           complement(202979..203346)
FT                   /gene_synonym="SPAC24B11.04c"
FT                   /locus_tag="SPAC13G6.15c"
FT   misc_RNA        complement(203597..204322)
FT                   /locus_tag="SPNCRNA.621"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           204386..205212
FT                   /locus_tag="SPAC24B11.05"
FT   CDS_pept        205213..205893
FT                   /transl_table=1
FT                   /locus_tag="SPAC24B11.05"
FT                   /product="pyrimidine 5'-nucleotidase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.05.1"
FT                   /db_xref="GOA:Q09893"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="PomBase:SPAC24B11.05"
FT                   /db_xref="PomBase:SPAC24B11.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09893"
FT                   /protein_id="CAA91770.1"
FT                   /translation="MTVEQKIIFFDLDNCLYPKSYKIHNMMAARITAFFSDKLGIPTEE
FT                   AERLREVYYRHYGIAIRGLVLHHEIDAVDYDQRVDQSLPLEKVIKKDEVLREMLLELRK
FT                   KYKCWIFTNAYIVHANRVLKYLGIEDCFDGITYCDYNAKDLIAKPMPEMYERVMREAGV
FT                   TDKDKCIFVDDSYGNILGAREFGWKYTVQLVEHGDPLPQPQAGSHVIRDIHKFKHLLDE
FT                   IDGE"
FT   3'UTR           205894..206081
FT                   /locus_tag="SPAC24B11.05"
FT   3'UTR           complement(206476..206863)
FT                   /gene="sty1"
FT                   /gene_synonym="spc1"
FT                   /gene_synonym="phh1"
FT                   /locus_tag="SPAC24B11.06c"
FT   misc_RNA        206775..209401
FT                   /locus_tag="SPNCRNA.622"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(206864..207913)
FT                   /transl_table=1
FT                   /gene="sty1"
FT                   /gene_synonym="spc1"
FT                   /gene_synonym="phh1"
FT                   /locus_tag="SPAC24B11.06c"
FT                   /product="MAP kinase Sty1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.06c.1"
FT                   /db_xref="GOA:Q09892"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008352"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR038783"
FT                   /db_xref="PomBase:SPAC24B11.06c"
FT                   /db_xref="PomBase:SPAC24B11.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09892"
FT                   /protein_id="CAA91771.1"
FT                   /translation="MAEFIRTQIFGTCFEITTRYSDLQPIGMGAFGLVCSAKDQLTGMN
FT                   VAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENIISLSDIFISPFEDIYFVTELLGTDL
FT                   HRLLTSRPLETQFIQYFLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDFGLA
FT                   RIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRDHVNQ
FT                   FSIITELLGTPPMEVIETICSKNTLRFVQSLPQKEKVPFAEKFKNADPDAIDLLEKMLV
FT                   FDPRKRISAADALAHNYLAPYHDPTDEPVADEVFDWSFQDNDLPVETWKVMMYSEVLSF
FT                   HNMDNELQS"
FT   5'UTR           complement(207914..208044)
FT                   /gene="sty1"
FT                   /gene_synonym="spc1"
FT                   /gene_synonym="phh1"
FT                   /locus_tag="SPAC24B11.06c"
FT   3'UTR           complement(208839..209345)
FT                   /locus_tag="SPAC24B11.07c"
FT   CDS_pept        complement(209346..211031)
FT                   /transl_table=1
FT                   /locus_tag="SPAC24B11.07c"
FT                   /product="oxidoreductase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.07c.1"
FT                   /db_xref="GOA:Q09894"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="PomBase:SPAC24B11.07c"
FT                   /db_xref="PomBase:SPAC24B11.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09894"
FT                   /protein_id="CAA91772.1"
FT                   /translation="MTDAGKKERVSILCVGSPSITTLLGWRLQQSSVVTCQETIMFFNA
FT                   PEPSTNVFTIQSKKFGTRKYRPTYRLSKLEEVTSDSEPFDYVFVSIKPNSRNFQLSNIL
FT                   EPVITAKHTCIVYNSTGAIGVEEALQRQYPENPIFSLITHTPVSQRSVDEFFFGDCAPF
FT                   YLAPAGSNLEIDQLSRLVEILEGGEISSEILDTLLPLEIEDLALPLSLYPLTVLTQNPN
FT                   LPKLLERPDINDLHQGILQELDSLCNCLGSSLDVKKLSKQRETLLSHMQVNPAFREYRS
FT                   NRPVEIVQYLHYCIDLATKQSLQVPRLRTISALISSIQHLPLVQPHHMNDMHGPTDNSP
FT                   KKNKVLVNMRPINPSSFVSDRHSPLHPYSVPENGKPNMGRIPSAPSLSKGRAMTADNMD
FT                   MLSLTTRRSRRSLYSPSLMQMQQSLKSDYEGLGRTFDPRFAPRGSPPVRGGKNVLSPEA
FT                   KEHTHKNISPESSRFGTPSDPNSSSQSLGNEVLSRPNSNSNSAESRNGETDDSGESETY
FT                   FTLMNNNKGVEPRASVASETSSMTVIPNAMRRFPLARGTSRMKS"
FT   5'UTR           complement(211032..211275)
FT                   /locus_tag="SPAC24B11.07c"
FT   3'UTR           complement(211714..212033)
FT                   /locus_tag="SPAC24B11.08c"
FT   CDS_pept        complement(212034..213206)
FT                   /transl_table=1
FT                   /locus_tag="SPAC24B11.08c"
FT                   /product="COPII-coated vesicle component Erv46 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.08c.1"
FT                   /db_xref="GOA:Q09895"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="PomBase:SPAC24B11.08c"
FT                   /db_xref="PomBase:SPAC24B11.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09895"
FT                   /protein_id="CAA91773.1"
FT                   /translation="MQFRSPLRRFDAFQKTVEDARIKTASGGLITLVSGLIVIFIVLME
FT                   WINYRRVIAVHEIIVNPSHGDRMEINFNITFPRIPCQILTVDVLDVSGEFQRDIHHTVS
FT                   KTRLSPSGEIISVDDLDIGNQQSISDDGAAECGDCYGAADFAPEDTPGCCNTCDAVRDA
FT                   YGKAHWRIGDVDAFKQCKDENFKELYEAQKVEGCNLAGQLSVNRMAGNFHIAPGRSTQN
FT                   GNQHVHDTRDYINELDLHDMSHSIHHLSFGPPLDASVHYSNPLDGTVKKVSTADYRYEY
FT                   FIKCVSYQFMPLSKSTLPIDTNKYAVTQHERSIRGGREEKVPTHVNFHGGIPGVWFQFD
FT                   ISPMRVIERQVRGNTFGGFLSNVLALLGGCVTLASFVDRGYYEVQKLKKN"
FT   5'UTR           complement(213207..213591)
FT                   /locus_tag="SPAC24B11.08c"
FT   misc_RNA        complement(213527..215928)
FT                   /locus_tag="SPNCRNA.623"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        213841..214818
FT                   /gene_synonym="SPNG45"
FT                   /locus_tag="SPNCRNA.142"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           214093..216482
FT                   /locus_tag="SPAC24B11.09"
FT   CDS_pept        216483..216839
FT                   /transl_table=1
FT                   /locus_tag="SPAC24B11.09"
FT                   /product="mitochondrial protein, predicted, human BRP44
FT                   ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.09.1"
FT                   /db_xref="GOA:Q09896"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="PomBase:SPAC24B11.09"
FT                   /db_xref="PomBase:SPAC24B11.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09896"
FT                   /protein_id="CAA91774.1"
FT                   /translation="MFRAGFKRFWNHPAGPKTVHFWAPAMKWTLVLSGIGDYARSPEYL
FT                   SIRQYAALCATGAIWTRWSLIVRPKNYFNATVNFFLAIVGAVQVSRILVYQRQQKRITA
FT                   QSEQRTELARSLAA"
FT   3'UTR           216840..216962
FT                   /locus_tag="SPAC24B11.09"
FT   3'UTR           complement(218260..218656)
FT                   /gene="chr3"
FT                   /gene_synonym="cfh1"
FT                   /locus_tag="SPAC24B11.10c"
FT   CDS_pept        complement(218657..221455)
FT                   /transl_table=1
FT                   /gene="chr3"
FT                   /gene_synonym="cfh1"
FT                   /locus_tag="SPAC24B11.10c"
FT                   /product="chitin synthase regulatory factor-like Chr3
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.10c.1"
FT                   /db_xref="GOA:Q09897"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="PomBase:SPAC24B11.10c"
FT                   /db_xref="PomBase:SPAC24B11.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09897"
FT                   /protein_id="CAA91775.1"
FT                   /translation="MKDSHSSRRKYEKEKLVFATNNGKRTEGTPAFLKSGNTASSSSPT
FT                   LQFRPTSRYPTLSHEPVYTNVLDLSSRIDANRASIMSATMGTPPSALKFSKKKISRPVV
FT                   SEDTFKDKLPRATIPVKPEPQPQYKIPAAPAPTSKRVVNRGLKLNTNLRQASPILPSPS
FT                   LKLDRQDAPIQINHEQKEDFLVSIPRPTPMTNLDDGKDEIGQPDPHRKYMAPPRVNSIS
FT                   RVQRRMSYIPYGGFDDFLDNYYKDDDTVLEDNQLKSNSRIETLEEEDGAESDSITNTVS
FT                   NASSDAEPAHRHLGPVYENSGHLPSKSHFSSTDSNTDSFGLESDERSLPSVSNDLKSSE
FT                   TLKNPRNDDLLTLQQPPRYPHSQMVMLPARSPVEVPAPTFDRRNVSRNSNNNSPEGYDN
FT                   NRTNPTVNNLPSYPTNLARPKAIKPMPTSIHGQTSPLSPIPPVHTTHGLVSDIRPLPSV
FT                   SSPIMRADSTPISHNLAVTPSFSPIPQQSNKSIGNHKNTSVANVSSKVANSKFERNISM
FT                   MSNSNASSPAIFEVGAEAKEKTKDAIPCHPDDKLMIPSPKIVTHGDAMQEEQRLRQKSQ
FT                   ITPDDEVELAKVYLNALETLENKPSLAPDQASYNTRINVYRTRAVELLKKNAYPSKTQN
FT                   TVPEALFLIGQFHSQGVLGFRRDLGKAFELYSLAAKKGHPLSNYRVAVCLQTGTGVKPD
FT                   TSKCVAIYKKAAEMDVVEAMFRIALIYLNGLLGQKRNISLGVQWLERACKSKGPESVRA
FT                   MYELAKIYEQPDRYGVSATPERKFELYKQSAVYGYAAAQCKLGECYEHGLLGCLAEPRR
FT                   SIFWYTRAAEQDYGEAELGLSGWYLTGSEGILPKNGEEALLWAHKAACKGLAKAQYAVG
FT                   FMMEQGIGVAADPSSAHNWYIRAAKQGFPKAKKRLEEQALSSKQTHSKAPKKKQQEQCV
FT                   VM"
FT   5'UTR           complement(221456..221562)
FT                   /gene="chr3"
FT                   /gene_synonym="cfh1"
FT                   /locus_tag="SPAC24B11.10c"
FT   3'UTR           complement(221694..222028)
FT                   /gene="sid2"
FT                   /locus_tag="SPAC24B11.11c"
FT   CDS_pept        complement(222029..223852)
FT                   /transl_table=1
FT                   /gene="sid2"
FT                   /locus_tag="SPAC24B11.11c"
FT                   /product="NDR kinase Sid2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.11c.1"
FT                   /db_xref="GOA:Q09898"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="PomBase:SPAC24B11.11c"
FT                   /db_xref="PomBase:SPAC24B11.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09898"
FT                   /protein_id="CAA91776.1"
FT                   /translation="MNRVNDMSPVEGDLGLQLSSEADKKFDAYMKRHGLFEPGNLSNND
FT                   KERNLEDQFNSMKLSPVASSKENYPDNHMHSKHISKLPIASPIPRGLDRSGELSYKDNN
FT                   HWSDRSSTGSPRWENGSMNLSVEEMEKVVQPKVKRMATICQMFFLDHYFEQLHYLYTRK
FT                   QRARLFEEQLLKEPDSRRDELVKRYNGRERVYLRKRRTRISHGDFQTITQVGQGGYGSV
FT                   WLARKRDTKEIVALKIMNKSVLHKMDEIRHVLTERDILTTANSEWLVRLLYAFQDTSNI
FT                   YLAMEFVPGGDFRTLLSNSGVLRDHHAKFYATEMFLAIDALHQLGYIHRDLKPENFLVG
FT                   ASGHIKLTDFGLSSGIISKKKIESMKIRLQEVNNVVVPERSMRERRQVFRTLLSQDPVY
FT                   AHSVVGSPDYMAPEVLRGENYNHSVDYWSLGCIMYECLSGFPPFSGSNVNETWSNLKNW
FT                   RKCFQRPHYDDPRDLEFNWRDDAWDFVCHCITDPKDRFCSLKQVMQHPYFSKIDWKNVR
FT                   TAYRPPFVPDLNSEIDAGYFDDFTNENDMSKYKEVHEKQAAIANMVNTFNKPKRNAFIG
FT                   FTFRHQKNSHPTSSSSALSSPLSAPSFGTLL"
FT   5'UTR           complement(223853..223991)
FT                   /gene="sid2"
FT                   /locus_tag="SPAC24B11.11c"
FT   3'UTR           complement(224080..224395)
FT                   /locus_tag="SPAC24B11.12c"
FT   CDS_pept        complement(join(224396..228232,228312..228683))
FT                   /transl_table=1
FT                   /locus_tag="SPAC24B11.12c"
FT                   /product="P-type ATPase (predicted)"
FT                   /EC_number="3.6.3.1"
FT                   /db_xref="GOA:Q09891"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR026871"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09891"
FT                   /protein_id="CAA91777.1"
FT                   /translation="MESVEEKSKQRRWLPNFKALRLKVYRLADRLNIPLADAARVELEE
FT                   YDGSDPQSLRGLQKLPRTLYFGLPLPDSELDDTGEAKRWFPRNKIRTAKYTPIDFIPKN
FT                   IFLQFQNVANLFFLFLVILQSISIFGEQVNPGLAAVPLIVVVGITAVKDAIEDFRRTML
FT                   DIHLNNTPTLRLSHYQNPNIRTEYISYFRRFKKRISALFRVFLAKQEEKKRAKRLNDAV
FT                   PLEDMAGSESRPSYDSIFRESFEAKRSFEDSKGKVPLSALDGTATILQSRPMDIIDYEA
FT                   EATGECHFKKTYWKDVRVGDFVKVMDNDEIPADIVIINSSDPEGICYIETKNLDGETNL
FT                   KMRHALTCGKNVVDEASCERCRFWIESEPPHANLYEYNGACKSFVHSEAGGSDTSQTVS
FT                   EPISLDSMLLRGCVLRNTKWVIGVVVFTGDDTKIMLNSGAPPLKRSRITRNLNWNVYLN
FT                   FIILFSMCFVCAVVEGIAWRGHSRSSYYFEFGSIGGSPAKDGVVTFFTGVILFQNLVPI
FT                   SLYISIEIVKTIQAIFIYFDKDMYYKKLKYACTPKSWNISDDLGQVEYIFSDKTGTLTQ
FT                   NVMEFKKCTINGVAYGEAFTEAMAGMAKREGKDTEELTLQKQSFIERDRMQMISQMRNM
FT                   HDNKYLVDDNLTFISSQFVHDLAGKAGEEQSLACYEFFLALALCHSVVADRVGDRIVYK
FT                   AQSPDEAALVGTARDVGFVFLDQRRDIMVTRALGETQRFKLMDTIEFSSARKRMSVIVK
FT                   GPDNRYVLICKGADSIIFERLEPNEQVELRKTTSEHLRIFALEGLRTLCIAKRELTEEE
FT                   YYEWKEKYDIAASAIENREEQIEEVADLIESHLTLLGGTAIEDRLQEGVPDSIALLAQA
FT                   GIKLWVLTGDKMETAINIGFSCNLLDAGMDMIKFDVDQEVSTPELEVILADYLYRYFGL
FT                   SGSVEELEAAKKDHDTPSGSHALVIDGSVLKRVLDGPMRTKFLLLCKRCKAVLCCRVSP
FT                   AQKADVVQLVRESLEVMTLAIGDGANDVAMIQKADIGVGIVGEEGRAAAMSADYAIGQF
FT                   RFLSKLVLVHGRWDYNRVAEMVNNFFYKSVVWTFTLFWYQIYNNFDANYLFDYTYVMLF
FT                   NLIFSSLPVIVMGVYDQDVNADLSLRIPQLYKRGILQLNSARKIFIGYMLDGFYQSVIC
FT                   FFFSFLVINNVTTAAQNGRDTMAVQDLGVYVAAPTIMVVDTYVILNQSNWDVFSIGLWA
FT                   LSCLTFWFWTGVYSQSLYTYEFYKSASRIFRTPNFWAVLCGTIVSCLFPKFLFMTTQKL
FT                   FWPYDVDIIRESYRTKRLHELDEEEEIENAEQSPDWASSTLQVPFNASSSSLATPKKEP
FT                   LRLDTNSLTLTSSMPRSFTPSYTPSFLEGSPVFSDEILNRGEYMPHRGSISSSEQPLRP
FT                   "
FT   5'UTR           complement(228684..229307)
FT                   /locus_tag="SPAC24B11.12c"
FT   misc_RNA        complement(229270..230855)
FT                   /locus_tag="SPNCRNA.624"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   CDS_pept        join(230545..230681,230743..230799,230830..231136)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC806.10"
FT                   /locus_tag="SPAC24B11.14"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.14.1"
FT                   /db_xref="PomBase:SPAC24B11.14"
FT                   /db_xref="PomBase:SPAC24B11.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UR21"
FT                   /protein_id="CAB61651.1"
FT                   /translation="MFAYNHKTLHVCLRLISLRNCSNTWTFVPYANSNRGLNINQQLKL
FT                   FNRRSKIALSSFIIPTSVDILVKVAGFQRYIVNVEFSNVQSYFRYYNYISLYFVTHSKV
FT                   PLNRLPNSMIPYTVFAHFDIVPYTTYSILTKYRCAQDKEREIVGLINASQSKLRYKFCG
FT                   LRN"
FT   5'UTR           231311..231654
FT                   /gene="hem3"
FT                   /gene_synonym="SPAC806.01"
FT                   /locus_tag="SPAC24B11.13"
FT   CDS_pept        231655..232665
FT                   /transl_table=1
FT                   /gene="hem3"
FT                   /gene_synonym="SPAC806.01"
FT                   /locus_tag="SPAC24B11.13"
FT                   /product="hydroxymethylbilane synthase (predicted)"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24B11.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24B11.13.1"
FT                   /db_xref="GOA:Q09899"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="PomBase:SPAC24B11.13"
FT                   /db_xref="PomBase:SPAC24B11.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09899"
FT                   /protein_id="CAB55280.1"
FT                   /translation="MPSCTSFPIGTRKSKLAVIQSEIIREELEKHYPHLEFPIISRDTI
FT                   GDEILSKALFEFKRQLAKSLWTRELEALLVTNQCRILVHSLKDLPSEMPDGMVIACIPK
FT                   RSCPLDAIVFKAGSHYKTVADLPPGSVVGTSSIRRRALLARNFPHLRFVDIRGNVGTRL
FT                   AKLDAPDSQFDCLVLAAAGLFRLGLKDRIAQMLTAPFVYYAVGQGALAVEVRADDKEMI
FT                   EMLKPLQHQETLYACLAERALMKRLQGGCAIPIGVQTDVLAISNSSYRISLLGTVLSAD
FT                   GLRAAFGNAEAVVSSEEEAEELGITVALALLKNGAGPILEEHQRSSDSEESLKNY"
FT   3'UTR           232666..233488
FT                   /gene="hem3"
FT                   /gene_synonym="SPAC806.01"
FT                   /locus_tag="SPAC24B11.13"
FT   3'UTR           complement(233032..233230)
FT                   /locus_tag="SPAC806.02c"
FT   CDS_pept        complement(join(233231..235053,235103..235106))
FT                   /transl_table=1
FT                   /locus_tag="SPAC806.02c"
FT                   /product="Par A family ATPase/WD repeat iron cluster
FT                   assembly fusion protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.02c.1"
FT                   /db_xref="GOA:Q9UT57"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028600"
FT                   /db_xref="InterPro:IPR028608"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC806.02c"
FT                   /db_xref="PomBase:SPAC806.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT57"
FT                   /protein_id="CAB55281.1"
FT                   /translation="MDKVQHVILVLSGKGGVGKSSVTTQLALSLHDSKVYSRPLKTGIL
FT                   DIDLTGPSIPRMFGKDAERNRIHQSSAGWVPVYTDETKEIGLMSLGFLLTSKNDSVVWR
FT                   GPKKAAMIRQFISDVSWGELDFLIIDTPPGTGDEHLTIVESLLSETSTVRDVPIDGAVI
FT                   VTTPQGIATLDVQKEIDFCKKASIKILGIVENMSGYICPHCADCTNIFSSGGGLTLSEK
FT                   YKLPFLGSVPIDPKFGEMIENLTPDSNIVHLYSKTEMSKKFSFITNEFLNQLYGPRKLD
FT                   TITTISGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGFHTRSIRRVA
FT                   WRPIERPVLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWSCNGNYLATCSRD
FT                   KSVWIWEATEDDEFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWA
FT                   LTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVATIDSTNILRPALQ
FT                   EEWKQQTSLPHIHKGAVYTISWMNDATLCSAGGDGKIVVYQREKHDEALWHVAYEQDHA
FT                   HGVYEINSLEYLRDDRLLSGGDDGECRVWSFK"
FT   intron          complement(235054..235102)
FT                   /locus_tag="SPAC806.02c"
FT   5'UTR           complement(235107..235164)
FT                   /locus_tag="SPAC806.02c"
FT   misc_RNA        235280..237141
FT                   /locus_tag="SPNCRNA.625"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(235533..235652)
FT                   /gene="rps2601"
FT                   /gene_synonym="rps26-1"
FT                   /gene_synonym="rps26"
FT                   /locus_tag="SPAC806.03c"
FT   CDS_pept        complement(235653..236015)
FT                   /transl_table=1
FT                   /gene="rps2601"
FT                   /gene_synonym="rps26-1"
FT                   /gene_synonym="rps26"
FT                   /locus_tag="SPAC806.03c"
FT                   /product="40S ribosomal protein S26 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.03c.1"
FT                   /db_xref="GOA:Q9UT56"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="PomBase:SPAC806.03c"
FT                   /db_xref="PomBase:SPAC806.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT56"
FT                   /protein_id="CAB55282.1"
FT                   /translation="MTQKRRNCGRNKHGRGHTKFVRCINCSRAVPKDKAIKRWNIRNMV
FT                   ETAAIRDLSEASVYSEYAIPKIYVKLQYCVSCAIHARVVRVRSREGRRIRTPPPRVRYN
FT                   RDGKRVNPAAIAKTAL"
FT   5'UTR           complement(236016..236104)
FT                   /gene="rps2601"
FT                   /gene_synonym="rps26-1"
FT                   /gene_synonym="rps26"
FT                   /locus_tag="SPAC806.03c"
FT   misc_RNA        236819..236928
FT                   /gene_synonym="SPNG46"
FT                   /locus_tag="SPNCRNA.143"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(237023..237211)
FT                   /locus_tag="SPAC806.11"
FT   misc_RNA        complement(237074..237848)
FT                   /gene="prl3"
FT                   /gene_synonym="prl03"
FT                   /locus_tag="SPNCRNA.03"
FT                   /product="non-coding RNA, poly(A)-bearing RNA (predicted)"
FT   CDS_pept        complement(237212..237430)
FT                   /transl_table=1
FT                   /locus_tag="SPAC806.11"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.11.1"
FT                   /db_xref="GOA:A6X969"
FT                   /db_xref="PomBase:SPAC806.11"
FT                   /db_xref="PomBase:SPAC806.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6X969"
FT                   /protein_id="CAO77636.1"
FT                   /translation="MLCPTHGPTTWNPHSCTVVEKCITNLLITTILLCFFNATTYWKLF
FT                   FGAMFDFIHYQLLFRNSLSEILLLGLG"
FT   5'UTR           complement(237431..237885)
FT                   /locus_tag="SPAC806.11"
FT   misc_RNA        complement(237820..239427)
FT                   /locus_tag="SPNCRNA.626"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        237903..238881
FT                   /locus_tag="SPNCRNA.627"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        238509..238898
FT                   /gene_synonym="SPNG48"
FT                   /locus_tag="SPNCRNA.144"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        238998..240617
FT                   /locus_tag="SPNCRNA.628"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        239730..240571
FT                   /gene_synonym="SPNG51"
FT                   /locus_tag="SPNCRNA.145"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(241008..241425)
FT                   /locus_tag="SPAC806.04c"
FT   CDS_pept        complement(join(241426..241537,241589..241709,
FT                   241757..242815,242917..242941))
FT                   /transl_table=1
FT                   /locus_tag="SPAC806.04c"
FT                   /product="DUF89 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.04c.1"
FT                   /db_xref="GOA:Q9UT55"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="InterPro:IPR039763"
FT                   /db_xref="PomBase:SPAC806.04c"
FT                   /db_xref="PomBase:SPAC806.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT55"
FT                   /protein_id="CAB55283.3"
FT                   /translation="MKFLNPPFPYSMTSDPESFGHECFTRRWGIILTGIEKDVSERLSK
FT                   LASTSKDSEVVAQGKPLLNDLEAFKSDIKNDRPLVPLEGEGQDIVEYNEELKQLDNASW
FT                   GNAPWLYSECYYYRRISLIFARYSEWKAYDPFFQQKDSTLKSSRAAVEELAGRYCLLEE
FT                   ELNSIAKKGDSHIAYMVFVEMAQISLWGNATDLSLLTNLSYEELQNLQGQKVVEESQKN
FT                   ILVNDFPTVWSKLKDVHNGRIDFVLDNAGFELYVDLIFAAYLLKAGIAKEIVLHPKDFP
FT                   WFVSDVLPYDIEYLLTNLDTIFPTESVTKFATDLRSFSAKGQLRLRTDPFWTTAHYFGR
FT                   MPDFAAGLLTELEKSDMIFFKGDLNYRKLTGDCLWPRTTPFGKTLGPIANAINACALRT
FT                   CKADVVVGLPDGLYEKIAKDLPHWERTGKYAVVEFCPKA"
FT   5'UTR           complement(242942..243122)
FT                   /locus_tag="SPAC806.04c"
FT   3'UTR           complement(244206..245303)
FT                   /locus_tag="SPAC806.06c"
FT   5'UTR           244214..244730
FT                   /locus_tag="SPAC806.05"
FT   CDS_pept        244731..245108
FT                   /transl_table=1
FT                   /locus_tag="SPAC806.05"
FT                   /product="mitochondrial ANC9 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.05.1"
FT                   /db_xref="GOA:Q9UT54"
FT                   /db_xref="PomBase:SPAC806.05"
FT                   /db_xref="PomBase:SPAC806.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT54"
FT                   /protein_id="CAB55284.1"
FT                   /translation="MKKEHASAFRQLWRAGMAAAISTRFPGHRFVIRDLLRNGFRQNNC
FT                   SFYSKEKVENTVIFLEMAASRKSVEHLILKNRLHIQMFRRKAGQRLAHYSTAKERPYFL
FT                   SAYDTYEWCLQRVGTIYNLYL"
FT   3'UTR           join(245109..247438,247491..247574)
FT                   /locus_tag="SPAC806.05"
FT   CDS_pept        complement(245304..246410)
FT                   /transl_table=1
FT                   /locus_tag="SPAC806.06c"
FT                   /product="nicotinamide mononucleotide (NMN)
FT                   adenylyltransferase (predicted)"
FT                   /EC_number="2.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.06c.1"
FT                   /db_xref="GOA:Q9UT53"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PomBase:SPAC806.06c"
FT                   /db_xref="PomBase:SPAC806.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT53"
FT                   /protein_id="CAB55285.2"
FT                   /translation="MHTMNGDNFANSFPKNPLLSRNSSSSNVIQYSDEFSPDEDWLNEH
FT                   AAKEHEERIRRPSVNRAWQKNSTSGGPSVSLEKREADVASLGEVMDLEEVPRGITRQAR
FT                   QLNEYIFPKHRFRNHLVDEGKIPLVLVACGSFSPITYLHLRMFEMATDTIQEQTNMELV
FT                   AGYFSPVNDHYKKEGLAPAYHRVRMCELACERTSSWLMVDAWESLQPSYTCTARVLDHF
FT                   DEEINQKRGGITLSDGTKRPCKIMLLAGGDLIASMGEPGVWSDKDLHHILGKFGCCIVE
FT                   RTGSDVWAFLLAHDIMFAYRGNILVIKQLIYNDISSTKVRLFIRRGMSIRYLLPNSVIQ
FT                   YIERYALYRDAEPVKTIFYQSPFVRMEP"
FT   5'UTR           complement(246411..247074)
FT                   /locus_tag="SPAC806.06c"
FT   misc_RNA        complement(247720..248448)
FT                   /locus_tag="SPNCRNA.629"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           247821..247927
FT                   /gene="ndk1"
FT                   /locus_tag="SPAC806.07"
FT   CDS_pept        247928..248383
FT                   /transl_table=1
FT                   /gene="ndk1"
FT                   /locus_tag="SPAC806.07"
FT                   /product="nucleoside diphosphate kinase Ndk1"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.07.1"
FT                   /db_xref="GOA:P49740"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="PomBase:SPAC806.07"
FT                   /db_xref="PomBase:SPAC806.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49740"
FT                   /protein_id="CAB55286.1"
FT                   /translation="MSTEQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRD
FT                   LVEEHYAEHKGKPFYEKLVGFMASGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPGTIR
FT                   GDYGIDLGRNVCHGSDSIESANREIKLWFQPSEIQVYDRTIEPWIYE"
FT   3'UTR           248384..248560
FT                   /gene="ndk1"
FT                   /locus_tag="SPAC806.07"
FT   3'UTR           complement(248579..248679)
FT                   /gene="mod21"
FT                   /locus_tag="SPAC806.08c"
FT   CDS_pept        complement(join(248680..250549,250607..250770))
FT                   /transl_table=1
FT                   /gene="mod21"
FT                   /locus_tag="SPAC806.08c"
FT                   /product="gamma tubulin complex subunit Mod21"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC806.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC806.08c.1"
FT                   /db_xref="GOA:Q9UT52"
FT                   /db_xref="InterPro:IPR032797"
FT                   /db_xref="PomBase:SPAC806.08c"
FT                   /db_xref="PomBase:SPAC806.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT52"
FT                   /protein_id="CAB55287.2"
FT                   /translation="MTMSRADQILQHLLRELIHNDSLVASEWLKHSKKIIQNVPSSTLV
FT                   FHEMIEHIKGICDKMGIQGREDLEMPLRNACEVLNRQTVSVKQSILHAQILKLFLELSK
FT                   PPSDIHVPQIPVYKDCNKNEQEAIIQLLTSCEGDHWLMPDWSSMPDDETITEDSEEETF
FT                   NGNANEITIPANIHIPIIEESDNASNNKLCTLFKKSKQPNLDFLQIKPFMFWDSSLNET
FT                   VRISERSIIRDSIYMLIGYPSFFFLKNGSKIETRLSLLPKLHHMSEEILRSIMTELADY
FT                   GSNLEFFRQKLTSPSDSFFKSDDQSTKNEPFLSVVFIYPQIKPHLLSCLKNTHQELIKL
FT                   ETEVYNATKNCTLFQFFQHVKKFVDPLLCFRFAYEKSATNMWDFVKTLEFIYSTRNYSS
FT                   QMFKLYKASAIAMLLWMVNQASQITSSMTIARPLYNILILCKDFPNNFLEKDNIALQLG
FT                   SIVFDQSPTLNNLLVEMEILIRSKILKLGKSLDLSFDFQSLMGEFENLIKQQEEAKKSL
FT                   WSKRFSRFYYGHYVFVNTCHNFFLTLYQSFTEVDENSIFNGVFETLNNDVDDESVIGEK
FT                   EKLILKQKQKCLSEFFVDDIKKLLNEELLNCQKQELPDVMENTYQISTVSGIKNDPLFT
FT                   LDQTCNIIAKLADNLIHPSVPIGSSAYRCRRNLADLLFLIMP"
FT   5'UTR           complement(250771..250983)
FT                   /gene="mod21"
FT                   /locus_tag="SPAC806.08c"
FT   3'UTR           complement(251173..251725)
FT                   /gene_synonym="SPAC806.09c"
FT                   /locus_tag="SPAC1639.01c"
FT   CDS_pept        complement(join(251726..252337,252392..252752,
FT                   253590..253714))
FT                   /transl_table=1
FT                   /gene_synonym="SPAC806.09c"
FT                   /locus_tag="SPAC1639.01c"
FT                   /product="GNS1/SUR4 family protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1639.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1639.01c.1"
FT                   /db_xref="GOA:Q7LKX0"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="PomBase:SPAC1639.01c"
FT                   /db_xref="PomBase:SPAC1639.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7LKX0"
FT                   /protein_id="CAB55288.3"
FT                   /translation="MPDSPTLHHNHIIGLENGSLTSNNNHQGMASVSVGQFQYPIWSWL
FT                   NSLADATFGKRPSSFEFIVNKTRFSSAPVVATIIISYYLLILVGGRIMRNRQPIRLQKI
FT                   FQYYNLTFSIASAILALLIFEQVAPAIYKHGFFFSICNEKAWTQPLVFLYYCAYISKFL
FT                   ELTDTFFLVLRKKPLQFLHCYHHGATAVLVYTQIVGRTSISWLIIEINLLVHVTMYYYY
FT                   YLVAKGIRVPWKKWVTRFQIVQFFADLGFIYFAVYTEVAYRLKFYKACMGHCSGHPLAA
FT                   FCGLATISSYLVLFIVFYHNTYKKNAALKMKAKAAAATKGNSSESSKNADLKRLSKSNA
FT                   SIAEVKCNNIVTNLYPISSGLNNEK"
FT   intron          complement(252753..253589)
FT                   /gene_synonym="SPAC806.09c"
FT                   /locus_tag="SPAC1639.01c"
FT   5'UTR           complement(253715..254600)
FT                   /gene_synonym="SPAC806.09c"
FT                   /locus_tag="SPAC1639.01c"
FT   misc_RNA        253719..255964
FT                   /locus_tag="SPNCRNA.630"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(255881..256029)
FT                   /gene="trk2"
FT                   /gene_synonym="SPAC1F5.12"
FT                   /locus_tag="SPAC1639.02c"
FT   CDS_pept        complement(join(256030..256134,256345..256370,
FT                   256427..256445,256542..256612,256684..256750,
FT                   256797..257009,257055..257070,257116..257135,
FT                   257179..257181,257229..258184,258220..259120,
FT                   259161..259315,259356..259461))
FT                   /transl_table=1
FT                   /gene="trk2"
FT                   /gene_synonym="SPAC1F5.12"
FT                   /locus_tag="SPAC1639.02c"
FT                   /product="potassium ion transporter Trk2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1639.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1639.02c.1"
FT                   /db_xref="GOA:Q10065"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004773"
FT                   /db_xref="InterPro:IPR015958"
FT                   /db_xref="PomBase:SPAC1639.02c"
FT                   /db_xref="PomBase:SPAC1639.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10065"
FT                   /protein_id="CAB55290.3"
FT                   /translation="MFVRYRRFLRRKILYRFYHAVIGFFYKRFRFLEYHYSFIIGMTIL
FT                   CSVILYGSGNLRYIDALLLASGSCTQTGLQPVDLTQISIYQQLTILLFGVLSTPITVNL
FT                   GLTLFKLYFYNKRYDMVITNNKLRMTYTYHTVRRRDTPEPSKVGNRKIRVLLDQGNQMH
FT                   RPVAPETKAEEAEHQENEKHHRHHFRLRKFANAIDRPSFFRGNTMPALPSYAGVRNSQE
FT                   NEDRTEALSPALGKRRMASIDNGSLSVVQNNARNNPVDFYIPSSFEESSFQTIPEDFEP
FT                   QVHDHENQTQLNHHLDNNSSISSHNPSLETANDGNQETVSSSNSNYSTTRVDNDPHVAS
FT                   YSPQNSNFDHQAAATTNDAHQNVVRGSAITIAPTPVPRHNRRPIYFADDTNGAEQEKGA
FT                   HRLDGRGRKRGKSFAVTPTLHRNERSMSVLPFQLAKSFTSALPRRLTFNRTHTKASTMS
FT                   LPYLSYNATVGRNSAFYALTPVEREELAGIEYESLRILTVILVVYFLFWHILGLVAFLI
FT                   FIYTAKTSGRVVTDGGINRGWWAAFTSSSLFDNLGYSLNSDSLNSFQKAIFPQVLGTIL
FT                   IFLGNTFFPIMLRFIIWIMIRTTRFSPNFQQALYFLFEHPRRSFTLLFPSKTTWVLFLN
FT                   LTLLNFASFFFFMVLDLGNSYVDKIPVGYRIMNAIFQNAATRSAGFTVVDLSQIAPAVM
FT                   VTYMFMMYISAYPIAMSIRQTNVYEERSLGIYAADTENDDDNNINNNNNDNNTPKRKNF
FT                   LMDHIQRQLSHDLWYLFLGYFIITIVEGRRLESEAEPQFTLFAILFEVISGYGTVGLSL
FT                   GYKNDPSLTAQFRKISKLVMVALQIRGRHRGLPSALDRAVLMPSDKNFDREEEDYMRRH
FT                   GKKNTNRADPVPSS"
FT   misc_RNA        256086..257001
FT                   /locus_tag="SPNCRNA.631"
FT                   /product="antisense RNA (predicted)"
FT   intron          complement(256135..256344)
FT                   /gene="trk2"
FT                   /gene_synonym="SPAC1F5.12"
FT                   /locus_tag="SPAC1639.02c"
FT   5'UTR           complement(259462..259505)
FT                   /gene="trk2"
FT                   /gene_synonym="SPAC1F5.12"
FT                   /locus_tag="SPAC1639.02c"
FT   5'UTR           259603..259718
FT                   /gene="tra2"
FT                   /locus_tag="SPAC1F5.11c"
FT   CDS_pept        join(259719..259782,259844..270747)
FT                   /transl_table=1
FT                   /gene="tra2"
FT                   /locus_tag="SPAC1F5.11c"
FT                   /product="phosphatidylinositol kinase-related protein Tra2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.11c.1"
FT                   /db_xref="GOA:Q10064"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033317"
FT                   /db_xref="PomBase:SPAC1F5.11c"
FT                   /db_xref="PomBase:SPAC1F5.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10064"
FT                   /protein_id="CAA92239.1"
FT                   /translation="MEDGFEKSLSSSIELLKAESTEIEEKIKLTKILITKVSSISSDAS
FT                   QLYAELIPLLLDFLRNTEVNLYRNSSVNELKIEALTLIQSCAHRDEFKQYAQSCVLSFI
FT                   SLIKADNEEVAVFCLKVIMDIFKTFKFCIESTAQPFFDLVLELSTNLPYLIPSIFVENP
FT                   KSNEEENTTLAFGSYLSTETSIIQQRVNSLAISTQPLELASQSFRVYVECPVIIVLILQ
FT                   AYRQAAFPGVQAIIPCFLKMVQIDVPIDIASYAMIEKDSSIDFIEFIRNKYQYRNFFMA
FT                   QVKTLSFLAYILRTHPNTLSEKDIIPDIVIKLLRRCPFDMCFARKELLVATRHILSTNL
FT                   KSLFVKKLDFLLDLNILLGNGVGTQKLLRPLAFSTLADLLHHVRDELNETQIRKSIMIY
FT                   STNMHDLTLSIGLQTMGARLILNMVDRMISLPSIPDAIFLLLSIFDSFVNKFSELNDSL
FT                   DQFFKKKYEEEIKETKSPTRSSPRDLSSFSTSVNDGSFLFKNLMFGLRALMYGLRTCKS
FT                   RCIEIGGEQFSGFLTNIKPFEAVTFQKLFFEVGKGFSYFRPEQVYLETFFCCEEESLDR
FT                   PAISTLPRNKDEKDCLEVFATIFIHLEPSIFLKVFETNLPTFFDQLKKNLTLFHIPQFL
FT                   LSNESTSSKFLNILLRFLLSRIEELGSSDIRHGSVLLRLFRLSFVTVSMFATENEPVLR
FT                   PYVSEIIVKCMKLAPNSANSLNYYYLLRALFRGIGGGRFESLYKEVMPLLHALLEAFNS
FT                   LLISARTPKEKDLFTELCLTIPVRLSLLLPYMSYLMRPLVMSLKSSQELVSQGLRTFEL
FT                   CLDNLTPDFLDPIMAPYIEDLMNALWSHLQPLPYNYNHSHTALKILGKLGGRNRKLLDR
FT                   VQSLKNSPEPNNDFTLLLSIKGVKQPQLLHYTQYVDEAVNLLSSPSSDLEVKQQAFTYV
FT                   CNISKLYVYKSDATNSLASSIRCTADKISKSNFDFRRPYSVIPSRMTGRSSFTQLSDDS
FT                   DETIILASATYGLFFATTVDELREEAYFWLEKLAVNVIVHDIFYAFDVIQGNHSKFTTN
FT                   LQKEVIISPHYFAHCLSEVVCNDNSKMGDAVKHVLKFMFSFLESIFENPERAFILPIFE
FT                   VLLSDFRHKCYDPHWYKKYGGCFGLECLIEQDHSSKWLFDRQVDILTALFFTLKDTTSE
FT                   VPTVCKDHVMDVLKQLFRKIYASKDTEIAPGILGHLVLELSNHNSVVRSSTQKLLSLLS
FT                   ELSNTPIVKLVSPFKERLLSPIFAKPLRALPFHIQIGHIDAVNYCISLGSELITFSDEL
FT                   IRLIHETTALAEADDDALIGIGKTSHFKNAALLIRLRVVCVELLSTCILKIDFNNPQHA
FT                   HLREGIIVVFFKSLYAKSKELIEAASLGLKNALQEDQKLSKELLQTTLRPILYNISDYR
FT                   RLSVAGLEGLGRLLRLLTNYFKVEIGRKLLDHLKALLENVDFQKVSSLPLFCQTEMKIV
FT                   RALIDLFHLLPNNANRFMDELLICVVEFSLRLQRTFPNYFSEPLLKYVNRYPEDAWKFF
FT                   MVRYDEAAFTSVFVELLRLKDSDPLLSVVKDNWLFFQTILTNEINTVTANRYSFALDSA
FT                   IVILQRDPSFFKDKNDFFRGSMDAVLAISHLVENESILESMVFWNDLLVRTSTFLLEVY
FT                   DLCIYNYDDGLKLLSCFHMYKNSLAKNLVSDLTAHLVKKIEEPDLENNVKLILNLILSK
FT                   DYGFLLKENLAGILLTYLNQNVSSLEKCNQIFSIFYEVFFQHPSTNVYANDEGIKIGAL
FT                   QIISFFLKNVPEITVQHQTEMLKMCSLFGNSEDVMIKQLSIYVMSLFILRSQFPYELVN
FT                   VVYMALLKSSPIEVRHLVKSSFDNIFSYIFSEEPESKKSPIWFELPLQVISSQSQNISQ
FT                   LLNVYDFISSHSDIFIEHRGRYVPILIDSLYKFGAIPNPNPEIRALSLGLIKVLLEWND
FT                   LQLKVDQKEIFSNNQKRAILSYLFRFVCLFSEPFTEGLCSEAISLLERLLSSGTWASLG
FT                   MKLSFFTKSITHFDATDANSVMFANSLRTLSIVVGHSDSAWIEENLSDLKFLLEKSLEN
FT                   ESVGVQSAIGNFVSTILTLSNTHPSIAGNPIFNDIWTSIASWTERRLQSCSQIEVTLPC
FT                   VECFFKYKKDALHTLLPGFMRCFHKVAKEFLSLGSQPSGNSLNLQIVNAVDERVSILKS
FT                   MIELGCSYISYLGDQRRWFLSALVQIIEKSSSYEICNYLLEIVRGWIMNSPVPVPTVKE
FT                   KAALLLKMVTFEGRFSQNEQNDLFNKYLSFIADIYEMEPYKNSELTFRLEAVYLLGTRV
FT                   ANKKLKERFIKGLNSSFPSDLFSRFQFLLGSQHWESLSNTYWIVQLNIFLSRCFDLNQR
FT                   CQFYKKPKLFSCFSIYCREFDEDLTSQAQDTEMLHNNLLKYGIIDFNQNSMLVSDFVLP
FT                   VLSLQFSNSKIAEYLWRDFFNASVCSFTKDEIPLCIGSIISFLSREYHIRLLGKTPNVL
FT                   ETILTSIVSSDMPIPLPPHLLVYLSKTYGLHHYCILLLENSLQNNPGLSEDELTVYHKS
FT                   CLDALSDIYYSLDEHDLYHGLWRRRANFLETEVATSHEQCHEWEKAQLVYEHAQLKVCT
FT                   GSLPYSPTEHGFWLDHWILCAQKLNQWDVLFDFSKQEGCAELYLECAWRLSDWSTEQDT
FT                   LEKATKSLSPFTSLRRHTADALLYLNKTQRKMGSVTEFSRIIDECMQFSLRRWQQLPKR
FT                   VYQSHVSLLHHFQEIVELQEAFGIYSQLNDTNIHNIDNKLRDIKVVLQGWRERLPNVWD
FT                   DIDIWSDLIAWRQSVFKSINKVFLPLVSIAQQSTNKSNTNSVSYLYRGYHELAWIINRF
FT                   AHVARVHHLPEVCINQLTKIYTLPNIEIQEAFLKLREQAECHYESPSEMQLGLEVINNT
FT                   NLMYFRNRQKAEFFTLKGMFQNRLGEKDEANQAFATAVQIDIGSGKAWSEWGLYHDELF
FT                   QANPQEIHHACNAVSCFLQASSLLSSSNSKPLLTRVLWLLSVDDSHGSVSEVVSSFKSE
FT                   IPTWNWIPFIPQLLSALSHRESIHARAILIQIAKTYPQSLHFQLRTAYEDFLMLKKQQA
FT                   ANVLRGNSRLRENDSSSDNKSKDLSPSGSFSSVSQFNSKNGSPSSIDSSEKHQISTVKP
FT                   AWELIADVTSILKTAYPLLALTMETMVDQIHTRLKSFPEEDAYRLIVALLNDGLQYISR
FT                   LGVVSKNTFQLPMSQANIQRFAENVLPVSVREAFLRDFVETKLDLLTYVDKLRMWRKKF
FT                   ENILDQRPKFLHLEQCSLYLSEFQHQKFDEVEIPGQYLLDKNNNNDFVRLERFVPNVDL
FT                   VRGHTMCYKRLTLRGYDGKLYPFALQYPATRHSRREERMLQLLGTFNTVLRSKIEIQNR
FT                   NFSFQIPSSIPLSSHMRIIADKPSYVTMQTISDEYCKNRGMPLDYGIRFYFDRLQTGLI
FT                   QLKRASASMLSNSTVEEKKQIFRQRALQLRMQLLETLNSSVFPESIYYDYFYKTFERYC
FT                   DFWFFRRTFTTQYAYMIIMTYVFNIGGRSPQKLFIVKDSGQVMSQDLLPSMTSNQPVFH
FT                   NTEAVPFRLTPPIQYLISDLGVEGLLSGLVMSIAQSLSSPTTDIKQYLSLYVRDEVFWW
FT                   SKQQRKPIPQGIQLFETVKVNVELLFRRISVISHNVPEDLPLNQTLVDLVSQATNPQQL
FT                   AQMDQLWQAWL"
FT   misc_RNA        complement(266551..267792)
FT                   /locus_tag="SPNCRNA.632"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           270748..271053
FT                   /gene="tra2"
FT                   /locus_tag="SPAC1F5.11c"
FT   3'UTR           complement(270893..271019)
FT                   /locus_tag="SPAC1F5.10"
FT   CDS_pept        complement(join(271020..272116,272170..272190,
FT                   272257..272323))
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F5.10"
FT                   /product="ATP-dependent RNA helicase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.10.1"
FT                   /db_xref="GOA:Q10055"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC1F5.10"
FT                   /db_xref="PomBase:SPAC1F5.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10055"
FT                   /protein_id="CAA92238.1"
FT                   /translation="MADEIMENVELTTSEDVNAVSSFEEMNLKEDLLRGIYAYGYETPS
FT                   AVQSRAIIQICKGRDVIAQAQSGTGKTATFSIGILQSIDLSVRDTQALILSPTRELAVQ
FT                   IQNVVLALGDHMNVQCHACIGGTSVGNDIKKLDYGQHVVSGTPGRVTDMIRRRNLRTRN
FT                   VKMLILDEADELLNQGFKEQIYDIYRYLPPGTQVVVVSATLPQDVLEMTNKFTTNPVRI
FT                   LVKRDELTLEGLKQYFIAVEKEEWKFDTLCDLYDTLTITQAVIFCNSRRKVDWLTEKMR
FT                   EANFTVTSMHGEMPQKERDAIMQDFRQGNSRVLICTDIWARGIDVQQVSLVINYDLPAN
FT                   RENYIHRIGRSGRFGRKGVAINFVTNEDVRILRDIEQYYSTVIDEMPMNIGDMV"
FT   misc_RNA        271077..272457
FT                   /locus_tag="SPNCRNA.633"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(272324..272610)
FT                   /locus_tag="SPAC1F5.10"
FT   misc_RNA        complement(272539..274901)
FT                   /locus_tag="SPNCRNA.634"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   CDS_pept        273152..274921
FT                   /transl_table=1
FT                   /gene="shk2"
FT                   /gene_synonym="pak2"
FT                   /locus_tag="SPAC1F5.09c"
FT                   /product="PAK-related kinase Shk2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.09c.1"
FT                   /db_xref="GOA:Q10056"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033923"
FT                   /db_xref="InterPro:IPR036936"
FT                   /db_xref="PomBase:SPAC1F5.09c"
FT                   /db_xref="PomBase:SPAC1F5.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10056"
FT                   /protein_id="CAA92237.1"
FT                   /translation="MLLSVRGVPVEIPSLKDTKKSKGIIRSGWVMLKEDKMKYLPWTKK
FT                   WLVLSSNSLSIYKGSKSESAQVTLLLKDIQKVERSKSRTFCFKLRFKSSTKNFEIQACE
FT                   LSVADNMECYEWMDLISSRALASKVSSPMNPKHQVHVGIDNEGNYVGLPKEWILLLQSS
FT                   SITKQECMEEPKAVIQALDFYSKQLDTTSETKDSFSFCKETLPRSSTTSYSIRDADKHH
FT                   KLTTSGVTKMNITERCKPKTTIQTDKKHIIRPFIEDKSHVESIMTGKVTKVPVKADSKN
FT                   TLSRRMTDRQALAMLKDSVTSHDPVEYFNVKHKLGQGASGSVYLAKVVGGKQLGIFDSV
FT                   AIKSIDLQCQTRKELILNEITVMRESIHPNIVTYLDSFLVRERHLWVVMEYMNAGSLTD
FT                   IIEKSKLTEAQIARICLETCKGIQHLHARNIIHRDIKSDNVLLDNSGNIKITDFGFCAR
FT                   LSNRTNKRVTMVGTPYWMAPEVVKQNEYGTKVDIWSLGIMIIEMIENEPPYLREDPIRA
FT                   LYLIAKNGTPTLKKPNLVSKNLKSFLNSCLTIDTIFRATAAELLTHSFLNQACPTEDLK
FT                   SIIFSRKANTHIN"
FT   CDS_pept        275089..276549
FT                   /transl_table=1
FT                   /gene="yam8"
FT                   /gene_synonym="ehs1"
FT                   /locus_tag="SPAC1F5.08c"
FT                   /product="calcium channel regulatory subunit Yam8"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.08c.1"
FT                   /db_xref="GOA:Q10063"
FT                   /db_xref="InterPro:IPR024338"
FT                   /db_xref="PomBase:SPAC1F5.08c"
FT                   /db_xref="PomBase:SPAC1F5.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10063"
FT                   /protein_id="CAA92236.1"
FT                   /translation="MFFFSTHLILKILFFWSITRNIFGATYTSLLLNNTINGNINDQST
FT                   AYYNLTWEGNTAYNVSLTLSTCTAFDGANDLMLYISNNTFDEALPLDNFTITASENGLA
FT                   TIFVTGYSPLYIAVSSAFSQFAPNFFVESGESTLEGNNVINYELAAGIDTPFSQYNATK
FT                   FLFAQDTDFQAALLITGNLTTNETSIIPSYEIYVNPSNSTYDNTFNKFSSSFCAFQNNP
FT                   STVNTNNADRSMTLRGLGPFAKEQFYLKGLDPNVTYTAYLVEPNIGQPGGTVYPGVTFT
FT                   TKTSPACQLIYDLQFCSEVAYAVPGNSSLFSASALAEWYDQQAYGYYQNFTYTLDLIPC
FT                   NATSWSAYSLLKNCSDCANSYKNWLCASVIPRCADINDNSSYLIYKNYDSRYPLIDEVI
FT                   QPGPYKEVLPCSYLCYSLASSCPLDLGFACPKAGYGLEFSYGEVSNVTGLITCNAPGVE
FT                   FYESGSALLNISWRTFFISLIFWILFVE"
FT   3'UTR           276550..276661
FT                   /gene="yam8"
FT                   /gene_synonym="ehs1"
FT                   /locus_tag="SPAC1F5.08c"
FT   3'UTR           complement(276657..278598)
FT                   /gene="lsh1"
FT                   /locus_tag="SPAC1F5.06"
FT   5'UTR           276723..276892
FT                   /gene="hem14"
FT                   /locus_tag="SPAC1F5.07c"
FT   CDS_pept        276893..278365
FT                   /transl_table=1
FT                   /gene="hem14"
FT                   /locus_tag="SPAC1F5.07c"
FT                   /product="protoporphyrinogen oxidase (predicted)"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.07c.1"
FT                   /db_xref="GOA:Q10062"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PomBase:SPAC1F5.07c"
FT                   /db_xref="PomBase:SPAC1F5.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10062"
FT                   /protein_id="CAA92235.1"
FT                   /translation="MSIAICGGGIAGLSTAFYLARLIPKCTIDLYEKGPRLGGWLQSVK
FT                   IPCADSPTGTVLFEQGPRTLRPAGVAGLANLDLISKLGIEDKLLRISSNSPSAKNRYIY
FT                   YPDRLNEIPSSILGSIKSIMQPALRPMPLAMMLEPFRKSKRDSTDESVGSFMRRRFGKN
FT                   VTDRVMSAMINGIYAGDLNDLSMHSSMFGFLAKIEKKYGNITLGLIRALLAREILSPAE
FT                   KALKAALLAEPKTAELSNSMKSTSMFAFKEGIETITLSIADELKKMPNVKIHLNKPAKT
FT                   LVPHKTQSLVDVNGQAYEYVVFANSSRNLENLISCPKMETPTSSVYVVNVYYKDPNVLP
FT                   IRGFGLLIPSCTPNNPNHVLGIVFDSEQNNPENGSKVTVMMGGSAYTKNTSLIPTNPEE
FT                   AVNNALKALQHTLKISSKPTLTNATLQQNCIPQYRVGHQDNLNSLKSWIEKNMGGRILL
FT                   TGSWYNGVSIGDCIMNGHSTARKLASLMNSSS"
FT   3'UTR           278366..278573
FT                   /gene="hem14"
FT                   /locus_tag="SPAC1F5.07c"
FT   CDS_pept        complement(278599..281145)
FT                   /transl_table=1
FT                   /gene="lsh1"
FT                   /locus_tag="SPAC1F5.06"
FT                   /product="ER heat shock protein Lhs1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.06.1"
FT                   /db_xref="GOA:Q10061"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="PomBase:SPAC1F5.06"
FT                   /db_xref="PomBase:SPAC1F5.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10061"
FT                   /protein_id="CAA92234.1"
FT                   /translation="MKRSVLTIILFFSCQFWHAFASSVLAIDYGTEWTKAALIKPGIPL
FT                   EIVLTKDTRRKEQSAVAFKGNERIFGVDASNLATRFPAHSIRNVKELLDTAGLESVLVQ
FT                   KYQSSYPAIQLVENEETTSGISFVISDEENYSLEEIIAMTMEHYISLAEEMAHEKITDL
FT                   VLTVPPHFNELQRSILLEAARILNKHVLALIDDNVAVAIEYSLSRSFSTDPTYNIIYDS
FT                   GSGSTSATVISFDTVEGSSLGKKQNITRIRALASGFTLKLSGNEINRKLIGFMKNSFYQ
FT                   KHGIDLSHNHRALARLEKEALRVKHILSANSEAIASIEELADGIDFRLKITRSVLESLC
FT                   KDMEDAAVEPINKALKKANLTFSEINSIILFGGASRIPFIQSTLADYVSSDKISKNVNA
FT                   DEASVKGAAFYGASLTKSFRVKPLIVQDIINYPYLLSLGTSEYIVALPDSTPYGMQHNV
FT                   TIHNVSTIGKHPSFPLSNNGELIGEFTLSNITDVEKVCACSNKNIQISFSSDRTKGILV
FT                   PLSAIMTCEHGELSSKHKLGDRVKSLFGSHDESGLRNNESYPIGFTYKKYGEMSDNALR
FT                   LASAKLERRLQIDKSKAAHDNALNELETLLYRAQAMVDDDEFLEFANPEETKILKNDSV
FT                   ESYDWLIEYGSQSPTSEVTDRYKKLDDTLKSISFRFDQAKQFNTSLENFKNALERAESL
FT                   LTNFDVPDYPLNVYDEKDVKRVNSLRGTSYKKLGNQYYNDTQWLKDNLDSHLSHTLSED
FT                   PLIKVEELEEKAKRLQELTYEYLRRSLQQPKLKAKKGASSSSTAESKVEDETFTNDIEP
FT                   TTALNSTSTQETEKSRASVTQRPSSLQQEIDDSDEL"
FT   5'UTR           complement(281146..281347)
FT                   /gene="lsh1"
FT                   /locus_tag="SPAC1F5.06"
FT   5'UTR           281774..281948
FT                   /locus_tag="SPAC1F5.05c"
FT   CDS_pept        281949..282404
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F5.05c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.05c.1"
FT                   /db_xref="GOA:Q10060"
FT                   /db_xref="InterPro:IPR028095"
FT                   /db_xref="PomBase:SPAC1F5.05c"
FT                   /db_xref="PomBase:SPAC1F5.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10060"
FT                   /protein_id="CAA92233.1"
FT                   /translation="MWSKLSISSKINRIRDPESDNTIEDTHVARVMRKYYMDKIGTLPE
FT                   WLRPPGWQPPVNTGPTSPVSINASNAAPSNLKASYIPANPRRLSSSTSSASSPPLRRLP
FT                   SVQHSTFDDLFEGVGSLQKSPSTTKPLSSTPSGSLLRSKFDHTRKKF"
FT   3'UTR           282405..282745
FT                   /locus_tag="SPAC1F5.05c"
FT   5'UTR           283287..283475
FT                   /gene="cdc12"
FT                   /locus_tag="SPAC1F5.04c"
FT   CDS_pept        283476..289001
FT                   /transl_table=1
FT                   /gene="cdc12"
FT                   /locus_tag="SPAC1F5.04c"
FT                   /product="formin Cdc12"
FT                   /db_xref="GOA:Q10059"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR042201"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10059"
FT                   /protein_id="CAA92232.1"
FT                   /translation="MRNSSKGQDPNFSYDSILSTPTPSARRTIGPRAPKSKTTYHKPPS
FT                   SIESVSTLIQPNKSQSVTSPYVKQFTFSSKEYNSHNKHALQNSQLPLPKTPEKSTVHRP
FT                   KANKVEVTDLPSSSSVEHLHTSKHLKGPRLPKNIIKSSEDVQIAPVTPPVHSRSFDPLP
FT                   KPPVPSVPVSKTKRRTKHKLAPVVEVPEITNEVSPKFTSTNDEQVYRLRSIRAGSPNSV
FT                   CSFQFEIPSTRPPSLDQLIHLFNDFLRHPVFDFDENAIEMLQSCTPDEKWCFIRSNFAG
FT                   FDDPSFQIPELAAVHRPVSWFVIQLWNKTISNLQLITLSSLLSTQSDRWISLFLELQGL
FT                   RALHNLLTYFNSSAVVQPQQAEVPRCMLTLLKKKPTLVTSNSYIFQAITVTLISPNLLP
FT                   RKVAADLLTWVLSLKEPLVVSILETGFKEINAEYEKEVPLFFGWIKSFKDIILEKELAR
FT                   TPPSSPARNSASSSPSNIAFLEYCTSTMEFINQLIVACEELEQGFDLDILDSLRESGIH
FT                   EVIQLLRNFPDQQLEKQLNIYESEEERRTISQTTHEDVDSFMSNESSILSSFNEFASNE
FT                   VGRLLESTIQNILLAKGTEKQKVKLIKVFNSLLQRILLNSKVSNESFEDSLQASLNMLT
FT                   ERFYSDDTARNALKEAKASRAMAEKMVIERDAMAAQVNLGAEDLIAKLNKEVEDQKDVI
FT                   LSQKRTNETLKTEIDALQKSHVTQIQRSEVELRELYLLINSDSFQGSTNSKERIIEYLL
FT                   DKLDLRKKEIAAESTLWSNDGIDDKLRDLREQMSRQSSQPSTVSTILQIPDKKFHRPFP
FT                   RHLHRYVGRSASESLTSEKDESIKSMKGIDDFANLEIPGKGIESNVVIKDISNQTHEIN
FT                   SVENKAETVSNNSKITNFDIPNDATSLPTIITHPTPPPPPPLPVKTSLNTFSHPDSVNI
FT                   VANDTSVAGVMPAFPPPPPPPPPLVSAAGGKFVSPAVSNNISKDDLHKTTGLTRRPTRR
FT                   LKQMHWEKLNSGLEFTFWTGPSDEANKILETLHTSGVLDELDESFAMKEAKTLVKKTCA
FT                   RTDYMSSELQKLFGIHFHKLSHKNPNEIIRMILHCDDSMNECVEFLSSDKVLNQPKLKA
FT                   DLEPYRIDWANGGDLVNSEKDASELSRWDYLYVRLIVDLGGYWNQRMNALKVKNIIETN
FT                   YENLVRQTKLIGRAALELRDSKVFKGLLYLILYLGNYMNDYVRQAKGFAIGSLQRLPLI
FT                   KNANNTKSLLHILDITIRKHFPQFDNFSPELSTVTEAAKLNIEAIEQECSELIRGCQNL
FT                   QIDCDSGALSDPTVFHPDDKILSVILPWLMEGTKKMDFLKEHLRTMNTTLNNAMRYFGE
FT                   QPNDPNSKNLFFKRVDSFIIDYSKARSDNLKSEEEEASQHRRLNLVNNHKEHVLERAMS
FT                   ENNKMDNEAMDGFLDKLRNVKLESHHKPRNRSAITMGKEHLIEAPNTSTKSSPAKNELF
FT                   VPKRSSVKSDLAKVRPRYPKGSESTDGLSDALNITPTKKGEVSSKAKKGYNYEKRRSGR
FT                   QVSDSYVLNKNSKNKSNKGRSASYTFSDPSSLEDSNRQKPFNGEKFRRFSSKSRRGSQN
FT                   RDSKKTGKARKDKGINNNQTSPQNKPSKESLKSDTISNEKKVFPQKASKVNLLTPTISN
FT                   GTRASKHANEKENTFPRGVENNLVAPMIPNNTELNEDTSAVSRNLENATNDLKETFPTT
FT                   TTISTARAKPGNNDINTILRRNNSRGRRRMLQQMSPLKSNKFSGTNDLNFQQATKPDGS
FT                   NKSSYMERLEKLKQNSERHLQSVGGKKVYSSEETPVNKILVSPSVSILDHNRILSQSTP
FT                   IKSPQRAQEMLAGLLSGKLAPKENEK"
FT   3'UTR           289002..289200
FT                   /gene="cdc12"
FT                   /locus_tag="SPAC1F5.04c"
FT   5'UTR           289790..289951
FT                   /locus_tag="SPAC1F5.03c"
FT   CDS_pept        join(289952..289985,290187..291301)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F5.03c"
FT                   /product="FAD-dependent oxidoreductase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.03c.1"
FT                   /db_xref="GOA:Q10058"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PomBase:SPAC1F5.03c"
FT                   /db_xref="PomBase:SPAC1F5.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10058"
FT                   /protein_id="CAA92231.1"
FT                   /translation="MSNSRNIVIVGGGITGVSCLYFLAHHPSFNRDRDTITLFESAGIA
FT                   SAASGKASGFLSLEWHGPSTSSLAALSYNLHKELSDQYDGVNKWGYRALDTWSIKADEN
FT                   CQQPDKLPEGIEWIAPSIVENVTRLGNKKNSGQVHPYKFCHAIYEEASKVANVTLVKGH
FT                   VLSVDENEVEYRLIGDDYAPDEEEEITSAEELHTIHSMEATHIIVAAGPWTPQLIPNLR
FT                   ISGARIHSITIDLPIKLNGNAVFSEITYKDGTIAAPEFYAREDELYVCGEFDDEPLPEL
FT                   SSDTKVDQDKCALIKQCANHFHQIIRDSPVKVRQACYLPISNATGAPVIGKIGSSIYVA
FT                   AAHGCWGITLGPGTGKVLSELILDGAVTSANIDLLDPEGSLE"
FT   3'UTR           291302..291927
FT                   /locus_tag="SPAC1F5.03c"
FT   3'UTR           complement(291979..292259)
FT                   /locus_tag="SPAC1F5.02"
FT   CDS_pept        complement(292260..293738)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F5.02"
FT                   /product="protein disulfide isomerase (predicted)"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F5.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F5.02.1"
FT                   /db_xref="GOA:Q10057"
FT                   /db_xref="InterPro:IPR005788"
FT                   /db_xref="InterPro:IPR005792"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PomBase:SPAC1F5.02"
FT                   /db_xref="PomBase:SPAC1F5.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10057"
FT                   /protein_id="CAA92230.1"
FT                   /translation="MKISNLLAAFLAFSGGFFCASAEVPKVNKEGLNELITADKVLMVK
FT                   FYAPWCGHCKALAPEYESAADELEKDGISLVEVDCTEEGDLCSEYSIRGYPTLNVFKNG
FT                   KQISQYSGPRKHDALVKYMRKQLLPTVKPISKDTLENFVEKADDLAVVAFFKDQKLNDT
FT                   YTEVAEVMKDDFVFAASDDKELAKSLGSNFPGIVAFTKDAAQDSDKLVYTGDWDPASIA
FT                   DFIGVSSIPLLDELNQMTFGKYQQSGLPLGIIFYNSTESRDELYDVFQPLAKKYQDTLR
FT                   FAFLDAVRYGAVAKQMNVESDWPAFVIANLKSMLKYPFPTTELTAKAMTKFVGDFVDGK
FT                   LQPKIKSQPIPESQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLA
FT                   EEYSDDSNVVVAKIDATENDISVSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFID
FT                   KHASFEPIKKEKESVPAPDLEDQVAVEDEMADEL"
FT   5'UTR           complement(293739..293771)
FT                   /locus_tag="SPAC1F5.02"
FT   misc_RNA        294010..294228
FT                   /gene_synonym="SPNG60"
FT                   /locus_tag="SPNCRNA.148"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(294591..294901)
FT                   /gene_synonym="SPAC1F5.01"
FT                   /locus_tag="SPAC18B11.11"
FT   CDS_pept        complement(294902..298786)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC1F5.01"
FT                   /locus_tag="SPAC18B11.11"
FT                   /product="GTPase activating protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.11.1"
FT                   /db_xref="GOA:Q09716"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="InterPro:IPR024584"
FT                   /db_xref="InterPro:IPR027107"
FT                   /db_xref="PomBase:SPAC18B11.11"
FT                   /db_xref="PomBase:SPAC18B11.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09716"
FT                   /protein_id="CAA92229.2"
FT                   /translation="MKALDIDTILTQISNQQSLDKRYKRIKRLINNEQFCKNVILQKLV
FT                   DSTKDIIENKVHGNILAATISLWTHAAEKHKEMSSDDRALLFNELSKVPNSEYYPATVD
FT                   ALIVITSQGERTESFSNDILKVLSEWLTDLFTIIDDMRAQSRKSFKGSAELRNYTRCFR
FT                   QIILLLTNMFRVGFNLFDEMEVSSMLANCVWVSKSTTDEEDIALVFSLLNCIISYGRIS
FT                   SAVLYSIVEVVCRAKFGLVASSQSAQQIVEKLLKTATKYEALNSLKRIMEETDEGSYIA
FT                   IMGGIQIVSALFTDIPRSVYCTRGMLLGFLQRSLKNKSSRIALETTRSLYNALERRSFV
FT                   EVLYADEWISLLDLLVEISSSLPKSLNYRPGTWQHIEPNIIESIASYQLQHLLLFNEIL
FT                   KPDSNHFVLEKFHEFLKINFSYLTPTLSQKLFTVLDLRSQLPYSEGWLEDQTILLKSYF
FT                   DTSFSLDFHVYLIGLFRKVLFACPVELRPEVYARMLCPLVKSLDKSSSEVIIDEVISLV
FT                   CDLSWIYPSNVFHEVKDSLCFYAHNSSNGDLQLRSIQAIVSLTFYYVLLPEFKSVLYDG
FT                   LVEISCDFKIRRTFRIPVLKLLLQLRINTNDYCFVNLSPAQLELISVYSTQWHNPFISE
FT                   EAQRCRDNKVKDRDLSFSPVFQKFPLKVNTSATLSKDLMSLPINEWVKNVMYIVTHETD
FT                   WKVVQYILINFTNQLRNTKMFTKTVEALQLLLNSLRDIINGKQSLNINFSDFFRIEDLL
FT                   VSLSKILSVLMVYKDVLPPTAHEQFFQLLNRFAEKGDKTMESCIDTLITNCCAMQSFSI
FT                   MHLPKFFSITMSSNLSERSLVNFLRLLHVVSDNWELNEGLEKETIQSICLFCLKVIRTK
FT                   KEELDGHKKLVNPNTKVFCLYLVSFSYSIISNLFLGCETTERAQLASFLLKEFLNLKNG
FT                   SHFEGYERVFYELLLRYTYSDERIESYPSDSRFHFNSSSKSWLYRGCVITINAEYETGD
FT                   YQMILRRMSGTTIYRFWRNMRDRGAFEKSLMMEQSMVSSELKQKYLQEIAASHVFMETV
FT                   LSPLDSPDEEPILIKPDARTEELIQSLDATHTKPVINIAVALQAGDVSDINTTVGWQLF
FT                   YRLLESFGHEKKLDNGETIYVWQSKTIEMIFRYVSDPAEALESSLYSSLIIIGSDDLVG
FT                   PDSLNWDSVDVPVIIKISLDSHLDALKMFDTLFHVKLEIITTGTDISHQSFWKLDQIIS
FT                   TNSIAPLLHSYLADIGLYQMIFENFAYVHPWLLRQQYIDTLYTIHQVPTTQRESSALPS
FT                   DKTFDFTLFL"
FT   5'UTR           complement(298787..299154)
FT                   /gene_synonym="SPAC1F5.01"
FT                   /locus_tag="SPAC18B11.11"
FT   3'UTR           complement(299278..299627)
FT                   /gene="tup11"
FT                   /locus_tag="SPAC18B11.10"
FT   misc_RNA        299464..299610
FT                   /gene="prl27"
FT                   /locus_tag="SPNCRNA.27"
FT                   /product="non-coding RNA, poly(A)-bearing (predicted)"
FT   CDS_pept        complement(join(299628..301263,301436..301520,
FT                   301588..301711))
FT                   /transl_table=1
FT                   /gene="tup11"
FT                   /locus_tag="SPAC18B11.10"
FT                   /product="transcriptional corepressor Tup11"
FT                   /db_xref="GOA:Q09715"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09715"
FT                   /protein_id="CAA90594.1"
FT                   /translation="MASVEDATKVQEMLDALKAEYNALAHHSFASKARGNDYESSMIQS
FT                   QIQEIEAFRKTVDDMYEKQKSIRETYEKDINKLKRELEELGVEANTASYRNRGERSELA
FT                   ASNNQVTHIDQEHPSQTKSTSQPPSNHLPAFQQIPPIHQSAYPQNNVAEVLMPPIPPSV
FT                   EASSGQNFNQGIASQNPAISTSNLPSTTPLYIPPVNYGANQVSQQPNPQLPGVSNYYNP
FT                   SATSKPAVNVQPPRIPTKATPSAEPSMTASANAGSISQAGPDGEYQGREQIAPVSDTEA
FT                   ARKTTSQSWYVTYNPACKRVFNINLVHTLEHPSVVCCVKFSNNGKYLATGCNQAANVFD
FT                   VQTGKKLFTLHEESPDPSRDLYVRTIAFSPDGKYLVTGTEDRQIKLWDLSTQKVRYVFS
FT                   GHEQDIYSLDFSHNGRFIVSGSGDRTARLWDVETGQCILKLEIENGVTAIAISPNDQFI
FT                   AVGSLDQIIRVWSVSGTLVERLEGHKESVYSIAFSPDSSILLSGSLDKTIKVWELQATR
FT                   SVGLSAIKPEGICKATYTGHTDFVLSVAVSPDSRWGLSGSKDRSMQFWDLQTGQSYLTC
FT                   QGHKNSVISVCFSPDGRQFASGSGDLRARIWSIDPASP"
FT   misc_RNA        300705..301411
FT                   /locus_tag="SPNCRNA.635"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(301712..301837)
FT                   /gene="tup11"
FT                   /locus_tag="SPAC18B11.10"
FT   5'UTR           303004..303160
FT                   /locus_tag="SPAC18B11.09c"
FT   CDS_pept        join(303161..303231,303334..303640,303716..303793,
FT                   303852..304019)
FT                   /transl_table=1
FT                   /locus_tag="SPAC18B11.09c"
FT                   /product="serine O-acetyltransferase activity (predicted)"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.09c.1"
FT                   /db_xref="GOA:Q09707"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="PomBase:SPAC18B11.09c"
FT                   /db_xref="PomBase:SPAC18B11.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09707"
FT                   /protein_id="CAA90593.1"
FT                   /translation="MTRTRVQKMIPKTIEYQKMISGQPYKAYDEELTQARCNAKKLMRR
FT                   FNDTMGDLENVGPAELIKRRAELLAEVFVFDESSAPEIEPPMAFDYGFNVHFGKKFFAN
FT                   YNCTFLDVAIITIGNNVMLGPNVQLCTATHPLDFKARNSGIEFGLPINIQDNVWIGMGV
FT                   IVLPGVTIGEGSVIGAGAVVTKDIPPNTLAVGSPAKPIRKIENE"
FT   3'UTR           304020..304161
FT                   /locus_tag="SPAC18B11.09c"
FT   5'UTR           304355..304462
FT                   /locus_tag="SPAC18B11.08c"
FT   CDS_pept        join(304463..304535,304674..304731,304771..304860,
FT                   304919..304955,305000..305029)
FT                   /transl_table=1
FT                   /locus_tag="SPAC18B11.08c"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.08c.1"
FT                   /db_xref="GOA:Q09714"
FT                   /db_xref="InterPro:IPR005351"
FT                   /db_xref="PomBase:SPAC18B11.08c"
FT                   /db_xref="PomBase:SPAC18B11.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09714"
FT                   /protein_id="CAA90596.2"
FT                   /translation="MAPAELKRPDLIVPYKARVKANEEVGLSLVSTATCMAALFLRFKL
FT                   IAWVAFILTFSNLLNANTSPSSSPTSMAFMGIAALVSTYLPQFLNTPNKT"
FT   3'UTR           305030..305168
FT                   /locus_tag="SPAC18B11.08c"
FT   5'UTR           305602..305722
FT                   /gene="rhp6"
FT                   /gene_synonym="ubc2"
FT                   /gene_synonym="sng1"
FT                   /locus_tag="SPAC18B11.07c"
FT   CDS_pept        join(305723..305764,305812..305876,306090..306210,
FT                   306316..306419,306468..306591)
FT                   /transl_table=1
FT                   /gene="rhp6"
FT                   /gene_synonym="ubc2"
FT                   /gene_synonym="sng1"
FT                   /locus_tag="SPAC18B11.07c"
FT                   /product="Rad6 homolog, ubiquitin conjugating enzyme E2
FT                   Rhp6"
FT                   /EC_number="6.3.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.07c.1"
FT                   /db_xref="GOA:P23566"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="PomBase:SPAC18B11.07c"
FT                   /db_xref="PomBase:SPAC18B11.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23566"
FT                   /protein_id="CAA90592.1"
FT                   /translation="MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPAD
FT                   TPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAA
FT                   ILTSIQSLLNDPNNASPANAEAAQLHRENKKEYVRRVRKTVEDSWES"
FT   3'UTR           306592..306762
FT                   /gene="rhp6"
FT                   /gene_synonym="ubc2"
FT                   /gene_synonym="sng1"
FT                   /locus_tag="SPAC18B11.07c"
FT   3'UTR           complement(306764..306963)
FT                   /locus_tag="SPAC18B11.06"
FT   CDS_pept        complement(306964..307947)
FT                   /transl_table=1
FT                   /locus_tag="SPAC18B11.06"
FT                   /product="U3 snoRNP-associated protein Lcp5 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.06.1"
FT                   /db_xref="GOA:Q09713"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="PomBase:SPAC18B11.06"
FT                   /db_xref="PomBase:SPAC18B11.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09713"
FT                   /protein_id="CAA90591.1"
FT                   /translation="MDVLNKSIQTALEALPKTSSSSSDGVSLVSLKCQLLLSYVQKLAF
FT                   LMLVKLDDESFLQHQDVVEKLVQLRIEIEKIRPLENRIQYSVDKLLRAAGRKEEIGSIK
FT                   EPENNGNDKDSQDSLKLHYKPNLSEFADDSDGPASENNVVKEDDKSSISSEDEEEELRS
FT                   AKDGIYRPPRIRAVTMDSEKRTRHRPNHLVDEFVSSDMSSVPQSMPSVGSNLEKRGRVI
FT                   HADERELQKMRERIEYEESNYTRLPKLSKKDLKKSKRVKKHDYGGEDWSLLDRKFHDDD
FT                   FSNRKLDLTSRAKRRANFEDVNDGSLASPVQIGQSYRKRKKNLKRR"
FT   5'UTR           complement(307948..308031)
FT                   /locus_tag="SPAC18B11.06"
FT   3'UTR           complement(308138..308380)
FT                   /gene="gpi18"
FT                   /locus_tag="SPAC18B11.05"
FT   CDS_pept        complement(join(308381..309719,309751..309806))
FT                   /transl_table=1
FT                   /gene="gpi18"
FT                   /locus_tag="SPAC18B11.05"
FT                   /product="pig-V, dolichyl-phosphate-mannose-glycolipid
FT                   alpha-mannosyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.05.1"
FT                   /db_xref="GOA:Q09712"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="PomBase:SPAC18B11.05"
FT                   /db_xref="PomBase:SPAC18B11.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09712"
FT                   /protein_id="CAA90590.2"
FT                   /translation="MYYIGHPSYYRKHIEHVCFQHSGILKKRNYQKNQKKYIMKLNESA
FT                   MKNAEKKSNSYLAIRMTRSGYNYFKGICVCTFLLSTILYLGIAVIMSHLCVFDDTAMLY
FT                   LRQNRSRLAESNIFRTLFISWIRWDAIYFVDMAVNGSLFEQEWAFSSLWPKIISFLAFR
FT                   SKDVVLLGIVSCFASIFFHAIACYALYLLTKSIFSNQKMTAYTVIFYCFSPSGIYMSVG
FT                   YTESLFAAFSFLGLLLFIKKQQYPAAFLWSLATLIRSNGIFWCIFFGMPAIGTLKISLE
FT                   RLQLTFMQVSQLVGYGTKCLIILVPFFYNQYLGFKLFCPGVAWCNKSLPLIYPAVQEKY
FT                   WNVGFLRYWTLNNIPNFLFALLSIIPILFALFYSISGSTLHSFRSIKSHLVLSALYLYI
FT                   GCFHMHTQVLNRMSSALPLLYWSMAHATLYAKSRNLKAFGHCILFVWIVYTVIQAGLYG
FT                   SFLPPA"
FT   5'UTR           complement(join(309807..309839,309889..310034))
FT                   /gene="gpi18"
FT                   /locus_tag="SPAC18B11.05"
FT   3'UTR           complement(310157..310658)
FT                   /gene="ncs1"
FT                   /locus_tag="SPAC18B11.04"
FT   CDS_pept        complement(join(310659..310790,310837..311180,
FT                   311299..311331,311371..311434))
FT                   /transl_table=1
FT                   /gene="ncs1"
FT                   /locus_tag="SPAC18B11.04"
FT                   /product="related to neuronal calcium sensor Ncs1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.04.1"
FT                   /db_xref="GOA:Q09711"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028846"
FT                   /db_xref="PDB:2L2E"
FT                   /db_xref="PomBase:SPAC18B11.04"
FT                   /db_xref="PomBase:SPAC18B11.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09711"
FT                   /protein_id="CAA90589.1"
FT                   /translation="MGKSQSKLSQDQLQDLVRSTRFDKKELQQWYKGFFKDCPSGHLNK
FT                   SEFQKIYKQFFPFGDPSAFAEYVFNVFDADKNGYIDFKEFICALSVTSRGELNDKLIWA
FT                   FQLYDLDNNGLISYDEMLRIVDAIYKMVGSMVKLPEDEDTPEKRVNKIFNMMDKNKDGQ
FT                   LTLEEFCEGSKRDPTIVSALSLYDGLV"
FT   intron          complement(310791..310836)
FT                   /gene="ncs1"
FT                   /locus_tag="SPAC18B11.04"
FT   intron          complement(311181..311298)
FT                   /gene="ncs1"
FT                   /locus_tag="SPAC18B11.04"
FT   intron          complement(311332..311370)
FT                   /gene="ncs1"
FT                   /locus_tag="SPAC18B11.04"
FT   5'UTR           complement(311435..311712)
FT                   /gene="ncs1"
FT                   /locus_tag="SPAC18B11.04"
FT   5'UTR           311920..312181
FT                   /locus_tag="SPAC18B11.03c"
FT   CDS_pept        join(312182..312212,312274..313586)
FT                   /transl_table=1
FT                   /locus_tag="SPAC18B11.03c"
FT                   /product="N-acetyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.03c.1"
FT                   /db_xref="GOA:Q09710"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="PomBase:SPAC18B11.03c"
FT                   /db_xref="PomBase:SPAC18B11.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09710"
FT                   /protein_id="CAA90588.2"
FT                   /translation="MDTYMEEREAGRLEIYSVKRNVLNMFSIVIVSATYSISLDSTVLY
FT                   PAVYHAIVNQPMLGARIHNCHSKIPIVKKLKTIDLDKVVKYADDQKVDSFCNNALQNFK
FT                   LCYDDETLPLWMVYVLNDKSELVFIYDHSLFDGGSGPLFHKYVLEGLQMSKTNFSSSTV
FT                   PVSELPLPKNLEKLIDVHPSWFCLMKALWTNSGLPFSKGFRSPSYKGHAPVRPFSSHTI
FT                   FFSISNAVVKNIKQLSKNIDASFTSIFYSVFMLSIYYAIAKNGKVNLDMLIDVNARRFL
FT                   PVAKQTMGNYVFSYVHHLNGFQPSQRQEDYKHTMVDLATEFSHRLKAALSNPREMSQQI
FT                   GLLSYIDIEDYLLKSCEKTRGNTAEISNLGYFSFPADSSVKIKNMAFAQPCSSLSAPFV
FT                   LNVITVADGPCSFSLSIFDDGNTEQTHELAIKIRDKFLSILEKVSMNS"
FT   misc_RNA        complement(312215..316276)
FT                   /locus_tag="SPNCRNA.636"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           313587..314040
FT                   /locus_tag="SPAC18B11.03c"
FT   5'UTR           313974..314029
FT                   /locus_tag="SPAC18B11.02c"
FT   CDS_pept        314030..315214
FT                   /transl_table=1
FT                   /locus_tag="SPAC18B11.02c"
FT                   /product="tRNA pseudouridylate synthase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC18B11.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC18B11.02c.1"
FT                   /db_xref="GOA:Q09709"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="PomBase:SPAC18B11.02c"
FT                   /db_xref="PomBase:SPAC18B11.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09709"
FT                   /protein_id="CAA90587.1"
FT                   /translation="MLKRPKRDPLKDCEYVFKGDGLRRVPPYYYEYITFAKLRWYGKTL
FT                   LEVFNTEFRDRESGYYEKAIRNGQVKVNNQIGNVDTLIENGYIVSHHAHRHEPPVSDQP
FT                   VGIVHEDESYVVIDKPAGVPVHPTGRYNHNTVLHILMKENKCSLLYPCNRLDRLTSGLM
FT                   FFSKSPKAAEEMRVHMISKSLKKEYVARVIGEFPNSGEVICDAPLLTVAPTLGLNRIHP
FT                   DGKEASTVFKRIAFDGHTSLVLCKPLTGRTHQLRVHLQYLGYPIANDPIYANKRVWGPS
FT                   LGKNGEGSNESVIMRLSEIGKTETASPLLQYEWYTNETEAEAKARRDKRLGELLTGKHC
FT                   SECGTPLYSDPSPEELGIWLHALKYESKDWSYKTQLPKWALDVCCRDPNALPIE"
FT   3'UTR           315215..315335
FT                   /locus_tag="SPAC18B11.02c"
FT   5'UTR           315394..315706
FT                   /gene_synonym="SPAC18B11.01c"
FT                   /locus_tag="SPAC12G12.16c"
FT   CDS_pept        315707..317197
FT                   /transl_table=1
FT                   /gene_synonym="SPAC18B11.01c"
FT                   /locus_tag="SPAC12G12.16c"
FT                   /product="Fen1 family nuclease, XP-G family (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.16c.1"
FT                   /db_xref="GOA:Q09708"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="PomBase:SPAC12G12.16c"
FT                   /db_xref="PomBase:SPAC12G12.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09708"
FT                   /protein_id="CAA90586.1"
FT                   /translation="MGVHGLLPIIRKVASEGIRWLQPEFFSKYYPVLAVDGNLLLYRFF
FT                   RSPNTPLHTNYQHVLWALKLSRYCRKLKTSPIVVFDNLKPNDFKAEEHEKRSLISSQIV
FT                   NQRQVVQEQMYFLCNLKNCLIDNNFPTGNFYYEIGPLLSQIGKLLFDLRSLNERDNPFH
FT                   AQNNAENLENATFVRLIVDKLNDREKTLMIQEKKNHLIHSLRQLLAFSEINDFPSEIRS
FT                   YLEFILSNLDLECLTLCLKIIKGILTLDELQKAIKLKQTELDKLERRLYRPSPQNIFEI
FT                   FEILKILGIPASFSPIGVEAEAFASAISQNNLAYAVATQDTDVLLLGSSMISNFLDLND
FT                   NFHLPLQIMDPRKIAQELNLTFDGFQDYCLMCGTDFTSRIPKIGPVRALKLIRYYGNAF
FT                   DVLKALNVEEKYIIPTDYIKKFLTAKKLFTDLPSNNELFSFIHNIPKEFLHLSDSTYLD
FT                   LEKQVLRIFNVQIEELDAKTPWYYHYELEKDVKSTYEY"
FT   3'UTR           complement(316996..317430)
FT                   /gene="sif3"
FT                   /locus_tag="SPAC12G12.15"
FT   3'UTR           317198..317585
FT                   /gene_synonym="SPAC18B11.01c"
FT                   /locus_tag="SPAC12G12.16c"
FT   CDS_pept        complement(join(317431..317469,317514..318172,
FT                   318221..318941))
FT                   /transl_table=1
FT                   /gene="sif3"
FT                   /locus_tag="SPAC12G12.15"
FT                   /product="Sad1 interacting factor 3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.15.1"
FT                   /db_xref="GOA:Q09877"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="PomBase:SPAC12G12.15"
FT                   /db_xref="PomBase:SPAC12G12.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09877"
FT                   /protein_id="CAA91510.3"
FT                   /translation="MSTKDKLNLPPKRTINTRLSTPVHIPPPINSESTRITPQHGSPPR
FT                   FGDHRISAAQGLFQRRRNARKIDHPLGWFLKNRHAAAHIPQRTTKTSQKLVLLPENHAV
FT                   NSFNEEESNYEDLLTPSDAYNLIKLENLPRDKREELGFPRATAYCVCEAFQLPKVKHFL
FT                   KHYHKVRAKKYDEVLYAVYHLPLVYGRSESCRVSSGPAPDDMPSSASNHNQKHLDSDKP
FT                   DNENFDSHIISQLYRISEIFVFSYGVVVFWNFSLSQEKDILADLTFGGDNSLMVKPLAE
FT                   EECEIEDLHFHYAPNTKRPRIYNDMIHIPSADNKMKLAMSHALAQSVKLSRFELRTDVT
FT                   MNSALFYPKKLALYGHLGLSRVEVVRMSGHLFQLRVDVNLISNILDTPDFLWDSEPLLL
FT                   PLYTAFREYLEIGPRTNVLNRRCKVIFDMLDIFGKSSADRKMNSITWIIIILISLFVII
FT                   FTLEVILRLRWAHR"
FT   misc_RNA        317718..319171
FT                   /locus_tag="SPNCRNA.637"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(318942..319185)
FT                   /gene="sif3"
FT                   /locus_tag="SPAC12G12.15"
FT   5'UTR           319815..319973
FT                   /gene="pfs2"
FT                   /locus_tag="SPAC12G12.14c"
FT   CDS_pept        319974..321503
FT                   /transl_table=1
FT                   /gene="pfs2"
FT                   /locus_tag="SPAC12G12.14c"
FT                   /product="WD repeat protein Pfs2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.14c.1"
FT                   /db_xref="GOA:Q9UTN4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC12G12.14c"
FT                   /db_xref="PomBase:SPAC12G12.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTN4"
FT                   /protein_id="CAB55873.1"
FT                   /translation="MERAENARIIQKPMTRRTVDYGSGLSKYIVNRHLRSNRYHIHVPR
FT                   PNPNQIINLYPPYEYKYNNTSSLCTKYIHTSANKARHVINVVRWTPDGRRLLTGSSTGE
FT                   FTLWNGLTFNFELINQSHDYAVRCAEWSTDGRWLISGDGGGMVKYFEPNLNNVKIVQAH
FT                   EMEVRDVAFSPNDSKFVTASDDGSLKVWNFHMSTEELKLTGHGWDVKTVDWHPSKGLLA
FT                   SGSKDNLVKFWDPRTGTCIATLHGHKNTIMQASFQKNFGSNYLATVSRDSTCRVFDLRA
FT                   MKDVRVLRGHEKDVNCVTWHPLYPNLLTTGGSDGSVNHYSLDEPPLLSQQKYHEKHPNV
FT                   TLSASSYLLYPTAEIPFAHDLGIWSMQYHPLGHLLCTGSNDKTTRFWSRSRPDDKESTM
FT                   DRHHLGEEQSEAMLSQRKAAIEEDDNYEPDENPLTETLANAHNPQFSGVLNLPGLGTMP
FT                   SFPSPYQHGQPQIPGMLHASLSNSYAEPSTQNSFIPGLTSKSQDGYPQNYR"
FT   3'UTR           321504..321825
FT                   /gene="pfs2"
FT                   /locus_tag="SPAC12G12.14c"
FT   5'UTR           321764..321923
FT                   /gene="cid14"
FT                   /locus_tag="SPAC12G12.13c"
FT   misc_RNA        complement(321796..322578)
FT                   /locus_tag="SPNCRNA.638"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        321924..323978
FT                   /transl_table=1
FT                   /gene="cid14"
FT                   /locus_tag="SPAC12G12.13c"
FT                   /product="poly(A) polymerase Cid14"
FT                   /EC_number="2.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.13c.1"
FT                   /db_xref="GOA:Q9UTN3"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="PomBase:SPAC12G12.13c"
FT                   /db_xref="PomBase:SPAC12G12.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTN3"
FT                   /protein_id="CAI79317.1"
FT                   /translation="MGKKSVSFNRNNYKKRKNERTEPLPRRIFKNDKPSKFKSKRKEKD
FT                   KNSDAYDEMLLNNNFTLLDQEEPMVEIGSKKSRNDNDSEGIRDKGGVEISNKNDPYIQF
FT                   GKADPLEPLEKPDLPEEAIKRGEPTILLGIPKREGRKTNPVHDKAVENNSDFIKFDWNS
FT                   DEDEDSVSNDKSKNNESLKKSSKNEIPGFMRQRGRFFHEANEKSDSNRKRKRQAYELDS
FT                   QSCPWHRQYKVEREVSRIFHQDILHFIDYITPTPEEHAVRKTLVSRINQAVLQKWPDVS
FT                   LYVFGSFETKLYLPTSDLDLVIISPEHHYRGTKKDMFVLAHHLKKLKLASEVQVITTAN
FT                   VPIIKFVDPLTKVHVDISFNQPGGLKTCLVVNGFMKKYPALRPLVIIIKHFLNMRALNE
FT                   VFLGGLSSYAIVCLVVSFLQLHPRLSTGSMREEDNFGVLLLEFLELYGKQFYYDAVGIA
FT                   VHNGGFYFSKKKMGWLKPNQPYLLSIQDPVDFQNDVSKSSRGLLRVKATFANGFDLLTS
FT                   KLYALASRIEREGVNRVKDFPSILSTILSVDEGVRQHREHMLKCYKNNPVPLEPLVEVD
FT                   ALASIDVDKLPLQDVGLQYVEDESDSDETDAAKDDLFKVNESIETNGHENFQKQALTST
FT                   GEQSSSNSRANPSKLFNISSDDSEDEVPIIEDTTASDEESRAKKIRKRF"
FT   3'UTR           323979..324129
FT                   /gene="cid14"
FT                   /locus_tag="SPAC12G12.13c"
FT   3'UTR           complement(324042..324193)
FT                   /locus_tag="SPAC12G12.12"
FT   CDS_pept        complement(join(324194..324407,324462..325166,
FT                   325225..325280))
FT                   /transl_table=1
FT                   /locus_tag="SPAC12G12.12"
FT                   /product="NST UDP-galactose transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.12.1"
FT                   /db_xref="GOA:Q09875"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="InterPro:IPR012404"
FT                   /db_xref="PomBase:SPAC12G12.12"
FT                   /db_xref="PomBase:SPAC12G12.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09875"
FT                   /protein_id="CAA91507.1"
FT                   /translation="MLLPIIMLTSGVANTVLSKYQDSIAEESEPIKSMAVLQSLNIFLG
FT                   EACLWFYVLYKRHSQGPGYESLDHLPLKHKVFMALPAIMDICGSTLMNVGLLYTSASIY
FT                   QMTRGSLIIFVALFATTLLKRTIGQLQWLSLSFVVLGVAIVGYSGSSSSIGSNPILGIT
FT                   AVLIGQFFLATQFTIEEYILSFIQVDPSELVAYEGTYGVFFVLLGMIISYYFIGSTTAG
FT                   YHGWFDYSHVISRFNEVPALYVISGVILVSIAFFNVSGLAITKLHSATTRSLLDIARTF
FT                   GIWIIAMAMGMESFHLLQFLGFVLLIYGIFTYHSIIKFPLAES"
FT   5'UTR           complement(325281..325517)
FT                   /locus_tag="SPAC12G12.12"
FT   5'UTR           326440..326693
FT                   /locus_tag="SPAC12G12.11c"
FT   CDS_pept        join(326694..326856,326942..327391,327498..327982)
FT                   /transl_table=1
FT                   /locus_tag="SPAC12G12.11c"
FT                   /product="DUF544 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.11c.1"
FT                   /db_xref="GOA:Q09874"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="InterPro:IPR033979"
FT                   /db_xref="PomBase:SPAC12G12.11c"
FT                   /db_xref="PomBase:SPAC12G12.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09874"
FT                   /protein_id="CAA91506.1"
FT                   /translation="MDNVQEHDPDTQEHNNETQNHKQEDHSNSYQTRTIPFIEPLSREY
FT                   QKRIILCQTVNGPCPIIALSNALILKSNVDRPFELPKKRYITPDELTEYLVEFAKAYGL
FT                   CKNQQSLQDKLTSMHFGQQLNPCLYDIEKFEYGHEIFCTFGVRLVHGWILSDDMGLSDE
FT                   DLSYLRKLEYYEKVADTFAERRSLLEMQEPLTEQQQDFLNNSTCVDKVMENRYTMQFLT
FT                   NAGLKKILELVGPGEIVVVFRSSHFSTMYSNPDSFAQFTLVTDSGYARTGEDVVWETFD
FT                   SQTVETGNGELCAANFIPAVYVLNQRKEEKKKRAKDDEQYAKRLAKEEEERGKKETPKK
FT                   ASNTPRRNKSNTQKSRKQSENCLIS"
FT   3'UTR           327983..328122
FT                   /locus_tag="SPAC12G12.11c"
FT   3'UTR           complement(328196..328221)
FT                   /gene="wdr21"
FT                   /locus_tag="SPAC12G12.10"
FT   CDS_pept        complement(328222..329484)
FT                   /transl_table=1
FT                   /gene="wdr21"
FT                   /locus_tag="SPAC12G12.10"
FT                   /product="WD repeat protein, human WDR21 family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.10.1"
FT                   /db_xref="GOA:Q09873"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC12G12.10"
FT                   /db_xref="PomBase:SPAC12G12.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09873"
FT                   /protein_id="CAA91505.1"
FT                   /translation="MSGLPFHIPGYYYNSEKKRYFRIISSGQSTPSSNIYTKERLKRGK
FT                   RFNNISKERTKGKGGNPVFNFSTYLFDRQFSQYPYSCNDDRDYLCAKNLKKINLRQLPV
FT                   GTELQKIGWLREVNTIILTSKNGDILGCCLTPEDKSGVANEKYTSEGSIQDFSLSRIGL
FT                   SNNPISSLVCNAMQIFWSTSPSLQNEGQFHISTYNQLLGESNNYRWGSLKLLKTPLCAE
FT                   SIGEMGFAVGGTSKIAIINREGKLTQSLQSKGDVFSLKYLGDNLVIAGCRNKSVLVYDL
FT                   RTKKECVQRFYHGSSICSMQNLDFSQPKLLVSGLESKISLYDCRFLQSKKRPQSIMSYM
FT                   GHSNLLERNLALMKNENGSIFSSAGDDYVLRFWKTDCSLPFKEMRVDDGKYLCRDGSWV
FT                   KAMNGTGWVLPYGRGLLIYEP"
FT   5'UTR           complement(329485..329545)
FT                   /gene="wdr21"
FT                   /locus_tag="SPAC12G12.10"
FT   CDS_pept        complement(329810..332743)
FT                   /transl_table=1
FT                   /locus_tag="SPAC12G12.09"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.09.1"
FT                   /db_xref="GOA:Q09872"
FT                   /db_xref="PomBase:SPAC12G12.09"
FT                   /db_xref="PomBase:SPAC12G12.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09872"
FT                   /protein_id="CAA91504.1"
FT                   /translation="MSFYKEKSINETNLGSFVDESNELFFSALSESSMNHGTPDDSILL
FT                   DLVSRSDNKDLYQDSLDVRDNFSNLSSDEIPQSSSYEQTRKPFFHHFNPFEFLEATSPL
FT                   QQNGKSRDTEKPPSMKEKDLSSNSSSQHDKAFHERVDQGKNKSSTTKYQEFRTVADYRE
FT                   FSPGQSVNSLKPNSGDEVPSTKSSTSSEMHTQLLKDEQKKILTPAPDVPHDVYCIEPSL
FT                   GRVFSFPASFVASPLLLEDCNKIASCDLPYSTFYANSQVIDKFSEYFAYVDQDPCHIRV
FT                   LNANTDQSLILYTQSDVKNLHFGKNKHTKPHLLVMDALSNLYVWKILQKRSEISVSLLF
FT                   TIRRANYGICDWIPNSSNMFSMIVKNSLYIVDISNIRSNNISPKVYAKDFNGLQAAKVD
FT                   LPGPINSYTISSDRSVVAILVNSQIFFYSFPVSNLFSTNPSHRGNWAAIATMSLQLPST
FT                   ANSISFLSSPPNNNDIIDKVICVSYANNTILGLFDFGLCAFTQEIEFSNEKEKSPIQQL
FT                   LTFNNSNMIVAKRNQLLDIFIYSPSDLSNVGVLSNTAALISAVSKGKRFGDSGYINKVI
FT                   SNEVVDHSIVFVTLIGCDSSKLELILALSSGYFQFCIESDSKFDEGTSLEYPNSDKRIL
FT                   ARASLTSGLKSNNTLRALSQDLKNCAKSKDDSTTQNLTESLGSVCYPSMPFFNQYVPQN
FT                   PNEVRENISSVMKSRIHAKFESLHSRVELVVKNSYMKLLEQTISEAATDEISDLFKLIH
FT                   SKPFLLEVGFLETGFLANDLENLTSTYRSSNRQLCDFSNRIGNINQKLEKLLMIERLET
FT                   SDQSPTSSSNFEESESFAVSKKVLELVRISKNKEALICFTKDPSIEAFRSLQDVPDYSL
FT                   DDCSSIHLLAFIHVLSKLIIKEEQLSFSRLQLLSRATSRLRTMTLSVFNNSGTLTPELF
FT                   SSVVRIVLKNVREFVLIGNSSIQKSKHEFLITTLQALLREVDIFLNT"
FT   5'UTR           complement(332744..332816)
FT                   /locus_tag="SPAC12G12.09"
FT   5'UTR           332838..333213
FT                   /locus_tag="SPAC12G12.17"
FT   3'UTR           complement(333178..333694)
FT                   /gene="mrpl6"
FT                   /locus_tag="SPAC12G12.08"
FT   CDS_pept        join(333214..333239,333291..333441)
FT                   /transl_table=1
FT                   /locus_tag="SPAC12G12.17"
FT                   /product="non-classical export protein 1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.17"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.17.1"
FT                   /db_xref="GOA:C6Y4B6"
FT                   /db_xref="InterPro:IPR024242"
FT                   /db_xref="PomBase:SPAC12G12.17"
FT                   /db_xref="PomBase:SPAC12G12.17.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6Y4B6"
FT                   /protein_id="CBA11489.1"
FT                   /translation="MSQPYLISKWMDPLFGIFVGTYGYYLYEKEHRPRGRSLRELALRK
FT                   WNKQAVSQQSMKN"
FT   3'UTR           333442..333578
FT                   /locus_tag="SPAC12G12.17"
FT   CDS_pept        complement(333695..334336)
FT                   /transl_table=1
FT                   /gene="mrpl6"
FT                   /locus_tag="SPAC12G12.08"
FT                   /product="mitochondrial ribosomal protein subunit L16
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.08.1"
FT                   /db_xref="GOA:Q09865"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="PomBase:SPAC12G12.08"
FT                   /db_xref="PomBase:SPAC12G12.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09865"
FT                   /protein_id="CAA91503.1"
FT                   /translation="MFSIDSCLKTRPLTFRIARLGMNFTTCSAARSYVGKKEIIVPKNI
FT                   QFDLEGEQLQITGPHGTLNMRFPNYLNLSKTNDILKVGMDANIEKQATKKQRAMWGTTR
FT                   AILANNVKGVTMYWQSIIKLVGIGYRTSLNDGNIHLKIGYANDILVSIPTDVQVENPTP
FT                   TSLVLRGIDRQKVTQFAAKIRSFKKPEPYKGKGIYVDGEKPQLKAKRSIS"
FT   5'UTR           complement(334337..334621)
FT                   /gene="mrpl6"
FT                   /locus_tag="SPAC12G12.08"
FT   5'UTR           334615..334659
FT                   /locus_tag="SPAC12G12.07c"
FT   CDS_pept        join(334660..334782,334830..335945)
FT                   /transl_table=1
FT                   /locus_tag="SPAC12G12.07c"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.07c.1"
FT                   /db_xref="GOA:Q09871"
FT                   /db_xref="PomBase:SPAC12G12.07c"
FT                   /db_xref="PomBase:SPAC12G12.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09871"
FT                   /protein_id="CAA91502.1"
FT                   /translation="MPSQGNNKNSENITQNPIEGELGSVIVEHLTKRIRNFTKKKQKIL
FT                   KLEEIAASDSNSLNDDQRKALQGKDAVLTTLNELKELLSQIDATRIRDEKHKRQFEATE
FT                   NAKRKEEIEAQYREGYDTAQKQVSSLVRFLRFASHNCVHPSDDAPFNSAVEKLLVIVYE
FT                   GTEKSEKAVADLNDSSTDVVPESEVSFQTISSRVDNFFAAPLPSEQAEELIEDDYAEQP
FT                   EQAVGQPIEQQSISDDEARQTNRPLNRGIQFLNESEIEGQHVEEPALPSETSVPANSTL
FT                   QVPTENVEVDVLGKDGTNIYPTQNQVVEQKQMQQKLDSMSPEWYQAADPSNGVVDGTPK
FT                   LNSNTRGSSKRPSVNRSQGSGQRGRGGRGFYRGGRGRGGFFNRSKRGQYSNSNNSTSQP
FT                   SPNAELSNFNPVA"
FT   intron          334783..334829
FT                   /locus_tag="SPAC12G12.07c"
FT   3'UTR           335946..336131
FT                   /locus_tag="SPAC12G12.07c"
FT   5'UTR           336308..336427
FT                   /locus_tag="SPAC12G12.06c"
FT   CDS_pept        336428..337519
FT                   /transl_table=1
FT                   /locus_tag="SPAC12G12.06c"
FT                   /product="rRNA processing protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.06c.1"
FT                   /db_xref="GOA:Q09870"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="PomBase:SPAC12G12.06c"
FT                   /db_xref="PomBase:SPAC12G12.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09870"
FT                   /protein_id="CAA91501.1"
FT                   /translation="MSTGQLKRFKGCEYLTHRLVLATLSGTPIRVEGIYPDEADPGVKD
FT                   YQVSFLRLLEKLTNGSVIEISYTGTSFIYRPGNIIGGRVVHDCPTTKGIGYFLEPILIL
FT                   CLFAKTPTSLTLTGVTSSNEDIGVDVLRTSVLPSLQKRFQVGDELELRILKRGSAPGGG
FT                   GEVNFLCPVIKESLPPIRLSEFGRVFRIRGIASSTRVSPAFANRLVESARGVLNPFIPD
FT                   VFIYTDVRRGDECGNSPGYSITLVAETNKGCSYAAEHCGEAGETPEDVGSFCAKKLLEV
FT                   IESGGCVDPYTQPSTLTGMLLSSEDVNTIVVGQLGITSQLVVFLRDVKALFNCEYRFKE
FT                   LESGQVEMSCLGKGYLNVNRRIQ"
FT   3'UTR           337520..338157
FT                   /locus_tag="SPAC12G12.06c"
FT   5'UTR           338286..338391
FT                   /gene="taf9"
FT                   /locus_tag="SPAC12G12.05c"
FT   CDS_pept        338392..338883
FT                   /transl_table=1
FT                   /gene="taf9"
FT                   /locus_tag="SPAC12G12.05c"
FT                   /product="SAGA complex/ transcription initiation factor
FT                   Taf9"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.05c.1"
FT                   /db_xref="GOA:Q09869"
FT                   /db_xref="InterPro:IPR003162"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="PomBase:SPAC12G12.05c"
FT                   /db_xref="PomBase:SPAC12G12.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09869"
FT                   /protein_id="CAA91500.1"
FT                   /translation="MSSPGISDESIKGPKDVRLIHLILSSLGVPSYSQTVPLQLLTFAH
FT                   RYTQQLIQDSQVYAEHSRGQNAPISVEDVRLAVASQINHSFTGPPPKEFLLELAMERNR
FT                   KPLPQIQPSYGFRLPPEKYCLTQPNWIVSNETQQNQPKEENSSDSRMEEDKLDFSVKSE
FT                   "
FT   3'UTR           338884..339763
FT                   /gene="taf9"
FT                   /locus_tag="SPAC12G12.05c"
FT   3'UTR           complement(339766..340106)
FT                   /gene="mcp60"
FT                   /gene_synonym="hsp60"
FT                   /locus_tag="SPAC12G12.04"
FT   CDS_pept        complement(340107..341855)
FT                   /transl_table=1
FT                   /gene="mcp60"
FT                   /gene_synonym="hsp60"
FT                   /locus_tag="SPAC12G12.04"
FT                   /product="mitochondrial heat shock protein Hsp60/Mcp60"
FT                   /db_xref="GOA:Q09864"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09864"
FT                   /protein_id="CAA91499.1"
FT                   /translation="MVSFLSSSVSRLPLRIAGRRIPGRFAVPQVRTYAKDLKFGVDARA
FT                   SLLTGVDTLARAVSVTLGPKGRNVLIDQPFGSPKITKDGVTVARSVSLKDKFENLGARL
FT                   VQDVASKTNEVAGDGTTTATVLTRAIFSETVRNVAAGCNPMDLRRGIQLAVDNVVEFLQ
FT                   ANKRDITTSEEISQVATISANGDTHIGELLAKAMERVGKEGVITVKEGRTISDELEVTE
FT                   GMKFDRGYISPYFITDVKSQKVEFENPLILLSEKKVSAVQDILPSLELAAQQRRPLVII
FT                   AEDVDGEALAACILNKLRGQLQVVAIKAPGFGDNRRNMLGDLAVLTDSAVFNDEIDVSI
FT                   EKAQPHHLGSCGSVTVTKEDTIIMKGAGDHVKVNDRCEQIRGVMADPNLTEYEKEKLQE
FT                   RLAKLSGGIAVIKVGGSSEVEVNEKKDRIVDALNAVKAAVSEGVLPGAGTSFVKASLRL
FT                   GDIPTNNFDQKLGVEIVRKAITRPAQTILENAGLEGNLIVGKLKELYGKEFNIGYDIAK
FT                   DRFVDLNEIGVLDPLKVVRTGLVDASGVASLMGTTECAIVDAPEESKAPAGPPGMGGMG
FT                   GMPGMM"
FT   misc_RNA        340209..341954
FT                   /locus_tag="SPNCRNA.639"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(341856..342080)
FT                   /gene="mcp60"
FT                   /gene_synonym="hsp60"
FT                   /locus_tag="SPAC12G12.04"
FT   3'UTR           complement(342090..343398)
FT                   /gene="cip2"
FT                   /locus_tag="SPAC12G12.03"
FT   CDS_pept        complement(343399..345129)
FT                   /transl_table=1
FT                   /gene="cip2"
FT                   /locus_tag="SPAC12G12.03"
FT                   /product="RNA-binding protein Cip2"
FT                   /db_xref="GOA:Q09868"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034069"
FT                   /db_xref="InterPro:IPR034186"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09868"
FT                   /protein_id="CAA91498.1"
FT                   /translation="MAEGTSQRPLTPLSQAFLSTNTLSPASSPLTFHSEAASLRRKRSN
FT                   FFPKLDELNGAQDEEMRGLNIPGGSGYLENRYGRDKFTFSDAAVNSAGMGGSGIFSHNN
FT                   ADDGLGDGSSTVLPSSLKQMLDPEISTANNPSAKPRRTRLQTAWKEATNSAGLSLRSAS
FT                   ALDVLKNSGPATTSLLSSTTYPFDSLNAFNEPSHSHVPNSASSTALSRGMSNSVTLTAP
FT                   PEPDEETIPTAIVIKNIPFSLKKEVLFKVFTALDIPRPYAFNYHFDNGVFRGLAFANFH
FT                   SPEEAKTVVQVLNGYEITGRRLRVEWKRQLPPAERERVERGKQEKRAVEERKNQLKSPF
FT                   SVANIGAGIDFDLNDPAILNVYSHILLFYYRSDNTNDLVFDSSTTQEERRVAALLASRL
FT                   NLNHSVTGDGEAKQVVITMPSTHFTPANNSSANHSPLMAPNASTLNPSSLGASNLSQPS
FT                   LANHLSSSGLFDNGLFSSGGLSSNFSSLRRPAPSMHLADSIRSLRGLNDSKAFSDIRSM
FT                   PATPLELATPFANLNVSSPLDRNATNSSNTLNGSAMNDYFASLTPSNTGAIGSRTFTKN
FT                   "
FT   5'UTR           complement(345130..345182)
FT                   /gene="cip2"
FT                   /locus_tag="SPAC12G12.03"
FT   3'UTR           complement(345234..345838)
FT                   /gene_synonym="SPAC630.01c"
FT                   /locus_tag="SPAC12G12.02"
FT   misc_RNA        345363..346322
FT                   /locus_tag="SPNCRNA.640"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(join(345839..346051,346114..346244,
FT                   346307..346439,346544..346618))
FT                   /transl_table=1
FT                   /gene_synonym="SPAC630.01c"
FT                   /locus_tag="SPAC12G12.02"
FT                   /product="rRNA processing protein, unnamed (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.02.1"
FT                   /db_xref="GOA:Q09867"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="PomBase:SPAC12G12.02"
FT                   /db_xref="PomBase:SPAC12G12.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09867"
FT                   /protein_id="CAB55874.1"
FT                   /translation="MPKFKGPGLSVLKKKIRDNERLLKKENLPANIRVEHERALLGLQE
FT                   QLSMAQLEHKKQKIFERYKKVRFFERKKAERRIKQLEKSLKDETMDDEKRKQCEKSMRK
FT                   CQIDLMYIKEYPPLTKYVSLYAEGTSEQTEETRNRIWAEMEERFNSGRKHKIPSSGSNR
FT                   VPVQEKSSTGGDLEDEFLQR"
FT   5'UTR           complement(346619..347735)
FT                   /gene_synonym="SPAC630.01c"
FT                   /locus_tag="SPAC12G12.02"
FT   5'UTR           346795..347194
FT                   /gene_synonym="SPAC630.02"
FT                   /locus_tag="SPAC12G12.01c"
FT   CDS_pept        347195..349912
FT                   /transl_table=1
FT                   /gene_synonym="SPAC630.02"
FT                   /locus_tag="SPAC12G12.01c"
FT                   /product="ubiquitin-protein ligase E3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC12G12.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC12G12.01c.1"
FT                   /db_xref="GOA:Q09866"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031488"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037593"
FT                   /db_xref="PomBase:SPAC12G12.01c"
FT                   /db_xref="PomBase:SPAC12G12.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09866"
FT                   /protein_id="CAA91496.2"
FT                   /translation="MLNRSKKRNGCYFWVNGSSDEIRYVAVKASPKVNWKTHIIWRSLK
FT                   NVKCIDSFHGNNEILGAGSSTGNISLLSVKHPEFQAVVTPGYARPCNSLAFSETEHLVA
FT                   GFAKSRNESSLKLWDLNSLLSDPKSSPLMQSSTLDGVSSVCYKKDTPLLLTGSTSRSVH
FT                   IIDTRQQLDSVSSVNTQYYSNIVVDPFSPNYFAANSYDGDIAIFDTRYFKSDNYLQIIL
FT                   RNENKKPKNPQLFALKYSEWKPGQLAVLSNNSITLRQLLPCVNGNEGSANNSVFVNYEK
FT                   KYPVKPNSQCSGIDFFTPSTAFPTHVQILGVINEQPKLFSVHDEVIPFSFNPYNDLIFS
FT                   FKEKLYPLNSSPFNTLSDVPQFDVSEFVDENSFDSSSSCSSKVFLTTRNNSINSEDSAH
FT                   EVLLSYNRVLGSDIQGTILDRVKKGYQFDSQKNSELVSDLYLKDLWSWIHLSHRQSEES
FT                   LFGDTGDTDFSYQGALGIWFMDTELTSMSDVFEAKESKFLEKKILRLARDVIERLDLDI
FT                   FTSIQTKRPLRQLALLACGLGMSNDDLLLEIRRLIRKNEHVKAAGLALFHGKIENVVRI
FT                   LSSGNELEKTISTAVAGYITSQGLSNFGSDSLWKEMSRNLSTELEDPYLRAIFAYVSNS
FT                   DWRDVLDEVSLSLKDRLGIALRFLPDDDLSNYLCDLCHTTVQSGDPEGLLLTGLTPLGM
FT                   ELLQNYIDHTSDVQTAALIAAFVVPKKFLDKRAEDWTESYRELLNRWKLYRERAKFDIF
FT                   RTELSKNHTGEITRKATEPSIRIICNFCRKPIFPFSNRNECNNLPTPIQRGVSKAGPAK
FT                   HLGKSCPHCGQPLPKCSVCGFSLGDEDVPQKDDFSQKPQNYVKEVNLQKSRFGLWFSFC
FT                   LNCGHGAHASHASEWFSTHTICPVPNCDCECKLK"
FT   3'UTR           349913..350151
FT                   /gene_synonym="SPAC630.02"
FT                   /locus_tag="SPAC12G12.01c"
FT   3'UTR           complement(350239..352426)
FT                   /locus_tag="SPAC630.04c"
FT   5'UTR           350406..350476
FT                   /gene="arp3"
FT                   /gene_synonym="act2"
FT                   /locus_tag="SPAC630.03"
FT   CDS_pept        join(350477..350511,350575..350598,350671..351199,
FT                   351295..351894,351960..352055)
FT                   /transl_table=1
FT                   /gene="arp3"
FT                   /gene_synonym="act2"
FT                   /locus_tag="SPAC630.03"
FT                   /product="actin-like protein Arp3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.03.1"
FT                   /db_xref="GOA:P32390"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="PDB:3DWL"
FT                   /db_xref="PomBase:SPAC630.03"
FT                   /db_xref="PomBase:SPAC630.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32390"
FT                   /protein_id="CAB52725.1"
FT                   /translation="MASFNVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASSG
FT                   PAVSSKPSYMASKGSGHLSSKRATEDLDFFIGNDALKKASAGYSLDYPIRHGQIENWDH
FT                   MERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQAVL
FT                   ALAASWTSSKVTDRSLTGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQS
FT                   LLRDRNEPDSSLKTAERIKEECCYVCPDIVKEFSRFDREPDRYLKYASESITGHSTTID
FT                   VGFERFLAPEIFFNPEIASSDFLTPLPELVDNVVQSSPIDVRKGLYKNIVLSGGSTLFK
FT                   NFGNRLQRDLKRIVDERIHRSEMLSGAKSGGVDVNVISHKRQRNAVWFGGSLLAQTPEF
FT                   GSYCHTKADYEEYGASIARRYQIFGNSL"
FT   3'UTR           352056..352296
FT                   /gene="arp3"
FT                   /gene_synonym="act2"
FT                   /locus_tag="SPAC630.03"
FT   CDS_pept        complement(352427..352927)
FT                   /transl_table=1
FT                   /locus_tag="SPAC630.04c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.04c.1"
FT                   /db_xref="GOA:Q9UUH8"
FT                   /db_xref="PomBase:SPAC630.04c"
FT                   /db_xref="PomBase:SPAC630.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH8"
FT                   /protein_id="CAB52726.1"
FT                   /translation="MGEEISAIDLVMANDQLVSTSDASDIPYDPYSQFWGKVLVLTFGI
FT                   ICVVFVIFMLHHERIKACRTIISAREQQRTQHSIHRRERSSSGASQQFEHHVRQTDCLP
FT                   LYEPITALNQQYLKTLPTTSTPPPPAIFDENGEFVGDVPSVAGAIERPPSYESLPAPQN
FT                   DEV"
FT   5'UTR           complement(352928..353340)
FT                   /locus_tag="SPAC630.04c"
FT   3'UTR           complement(353705..356232)
FT                   /locus_tag="SPAC630.06c"
FT   5'UTR           353783..353899
FT                   /gene="gyp7"
FT                   /locus_tag="SPAC630.05"
FT   CDS_pept        353900..356131
FT                   /transl_table=1
FT                   /gene="gyp7"
FT                   /locus_tag="SPAC630.05"
FT                   /product="GTPase activating protein Gyp7 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.05.1"
FT                   /db_xref="GOA:Q9UUH7"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR021935"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="PomBase:SPAC630.05"
FT                   /db_xref="PomBase:SPAC630.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH7"
FT                   /protein_id="CAB52727.1"
FT                   /translation="MTTLESLDMPEMTEVEDDTVDIHIDNSKVALLFSKSKVFVHPTSK
FT                   MKDNISGYLSLSKSKALGNSSVAGSDILLSWVPDSFLKNRPRDLSVFQNAETLSNGSIR
FT                   EWVEIPQHLDYSFSVRLCSIYSIIFRPPRYGWNYGSIVINLRDSGESLPPLFFHDDECI
FT                   STIEYGKQITRDRFDPFDESGNMFWGGTHLLMQLKKYASLEQSSHESQLYLVNPSPEDT
FT                   VAFQSVELQKVISNNRLNSSSTPPTPRSSSSIFNPFRRALHDLSFTVLERFSRVTNYGK
FT                   SEVDRLMEHKVTKSILPHLPRELQVLLESKRVQKLTEEYDPARMFLARWAEGIVEQSES
FT                   NNSQPVNNAGVWTDAQREEDSSLGPFELVYIEERVKRDDPLSVEQWNSMFNAHGKLQVD
FT                   VHRVLGIIFHGGIQPSLRKEVWPFLLSVYPWDSTSEERRVIYLSLQEEYCTLKRKWYED
FT                   IHKQFNDRWFIEQRNRIEKDVHRTDRQHEYFQIEDLPHPDPQSTFTGTNMNMEMMKDIL
FT                   LTYNEYDTELGYVQGMSDLLAPIYVTFNDNALTFWGMVGLMKRLHFNFLRDQSGMHRQL
FT                   DTLRLLIEFMDPELFAHLEKTDSSNLFCFFRMLLIYFKREFDWEVLLKLWDVLFTNYLS
FT                   YDYHIFVAYAIAERHREVLLNQTSAFDEVLKYFNELSGKLALEPTLICAEQCFYQFKNK
FT                   LALIDRKQMEETNSDEDGSKETDLPTIAPYLRNLLKTSQPQYTPSGKQE"
FT   3'UTR           356132..356580
FT                   /gene="gyp7"
FT                   /locus_tag="SPAC630.05"
FT   CDS_pept        complement(join(356233..356433,356511..356592,
FT                   356635..356904,356984..356997))
FT                   /transl_table=1
FT                   /locus_tag="SPAC630.06c"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.06c.1"
FT                   /db_xref="GOA:Q9UUH6"
FT                   /db_xref="InterPro:IPR018555"
FT                   /db_xref="PomBase:SPAC630.06c"
FT                   /db_xref="PomBase:SPAC630.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH6"
FT                   /protein_id="CAB52728.1"
FT                   /translation="METVKVTRKDLLLSPENKEIDSLDDVSALLSQRLSNVFEFSIASE
FT                   EVQSDEVFEDTYPNDDQATFNLFSDVNTVVTKVTEPSIKNSRPLNYYILEDSPERQRQL
FT                   QASVFTYDQLMKAKEEKWPACQKLHKVVSIKKEESKHRRRPSKKRRIRMKLLREKEEQL
FT                   KRQAMAAKRNRFRKNVRKLPNKKKH"
FT   5'UTR           complement(356998..357205)
FT                   /locus_tag="SPAC630.06c"
FT   3'UTR           complement(357325..357592)
FT                   /locus_tag="SPAC630.07c"
FT   CDS_pept        complement(357593..358885)
FT                   /transl_table=1
FT                   /locus_tag="SPAC630.07c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.07c.1"
FT                   /db_xref="GOA:Q9UUH5"
FT                   /db_xref="PomBase:SPAC630.07c"
FT                   /db_xref="PomBase:SPAC630.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH5"
FT                   /protein_id="CAB52729.1"
FT                   /translation="MDQYRDLPKEDPDTAIEYESGVDEESSLKIEKFRVLIFGKDNSQD
FT                   DLVKSVFNLSKLSEKEKMPFGIKCESEENPNFESYHSKVGKKSCKRFMRWLKANAFAEE
FT                   RDIDCIWYQLNLLDISDEDILCLQYLQGCLIPIVSIIYDFNEFLSPFTKSFLSKIGESN
FT                   TITVKGMPLADVLVFRKKVLKLVSQLSFMTDRKELVYTTCLALEDDDAYTNFVSAQQED
FT                   SSCKFYGGILIGVSHCKYAAAGASYPLPIPASGLLAQKLAIGLLCKDIIKLWNLCPESS
FT                   ILTKEILLELPKASDVAKSIGKMILTSMFVPLWLLKGIWEAPATAKIIIGSIADVTLPV
FT                   QRMYYFIKAGGKLDVPTIHAFYQHYKEFVRPKCLEHIAEITTFNVVTAFSSEAVYQEAI
FT                   RLLDRFRYVSKSSEEDLIVPSFVVNDLITYD"
FT   misc_RNA        358613..359235
FT                   /locus_tag="SPNCRNA.641"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(358886..359228)
FT                   /locus_tag="SPAC630.07c"
FT   3'UTR           complement(359638..360059)
FT                   /gene="erg25"
FT                   /locus_tag="SPAC630.08c"
FT   CDS_pept        complement(360060..360962)
FT                   /transl_table=1
FT                   /gene="erg25"
FT                   /locus_tag="SPAC630.08c"
FT                   /product="C-4 methylsterol oxidase (predicted)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.08c.1"
FT                   /db_xref="GOA:Q9UUH4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="PomBase:SPAC630.08c"
FT                   /db_xref="PomBase:SPAC630.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH4"
FT                   /protein_id="CAB52730.1"
FT                   /translation="MNTTSEVIVGTGFQAIRQQLAQMHPELNFVEQLWLAYYKWFDNDV
FT                   VATGLMSFLLHELIYFGRCIPWMIIDAMPYFRRWKIQPKKVPTLAEQWECTRLVLLSHF
FT                   TVELPQIWLFDPMCATFGLSTSVPFPPVTKMIWQITLFFFLEDTWHYWAHRLFHYGIFY
FT                   RFIHKVHHRYSAPFGLSAEYAHPLEIILLGAGTVFVPLMWCYFTHDLHLVTMYIWITLR
FT                   LFQAVDSHAGYDFPWSLNKFLPIWAGADHHDYHHMAFKDNFSSSFRWWDAVLKTDQNYH
FT                   QFKARRLAAKYEAESKKAK"
FT   5'UTR           complement(360963..361266)
FT                   /gene="erg25"
FT                   /locus_tag="SPAC630.08c"
FT   misc_RNA        complement(361498..362202)
FT                   /locus_tag="SPNCRNA.642"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        361557..361874
FT                   /transl_table=1
FT                   /gene="mug177"
FT                   /locus_tag="SPAC630.15"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.15.1"
FT                   /db_xref="GOA:Q9C110"
FT                   /db_xref="PomBase:SPAC630.15"
FT                   /db_xref="PomBase:SPAC630.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C110"
FT                   /protein_id="CAC35074.1"
FT                   /translation="MYPKIVARCMIVITKNRESERNVLICYRNVTNVYFSLRILLNRQN
FT                   EGNNCKYKLVFSLYRVSFRRMRLNDRQLSCVESVTNGIGLLCLKQADQVCLFTPTVDSH
FT                   L"
FT   3'UTR           361875..363654
FT                   /gene="mug177"
FT                   /locus_tag="SPAC630.15"
FT   3'UTR           complement(362248..362768)
FT                   /gene="mug58"
FT                   /locus_tag="SPAC630.09c"
FT   CDS_pept        complement(362769..363602)
FT                   /transl_table=1
FT                   /gene="mug58"
FT                   /locus_tag="SPAC630.09c"
FT                   /product="glycerate kinase (predicted)"
FT                   /db_xref="GOA:Q9UUH3"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH3"
FT                   /protein_id="CAB52731.1"
FT                   /translation="MSSLEIIVDKILKFLEKQPKPEGRPFILGISGPQGSGKSTLASAL
FT                   DTELTRKNESVVKFSLDDFYLTHAEQVELAKNNPNNPLVQHRGLAGTHDVTFLNNVLNA
FT                   FVKGSDEEVSIPFYDKSKFGGYGDRGDESQWKKANPKTTTYVIFEGWMVGFEPLDSCML
FT                   SVRARSTRWQNIEGSLLWVNRKLADYQPIFQKIDSLVELEAQEINYVYRWRLQQEHALK
FT                   ARIHKGMSDEEVIEFVNHYMPQYVFYLGTLSNKVHLNPHCLEIILDENRYPVVMH"
FT   5'UTR           complement(363603..363714)
FT                   /gene="mug58"
FT                   /locus_tag="SPAC630.09c"
FT   tRNA            365155..365226
FT                   /locus_tag="SPATRNAPRO.01"
FT                   /product="tRNA Proline"
FT   5'UTR           365204..365549
FT                   /locus_tag="SPAC630.10"
FT   CDS_pept        365550..366362
FT                   /transl_table=1
FT                   /locus_tag="SPAC630.10"
FT                   /product="conserved eukaryotic protein, DUF3321 family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.10.1"
FT                   /db_xref="GOA:Q9UUH2"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="PomBase:SPAC630.10"
FT                   /db_xref="PomBase:SPAC630.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH2"
FT                   /protein_id="CAB52732.1"
FT                   /translation="MRPIPVKNRIGKNNIDNAKGLKGNKLIRHYHNLLKEKSRLIASSA
FT                   PIEKIKNVESELENIGIDAYQRASRSGQAEGKGGDSSKILIKWIRTTPCFSYCARLKEP
FT                   KDLLEIGSVSVDNKCSTCGLFRVSRIDLHSVHPLIKQQDFLERTPEEGLFTGISCSLVL
FT                   NFAPPELRAKMLLHCTGLLMPPNKEQPPWLFLVLPSPCITNSRYMDEKTLHSIMIQFGF
FT                   ICRQKSISKKIAYYLYSYECFPMKEIDWKKKIVNDGATRNNFFIPCIL"
FT   3'UTR           366363..366442
FT                   /locus_tag="SPAC630.10"
FT   5'UTR           366634..366800
FT                   /gene="vps55"
FT                   /locus_tag="SPAC630.11"
FT   CDS_pept        join(366801..366817,366873..366891,366968..367040,
FT                   367105..367189,367293..367348,367395..367531)
FT                   /transl_table=1
FT                   /gene="vps55"
FT                   /locus_tag="SPAC630.11"
FT                   /product="vacuolar sorting protein Vps55 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.11.1"
FT                   /db_xref="GOA:Q9UUH1"
FT                   /db_xref="InterPro:IPR007262"
FT                   /db_xref="PomBase:SPAC630.11"
FT                   /db_xref="PomBase:SPAC630.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH1"
FT                   /protein_id="CAB52733.2"
FT                   /translation="MSDLRKIIGLSSVLAVGFMLVILSCALFKNWYPLLIVIPFILAPL
FT                   PNLLTKKYSTSHDFLQEEDRNLLDFGRFTFGATICTGFALPIVFVNVGLIGTAAATMSC
FT                   VGGSIIFLVITLYSQAFVQHEEEF"
FT   3'UTR           367532..367890
FT                   /gene="vps55"
FT                   /locus_tag="SPAC630.11"
FT   5'UTR           368040..368571
FT                   /locus_tag="SPAC630.12"
FT   CDS_pept        368572..369840
FT                   /transl_table=1
FT                   /locus_tag="SPAC630.12"
FT                   /product="ER lipid phosphatase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.12.1"
FT                   /db_xref="GOA:Q9UUH0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR033308"
FT                   /db_xref="InterPro:IPR041834"
FT                   /db_xref="PomBase:SPAC630.12"
FT                   /db_xref="PomBase:SPAC630.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUH0"
FT                   /protein_id="CAB52734.1"
FT                   /translation="MKVGRFLVIIAFCFYVLYLEKIIHTRPHKKCDWRSWEQWESTGNP
FT                   VRIALVADPQLVDDLTYDYPRPLIGIVKWISDQFLRRHWRYLHKSLKPDITFIMGDLMD
FT                   TGREFATEEFKKDYFRMMNVLDPKFTNKLEIYPGNHDIGFGNHAIVKDIQRFESLFGPT
FT                   SRSIDVGNHTLVIVDGIRLSNNVNPQVYQPARDFLKSFETNKDNSRPRILLSHVPLFRP
FT                   AINSCGELREKDDVIKYGLGYQYQNLLLPELSESILKAVEPIAAFAGDDHDYCEVVHNY
FT                   QVDTREAATTEYNVKAFSMTSGILYPGYQLLSLNYPYDNPKADQKSSYQTKLCILPNQI
FT                   QIYVWYGASISIFFALILLRTAIFFFGTDRYSLPLYKTHARRFSLSTTIHLFKKIVRIT
FT                   LSTFISYTWIPFLLFIFLNIFII"
FT   3'UTR           complement(369791..369944)
FT                   /gene="tsc2"
FT                   /locus_tag="SPAC630.13c"
FT   3'UTR           369841..369950
FT                   /locus_tag="SPAC630.12"
FT   CDS_pept        complement(369945..373964)
FT                   /transl_table=1
FT                   /gene="tsc2"
FT                   /locus_tag="SPAC630.13c"
FT                   /product="tuberin"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC630.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC630.13c.1"
FT                   /db_xref="GOA:Q9UUG9"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="InterPro:IPR024584"
FT                   /db_xref="InterPro:IPR027107"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="PomBase:SPAC630.13c"
FT                   /db_xref="PomBase:SPAC630.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUG9"
FT                   /protein_id="CAB52735.1"
FT                   /translation="MNNKSLLDLSSEPAIKDTDILSYFDANLPFKKRHQIVRSIYHGLK
FT                   YYIYSSTSIIQVWQNIQDFISTKNDNAAFRELVYNLMMRYVSTQKHLSIIERHTFFQTI
FT                   EKDPFQDIAELQLRLKSLSVLTDEGHKISGIENRVGPLLSAWFNQYLQWQSQATELQGK
FT                   DADSKLVHLLFFKSLFKFSTNLVKFQWFLVPEPQMLQLVNSVVQICNHARLEDVVTEVL
FT                   MFFDSMIRYSVIPKASLYDTVLILCSTYISTYSYSKLAQSVIFNLISSPVSNLAFENVF
FT                   NILQYNRSNVNAVRGAVRLMRFLMLQEVKNDAIASITLSSSIEFTEFPLGFNENVDFEI
FT                   LGTVYLFLRTPSILNRLNFLDWHRILNILMYCSQYLPLKASTSKEAFSKTAAFANIYDR
FT                   VLDFLDFEALIPLLQQFQVKLVFFLKDVLPVLKPKIRKKLLRLFETYNLIFPCNQYWVF
FT                   NLEFLLGIYQCKTFDLEDRALLFKLVEDACSVADENSAPILCSKFLFPVIESFSKESDD
FT                   CVVSPVYNMLFFLSVNFQNPGLKDCIDHIFQQLISDTSSVTVRRLATSTLIRLFYYYYD
FT                   LRDAVPIQETLAKMLEILETPSFPFVSRMLCLQFFLRFRANGTSIYICENIDLNEPFKV
FT                   LNVDSELIPAVYPISDSFVNSATVEKHIWERKENDLIKISNHSTEYGKDFVTFPTSSLL
FT                   RFYRKSMATESNWTILMFMITHLADQISNRSMFIGALEEIYNLLDFMCDIVFERVSISA
FT                   EIPSNIRKANIMIPILQNVQMLFVYHDQFSRAQEDELVSVFFAGLQKWNEACHVSIHSL
FT                   MLCCYELPVSIRKQLPAILVTLSRLITKPDLSVHILEFLCSLARLPDLIANFTDADYRQ
FT                   IFAIALKYIQHRDFTKESKDSNDTESILKNSYSSYVLALAYSVLQIWFLSLRLTERKKF
FT                   VPWILRGLKLASEGKPLEDLCLVQYDMMQQFCYSNSDINNQTSTFVDSDVESETWIRGN
FT                   SLFTINVSVNSGFLEAVIRRPTGTTQYTFRNEASLQKFLWEENLTSSKALTRGLLCTPS
FT                   SFVSHFLDPHGISLYNQPLLLPSNDDSVRRAISVFDRIPVIESLKAGLVYVGYQQRREA
FT                   DILANTNPSEDFLTFLNGLGTLFELKTDQKVFAGGLDRENDIDGAFAYCWKDKVTQMVF
FT                   HCTTMMPTNIEHDPGCTLKKRHIGNDFVTIIFNESGLEYDFDTIPSQFNFVNIVITPES
FT                   ESIRRTGRQIKFYKVKALTKYDIDFSLFRRYKIVSSDALPAIVRDVTLNAAVFSHIYHR
FT                   SAGDYVHIWAERLRQLKRLREKFQASVLPEDYNLDEQTKTKLQNGTNFSDFTSYL"
FT   5'UTR           complement(373965..374217)
FT                   /gene="tsc2"
FT                   /locus_tag="SPAC630.13c"
FT   3'UTR           complement(374316..374682)
FT                   /gene="tup12"
FT                   /locus_tag="SPAC630.14c"
FT   CDS_pept        complement(join(374683..375830,376094..376446,
FT                   376844..376931,376993..377200))
FT                   /transl_table=1
FT                   /gene="tup12"
FT                   /locus_tag="SPAC630.14c"
FT                   /product="transcriptional corepressor Tup12"
FT                   /db_xref="GOA:Q9UUG8"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUG8"
FT                   /protein_id="CAB52736.2"
FT                   /translation="MLFLVISQTTSFMITVRQFTFTIFKFQFMATSNVSSRVNELLEAV
FT                   KKEFEDICQKTKTVEAQKDDFEYKAMISAQINEMALMKQTVMDLEMQQSKVKDRYEEEI
FT                   TSLKAQLEARRKEIASGVVPQSSKTKHGRNSVSFGKYGNAGPFNSDNSSKPLILNNGSS
FT                   GGTPKNLRSPAIDSDGTVLAPIQTSNVDLGSQYYSSPHVRPAVGATMAGSAMRTFPSNL
FT                   PLGHPPPPSDSANSSVTPIAAPLVVNGKVSGNPPYPAEIIPTSNVPNREEKDWTVTSNV
FT                   PNKEPPISVQLLHTLEHTSVICYVRFSADGKFLATGCNRAAMVFNVETGKLITLLQEES
FT                   SKREGDLYVRSVAFSPDGKYLATGVEDQQIRIWDIAQKRVYRLLTGHEQEIYSLDFSKD
FT                   GKTLVSGSGDRTVCLWDVEAGEQKLILHTDDGVTTVMFSPDGQFIAAGSLDKVIRIWTS
FT                   SGTLVEQLHGHEESVYSVAFSPDGKYLVSGSLDNTIKLWELQCVSNVAPSMYKEGGICK
FT                   QTFTGHKDFILSVTVSPDGKWIISGSKDRTIQFWSPDSPHSQLTLQGHNNSVISVAVSP
FT                   NGHCFATGSGDLRARIWSYEDL"
FT   intron          complement(375831..376093)
FT                   /gene="tup12"
FT                   /locus_tag="SPAC630.14c"
FT   intron          complement(376447..376843)
FT                   /gene="tup12"
FT                   /locus_tag="SPAC630.14c"
FT   intron          complement(376932..376992)
FT                   /gene="tup12"
FT                   /locus_tag="SPAC630.14c"
FT   5'UTR           complement(377201..377908)
FT                   /gene="tup12"
FT                   /locus_tag="SPAC630.14c"
FT   3'UTR           complement(377844..378191)
FT                   /gene="gti1"
FT                   /locus_tag="SPAC1751.01c"
FT   CDS_pept        complement(378192..380354)
FT                   /transl_table=1
FT                   /gene="gti1"
FT                   /locus_tag="SPAC1751.01c"
FT                   /product="gluconate transporter inducer Gti1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1751.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1751.01c.1"
FT                   /db_xref="GOA:O14367"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="PomBase:SPAC1751.01c"
FT                   /db_xref="PomBase:SPAC1751.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14367"
FT                   /protein_id="CAB61447.1"
FT                   /translation="MTEPGNLQPTFVGFIGTTVDALLLFEACRQNYTHFVDRRPQDRER
FT                   ERLIRSGSVFVFDEVQSGIKRWTDGIAWSPSRVIGNFLVYRQLCKKNSVSDRKRSSKSR
FT                   SDSDEEEVSAFTVSVPVDVDVASHVNISSPSAPSLSDNLFPGSSFSASSQQNPSSPGSN
FT                   DIKSEFAAVKNEYVLSPTSPTTSAAFPSSFSSLPLVSSKPTGTPFVPKSPPSSSPSTTN
FT                   VSNASTSSAPINPRAPQTRRESISSTSSIHYCSSSSLSYLHDTERALVGSLTDSYGFKK
FT                   SGLIKKTISLMIDGRLHHLISYYTPEDVLNGKLQTPSSFNLFQQLTISKDLLEYKSFRI
FT                   PPLVEAAESEKISQLSTLEKRTLPSFPYNPFFSSSTAEIDPYHFQGLTLSTSPISGVES
FT                   SSLSSAISRNQSNLSSFQQQQQFSALQSISNNALNENIEQPPIKMAARHSYPNFLQTLP
FT                   QYMNDVYNPSGLAFNPVNPNANNSFVNLNLIQFTSPSQALFDYGEGPYVDQKSQYLQPK
FT                   QPSSNTDSIDQSSYNMSLAASKQFLTSDTQPDVNENYSFISNSIPKNLSTSWNQNMGYH
FT                   VTNSNSELASQNPLYAQQAVSMESMGNAIQSSAYSAMSTPHGGHYDHYAATAKGKNPLA
FT                   AENHASGGRLPKVPIPPLSNMRRGSVPIIPSSASLPMRTSGNRFCHYSSLNGNHNRISA
FT                   RTNPYPINNQTMLFTEPLSKERGSLS"
FT   5'UTR           complement(380355..384751)
FT                   /gene="gti1"
FT                   /locus_tag="SPAC1751.01c"
FT   5'UTR           383580..384319
FT                   /locus_tag="SPAC1751.04"
FT   CDS_pept        join(384320..384349,384480..384590,384986..385060,
FT                   385125..385220)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1751.04"
FT                   /product="pre-ribosomal protein Loc1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1751.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1751.04.1"
FT                   /db_xref="GOA:Q8TFI0"
FT                   /db_xref="PomBase:SPAC1751.04"
FT                   /db_xref="PomBase:SPAC1751.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TFI0"
FT                   /protein_id="CAD29730.2"
FT                   /translation="MVVKKSKPKNQIRVEDLDLPKLNTSKNPQTKIQKKGKKKGKIFAE
FT                   TKDDLQNILNQVTYELDDKIKSKLQVAHEREAVFSKQSDRKISNNKADKKTGRKNEKK"
FT   3'UTR           complement(384886..385754)
FT                   /gene="rsm19"
FT                   /locus_tag="SPAC1751.02c"
FT   3'UTR           385221..385433
FT                   /locus_tag="SPAC1751.04"
FT   CDS_pept        complement(join(385755..385887,385938..386043,
FT                   386107..386149))
FT                   /transl_table=1
FT                   /gene="rsm19"
FT                   /locus_tag="SPAC1751.02c"
FT                   /product="mitochondrial ribosomal protein subunit S19
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1751.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1751.02c.1"
FT                   /db_xref="GOA:Q9US30"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="PomBase:SPAC1751.02c"
FT                   /db_xref="PomBase:SPAC1751.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9US30"
FT                   /protein_id="CAB61448.2"
FT                   /translation="MFWTSVARARSVWKGPNVVDFGVNVQQCIKGNVPIKTAVRSATIL
FT                   PRMVGAQFMVHNGKSYANVKITEDMIGHKLGEFAPTRKAFHYRQTKNR"
FT   5'UTR           complement(386150..386195)
FT                   /gene="rsm19"
FT                   /locus_tag="SPAC1751.02c"
FT   5'UTR           386266..386343
FT                   /gene_synonym="SPAC31A2.01"
FT                   /locus_tag="SPAC1751.03"
FT   CDS_pept        join(386344..386394,386458..386614,386786..387786)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC31A2.01"
FT                   /locus_tag="SPAC1751.03"
FT                   /product="translation initiation factor eIF3m"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1751.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1751.03.1"
FT                   /db_xref="GOA:Q09722"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR027528"
FT                   /db_xref="InterPro:IPR040750"
FT                   /db_xref="PomBase:SPAC1751.03"
FT                   /db_xref="PomBase:SPAC1751.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09722"
FT                   /protein_id="CAB61449.2"
FT                   /translation="MEGSDFILVVDSSVEEQVEELAMYLDNLEANTDKNVLALCREYLA
FT                   SENVKEVLNLFLTRLPLLAQAPEKELEPILAVFINLIQESAAFEDHVSKFCQALEQIAD
FT                   QNNNLTPAILSVLSILFNTAVKERQHARLSILTSVVTLTTRYSLFSTLAPNLKYFPDWL
FT                   KEAGVSVSDHRAFNIFVSKAIQSYDDEQSFAFLLEAVKMDNSTADEAVRELVQRAVNSP
FT                   KYFFFDDIVTLPPVQQLEQSTLQLLGILSGGMTDDYVSWVAENHAHCQHQKFDEDAIAR
FT                   KMKLLTIASLATQAPNNTLSYGDVAKSLKIDENEVELWIIDVIRAGLVEGRMSQLTKTL
FT                   SIHRSSYRVFGKHEWVALHEKLAKWGSSLRYMLQVMEQPLSSFTIASSKKGNRDGSAVT
FT                   ASE"
FT   intron          386395..386457
FT                   /gene_synonym="SPAC31A2.01"
FT                   /locus_tag="SPAC1751.03"
FT   intron          386615..386785
FT                   /gene_synonym="SPAC31A2.01"
FT                   /locus_tag="SPAC1751.03"
FT   3'UTR           387787..387856
FT                   /gene_synonym="SPAC31A2.01"
FT                   /locus_tag="SPAC1751.03"
FT   5'UTR           388233..388399
FT                   /gene="trm112"
FT                   /locus_tag="SPAC31A2.02"
FT   misc_RNA        complement(388352..389177)
FT                   /locus_tag="SPNCRNA.643"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        join(388400..388415,388452..388621,388721..388813,
FT                   388859..388960)
FT                   /transl_table=1
FT                   /gene="trm112"
FT                   /locus_tag="SPAC31A2.02"
FT                   /product="protein and tRNA methyltransferase regulatory
FT                   subunit Trm112 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.02.1"
FT                   /db_xref="GOA:Q09723"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR039127"
FT                   /db_xref="PomBase:SPAC31A2.02"
FT                   /db_xref="PomBase:SPAC31A2.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09723"
FT                   /protein_id="CAA90460.1"
FT                   /translation="MKLLTANFLNCSNKKCTSSPEAFPLDVVDAKLAIQQLELKPEFLI
FT                   GIMPRIDWNALLKTTRQLGNYSLPDEKPDLVDDSDEVLLKSLHNVLLETEITEGKMVCG
FT                   NCGHVYPIFEGIPNMLLSESEI"
FT   3'UTR           388961..389229
FT                   /gene="trm112"
FT                   /locus_tag="SPAC31A2.02"
FT   5'UTR           389391..389542
FT                   /gene="mrpl11"
FT                   /locus_tag="SPAC31A2.03"
FT   CDS_pept        join(389543..389564,389617..390245)
FT                   /transl_table=1
FT                   /gene="mrpl11"
FT                   /locus_tag="SPAC31A2.03"
FT                   /product="mitochondrial ribosomal protein subunit L11
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.03.1"
FT                   /db_xref="GOA:Q09724"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="PomBase:SPAC31A2.03"
FT                   /db_xref="PomBase:SPAC31A2.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09724"
FT                   /protein_id="CAA90461.1"
FT                   /translation="MRCSVAVRASSIYVKNPQLRKSFLHSNYVQLIQESPNFLILQHNN
FT                   LLPREAKSLRTELKAKVPGSKLQVIRGSIFHHALKVYESIDRLSNGCVDMQKVNLIETH
FT                   KKAQKIKLDIDNLFVGPLAIFTLGPKLSPEAIRGFMSVLKGYQNKILLLGIRAESKGMD
FT                   PFEVENLSKIPSLEFLQSSLLSVLSSPASQLRRILDLSKANVAYTLERREPSE"
FT   3'UTR           390246..390520
FT                   /gene="mrpl11"
FT                   /locus_tag="SPAC31A2.03"
FT   3'UTR           complement(390407..390588)
FT                   /locus_tag="SPAC31A2.04c"
FT   CDS_pept        complement(390589..391173)
FT                   /transl_table=1
FT                   /locus_tag="SPAC31A2.04c"
FT                   /product="20S proteasome component beta 4 (predicted)"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.04c.1"
FT                   /db_xref="GOA:Q09720"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035206"
FT                   /db_xref="PomBase:SPAC31A2.04c"
FT                   /db_xref="PomBase:SPAC31A2.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09720"
FT                   /protein_id="CAA90462.1"
FT                   /translation="MESLLAVQGQDFVLTASSSSAVRGITVLKPDDDKSQILNSHNLML
FT                   YCGEAGDTTNFAEYIAANISLYTLRHNLNLSPEATASFTRKQLATSLRSRKPYQVNILL
FT                   AGYETNLGKPELFWLDYLATCVRVPYACQGYSSFYCLSIFDRYYKPDLTIDEAVRIMKL
FT                   CFDELKKRMPIDFKGFICKVVDKDGIREINI"
FT   5'UTR           complement(391174..391260)
FT                   /locus_tag="SPAC31A2.04c"
FT   3'UTR           complement(391628..391837)
FT                   /gene="mis4"
FT                   /locus_tag="SPAC31A2.05c"
FT   CDS_pept        complement(join(391838..391915,391956..392612,
FT                   392652..392787,392828..394611,394656..395123,
FT                   395167..396502,396546..396741,396781..396889))
FT                   /transl_table=1
FT                   /gene="mis4"
FT                   /locus_tag="SPAC31A2.05c"
FT                   /product="adherin, cohesin loading factor Mis4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.05c.1"
FT                   /db_xref="GOA:Q09725"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024986"
FT                   /db_xref="InterPro:IPR026003"
FT                   /db_xref="InterPro:IPR033031"
FT                   /db_xref="PomBase:SPAC31A2.05c"
FT                   /db_xref="PomBase:SPAC31A2.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09725"
FT                   /protein_id="CAA90463.2"
FT                   /translation="MLFEMTPETFKKVNSSNRIIKGLQYTPLASSIPLENGLQNVLYPS
FT                   SKFQNEPLQLNSEESSIMQRYVDMLNPGATFVNDSETFNFYKNALSAMITEPAMPAMRV
FT                   NASPVLDQKVCNSDSLSELNDFTKSLIQPSMLMCEPKEKPDASSINTNRSSSDNGFLTP
FT                   SSSPRSPSCSRVFNAVQLCSPKKSKDDITTPKKRLMEDTYSPRESPSKIQRLQDVLLKQ
FT                   LQDTRLLISQVIEAENSEDFSSNSLFIKREDDDGKHISSHAIEKLYMALTKLSRLGACD
FT                   KLLEEGSIILVKQILEKELKELPVACYSIINLHDSLTQFPNLDFILKTTALVLFIIFLV
FT                   PSFKKLQNEESILHLLNILHSIFEYTVPEAIDNIVQSKTSDARTSEIQHLSVLLQKVAN
FT                   VLNILSKVAHEIPLSEAVVIRIVYLFPKVSTLDNSFKTKLPNCNSSSFDFLKAPLFQTL
FT                   QYLFRLYPYQRDFIIEESLTNFSHLPTARSVSRTYRLSNGKSIQYYSTLFVRLIQSCSI
FT                   QNLFDSEIVQSESKSTEALHSGNLTEHLKTVESILSKSRHEEYRIANHIVAYLLSRSLK
FT                   QNKTESDNSFAILTKILLEDLLNMLSLPEWCGTETIIRQFAMNLVMTVTNDKQAVSSKN
FT                   AALDLISLIVNKVLALFDLSLFEKHNIPAPTNFNDIISFIPSITRLNELSQVSFNHFYF
FT                   LCKGDISLENILPYNYNKWFSFLLQLRKVCNDSEALKIIDNCIDKNMQKSQEGFQGPSP
FT                   FKADENDEDIFIISLYHSSLFLNLKFFVSLIIGFLDSPQASLRTKCLRIINQMKTIPSI
FT                   LRTHPEVLAQIISKSNDQSAIVRDTVLDLLGTYIMAYRETIPQIYGCIISGISDPSTIV
FT                   RKRAIKQLCEVYEATEDLNIRVDIASKLLTRSNDEEETISELSLEVLEKLWFSPASNEL
FT                   DCQKGYEQLTFLEKQKLRVQYFPILKLCAEPSTERHVLLVTSLKTMLTSKEEINLSTLH
FT                   TQIRLLLSCLFNQLIEVVTEDQVDESTKGILYEIMSTLFVFSRAFPFLFDLSYLHLLKP
FT                   YLRSASTIEEQRFLYYVVAIFRQVLPFQKEISESFLRSLESVLLQRLTKAGTATLMEIV
FT                   PCLCSLFTRLNDYERLKKIVVSCLKSLEEARHSENNFQKMVRLIDLIGLFSRYGDLNRI
FT                   NDDWKHSLDFISPECDDAYVILLGYFQKLLKDAKGQLRIHIIDNMSRICLRETSLFISP
FT                   LMLSTLDMIIAENNVNEVSVLFKSFLELLAADEDLIFEADQKLSLKGKQNVQSNKSVDR
FT                   DMLKGTKDKQWIEGVSASLMQHFLPCILDSCFSKNLRYSMLGIEILKCIIHQGLVNPRM
FT                   CFSTIIALESNAIKETREVAILLHTELHRRHESLIDGLYAQSADLIFSLQKTEEYQTFK
FT                   LGEFSPFQSAYTIVSADKSSKSRKKLIMQILKPLKLDGIDLPSFTEEKVSFVSFCCVCL
FT                   AGIPYVSIEEPLMIISTVDSVLATIGPTITGWMKKLDHERFKILAGINLCNLIYLKRYI
FT                   KYAFSISDSSRPIREKKPLTLLNRGYVDLITSDAKPDIVSKLVIKLFEEENILSGEDQV
FT                   EGEQLTVV"
FT   intron          complement(391916..391955)
FT                   /gene="mis4"
FT                   /locus_tag="SPAC31A2.05c"
FT   5'UTR           complement(396890..396999)
FT                   /gene="mis4"
FT                   /locus_tag="SPAC31A2.05c"
FT   repeat_region   complement(397023..397370)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           397426..397708
FT                   /gene="atp25"
FT                   /locus_tag="SPAC31A2.06"
FT   CDS_pept        397709..399337
FT                   /transl_table=1
FT                   /gene="atp25"
FT                   /locus_tag="SPAC31A2.06"
FT                   /product="mitochondrial ATP synthase complex assembly
FT                   protein Atp25 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.06.1"
FT                   /db_xref="GOA:Q09726"
FT                   /db_xref="InterPro:IPR040152"
FT                   /db_xref="PomBase:SPAC31A2.06"
FT                   /db_xref="PomBase:SPAC31A2.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09726"
FT                   /protein_id="CAA90464.1"
FT                   /translation="MPTYRFNYLRFNKLCVSFFRSKFDKRPFASQKFPENLVPDNSSND
FT                   ANSQPEEVSSKKPWYVDEKHNLFPKKAHFDAVALPPIPKGAPNFLADVLNLLKKKYYAT
FT                   DLSFVNSPADSFWCDSDLILLASCNCGSEVVSATNGLLRLLKQKNVGPVNVDGLTSASR
FT                   RKILERRMRKRSNLSNRQLNTSENNWTCLSIENFGISIHVITKNFREYYKLDNIEHVKD
FT                   ETLYSDLEHGKQSRVSLTSKSTPDNSLPPNFINNHSNVFRRSFHTCNFSLKSAASLYCD
FT                   TQDILLNVNSQNLTSTLEKYKKMHLQNPNNFSLDFTLSIFERLRKDSSLQLTTKDINTL
FT                   FSTIALSPTKLSMASKHSKNLVSERMLYLSLMYKSLVDLKTIDSFSLKLLFLKFMICSC
FT                   MVKGESNFFLDNRIFLLERIMNRYGIPMTIDTFLLMQFILAKSNRWSEVWRRWDNLRKA
FT                   GVVFNERLYNHVYLLAFESKNERVINYVLTNIFEDMVSQSPPIPASKLMATSLKKCVQS
FT                   LPEKYAHSFPSVRNYIAKMENSMTH"
FT   3'UTR           399338..402487
FT                   /gene="atp25"
FT                   /locus_tag="SPAC31A2.06"
FT   3'UTR           complement(399462..399547)
FT                   /gene="dbp10"
FT                   /locus_tag="SPAC31A2.07c"
FT   CDS_pept        complement(join(399548..401871,401972..402194))
FT                   /transl_table=1
FT                   /gene="dbp10"
FT                   /locus_tag="SPAC31A2.07c"
FT                   /product="ATP-dependent RNA helicase Dbp10 (predicted)"
FT                   /db_xref="GOA:Q09719"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012541"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033517"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09719"
FT                   /protein_id="CAA90465.1"
FT                   /translation="MSGFQTSDEVDISNSLKAFPVDIATDNQKDKHENVGENVSDEDDG
FT                   NYIASKLLESNRRTKGKKGNGKASNFQSMGLNQTLLRAIFKKGFKAPTPIQRKTIPLLL
FT                   EGRDVVGMARTGSGKTAAFVIPMIEHLKSTLANSNTRALILSPNRELALQTVKVVKDFS
FT                   KGTDLRSVAIVGGVSLEEQFSLLSGKPDIVVATPGRFLHLKVEMKLELSSIEYVVFDEA
FT                   DRLFEMGFAAQLTEILHALPTSRQTLLFSATLPRTLVDFAKAGLQDPVLVRLDVESKVS
FT                   ADLQSAFFSVKTAEREAALLCILQDIIKLPLKDNVRPREIGNVNNPKKRKRALELALKG
FT                   SESGSPDSTLVFVPTKHHVEYVSELLVQAGYSVSKIYGSLDQEARLNEINNFRLGKTNL
FT                   LVVTDVASRGIDIPLLANVINYDFPPQPKVFVHRVGRTARAGRTGWAYSLVRAEDAGYL
FT                   LDLQLFLNRPLVTSSKQVKTDSDCDFTKQIVLGSLPQELVAELLEWVQRIVSRDVELQQ
FT                   LSNVAARGEKLYFRTRATCSAESAKRAKELVDSKGWSSNNPLFGDVSVIEAEEKYAELL
FT                   SKVSSYRPSETVFEIGQRGHLKTEAAEIMRKRRNKVKPKGIKSEVASDKITDSSPGNMS
FT                   EASESELEEVFKNPKELSKKKTTDFKDKEYYMSHYAPKESIQETGYAINSGENFTTAAR
FT                   HAILDLTNDEGIEQSRKGGQRWDPKKKKFVNIINDEDGSKGSPKIIRGESGVKLPATYR
FT                   SGRFDEWKASKAFGANDSPIRENKRYKHNKLQTPKPADKFRDNYHKQNKRNREAKERGI
FT                   GIKVNSELKSAVEIRKARELKEKRLAKNNRPSKKHR"
FT   5'UTR           complement(402195..402266)
FT                   /gene="dbp10"
FT                   /locus_tag="SPAC31A2.07c"
FT   repeat_region   402409..402782
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   3'UTR           complement(402719..403812)
FT                   /gene="apm4"
FT                   /locus_tag="SPAC31A2.09c"
FT   5'UTR           402841..403059
FT                   /gene="mrp20"
FT                   /locus_tag="SPAC31A2.08"
FT   CDS_pept        403060..403545
FT                   /transl_table=1
FT                   /gene="mrp20"
FT                   /locus_tag="SPAC31A2.08"
FT                   /product="mitochondrial ribosomal protein subunit L23
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.08.1"
FT                   /db_xref="GOA:Q09727"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="PomBase:SPAC31A2.08"
FT                   /db_xref="PomBase:SPAC31A2.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09727"
FT                   /protein_id="CAA90466.1"
FT                   /translation="MSKIAGKRLVYFPNITFTLCRGLNLQPKFAVFRVPLHVNKFDVRD
FT                   YLQHVYNLKVVSVKSRIYQGKLFRNQLGQVKRPQSEKRVIVEMEEPFVYPNAPNDLKDW
FT                   QEGELLPDGSNVKTLSRYPKVLEQVDMKRVNEELSKLQDKQILESQQKIARLLKKKY"
FT   3'UTR           403546..403862
FT                   /gene="mrp20"
FT                   /locus_tag="SPAC31A2.08"
FT   CDS_pept        complement(join(403813..405079,405138..405202,
FT                   405241..405249))
FT                   /transl_table=1
FT                   /gene="apm4"
FT                   /locus_tag="SPAC31A2.09c"
FT                   /product="AP-2 adaptor complex subunit Apm4 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.09c.1"
FT                   /db_xref="GOA:Q09718"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="PomBase:SPAC31A2.09c"
FT                   /db_xref="PomBase:SPAC31A2.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09718"
FT                   /protein_id="CAA90467.1"
FT                   /translation="MISGLFIFNLKGDTLICKTFRHDLKKSVTEIFRVAILTNTDYRHP
FT                   IVSIGSSTYIYTKHEDLYVVAITKGNPNVMIVLEFLESLIQDLTHYFGKLNENTVKDNV
FT                   SFIFELLDEMIDYGIIQTTEPDALARSVSITAVKKKGNALSLKRSHSSQLAHTTSSEIP
FT                   GSVPWRRAGIKYRKNSIYIDIVERMNLLISSTGNVLRSDVSGVVKMRAMLSGMPECQFG
FT                   LNDKLDFKLKQSESKSKSNNSRNPSSVNGGFVILEDCQFHQCVRLPEFENEHRITFIPP
FT                   DGEVELMSYRSHENINIPFRIVPIVEQLSKQKIIYRISIRADYPHKLSSSLNFRIPVPT
FT                   NVVKANPRVNRGKAGYEPSENIINWKIPRFLGETELIFYAEVELSNTTNQQIWAKPPIS
FT                   LDFNILMFTSSGLHVQYLRVSEPSNSKYKSIKWVRYSTRAGTCEIRI"
FT   5'UTR           complement(405250..405389)
FT                   /gene="apm4"
FT                   /locus_tag="SPAC31A2.09c"
FT   5'UTR           405582..405801
FT                   /locus_tag="SPAC31A2.10"
FT   CDS_pept        join(405802..405924,405964..406032,406134..406168,
FT                   406268..406460,406503..407465)
FT                   /transl_table=1
FT                   /locus_tag="SPAC31A2.10"
FT                   /product="Ran GTPase binding protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.10.1"
FT                   /db_xref="GOA:Q09721"
FT                   /db_xref="InterPro:IPR008812"
FT                   /db_xref="PomBase:SPAC31A2.10"
FT                   /db_xref="PomBase:SPAC31A2.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09721"
FT                   /protein_id="CAA90468.2"
FT                   /translation="MDQVLSKVTTTAATYATAYAVRTGLQLAGSLVAKRFSKYIQTSAP
FT                   KSSQFNLELVKSRLEQKIQAITPAVDLIQLVAARGNSSLQNLVPLIIRLRDHIDDFLEF
FT                   IDYEASGSEKKSPEKADEASEKIFRRCEVLLREIEETIPLINLSLTTAGITLNTALSNT
FT                   ISPSRLLQAQCFLELSDKRFEESHTEIQIGPKFTVVLYTSFSQPSKSDGPLDVRWQETF
FT                   AKSDLYIKRVVSASQKFSYVICIDEDLNDGRYHEETVGKPTSAPVFGKKLEISLQRMSL
FT                   LCYTVSGRLLNISQAKSPVLALQLTSIKDVSALDKAHQDNSEDLNNPFIKNNDKTKFHQ
FT                   NIDWIALEKYFEVNALDISDSESEDLSDILSDSEFSIGNRNKNIGNNEYSAQISSDPAE
FT                   EEIANAMHSLKLEPETSIYLTNPGSLSLLEYLLRLCSLQELHQISCLEMTDSQLAAMLN
FT                   SN"
FT   3'UTR           407466..407710
FT                   /locus_tag="SPAC31A2.10"
FT   3'UTR           complement(407714..408029)
FT                   /gene="cuf1"
FT                   /locus_tag="SPAC31A2.11c"
FT   CDS_pept        complement(408030..409265)
FT                   /transl_table=1
FT                   /gene="cuf1"
FT                   /locus_tag="SPAC31A2.11c"
FT                   /product="nutritional copper sensing transcription factor
FT                   Cuf1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.11c.1"
FT                   /db_xref="GOA:Q09728"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="PomBase:SPAC31A2.11c"
FT                   /db_xref="PomBase:SPAC31A2.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09728"
FT                   /protein_id="CAA90469.1"
FT                   /translation="MVVINNVKMACMKCIRGHRSSTCKHNDRELFPIRPKGRPISQCEK
FT                   CRIARITRHLHVKCTCNSRKKGSKCSTSSTTDLDSSSASNSSCSIPSSISEKLLPRDNV
FT                   KTHCPKRSASCCGKKPDVMPLKINLESQTDFMGMPLQSQRPHSESYRMLPEPEKFKSEY
FT                   GYPSQFLPIEKLTSNVAYPPNYNNYLKSPYQQPTNFPPEIQYNYSHSPQHSIQEAEEAA
FT                   VYGPPVYRSGYQILYNNNTDSIAAAAATHDLYPQPDVPLTFAMLADGNYVPLPSSTNTY
FT                   GPSNSYGYEININESTNHVDSSYLPHPIQLSNYFTLPSSCAQADAACQCGDNCECLGCL
FT                   THPNNATTLAALNHISALEKETISHTDLHHTFKHEVNSSNNYELTNDELAASSPLYTSS
FT                   SVPPSHITTGST"
FT   5'UTR           complement(409266..409872)
FT                   /gene="cuf1"
FT                   /locus_tag="SPAC31A2.11c"
FT   5'UTR           411651..412083
FT                   /locus_tag="SPAC31A2.12"
FT   CDS_pept        412084..413874
FT                   /transl_table=1
FT                   /locus_tag="SPAC31A2.12"
FT                   /product="arrestin/PY protein 1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.12.1"
FT                   /db_xref="GOA:Q09729"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="PomBase:SPAC31A2.12"
FT                   /db_xref="PomBase:SPAC31A2.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09729"
FT                   /protein_id="CAA90470.1"
FT                   /translation="MNILSRKENVASYFDIRVAAEHDLIVIQGLADSAEPTPLSGSVVL
FT                   CLNEAISVKAISLKLVGKCRISWSEPSPTVRGGQRHNKQEYVVYEKNWIFVPYTGANRT
FT                   LRAGNYEYPFHVMLPGDIAESVEGLQSCYVVYRLKASIDRTGLASKMVKKKHIRLIRAL
FT                   PADAIEYTQTISVDNTWPNKIEYTISVPTKAYAIGSYIPIHFVLVPLLKRLTIGKISIT
FT                   LKEYITLHVAHGYNGLPASKDEVRTVRSLQTEELEEFSDHYELTKNLELPSSLVECLQD
FT                   CDLDGIKIRHKLKFSVSLRNPDGHISELRAALPVVLMIPPQLFGDRAEVESLRENFESF
FT                   NQPLPSYQNSMYDRLYDGLSYSNLDTPLPSGATTPRRRDSMEPTYASNEAHRRQLIAGL
FT                   TELALQQQPQGRSPNEHSPSNHPEDFPPSFSLGSNPSSGAASAVITRNPSETSLADLSR
FT                   VPSYKEATRSAVPLESPLQSTLPSYEDVARIEHLSRPPSPGIVTPPQRTSPSFFVSPTE
FT                   STRQSLDSRRSFEHSTSSSSGISPSHSSASLAHLSQASNPNGSSSAPHRPTSARVGSHR
FT                   NALDALRRARMLPSGFSRRN"
FT   3'UTR           413875..414448
FT                   /locus_tag="SPAC31A2.12"
FT   3'UTR           complement(414245..414470)
FT                   /gene="sft1"
FT                   /locus_tag="SPAC31A2.13c"
FT   CDS_pept        complement(join(414471..414629,414684..414800))
FT                   /transl_table=1
FT                   /gene="sft1"
FT                   /locus_tag="SPAC31A2.13c"
FT                   /product="SNARE Sft1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.13c.1"
FT                   /db_xref="GOA:Q09730"
FT                   /db_xref="InterPro:IPR039897"
FT                   /db_xref="InterPro:IPR039899"
FT                   /db_xref="PomBase:SPAC31A2.13c"
FT                   /db_xref="PomBase:SPAC31A2.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09730"
FT                   /protein_id="CAA90471.1"
FT                   /translation="MNDQNERRLETLSGQVSSLKNVTYDIYSRANDYTRIDRATESFSG
FT                   LSNSVKKSTENFFRVVRSAGRRRIMTMVLAIVGSILIIYYASKWFF"
FT   5'UTR           complement(414801..414930)
FT                   /gene="sft1"
FT                   /locus_tag="SPAC31A2.13c"
FT   5'UTR           414942..415405
FT                   /gene="bun107"
FT                   /gene_synonym="wdr48"
FT                   /locus_tag="SPAC31A2.14"
FT   CDS_pept        join(415406..415685,415763..418371)
FT                   /transl_table=1
FT                   /gene="bun107"
FT                   /gene_synonym="wdr48"
FT                   /locus_tag="SPAC31A2.14"
FT                   /product="WD repeat protein, human WDR48 family Bun107"
FT                   /db_xref="GOA:Q09731"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR021772"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09731"
FT                   /protein_id="CAA90472.1"
FT                   /translation="MSVRKRYKVTYVLDSCNDQLGHRLDANCLVLGRYFSEQGSAPVTR
FT                   ALYSGGRDGQLFGWDIGYDYGKASQPLAKIQAHSAWVNDIALTHDSEGVISCSSDSTVK
FT                   LWKPHVLNASCLSTIGEHTDYVKRVSIPKYSKSPLVASGGLDKRIIVWDYNVGQEVMRF
FT                   EQLPDCSLVVGPRSGVYSLAANNNIIANGGLQKDIQLWDCVSKKRITDLVGHTDNVRDI
FT                   LISDDGRTILTASSDATIKLWSLRAQKCLFSFIAHSDSVWALYSEHPDLKVFYAGDRSG
FT                   LITRTDIRNQPNNQSCTAICKQDAPVSDIVARQSFIWSTSRDGSILRWKDEPLFNQDVG
FT                   AALSKHTSSHLSVSSDCPSRHSSDIRNHSCPTLYHDDAEDIYYDLHHTESYSNINLTKT
FT                   PDYVIHGGIGLLKYRMLGDRRHVLTEDAVGNKCLWDILACKQAGEFDKSEDFEKIVQSL
FT                   DTVQAIPRWASVNCLLGILAVTLDENHYMDAEIYADECPLLKVDSPSDKRINLGVWILK
FT                   NLFREFIDAELHRDLKFRQNLDVVRSEAKKQIEAQREEARKGNVNMPSALSPLRIRSRP
FT                   SPLSLPPEPLLSPTIDYSATPFPLEPPPESPGPSLQIPSNNPVYTNLTDTDSMMGAPDY
FT                   FSIPARQNRNRKPHTEVVGSPTVVRTKEIIPPKVTREGSFMGRLKKLGRSKSSKSLQTD
FT                   FMKASVERAASSRVFSTGTSVTSPQALSKTNNTVNNAANTENNTLAKDKQQTSEASSPG
FT                   TPRELKTTGELIEDLHEQYVHFKDKDTVLSLMKPPNDDTFPMLNLSSQITVIISEESPE
FT                   AGNSRDIYRSTLENMADDIDLLENIMPFWLGRLLLLNEFPSKTAPTVNFTLQPFPGSGL
FT                   PLIVNENTRLSASAMLRAQKIMDYSYSKLSQQRKDVSSLQFRCKDVVVTPKMTLATVKA
FT                   RIWRSGDDVVFHYDVAPRSVSEIVDKTQSLNI"
FT   3'UTR           complement(417823..418474)
FT                   /gene="dcc1"
FT                   /locus_tag="SPAC31A2.15c"
FT   3'UTR           418372..418504
FT                   /gene="bun107"
FT                   /gene_synonym="wdr48"
FT                   /locus_tag="SPAC31A2.14"
FT   CDS_pept        complement(join(418475..418720,418759..419220,
FT                   419268..419502,419602..419732))
FT                   /transl_table=1
FT                   /gene="dcc1"
FT                   /locus_tag="SPAC31A2.15c"
FT                   /product="Ctf18 RFC-like complex subunit Dcc1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.15c.1"
FT                   /db_xref="GOA:Q09732"
FT                   /db_xref="InterPro:IPR019128"
FT                   /db_xref="PomBase:SPAC31A2.15c"
FT                   /db_xref="PomBase:SPAC31A2.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09732"
FT                   /protein_id="CAA90473.2"
FT                   /translation="MEANEERCILLKYPHPSSDISSEYLLLELDDDLLKTLEENPEEEI
FT                   VFKSDFDKKASVLCTSDKTYAVRQVVQSNSYLLFDELSPTDWVLNDTCYSFLEVERIYG
FT                   FIFSDDKISYWDEDSVELKPISLTKDQFIRSVPASRNEVDSFLQKNFFMVKNEFLYRLS
FT                   PSYICSIIDWIFVIAQQLHIDFASFEFKILKKPAMDDEFDWDSVICVLESISSPIKDNV
FT                   LPKKFNIDLELTTFWYGRFLLEGINSISSDEFIQLWDNRLPYPCKGLPSLNLLKGYYFH
FT                   DTPNTIQYLSGDQLPREPSRRFQSLFQLKSKWLYEELWSFVKDLALSKSRVEALILKYG
FT                   RKQTSRDGVYINSRGTW"
FT   5'UTR           complement(419733..419996)
FT                   /gene="dcc1"
FT                   /locus_tag="SPAC31A2.15c"
FT   5'UTR           419958..420465
FT                   /gene="gef2"
FT                   /locus_tag="SPAC31A2.16"
FT   CDS_pept        join(420466..422887,422926..423153,423199..423307,
FT                   423357..423903)
FT                   /transl_table=1
FT                   /gene="gef2"
FT                   /locus_tag="SPAC31A2.16"
FT                   /product="RhoGEF Gef2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC31A2.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC31A2.16.1"
FT                   /db_xref="GOA:Q09733"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR032634"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="PomBase:SPAC31A2.16"
FT                   /db_xref="PomBase:SPAC31A2.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09733"
FT                   /protein_id="CAA90474.1"
FT                   /translation="MDVGTMGSRAELLAISIQFGGLWVFRDLLQMNPLFEQDHVFCTFN
FT                   HPNMGLVLISFAKVDGHILAAYALSKLGPDTFSICYPFSSKLDAFAQTLDLEWQIASMH
FT                   KEAAACVYEFLCVESVCLHTGENWRESVIEPEYASYIFDTINVFQSSSLTRELYSLGEP
FT                   NGVREFVVDAIFDIKVDNSWWEDPSNSYWKTVIGSREMFEDSRKKTSSPSPSFASSKDA
FT                   GTIPAIQKKKSLLIEMMETESTYVERLRHLVNDYALPLRDLAKSSKKLLGLYELNTLFP
FT                   PCLNKLIQLNSAFLDEFEAIMSDLNFEDIDEKKFEEIDLRLACCFESHFFAFSQHYPRY
FT                   LEQSNDFGNVLKMASKIPKFVEFHDQVKLNANMNVGLSQLIMEPVQRIPRYSLFLDQII
FT                   LLTQEGECQHTYVRSVEIIKNIAEMPTVDAEERSRIFAGLQHIIPDLAPNMISNSRNFI
FT                   DCIDVTREFLKNGQLHLIPYTLILFNDRICLVQRRSKSSIASTILDLRKQNPRNSYSKE
FT                   KRAQYIGSNMNEAVELTRSMVEENTIFLISKYASSPSFFNEYPILKFRCDFENVRTMDR
FT                   FYQSFQKALSMNKSQPSCLSFSKLNDFVVFFNNYSRFEYEKESKRSDIVCICTNDANVD
FT                   KHKFLQDGNIVITFFQQDEDFHLSFDSWLGVSLPTEAVIAKEDLREACLNYLINIKRLL
FT                   LCPFSNRNFSSLDLYSNLIQHLLSANSSPRKSRLSFGGRPGSPSKISLSLNRFYNQGGL
FT                   SKSCATLPSQMYNLDHNNISQKSLKFNTHNTSKASAEKTVEHLEAFKGGFKYHTDLKNL
FT                   LYPLSEKEKIEGDELYDNILKETFNEELLSHYPPNIIYATFQKYLSSFINRKFGVLLSS
FT                   SFIQQLNTVENLNLSFNSTDAVYHLKKILQDLPESSLKILENIFSIASDLLLRLPLKDQ
FT                   CDFVTKQLAIALAPSMFGSNAVELVYYLAYHSDRIFGTVEELPTPVSPANSNNDKQLDE
FT                   SKFQAIAMKEMPERHPKEILPGQIEREAYEDLRRKYHLTLARLAQMTRLNEDSKKSIPL
FT                   LYDRFNHDLKLIKQSVQASLIRKQCELDTAKWTLEEYESKLNAKEGCQTNIFI"
FT   3'UTR           423904..423991
FT                   /gene="gef2"
FT                   /locus_tag="SPAC31A2.16"
FT   3'UTR           complement(423926..424476)
FT                   /gene_synonym="SPAC31A2.17c"
FT                   /locus_tag="SPAC13C5.01c"
FT   CDS_pept        complement(424477..425223)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC31A2.17c"
FT                   /locus_tag="SPAC13C5.01c"
FT                   /product="20S proteasome component alpha 3 (predicted)"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13C5.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13C5.01c.1"
FT                   /db_xref="GOA:Q09682"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="PomBase:SPAC13C5.01c"
FT                   /db_xref="PomBase:SPAC13C5.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09682"
FT                   /protein_id="CAA90475.2"
FT                   /translation="MSRSYDSRTTIFSPEGRLYQVEYALEAINHAGVALGIVAKDGIVL
FT                   AAEKKVTSKLLEQEESAEKLYHIGDNMLCAVAGLTADANILINYARRVGQQYLQTFNEE
FT                   MPCEQLVRRVCDLKQGYTQYGGLRPFGVSFLYAGWDHIRGYQLFQSNPSGNYGSWQANS
FT                   IGGNSTSVQSLMRQEYKDDINLDEASAMAVKFLSKTLDSNSLTHEKIEFATITKDTTKN
FT                   KMVCKIWKSDEINEVLNKYQETQRQS"
FT   5'UTR           complement(425224..425256)
FT                   /gene_synonym="SPAC31A2.17c"
FT                   /locus_tag="SPAC13C5.01c"
FT   5'UTR           425631..426029
FT                   /gene="dre4"
FT                   /locus_tag="SPAC13C5.02"
FT   CDS_pept        join(426030..426069,426106..426322,426364..427342)
FT                   /transl_table=1
FT                   /gene="dre4"
FT                   /locus_tag="SPAC13C5.02"
FT                   /product="splicing associated factor Dre4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13C5.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13C5.02.1"
FT                   /db_xref="GOA:Q09685"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="InterPro:IPR039726"
FT                   /db_xref="PomBase:SPAC13C5.02"
FT                   /db_xref="PomBase:SPAC13C5.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09685"
FT                   /protein_id="CAA90453.1"
FT                   /translation="MSQPLPPGWTEHKAPSGIPYYWNAELKKSTYQRPSFIEKNHSSSV
FT                   TASQASLAFNTSEKLFVNENAEERKNSRDLRKQLPDRPKFKKRIPNNDSWVVVFTKKNR
FT                   YFFHNLKSHESYWEPPLEISKDLKILRLPIRKQISKDSSQSQNVDSGKTNHEEIHESRH
FT                   LQTEIEEPSGLEESSEESVLYSEEFYEKSDEEEDEEKSHSAEELEFGEEDIMYQLQQLD
FT                   DETVSYDIQEQATNLSTDDARRVFTELLKDKNIGAYQPWELVYPKLLDDDRFYVLDSGE
FT                   RRKEVFEEYCKSVVSTKKITRRKNTLSDFWTLLHSLPSTLLWPQFKRKYRKSSTLQIPG
FT                   YSERDFEKLFREFQILRKQPMQDKLLNFKKLCKSKTVDPKNPDEFTESILNDTRYAVLT
FT                   REELDSLACSSN"
FT   3'UTR           427343..427415
FT                   /gene="dre4"
FT                   /locus_tag="SPAC13C5.02"
FT   5'UTR           427350..427582
FT                   /gene="tht1"
FT                   /locus_tag="SPAC13C5.03"
FT   CDS_pept        join(427583..427943,427986..428590,428653..429318)
FT                   /transl_table=1
FT                   /gene="tht1"
FT                   /locus_tag="SPAC13C5.03"
FT                   /product="nuclear membrane protein involved in karyogamy
FT                   Tht1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13C5.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13C5.03.1"
FT                   /db_xref="GOA:Q09684"
FT                   /db_xref="InterPro:IPR007292"
FT                   /db_xref="PomBase:SPAC13C5.03"
FT                   /db_xref="PomBase:SPAC13C5.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09684"
FT                   /protein_id="CAA90454.1"
FT                   /translation="MKYSNVAFSEGLAGFDSLAHVYQALLKKSTCYQEVAATLISKCSL
FT                   LNTELTIDNRIHSAIQMTLCDFERSQILAPSECVRGSQSECVSKLESTSTWWLSFTSHF
FT                   HDVNHLCRLANLEMQKELSIEVNMNVTLVQKQFLEMVILHLRNFESVTDKMNQRIDKFD
FT                   GKFNSVIENSFKDINFRVNQEIMGLVELQNHQQEGMVQQKEILSTIKQLKSEIFDINSF
FT                   FANFIEESAGYSNSLIEKLNEKFTSENAIALSAIGKYTSEFSAFMEKRIKNLITTTEDS
FT                   LQQSVQSNIDFVNSGFQPLYDLTIQLKEELQSLKRLSSEQQNLQHEQILQWKSDFLNVS
FT                   KDHLKVLQQLRPLIDIVEKFMNVYFKGLSNIISSFAFIGFTLFATLSSLFFKVLKIHRR
FT                   PIIVFGSLSIIFIHIYCFKITSWVNLYGWITCTIARTLSFIKLNIRTFYLTAFLCALLN
FT                   FLRYLKYRNSKKDTELSLFLPAPEECNIYHNEHIQVQEDNYLCPIENSLIDLFGSENNK
FT                   EKLGKQENVRFAFLNSESLEQSPWWD"
FT   misc_RNA        complement(429030..430050)
FT                   /locus_tag="SPNCRNA.644"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           429319..430121
FT                   /gene="tht1"
FT                   /locus_tag="SPAC13C5.03"
FT   5'UTR           430056..430129
FT                   /locus_tag="SPAC13C5.04"
FT   misc_RNA        complement(430088..431033)
FT                   /locus_tag="SPNCRNA.645"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        430130..430876
FT                   /transl_table=1
FT                   /locus_tag="SPAC13C5.04"
FT                   /product="amidotransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13C5.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13C5.04.1"
FT                   /db_xref="GOA:Q09686"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PomBase:SPAC13C5.04"
FT                   /db_xref="PomBase:SPAC13C5.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09686"
FT                   /protein_id="CAA90455.1"
FT                   /translation="MDYHIAILNADTPMVEITSAYGDYADMVKSLLQSGSEYYSTEWNL
FT                   VTKTYEVYKNPNDYPQKEDFPNINAIIITGSKASATSDAPWIKKLISFVKDVLFKYPHI
FT                   KIVGLCFGHQIVAKAAGVPIIQNPKGWEVSSTVVQLTENGEKFFGRKVININQMHQDMA
FT                   VDVPEGFELLGSTEDCEFQIFYKPRQALTFQGHPEFSTEVVNTMVKVLRGTEVFTEQQK
FT                   EEALKRSENPADNDFLAVSIVKFLLE"
FT   3'UTR           430877..431032
FT                   /locus_tag="SPAC13C5.04"
FT   3'UTR           complement(431367..431561)
FT                   /locus_tag="SPAC13C5.05c"
FT   CDS_pept        complement(join(431562..432982,433028..433113,
FT                   433154..433203))
FT                   /transl_table=1
FT                   /locus_tag="SPAC13C5.05c"
FT                   /product="N-acetylglucosamine-phosphate mutase (predicted)"
FT                   /EC_number="5.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13C5.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13C5.05c.1"
FT                   /db_xref="GOA:Q09687"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="PomBase:SPAC13C5.05c"
FT                   /db_xref="PomBase:SPAC13C5.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09687"
FT                   /protein_id="CAA90456.1"
FT                   /translation="MTKNKKYSYGTAGFRTKASDLEAAVYSSGVAAALRSMELKGKTIG
FT                   VMITASHNPVEDNGVKIIDADGGMLAMEWEDKCTQLANAPSKAEFDFLIKQFLTPTTCQ
FT                   PKVIIGYDTRPSSPRLAELLKVCLDEMSASYIDYGYITTPQLHWLVRLINKSTAASFLE
FT                   EGPPITEYYDTLTSAFSKIDPSMQDSPTVSRVVVDCANGVGSQPLKTVAGLVKDSLSIE
FT                   LVNTDVRASELLNNGCGADFVKTKQSPPLALEGKIKPNQLYASIDGDADRLIFYYINQN
FT                   RKFHLLDGDKISTALVGYLNILVKKSGMPFSLGVVQTAYANGASTEYLQDLGITTVFTP
FT                   TGVKHLHKAAKEFDIGVYFEANGHGTVLFSDKALANLAHPFFTPSPVQAAAIEQLQSYS
FT                   VLINQAIGDAISDLLATISVLNALHWDASAWSNTYKDLPNKLAKVKVSDRTIYKSTDAE
FT                   RRLVSPDGLQEKIDALVAKYEKGRSFVRASGTEDVVRVYAEASTKQAADELCEKVCQLV
FT                   L"
FT   5'UTR           complement(433204..433274)
FT                   /locus_tag="SPAC13C5.05c"
FT   3'UTR           complement(434102..434523)
FT                   /gene="mug121"
FT                   /locus_tag="SPAC13C5.06c"
FT   misc_RNA        join(434104..434267,434338..434843)
FT                   /gene="prl5"
FT                   /gene_synonym="prl05"
FT                   /locus_tag="SPNCRNA.05"
FT                   /product="antisense RNA, poly(A)-bearing (predicted)"
FT   CDS_pept        complement(join(434524..434831,434876..435101))
FT                   /transl_table=1
FT                   /gene="mug121"
FT                   /locus_tag="SPAC13C5.06c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13C5.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13C5.06c.1"
FT                   /db_xref="GOA:Q09688"
FT                   /db_xref="PomBase:SPAC13C5.06c"
FT                   /db_xref="PomBase:SPAC13C5.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09688"
FT                   /protein_id="CAA90457.1"
FT                   /translation="MKGFVVISRFILTLFILITPGLAGVVNYAENSEWNVPKYGNVLDS
FT                   NCQGQKPVTFFGSVTEHVSNSWWIKLYDYMMTFISGEKLCMQNVAYEFEDISLCMDVVG
FT                   SKCIPTLQSTDIEKVVNSTSAYLENSESDLTLGCFQIQRFQEESTLYIRALKSSEPVSC
FT                   DTVRCIHFNHIPYV"
FT   5'UTR           complement(435102..435179)
FT                   /gene="mug121"
FT                   /locus_tag="SPAC13C5.06c"
FT   misc_RNA        complement(435113..436058)
FT                   /locus_tag="SPNCRNA.646"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           435170..436213
FT                   /gene="rad32"
FT                   /gene_synonym="mre11"
FT                   /locus_tag="SPAC13C5.07"
FT   CDS_pept        join(436214..436381,436430..436935,437006..437580,
FT                   437624..437807,437853..438369)
FT                   /transl_table=1
FT                   /gene="rad32"
FT                   /gene_synonym="mre11"
FT                   /locus_tag="SPAC13C5.07"
FT                   /product="Rad32 nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13C5.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13C5.07.1"
FT                   /db_xref="GOA:Q09683"
FT                   /db_xref="InterPro:IPR003701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007281"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR038487"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="PDB:4FBK"
FT                   /db_xref="PDB:4FBQ"
FT                   /db_xref="PDB:4FBW"
FT                   /db_xref="PDB:4FCX"
FT                   /db_xref="PomBase:SPAC13C5.07"
FT                   /db_xref="PomBase:SPAC13C5.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09683"
FT                   /protein_id="CAA90458.1"
FT                   /translation="MPNDPSDMNNELHNENTIRILISSDPHVGYGEKDPVRGNDSFVSF
FT                   NEILEIARERDVDMILLGGDIFHDNKPSRKALYQALRSLRLNCLGDKPCELELLSDTSL
FT                   TTGDTAVCNINYLDPNINVAIPVFSIHGNHDDPSGDGRYSALDILQVTGLVNYFGRVPE
FT                   NDNIVVSPILLQKGFTKLALYGISNVRDERLYHSFRENKVKFLRPDLYRDEWFNLLTVH
FT                   QNHSAHTPTSYLPESFIQDFYDFVLWGHEHECLIDGSYNPTQKFTVVQPGSTIATSLSP
FT                   GETAPKHCGILNITGKDFHLEKIRLRTVRPFIMKDIILSEVSSIPPMVENKKEVLTYLI
FT                   SKVEEAITEANAQWYEAQGTVPVVENEKPPLPLIRLRVDYTGGYQTENPQRFSNRFVGR
FT                   VANATDVVQFYLKKKYTRSKRNDGLYTSAVEDIKINSLRVESLVNEYLKTNRLECLPED
FT                   SLGEAVVNFVEKDDRDAIKECVETQLNKQINLLVKKRVTEENLEQEISSIINDLPKIST
FT                   TKRKDYEELPEEVSETSINIAEHTPVLKHTSSLLDHHSPLATSSSEHEMEATPSPALLK
FT                   KTNKRRELPSSLTKKNTRTPQRSKEVKKVPARKLSQSTKKSDKNTQSTLLFYDPSSTTE
FT                   AQYLDNEDDEILDD"
FT   misc_RNA        complement(436953..438699)
FT                   /locus_tag="SPNCRNA.647"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           438370..439980
FT                   /gene="rad32"
FT                   /gene_synonym="mre11"
FT                   /locus_tag="SPAC13C5.07"
FT   misc_RNA        complement(439141..440079)
FT                   /locus_tag="SPNCRNA.648"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           442201..443568
FT                   /gene="fep1"
FT                   /gene_synonym="gaf2"
FT                   /locus_tag="SPAC23E2.01"
FT   CDS_pept        443569..445263
FT                   /transl_table=1
FT                   /gene="fep1"
FT                   /gene_synonym="gaf2"
FT                   /locus_tag="SPAC23E2.01"
FT                   /product="iron-sensing transcription factor Fep1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23E2.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23E2.01.1"
FT                   /db_xref="GOA:Q10134"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="PomBase:SPAC23E2.01"
FT                   /db_xref="PomBase:SPAC23E2.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10134"
FT                   /protein_id="CAA93113.1"
FT                   /translation="MAAKPAPFGQSCSNCHKTTTSLWRRGPDNSLLCNACGLYQKHRKH
FT                   ARPVKSEDLKDISPLIQQVCKNGTCAGDGFCNGTGGSASCTGCPALNNRIRSLNASKSQ
FT                   SGRKSLSPNPSSVPSSTETKASPTPLESKPQIVSDTTTETSNGTSRRRSSHNQHEDSSP
FT                   PHEPSVTFCQNCATTNTPLWRRDESGNPICNACGLYYKIHGVHRPVTMKKAIIKRRKRL
FT                   VFNGNANESQHNLKRMSSGDSGSSVKQQSTRDGPFSKSFPNGNGHASGNSGEGLAEHGM
FT                   NTGVLPPASTFPSYNSNFTGFLPSSFNPSPLMTLSRLAAGEPDNNGKVYYSYGPTQEQS
FT                   ILPLPENKHEGLPPYQNEYVPNGIRANQVVYPGQLVAVGNDSSKQLSESTTSNTDNNGV
FT                   ATANQSNPLGMKFHLPPILPVGESVCLPPRTSAKPRIAEGIASLLNPEEPPSNSDKQPS
FT                   MSNGPKSEVSPSQSQQAPLIQSSTSPVSLQFPPEVQGSNVDKRNYALNVLSQLRSQHDL
FT                   MIQELHNLNQHIQQIDEWLRSSDNENMASEHIKSSTPAVVASGALQT"
FT   3'UTR           445264..445721
FT                   /gene="fep1"
FT                   /gene_synonym="gaf2"
FT                   /locus_tag="SPAC23E2.01"
FT   tRNA            446000..446071
FT                   /locus_tag="SPATRNAVAL.01"
FT                   /product="tRNA Valine"
FT   repeat_region   446075..446342
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        complement(446175..446702)
FT                   /locus_tag="SPNCRNA.649"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        join(446491..446513,446679..449241,449295..450530)
FT                   /transl_table=1
FT                   /gene="lsd2"
FT                   /gene_synonym="swm2"
FT                   /gene_synonym="saf140"
FT                   /locus_tag="SPAC23E2.02"
FT                   /product="histone demethylase SWIRM2 (predicted)"
FT                   /db_xref="GOA:Q10135"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10135"
FT                   /protein_id="CAA93114.1"
FT                   /translation="MPLGRSSWICCAKYFVNTKSRFNEILPPRFTLIVSFYSMNTSEND
FT                   PDGHYDFPEMTEHHSDRASSYANANNVNSTQPQLVSSEQALLAILGGGLQSITPNSVNQ
FT                   NAYSRSTYRTDGGLNSQPVSSLNNQWGNYNPAFLPSRYDSSFHPYTISQAANQPFPQHL
FT                   LGNSNAGVAQQSGMRTIGLPPTVGSSFPQQKSSTYENFFDANSPSSQQFPSTYPSRSQN
FT                   PLSSSGDGSTAIHAGPIQHQNSNAFSNYPYPLDASHLSSQQLLSMYRDQVSHGVTPSTF
FT                   RNHESFMPTQLVSATELSKSVDNAVLPIPPTTAPAVVSPPASSFPLMSSAATSGNISSP
FT                   ALFDSELGARPEGSVAIEPSRVLLQWSSQSSSHTIPSAGASIPTSSLKSFFEHAAEAAR
FT                   KCNLDPRALESFEQHMLSDRLHDPVVLFHYFQIRNSICWLWIKNPTHAISRVEAQGVCV
FT                   DRCLFQLASLAYEFLVRYGYINYGCLSFDSSFTNETNTGTTSSSASKQKTIAVVGAGLT
FT                   GLICARQLTGLFSQYSSSFLSKNELPPKVIILEAKERTGGRIYSRALPVSHTSATQINH
FT                   HTSNSNSISSNSTSLNPKDVTDPSHIPSAIDLGFQFLFSPMDDILLNLLNKQLGIEVTE
FT                   MTGSDLVYDETDTKVLDMVEVKKLNILWEKLLEYVSVCFFINVEESVRISWISQFQLFI
FT                   DEMFPDHLSKSLSLNASHEFSFKKTMLILIDEVSSYAKLGNSQKKFLIWCFKVAELDDT
FT                   LYPLNTVDTDFSKDILIPKVARRGLSQLPWALQSYPSPLNIHYEKFVSKVTIENDKCTL
FT                   DCKDNSSYEVDQVVIACSPSHFSSNIEFSPGLPNFVTENIKSIDFKPGKKVILRYAAAF
FT                   WRKNIRSFGIIPKSLSQEMNNDENDGKSCFVLRIWNMLPETGVPILVADINPQMTSSSS
FT                   NETSHLIQELHSLIVDHFQNDSNSSADLLDAWVTNWSRNGVYDGLNSYPNFANDKQQYE
FT                   KRFRQSQLSYNLGRLHIAGDYIFSCVGCRTLQRSFLSGLSVCTGIIDSLAPISLTIPII
FT                   GETSRKELDQFLRNSKVNNFDPNAEAQRHLSYQARYRLKKQERLDEHKEEQEQLVTELL
FT                   GYLPEPPSKPNANPFLLYQKMQWHVCRALADEDKRRLTGDSTAKATINETRAKLGKTWR
FT                   QLDDLGKKPWIDEIAAQREAYAGKILRYQRLTKEYEMRAEQIRNDYAAKCQDEPIPDDE
FT                   ARLFMQAQREEEQRKQTQDDNISKSREASDEEYHDDGSSDSGYNGTRY"
FT   intron          448080..448157
FT                   /gene="lsd2"
FT                   /gene_synonym="swm2"
FT                   /gene_synonym="saf140"
FT                   /locus_tag="SPAC23E2.02"
FT   3'UTR           450531..450726
FT                   /gene="lsd2"
FT                   /gene_synonym="swm2"
FT                   /gene_synonym="saf140"
FT                   /locus_tag="SPAC23E2.02"
FT   3'UTR           complement(450860..451209)
FT                   /gene="ste7"
FT                   /locus_tag="SPAC23E2.03c"
FT   intron          complement(451001..451261)
FT                   /gene="ste7"
FT                   /locus_tag="SPAC23E2.03c"
FT   CDS_pept        complement(451210..452919)
FT                   /transl_table=1
FT                   /gene="ste7"
FT                   /locus_tag="SPAC23E2.03c"
FT                   /product="meiotic suppressor protein Ste7"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23E2.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23E2.03c.1"
FT                   /db_xref="GOA:Q10136"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="PomBase:SPAC23E2.03c"
FT                   /db_xref="PomBase:SPAC23E2.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10136"
FT                   /protein_id="CAA93115.3"
FT                   /translation="MFLEIILDSATYSFDRVITGKICFETNAATSPRSFQIQLRIKGYA
FT                   VYHHGFLSSPSHKHPTTASASDSDEATEIFTHSQPLPIPAGPSSKSHAIDFKFKFPSKS
FT                   ASSLPCSKSNDSMVNICYMLKATISKRYAFLGSSQSAKAELIMVPPNLAGKPLSANSSF
FT                   GSSAKTFQLPEFDSVTPSASLYKQPSFNSNPAPITTSSATHTSQFSTSSSSSVNSVHTP
FT                   VMVPNPYFQYNSSMTAPSSSSSSVAPFVPRRQFSVSSASDPPQTPISMSPPIPPTPSQF
FT                   SAFMYQNQQSYLSPQSHYENPLSISSRPSPCCPSTPSSAVTLSNGFDSQSNAYNNSGTG
FT                   PPMLYKFPQRSYTAPNTSFNSQRRMSSITSLPTASFCPVKHGVSPPSLAGNQPSPLSSP
FT                   LTNSNVSPSTICSPDNNVTFVNLAPGEKLTFKIEPNDLMDEEEVVENSNMYSIPGKTVA
FT                   TTVCHSSSSSGDFSALSCHRNLSFSESLPTAEDQVHNNHCAVSPSRRSSSNALYLATLP
FT                   MGYERSNSVSYCSDSSLSSPLPDDNMLQDPHALNMAYAKEFDVLINEVLQSL"
FT   5'UTR           complement(452920..453603)
FT                   /gene="ste7"
FT                   /locus_tag="SPAC23E2.03c"
FT   misc_RNA        453735..455859
FT                   /locus_tag="SPNCRNA.650"
FT                   /product="intergenic RNA (predicted)"
FT   rRNA            456527..456645
FT                   /locus_tag="SPRRNA.11"
FT                   /product="5S rRNA"
FT   3'UTR           complement(456931..457060)
FT                   /locus_tag="SPAC24H6.13"
FT   CDS_pept        complement(457061..459676)
FT                   /transl_table=1
FT                   /locus_tag="SPAC24H6.13"
FT                   /product="DUF221 family protein implicated in Golgi to
FT                   plasma membrane transport (predicted)"
FT                   /db_xref="GOA:Q09766"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="InterPro:IPR027815"
FT                   /db_xref="InterPro:IPR032880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09766"
FT                   /protein_id="CAA90857.1"
FT                   /translation="MSDSSSSSTSAFVSSLVFNFAIFCAFIGLFLCLRPREKHVYQPRC
FT                   IIDTQPKEEKPEPSPSSPFGLFAYVVKRSETYLIQYAGVDGYFFIRYLFTFGALCILGC
FT                   LVLFPILLPVNATNGVGEKGFDILSFSNVKNHNRFYAHVFLSWLFFGFTIFIIYRELRY
FT                   YVIFRHAMQSSGLYNNLPSSSTMLLTELPNSVLNDEETLHELFPNASEFTCVRDLKKLE
FT                   KKVKKRSDLGNKYESTLNSLINKSVKKHNKLVKKHKPLPSTLDYTAYVKKRPTHRLKFL
FT                   IGKKVDTIDYCRDTIAELDEVVDKLQTSLEERKKVGSVFIRFRSQTDLQTAYQAFLYSK
FT                   KFRKYRFGRALVGIAPEDIVWSNLDLSMYTRRGKKTISNTILTLMIIFWAFPVAVVGCI
FT                   SNVNYLIEKVHFLKFIDHMPPKLLGIITGILPSVALSILMSLVPPFIKFLGKFGGALTV
FT                   QEIENYCQNWYYAFQVVQVFLVTTMTSAATSAVVQVIKEPASSMTLLASNLPKASNFYI
FT                   SYFLLQGLSIPGGALLQIVTLLLSKVLGRIFDNTPRKKWNRWNQLSAPSWGTVYPVYSL
FT                   LVTIMICYSIIAPIIIGFAAVAFVLIYFAYSYNLIYVLGHNADAKGRNYPRALFQVFVG
FT                   LYLAEVCLIGLFVLAKNWGATVLEAVFLGFTVACHLYFKYKFLPLMDAVPISAIESVSE
FT                   RPEIKYPMDLGTSEMKNVGRAYPEILEKLSSSSGSDEFLETSSRTSENTKEKIDKDDEG
FT                   FAITNISSVHKMPSFVLSYFSDLAASNRILTGFDRVLQLLPSFYDIPVRVRNVQYVSPA
FT                   LKATPPSVWIPKDPLGLSTYAIEDARGKVDIFDDNTTFNEKGNLQYTGPPPDYDEAIRS
FT                   "
FT   5'UTR           complement(459677..460811)
FT                   /locus_tag="SPAC24H6.13"
FT   misc_RNA        460793..461752
FT                   /locus_tag="SPNCRNA.651"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           461686..461938
FT                   /gene="uba3"
FT                   /locus_tag="SPAC24H6.12c"
FT   CDS_pept        461939..463273
FT                   /transl_table=1
FT                   /gene="uba3"
FT                   /locus_tag="SPAC24H6.12c"
FT                   /product="NEDD8 activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.12c.1"
FT                   /db_xref="GOA:Q09765"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR014929"
FT                   /db_xref="InterPro:IPR023318"
FT                   /db_xref="InterPro:IPR030468"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="PomBase:SPAC24H6.12c"
FT                   /db_xref="PomBase:SPAC24H6.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09765"
FT                   /protein_id="CAA90856.1"
FT                   /translation="MPSSDVCKAGSHRHSGWIQSLKKPGPFNLDAPENPEETLKSAFSS
FT                   KILIIGAGGLGCEILKDLALSGFRDLSVIDMDTIDITNLNRQFLFNESNIDEPKANVAA
FT                   SMIMKRIPSTVVTPFYGKIQDKTIEFYKEFKLIICGLDSVEARRWINSTLVAIAKTGDL
FT                   IPLVDGGSEGLKGQARVIIPTITSCYECSLDMLTPKISYPICTLANTPRLPEHCVEWAY
FT                   LLEWPRVFLNASVDSFSKQEVFEPLDGKNSNFEPDNIRHIDWLVKRSIERANKFQIPSS
FT                   SINRFFVQGIVKRIIPAVASTNAIIAASCCNEALKILTESNPFLDNYMMYVGEDGAYTY
FT                   TFNLEKRSDCPVCGVLSEVYDISASSTVTLKDILNHYSKSYNLQNPSVSTAAGTPLYLA
FT                   SPPALQVATSKNLSQPILSITSVDVNLVITDKNLSTSLSVQLREC"
FT   3'UTR           463274..463599
FT                   /gene="uba3"
FT                   /locus_tag="SPAC24H6.12c"
FT   5'UTR           464120..465298
FT                   /locus_tag="SPAC24H6.11c"
FT   CDS_pept        465299..468175
FT                   /transl_table=1
FT                   /locus_tag="SPAC24H6.11c"
FT                   /product="sulfate transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.11c.1"
FT                   /db_xref="GOA:Q09764"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="PomBase:SPAC24H6.11c"
FT                   /db_xref="PomBase:SPAC24H6.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09764"
FT                   /protein_id="CAA90855.1"
FT                   /translation="MPTHSLNQKRSLLYPSIDNGSVPDSSFLSQSFRDTNDIHLLSARL
FT                   ASVEVDPETLPSNSPETNDDVSNYDYMSISSYQRAHSLASTSRNDFNYRPSEINETRPL
FT                   LPEREEHSSQLPPAQNQVLPFQSLNAPSKKLRGRISLSKIYQFFFDDKGPILFILNIPA
FT                   VIIGLLLNILDALSYGLILFPISDPLFKNLGADGLAIYYVSCVVSQLVYSLGGSFFKGS
FT                   VGSEMIEVIPFFHQIAFTILNRVGEDNPKSVIATTILAYCLSSILTGLVFFILGILRLG
FT                   RLIEFFPRHILLGCIGGVGSFLVLTAVEVSSRLEGSVSFNWASLSALFQPMTFAKWSIP
FT                   LFLSSALEFAQQRWPHPFLIPSFFVIAPAIFYVLVWAIPGMSLEYLRETGWVFSSTETN
FT                   VPWYHFYSLFSLRDTDWSALLATVPEMCALTFFGILHVPINVPALAISLGLDFVDTDKE
FT                   LIAHGVSNTLSGAVGSIQNYMTYTNSLMFIRSGGNNRLAGIMLALATVALLVIGPGIIA
FT                   YIPVWTVGCLIYLLGIELLKESLWDPIGITTKIEYFTICAIVFTMTVVDFVVGIVIGII
FT                   MACVFFVIQASSRSALRGIYSGGIVRSTVRRPMNQQRFLNEIGRQIQVCKLSGFLFFGT
FT                   INGVEKNIAGLIEELNVSNNPLRFLIIDFSLVNGADFSVVQAFLRIRRMLATMNVQLCV
FT                   CGLDETRSSFKTLTTMCFGGDDNCGCQVFEDVNSSLEYCENMLLDDYDVYRTKLLHKAG
FT                   YSHTLAVPGKHKQNISMAETFSPSPRHDLLRQVAMSSVKAETKELSKFEKYAKYEQPFP
FT                   LLMQVFGEITTKREDFWLGLCPFFKKAFLRKGDLLWRKGDTPSKLVILETGMVKASYQM
FT                   DRESLSENITCLCVVGELPFFSKTCYNATVVAELDSAVWILDREGWETMLKSSDKAEVI
FT                   ENEMLYLTLKMTRDKFNVFTNFALNLYR"
FT   misc_RNA        complement(465302..468551)
FT                   /locus_tag="SPNCRNA.652"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           468176..468581
FT                   /locus_tag="SPAC24H6.11c"
FT   5'UTR           468664..468719
FT                   /locus_tag="SPAC24H6.10c"
FT   CDS_pept        468720..469826
FT                   /transl_table=1
FT                   /locus_tag="SPAC24H6.10c"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase
FT                   (predicted)"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.10c.1"
FT                   /db_xref="GOA:Q09755"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PomBase:SPAC24H6.10c"
FT                   /db_xref="PomBase:SPAC24H6.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09755"
FT                   /protein_id="CAA90854.1"
FT                   /translation="MDKHTPLLPGDSVFSRCKTEDSRIKGYDPVISPALIQSELAASDE
FT                   TLAFVSDQRRQAADIIAGRDDRLLLIVGPCSLHDPVAAKEYAIRLQKEAIKHKKDLHII
FT                   MRAYLEKPRTTVGWKGLINDPDLDGSYNINKGIRVARRIFLELLETGVGIASEMLDTIS
FT                   PQYLADLICWGAIGARTTESQLHRELASGLSFPIGFKNATDGNIGIAIDAMNSSANPHH
FT                   FLSVTKQGVVAIVTTTGNPDTHIILRGGKSGTNFDADSVAGAKAKLEECNKLPSIMIDC
FT                   SHGNSSKNHKNQPKVAACIAEQVANGQKAITGVMIESHLNEGKQAIPEDDLSSMKYGVS
FT                   VTDACIGWDDTTAVFEQLAAAVRSRRSH"
FT   3'UTR           469827..469890
FT                   /locus_tag="SPAC24H6.10c"
FT   3'UTR           complement(469981..470582)
FT                   /gene="gef1"
FT                   /locus_tag="SPAC24H6.09"
FT   CDS_pept        complement(join(470583..472802,472858..472899))
FT                   /transl_table=1
FT                   /gene="gef1"
FT                   /locus_tag="SPAC24H6.09"
FT                   /product="RhoGEF Gef1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.09.1"
FT                   /db_xref="GOA:Q09763"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="PomBase:SPAC24H6.09"
FT                   /db_xref="PomBase:SPAC24H6.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09763"
FT                   /protein_id="CAA90853.1"
FT                   /translation="METLKADLSDMSDSPEYFETLANRDLPRLPGTSKLHRAACIKRKS
FT                   INLSLPSNSYSLSYRQSDDTDGDVSESQSEYRLSSGRRSRASFARALQDPQTPNTPPVS
FT                   SQHRRFFSEGSFNLPNSNMSHSLNGDSTASNSSTLTPNRIYGDRNRQDYAQSSRYTLPS
FT                   LPSSPSYNCPTTLRKIHTNTSSNGTSRRVSGLGSFMAQNSSETSSNRTSAYLPGSSTDE
FT                   QEKRSSVTLASMPSSHSSTASLLSPLDTTSFSTKLDSTILALETDESLSRTISYATTSL
FT                   PSTPGKRLSKESLAMSEASSINPEYKRIKKRANLIKELVTTEAAYLNDLIAIQQSYGLR
FT                   VKECSALNPVDAQTVFGDIESLLTFTVEFHSRLYQAGEGSWRVNLDTQLIDPLPCNLGL
FT                   IFLESLSEIGQIYTGYCNRQDSVFKIITKWREKPATASWIMEGDKIVQKYTNAWDLGSL
FT                   IIKPLQRLLKYPLLLQKIIDVTPESSSERPDLVLSYQLLQELISGINQKQKPSHKRGSL
FT                   SASHKRDAAWSLLYKATSNKSRPTTTSTELKTDARLNFQRQVLQDFRQRFAILKALHAT
FT                   LETWYVTVHRGFSVFEKVLAELEGLSALEPEDKPVDTWRKYHLLAHMMTANLPSQIQTS
FT                   LNSSILNPITNILRVIQKVIQFIISAEFVIPAQKLEAISTLVEKEFHSVVYHFIGIQRS
FT                   LYENYAQGFLFLIPQDMRDSILEETQDYAELVRAFEPMHYDDEVLLEELMKSVSLAARV
FT                   "
FT   5'UTR           complement(472900..472993)
FT                   /gene="gef1"
FT                   /locus_tag="SPAC24H6.09"
FT   3'UTR           complement(473792..474034)
FT                   /locus_tag="SPAC24H6.08"
FT   CDS_pept        complement(474035..474697)
FT                   /transl_table=1
FT                   /locus_tag="SPAC24H6.08"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.08.1"
FT                   /db_xref="GOA:Q09762"
FT                   /db_xref="PomBase:SPAC24H6.08"
FT                   /db_xref="PomBase:SPAC24H6.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09762"
FT                   /protein_id="CAA90852.1"
FT                   /translation="MTSHQTGKIEVHWNDPSSGIFLSQTQRTSSTSSLKKSASSRRLVY
FT                   GDDMLAPKPLAGQVLSKSPLPPFSPSKIMNRSISVPPTNISVPQISSNPLNLMKKSSDN
FT                   DIFTTFNDTTNDCMNEASCEDVRHSLLQIIESKSNLSDSVHKMLGERVKTNLLLQGQLE
FT                   NMEGFWLQKLSQTCRLALTGNISEAKAFIVEIMCAGVVTNCVRWCPVLKTLIENLAI"
FT   5'UTR           complement(474698..475041)
FT                   /locus_tag="SPAC24H6.08"
FT   3'UTR           complement(475354..475492)
FT                   /gene="rps901"
FT                   /gene_synonym="rps9-1"
FT                   /gene_synonym="rps9a"
FT                   /locus_tag="SPAC24H6.07"
FT   CDS_pept        complement(join(475493..476053,476099..476113))
FT                   /transl_table=1
FT                   /gene="rps901"
FT                   /gene_synonym="rps9-1"
FT                   /gene_synonym="rps9a"
FT                   /locus_tag="SPAC24H6.07"
FT                   /product="40S ribosomal protein S9"
FT                   /db_xref="GOA:Q09757"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09757"
FT                   /protein_id="CAA90851.1"
FT                   /translation="MPSAPRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWRV
FT                   ALTLSKIRRAARELLTLDEKDPKRLFEGNAIIRRLVRLGILDETRMKLDYVLALRIEDF
FT                   LERRLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKHIDFALSSP
FT                   YGGGRPGRCKRKRLRSQEGGEGEEAEEE"
FT   5'UTR           complement(476114..476128)
FT                   /gene="rps901"
FT                   /gene_synonym="rps9-1"
FT                   /gene_synonym="rps9a"
FT                   /locus_tag="SPAC24H6.07"
FT   regulatory      complement(476164..476171)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(476183..476192)
FT                   /regulatory_class="promoter"
FT   3'UTR           complement(476474..476548)
FT                   /gene="sld3"
FT                   /gene_synonym="mug175"
FT                   /locus_tag="SPAC24H6.06"
FT   CDS_pept        complement(join(476549..478606,478655..478696))
FT                   /transl_table=1
FT                   /gene="sld3"
FT                   /gene_synonym="mug175"
FT                   /locus_tag="SPAC24H6.06"
FT                   /product="DNA replication pre-initiation complex subunit
FT                   Sld3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.06.1"
FT                   /db_xref="GOA:Q09761"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="InterPro:IPR042511"
FT                   /db_xref="PDB:6HM3"
FT                   /db_xref="PomBase:SPAC24H6.06"
FT                   /db_xref="PomBase:SPAC24H6.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09761"
FT                   /protein_id="CAA90850.3"
FT                   /translation="MNNDHASKKSFCIKAPSNWEKSYLEVWPLVTVPRQCICLRWCISK
FT                   EYHEFTCSSLQFIVIRPAGTSVLLGRVKSSKANQLVGIEHVEGSRYALIFLSEKLDFKS
FT                   LKVIANHQLTKSSKSLSNVSNKPLGDQLFRSNSLMSPSLLKKELHRIQSDASQANERES
FT                   QAPHSFVTHDLISSSKDGNSLTHEFANDSVTEMVQDYTPSCSRDVKSLLDHLYNSYFYQ
FT                   LLMTKTPVVFYVKQMVGKTRQLAVEVHNHVEEKALVDELLKFLDNLKSVDDRKSRLLQC
FT                   FESHLNYKAWHLEFENEAHQYEIKGYRLWLQNILNRENCQITKLDFEREFSQLKLKEYE
FT                   IRVLLYFEILYLFLKWDPEYARRRANDNSLLDSRDSGKRKSRKKNAKTLNPFETAQLKL
FT                   EFTFDGLCIRRTIEQNATERSEDLLLKFCKETIVPYYSSKFPRITRNLLEKCNGLDLLP
FT                   ERSHKHRHSAPPRSKLISSKSEAGRALPGNTSGASISNTSSPHSEASISKDYEILKRRR
FT                   SNSGVHSLTRSDSSFNGFERDTRRRSSDIARIKNREINLPSSSLSKQRNSMHDISTNFP
FT                   RRNLSFTEKLTMASLQGQSEESVQPKTTSSLSRSKTLSILEGSVSKRSEPSMDSILVQA
FT                   TPRKSSSVITELPDTPIKMNSLDKASACTVENHIVTESPAHKSNKAQLFVCVPTTPVKK
FT                   KSASP"
FT   intron          complement(478607..478654)
FT                   /gene="sld3"
FT                   /gene_synonym="mug175"
FT                   /locus_tag="SPAC24H6.06"
FT   5'UTR           complement(478697..478803)
FT                   /gene="sld3"
FT                   /gene_synonym="mug175"
FT                   /locus_tag="SPAC24H6.06"
FT   3'UTR           complement(479228..479749)
FT                   /gene="cdc25"
FT                   /gene_synonym="sal2"
FT                   /locus_tag="SPAC24H6.05"
FT   CDS_pept        complement(479750..481540)
FT                   /transl_table=1
FT                   /gene="cdc25"
FT                   /gene_synonym="sal2"
FT                   /locus_tag="SPAC24H6.05"
FT                   /product="M phase inducer phosphatase Cdc25"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.05.1"
FT                   /db_xref="GOA:P06652"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="PomBase:SPAC24H6.05"
FT                   /db_xref="PomBase:SPAC24H6.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06652"
FT                   /protein_id="CAA90849.1"
FT                   /translation="MDSPLSSLSFTNTLSGKRNVLRPAARELKLMSDRNANQELDFFFP
FT                   KSKHIASTLVDPFGKTCSTASPASSLAADMSMNMHIDESPALPTPRRTLFRSLSCTVET
FT                   PLANKTIVSPLPESPSNDALTESYFFRQPASKYSITQDSPRVSSTIAYSFKPKASIALN
FT                   TTKSEATRSSLSSSSFDSYLRPNVSRSRSSGNAPPFLRSRSSSSYSINKKKGTSGGQAT
FT                   RHLTYALSRTCSQSSNTTSLLESCLTDDTDDFELMSDHEDTFTMGKVADLPESSVELVE
FT                   DAASIQRPNSDFGACNDNSLDDLFQASPIKPIDMLPKINKDIAFPSLKVRSPSPMAFAM
FT                   QEDAEYDEQDTPVLRRTQSMFLNSTRLGLFKSQDLVCVTPKQSTKESERFISSHVEDLS
FT                   LPCFAVKEDSLKRITQETLLGLLDGKFKDIFDKCIIIDCRFEYEYLGGHISTAVNLNTK
FT                   QAIVDAFLSKPLTHRVALVFHCEHSAHRAPHLALHFRNTDRRMNSHRYPFLYYPEVYIL
FT                   HGGYKSFYENHKNRCDPINYVPMNDASHVMTCTKAMNNFKRNATFMRTKSYTFGQSVLA
FT                   SPDVNDSPTAMHSLSTLRRF"
FT   5'UTR           complement(join(481541..482185,482286..482556))
FT                   /gene="cdc25"
FT                   /gene_synonym="sal2"
FT                   /locus_tag="SPAC24H6.05"
FT   3'UTR           complement(482607..483446)
FT                   /gene="hxk1"
FT                   /locus_tag="SPAC24H6.04"
FT   CDS_pept        complement(483447..484901)
FT                   /transl_table=1
FT                   /gene="hxk1"
FT                   /locus_tag="SPAC24H6.04"
FT                   /product="hexokinase 1"
FT                   /EC_number="2.7.1.1"
FT                   /EC_number="2.7.1.4"
FT                   /EC_number="2.7.1.7"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.04.1"
FT                   /db_xref="GOA:Q09756"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="PomBase:SPAC24H6.04"
FT                   /db_xref="PomBase:SPAC24H6.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09756"
FT                   /protein_id="CAA90848.1"
FT                   /translation="MSLHDAYHWPSRTPSRKGSNIKLNKTLQDHLDELEEQFTIPTELL
FT                   HRVTDRFVSELYKGLTTNPGDVPMVPTWIIGTPDGNEHGSYLALDLGGTNLRVCAVEVQ
FT                   GNGKFDITQSKYRLPQELKVGTREALFDYIADCIKKFVEEVHPGKSQNLEIGFTFSYPC
FT                   VQRSINDASLVAWTKGFDIDGVEGESVGPLLSAALKRVGCNNVRLNAILSDTTGTLVAS
FT                   NYASPGTEIGVIFGTGCNACYIEKFSEIPKLHKYDFPEDMNMIINCEWCDFDNQHVVLP
FT                   RTKYDVAIDEESPRPGLQTYEKMIAGCYLGDILRRILLDLYEQGALFNGQDVTKIRDPL
FT                   AMDTSVLSAIEVDPFENLDETQTLFEETYGLKTTEEERQFIRRACELIGTRSARLSACG
FT                   VCALVRKMNKPSMIVGTDGSVYNLYPRFKDRLAQAFKDILGEEIGSKVVTIPAEDGSGV
FT                   GAALVSALEAKGKALTSDILAEHLKN"
FT   5'UTR           complement(484902..485408)
FT                   /gene="hxk1"
FT                   /locus_tag="SPAC24H6.04"
FT   misc_RNA        485606..487008
FT                   /locus_tag="SPNCRNA.653"
FT                   /product="antisense RNA (predicted)"
FT   misc_RNA        485703..486330
FT                   /gene_synonym="SPNG2AF15"
FT                   /locus_tag="SPNCRNA.551"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(485723..485959)
FT                   /gene="cul3"
FT                   /gene_synonym="pcu3"
FT                   /locus_tag="SPAC24H6.03"
FT   CDS_pept        complement(join(485960..486131,486188..486597,
FT                   486649..486822,486867..486931,486984..487093,
FT                   487133..488517,488574..488615))
FT                   /transl_table=1
FT                   /gene="cul3"
FT                   /gene_synonym="pcu3"
FT                   /locus_tag="SPAC24H6.03"
FT                   /product="cullin 3"
FT                   /db_xref="GOA:Q09760"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016157"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09760"
FT                   /protein_id="CAA90847.1"
FT                   /translation="MQRSAKLKIRAPRKFSANQVDFATHWEVLQRAIGDIFQKSTSQLS
FT                   FEELYRNAYILVLHKYGEKLYNHVQDVIRSRLKEETVPAIYKNYDASLLGNALLDIRKN
FT                   DSYSTSWSRSLEAAHRFLSSLVNSWKDHIVSMQMISSVLKYLDKVYSKSADKVPVNENG
FT                   IYIFREVVLLNSFEIGEKCVETILILVYLERKGNTINRPLINDCLDMLNSLPSENKKET
FT                   LYDVLFAPKFLSYTRNFYEIESSTVIGVFGVVEYLKKAEKRFEEEKERSKNYLFTKIAS
FT                   PLLSVVEDELLSKHLDDLLENQSTGFFSMIDSSNFEGLQLVYESFSRVELGVKSLKKYL
FT                   AKYVAHHGKLINETTSQALEGKMAVGRLSSNATMATLWVQKVLALWDRLNTIISTTMDA
FT                   DRSILNSLSDAFVTFVDGYTRAPEYISLFIDDNLKKDARKAIEGSIEATLQNSVTLFRF
FT                   ISEKDVFEKYYKTHLAKRLLNNRSISSDAELGMISRLKQEAGNVFTQKLEGMFNDMNLS
FT                   QELLQEYKHNSALQSAKPALDLNVSILASTFWPIDLSPHKIKCNFPKVLLAQIDQFTDF
FT                   YLSKHTGRKLLWYPSMGSADVRVNFKDRKYDLNVSTIASVILLLFQDLKENQCLIFEEI
FT                   LEKTNIEVGDLKRNLQSLACAKYKILLKDPKGREVNAGDKFYFNENFVSNLARIKISTV
FT                   AQTRVEDDSERKRTLEKVDESRKHQADACIVRVMKDRKVCEHNQLMAEVTRQLNPRFHP
FT                   SPMMIKRRIEALIEREYLQRQADNGRIYEYLA"
FT   5'UTR           488339..488778
FT                   /locus_tag="SPAC24H6.02c"
FT   5'UTR           complement(488616..488811)
FT                   /gene="cul3"
FT                   /gene_synonym="pcu3"
FT                   /locus_tag="SPAC24H6.03"
FT   CDS_pept        join(488779..489029,489074..489350)
FT                   /transl_table=1
FT                   /locus_tag="SPAC24H6.02c"
FT                   /product="TIM23 translocase complex subunit Tim15
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.02c.1"
FT                   /db_xref="GOA:Q09759"
FT                   /db_xref="InterPro:IPR007853"
FT                   /db_xref="InterPro:IPR024158"
FT                   /db_xref="PomBase:SPAC24H6.02c"
FT                   /db_xref="PomBase:SPAC24H6.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09759"
FT                   /protein_id="CAA90846.1"
FT                   /translation="MWSFARYTQKFCLRNLQLKNFSNKVKVSSLLFCSPNVRNISNWQC
FT                   KRFTQSDAKDLASGVPSVKSDADQLQPKPTYNVSFTCTVCNTRSNHNFSKQAYHNGTVL
FT                   VQCPKCKNRHLMADHLKIFSEERVTIEDILAKKGETFKKGYGQVINGNVVEFKPPQFKI
FT                   RPAKSSSSNSSK"
FT   misc_RNA        complement(489023..489562)
FT                   /locus_tag="SPNCRNA.654"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           489351..489482
FT                   /locus_tag="SPAC24H6.02c"
FT   5'UTR           489871..490015
FT                   /gene_synonym="SPAPB21F2.01"
FT                   /locus_tag="SPAC24H6.01c"
FT   CDS_pept        join(490016..490262,490338..490771,490812..490931,
FT                   490979..491149,491186..491858,491905..492011)
FT                   /transl_table=1
FT                   /gene_synonym="SPAPB21F2.01"
FT                   /locus_tag="SPAC24H6.01c"
FT                   /product="membrane bound O-acyltransferase, MBOAT
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC24H6.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC24H6.01c.1"
FT                   /db_xref="GOA:Q09758"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="PomBase:SPAC24H6.01c"
FT                   /db_xref="PomBase:SPAC24H6.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09758"
FT                   /protein_id="CAA90845.4"
FT                   /translation="MLRLFRFDVLETSTKDTERPNSKSSRLSSTSGSSHPSSSSRLTVR
FT                   SAVPEKSAFGSIEFIFYFSVILSILTIACFKIHYVSSPKHPNYKNIEKYLKPGWLFGQK
FT                   VDSADFQYSAFRENMPILLLVIIVYNFLWRLVKLVFTKNTNDELAIKNNYRLCFSLLFA
FT                   LLVYGTGVIYVLTIALINYLISKSLKNSIFNPLLTWTLDISVVFFKEYFAYCKFSSLHP
FT                   GLGFLDQYTGILERWYVLFNITMLRLVSFNMDYYWSLKHNSEKLNTLIFDKDREPTTLT
FT                   FRERVDYSCLDEDYNLKNFLTYIFYAPLYLAGPIISFNNFMSQMKYPTVSTLKYRNLLY
FT                   AIRFLVCVLTMEFLLHYAYVTAISKDGNWNQYSAVESAMISFIVLFMTWLKLLIPWRLF
FT                   RLWSLIDDIEPPENIVRCMCNNYSAVGFWRAWHRSFNRWLIRYIYVPLGGSNHSILNLF
FT                   IIFTFVALWHDISWELFAWGWLIVLFILPERLCCFMSRRTGLTKHPYYRYISGFGAALN
FT                   IYFMIICNLIGFAVGIDGIKNVLVSFFLTLKGAMSAIAAFIMFFSAVQIMFQIRVNEEE
FT                   EGINLRC"
FT   misc_RNA        complement(491816..492201)
FT                   /gene="prl47"
FT                   /locus_tag="SPNCRNA.47"
FT                   /product="antisense RNA, poly(A)-bearing RNA (predicted)"
FT   3'UTR           492012..492181
FT                   /gene_synonym="SPAPB21F2.01"
FT                   /locus_tag="SPAC24H6.01c"
FT   5'UTR           492335..492460
FT                   /locus_tag="SPAPB21F2.02"
FT   CDS_pept        join(492461..492476,492512..492630,492673..494385,
FT                   494423..494615,494667..497689)
FT                   /transl_table=1
FT                   /locus_tag="SPAPB21F2.02"
FT                   /product="Dopey family protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAPB21F2.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAPB21F2.02.1"
FT                   /db_xref="GOA:Q9C0Z4"
FT                   /db_xref="InterPro:IPR007249"
FT                   /db_xref="InterPro:IPR040314"
FT                   /db_xref="PomBase:SPAPB21F2.02"
FT                   /db_xref="PomBase:SPAPB21F2.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0Z4"
FT                   /protein_id="CAC36891.1"
FT                   /translation="MNTIIDASNDAKYRKYQDAIRKCIALFQTVEQWPDYISFLTKLHK
FT                   VLQTHSSFVNIPCSLLVSRALAECLSPGLPSGVHKKTLEVYDYIFTIIGSKTLTNELST
FT                   WSYGLTPFFSISSIKTKHDYINIIKKHYVSLGVGIRPCFQAVFISLLSGLEEDVDESSQ
FT                   EVYHLLDDLVKVLNDEKFAWGCIWSTILSFPSQRPGALAYLLRVCNNLAEEDIQTRVIQ
FT                   PDSGLVVRSFAAAISDNDILVQRGYMDALLNYFPIQSTFYKDVKPFDLKLLHMSVASIV
FT                   LRNDLSLNRRFYAWLMGLSKDTELSISDSSITVDENTLQQNMAIFFEGVKDLLSSKNSL
FT                   MSFYKAFRILYALSDRRPLFTIVESQILPCVLHSYETLTNVFHRDDSKHLYESAVDHGR
FT                   RLIMKFSDSELHTFLFHCVNKIVANTTENSDSAEAVKFILDSQNFFFESINTEYSFIIF
FT                   TNLLMHLEKTSPNSDVDGVSMTILTICKILLNNFDWNFFNYNNSAIDSYAKCTLNLDSD
FT                   FENGILTYEILYKKCKCSLLSLLKQYIKDSHVHHEVLLISLNLIKEASDTEFENEFLDL
FT                   SLQGFKDNSWSFQTLGSFVKQLPSRILINSTACVNVILDRIWCELCMFSYFREEELLSV
FT                   IWTLQEKLQTRIIESYFSTCIVKEQLELRAPTIYYTPFYNLLKKSAQQSLFHFVFDRPL
FT                   LLLLNSLLEDESGRDYTAMMNWINASSSLQLRVLELMTENLLSLSPNLTSVNSLETAMT
FT                   RYNINEDQRNSEASRCVYFLKLCTRIISYFQDLHPKEGRLKSAKQVEELCLVTWADALL
FT                   IQKKSLTYSSFLAFLVKLCLDIVLTPQNIKTSTDVYIIQTWALRLLYQITSIWENPLKF
FT                   ESSLIVGLFALVQEVERSPSSTYRSFILSLLQMLEFLLSRLDGTIDLSSEQHYLLSNFV
FT                   LVGMLNDDPGLSPKWLHAIKKLLPLLLQNLQLLMVNPIQSLCKFVHSFLDQHESMYLKY
FT                   PDPVKDYACMDVFIAKLKMLSELVSAALLEFTYSPGPKKSNLEANGIIGNVISGVFAAE
FT                   SSGVSIDVNKRLSMLLTMQDALQTLFLSYSWHIRSSYADKTSKVFMNDSSVLKEASLSG
FT                   LKEFYFCEPLECVETLVQIYLENNVECCQCIWDIFSFLSDSEPQYIVKQLVSSFFAREG
FT                   IASYAGPSSLTAKITQLDILCCMSDFVSRVEGENTSKIFTEISKFVREIISSSNSFKNY
FT                   LLVCLRMLLEVAKNVNTYCESRQQKDFIDLMGKTLSSVLFHAGKSSDPNLTVDFLAYHK
FT                   AAADTFEVAKTQKKTSSVYLFVKYLDPSLLDFFCSEFVPKITELSKEEDKLVAWATSIV
FT                   NVFITPLVKARTFPESLTTYHLDLLLVLSKHPFLSKSWRRDFWEIFNDNSLFRFDIDQL
FT                   RKLSPVIYTALYQEISRLNDLITKSDLGVTTLFTSRDTQLGARQSNICRITILMLSSPR
FT                   DFFLPSLPPLIDLVKRLITSDPEGVLKKDLFLFIRALALRTSSKHLLPLWPIVVSELLI
FT                   IFKSYCMPNVAISKETLLDACRLLDFLTALKLEEFALHEWVVMLSPLDAVYWSGKTSRK
FT                   SLVQKVSERLQEQASEKDDKSSVESEHSILTSTTRTPSLGIYTTDAQLRNFLNRISIDA
FT                   YEESYSFSTIDIQSFENSIYREVLQRFSNAPLSPFSSIKAPSSLAGSSN"
FT   3'UTR           497690..497927
FT                   /locus_tag="SPAPB21F2.02"
FT   5'UTR           498111..498170
FT                   /locus_tag="SPAPB21F2.03"
FT   CDS_pept        join(498171..498173,498215..498730)
FT                   /transl_table=1
FT                   /locus_tag="SPAPB21F2.03"
FT                   /product="ribosome biogenesis protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAPB21F2.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAPB21F2.03.1"
FT                   /db_xref="GOA:Q9C0Z3"
FT                   /db_xref="InterPro:IPR028160"
FT                   /db_xref="PomBase:SPAPB21F2.03"
FT                   /db_xref="PomBase:SPAPB21F2.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0Z3"
FT                   /protein_id="CAC36892.1"
FT                   /translation="MPKAKKRVSLASKASSRLPSSGKPSQQASIPNVELSSTVTSNSQV
FT                   LNNDPLKETKKDKRKDRHFNWQQKFSNPKISASARKRRNRKARENLKVNVSSIGEVLPE
FT                   IDLDISVANSRLKPVIKDSLSSKQTKSSMKRNTVEEIERFQAILKHPSFVSNPLETVRE
FT                   HLGNSLDSR"
FT   intron          498174..498214
FT                   /locus_tag="SPAPB21F2.03"
FT   3'UTR           498731..499027
FT                   /locus_tag="SPAPB21F2.03"
FT   3'UTR           complement(498878..499283)
FT                   /gene_synonym="SPAPB21F2.04c"
FT                   /locus_tag="SPAC227.01c"
FT   CDS_pept        complement(499284..500405)
FT                   /transl_table=1
FT                   /gene_synonym="SPAPB21F2.04c"
FT                   /locus_tag="SPAC227.01c"
FT                   /product="Erd1 homolog (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.01c.1"
FT                   /db_xref="GOA:Q9UTD8"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="PomBase:SPAC227.01c"
FT                   /db_xref="PomBase:SPAC227.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD8"
FT                   /protein_id="CAC36893.2"
FT                   /translation="MALIEDLNHFINYFPLVLRLFFLVVFGLYSFTLILHLLVINRVDV
FT                   FSLLHTPLPVNRSQQANAPLWQLSFSLSILGTLLFVIAESLYLISGSDELAYVPVFIFG
FT                   VIVFMPVHKFWFFQRKVFTRQCLRILGGSYRPDYKFPDVIFSDLLTSYSRVIADLWLAG
FT                   AILIYVTDSPNNSHRKQYENEVIMSMIAAYPYAIRFRQCLIERSSADNSSDKFWSTLNS
FT                   IKYFTAFPAIFLGIFAKKRFSFLWFLWNTSSAINSTYSFWWDVSMDWSLPFFKQPLSIQ
FT                   NWKFGVRRLFPTFTFAVVSAIDFVLRMAWVVRVLPEHQSAFFTTDFGIFIMQFLEVFRR
FT                   CVWVFFRIEAEASKSLAYVNISDRSDIPTIHPD"
FT   5'UTR           complement(500406..500674)
FT                   /gene_synonym="SPAPB21F2.04c"
FT                   /locus_tag="SPAC227.01c"
FT   CDS_pept        complement(join(501117..501248,501366..501485))
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.19c"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.19c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.19c.1"
FT                   /db_xref="GOA:C6Y4B7"
FT                   /db_xref="InterPro:IPR029164"
FT                   /db_xref="PomBase:SPAC227.19c"
FT                   /db_xref="PomBase:SPAC227.19c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6Y4B7"
FT                   /protein_id="CBA11490.1"
FT                   /translation="MMGSMVSNGYLLLFTCWFLFVFGLMTIFNFVEIPLYVDGDVSPIR
FT                   SYYPCILILTCTVVFFVWLFFNWLGLKYFRHSPSAMRR"
FT   misc_RNA        501407..504208
FT                   /locus_tag="SPNCRNA.655"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(501751..501766)
FT                   /locus_tag="SPAC227.02c"
FT   CDS_pept        complement(501767..502384)
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.02c"
FT                   /product="rRNA processing protein Rrp15 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.02c.1"
FT                   /db_xref="GOA:Q9UTD7"
FT                   /db_xref="InterPro:IPR012459"
FT                   /db_xref="PomBase:SPAC227.02c"
FT                   /db_xref="PomBase:SPAC227.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD7"
FT                   /protein_id="CAB61451.1"
FT                   /translation="MAKSQRSQIKNEDISFVSQEDDSSKKFVKDDSENSEEELEDLNSE
FT                   DEFYQSNSSEDEIEEEVQESTIADDIADILNQQVTQTDEQDTPVLSLSKKSKKALRKSN
FT                   AEKKDSKLRTSRRRERLRKEMVGRVTSVVAVNAETAKALFTHERELRRIARRGVVQLFN
FT                   AVRTAQLQSSLNRENISGGRTAREQKVKELSKASFLDLIKSQ"
FT   5'UTR           complement(502385..502444)
FT                   /locus_tag="SPAC227.02c"
FT   3'UTR           complement(502577..502977)
FT                   /locus_tag="SPAC227.03c"
FT   CDS_pept        complement(502978..504093)
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.03c"
FT                   /product="mitochondrial NAD+ transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.03c.1"
FT                   /db_xref="GOA:Q9UTD6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="PomBase:SPAC227.03c"
FT                   /db_xref="PomBase:SPAC227.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD6"
FT                   /protein_id="CAB61452.1"
FT                   /translation="MVDDSLKDAIAGGAAGLASSLVVAPLDVVKTRKQAQKAFYSTGGG
FT                   KNTMVLGGTLSSMRTIFHNEGIAGLYRGVGPMMLGYLPSWSIYFVVYEKCKVLFGVNKK
FT                   YTSLHEIDSSKVGIKASLDSSDKQFYRYWGGQIFSAVIAGAASVTLTNPIWVVKTRLVT
FT                   QSHPRASSFVDKIAAATTVQFRNLQTDAPSVKWRMPRFWLKRRTNVKSSPSQHPVNPPT
FT                   GPACSPAYNNTFDAFRKIYKYEGLAAFYRGLFPSLFGTLHVGIQFPLYEYFKSFLDDFF
FT                   GKKSNFHIVLAATLSKIAASTVTYPHEVLRTRLQSLDAPTHNSATLLIRDIWRSEGWRK
FT                   YYSGMATNFIRTIPASSVTFLSFEIVRKWLN"
FT   5'UTR           complement(504094..504324)
FT                   /locus_tag="SPAC227.03c"
FT   misc_RNA        504201..504900
FT                   /locus_tag="SPNCRNA.656"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           504835..505052
FT                   /locus_tag="SPAC227.04"
FT   CDS_pept        505053..505592
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.04"
FT                   /product="autophagy C terminal domain family protein
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.04.1"
FT                   /db_xref="GOA:Q9UTD5"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="PomBase:SPAC227.04"
FT                   /db_xref="PomBase:SPAC227.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD5"
FT                   /protein_id="CAB61453.1"
FT                   /translation="MSFKSQLLILAQKLSKGGISCELIEFDECILKLEWHTELLDKNDS
FT                   LLYEQEEDDILSLMNPMITMHAWIRDSPSFEVPQFFFQPYANGSDPLTKMEQIFELLEG
FT                   SSQNLAYDALAIGDCPGTVGIAWYIHPCRTRDYFEMLQIDKEDPKYLSLWLLYIHQVLS
FT                   PLTQPIIKAVDDAEKS"
FT   3'UTR           505593..505775
FT                   /locus_tag="SPAC227.04"
FT   5'UTR           505902..505983
FT                   /locus_tag="SPAC227.05"
FT   CDS_pept        505984..506355
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.05"
FT                   /product="prefoldin subunit 4 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.05.1"
FT                   /db_xref="GOA:Q9UTD4"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR016661"
FT                   /db_xref="PomBase:SPAC227.05"
FT                   /db_xref="PomBase:SPAC227.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD4"
FT                   /protein_id="CAB61454.1"
FT                   /translation="MEQVPVLAEDQRNLNEFSVLHSRKAIQELDIKNLKTQIEDIVDAK
FT                   NECELLDEDDGDDIPALKVGDAFFQVSLPVLLDQLEQSEESLEKQVDVLRSSMEKDETR
FT                   IQELKSMLYSKFHDQINLD"
FT   5'UTR           506520..506542
FT                   /locus_tag="SPAC227.06"
FT   CDS_pept        506543..507292
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.06"
FT                   /product="Rab GTPase binding (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.06.1"
FT                   /db_xref="GOA:Q9UTD3"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="InterPro:IPR039765"
FT                   /db_xref="PomBase:SPAC227.06"
FT                   /db_xref="PomBase:SPAC227.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD3"
FT                   /protein_id="CAB61455.1"
FT                   /translation="MAHEIEIDSEADLGRTTFEAEDLYKQRTPITKPPAPRLQSRRASM
FT                   QETPWTIKDSFNVETKDVVQRCIHTLIPTVNFFDVVDDRPDLYGPFWITTTVIQALFFS
FT                   NSITEYARYATGHGTSGYSIKKLISAASIIYGYTTIIAVLLWGILVWNKCNPKLLDCLC
FT                   LYGYANIVWLPVSLATPPFGLLSTLASHIVKYVLTGIGLLISIVFLTRNLYPICQQAGS
FT                   NLCKLLLFGIIVFHCLLALSLQLIFFS"
FT   3'UTR           507293..507605
FT                   /locus_tag="SPAC227.06"
FT   3'UTR           complement(507522..508135)
FT                   /gene="pab1"
FT                   /locus_tag="SPAC227.07c"
FT   CDS_pept        complement(join(508136..508159,508203..509485,
FT                   509563..509603,509648..509691))
FT                   /transl_table=1
FT                   /gene="pab1"
FT                   /locus_tag="SPAC227.07c"
FT                   /product="protein phosphatase regulatory subunit Pab1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.07c.1"
FT                   /db_xref="GOA:Q12702"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC227.07c"
FT                   /db_xref="PomBase:SPAC227.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12702"
FT                   /protein_id="CAB61456.1"
FT                   /translation="MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLA
FT                   TGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRA
FT                   HFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMII
FT                   AAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENME
FT                   ELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFS
FT                   EIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDC
FT                   IFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANN
FT                   VPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLF
FT                   VFSKL"
FT   5'UTR           complement(509692..509960)
FT                   /gene="pab1"
FT                   /locus_tag="SPAC227.07c"
FT   misc_RNA        510357..511293
FT                   /locus_tag="SPNCRNA.657"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(510410..510668)
FT                   /gene="yth1"
FT                   /locus_tag="SPAC227.08c"
FT   CDS_pept        complement(join(510669..510720,510780..511070,
FT                   511167..511336))
FT                   /transl_table=1
FT                   /gene="yth1"
FT                   /locus_tag="SPAC227.08c"
FT                   /product="mRNA cleavage and polyadenylation specificity
FT                   factor complex Yth1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.08c.1"
FT                   /db_xref="GOA:Q9UTD1"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR041367"
FT                   /db_xref="PomBase:SPAC227.08c"
FT                   /db_xref="PomBase:SPAC227.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD1"
FT                   /protein_id="CAB61457.1"
FT                   /translation="MTDYIKDKAIAADFSSVQFRFDNYLKQNFNFGRSALLNSGNGRDS
FT                   GSKMGSVVCKHWLRGLCKKGEQCDFLHEYNLKKMPPCHFYAERGWCSNGEECLYLHLDP
FT                   SKQVGVCAWYNMGFCPLGPICRGKHVRKPRPCPKYLAGFCPLGPNCPDAHPKHSEPPHP
FT                   PQKRKDW"
FT   5'UTR           complement(511337..511433)
FT                   /gene="yth1"
FT                   /locus_tag="SPAC227.08c"
FT   5'UTR           join(511350..511508,511662..511806)
FT                   /locus_tag="SPAC227.09"
FT   CDS_pept        511807..513060
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.09"
FT                   /product="folylpolyglutamate synthase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.09.1"
FT                   /db_xref="GOA:Q9UTD0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="PomBase:SPAC227.09"
FT                   /db_xref="PomBase:SPAC227.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTD0"
FT                   /protein_id="CAB61458.1"
FT                   /translation="MPIQLGLQRMLQLLKHLGNPQESFCAVQIAGTNGKGSICSYIYTS
FT                   LLQAAIKTGRYTSPHFLEPRDTISINGQIASEEIFNTCWKQVIEVDRRFRTKATEFELL
FT                   TATAFQCFHHSGVRVAVIETGMGGRLDATNVFEEPVLSIISRICLDHQAFLGNTLEAIA
FT                   KEKAGIFKKNVPCVVDGLNEVNVLNQLKLSAEETRAHPFYLAKGKSGENKNEWIINTPN
FT                   WGTNTFSTPLKGDYQGQNLACAVTALDILSSSFSIMLPHVQNGVKNTSWPGRLDIRSVP
FT                   SLGDILFDGAHNKEAAIELAKFVNSQRREHNKSVSWVVAFTNTKDVTGIMKILLRKGDT
FT                   VIATNFSSVSGMPWIKSMEPEVIKNSISSESSVECYTADNLTISEILRLAKEKNSSVIV
FT                   CGSLYLLGDMYRYLKLDV"
FT   3'UTR           513061..513382
FT                   /locus_tag="SPAC227.09"
FT   5'UTR           513820..513830
FT                   /locus_tag="SPAC227.10"
FT   CDS_pept        join(513831..513858,513908..513998,514046..514169,
FT                   514244..514345)
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.10"
FT                   /product="prefoldin subunit 2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.10.1"
FT                   /db_xref="GOA:Q9UTC9"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR027235"
FT                   /db_xref="PomBase:SPAC227.10"
FT                   /db_xref="PomBase:SPAC227.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC9"
FT                   /protein_id="CAB61459.1"
FT                   /translation="MAEQPSRQQILQTQYNSYKSRLQQIAQKIVDLETDADEHKLVMDT
FT                   LNSMDNNRRCFRMIHGVLVERTVGTVVPILKTTQEGIQTAMNGLLDQYKQLEAEFQKFQ
FT                   KDNKIQVVRQ"
FT   3'UTR           complement(513967..514551)
FT                   /locus_tag="SPAC227.11c"
FT   3'UTR           514346..514921
FT                   /locus_tag="SPAC227.10"
FT   CDS_pept        complement(join(514552..515082,515222..515482,
FT                   515534..515674))
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.11c"
FT                   /product="sensor for misfolded ER glycoproteins Yos9
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.11c.1"
FT                   /db_xref="GOA:Q9UTC8"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="PomBase:SPAC227.11c"
FT                   /db_xref="PomBase:SPAC227.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC8"
FT                   /protein_id="CAB61460.3"
FT                   /translation="MFSSSMFPHLILPAIGSSKVRTMVLPFAFVGFFIFPICLASLLDW
FT                   NDAYEYPKYSFEWSNVSILEGDIDSIKEKTEKTKLSSLFYAGKHEYFCVYPNASLIKQN
FT                   STTEPSYDLQELRIQGTEKINELANVFLIENRGYWTYDYVYGQHVRQYHLEPQQGSDKV
FT                   LANPMYILGTAPNTQTKKNLEENWAIGFVEGKAYLQTTFRNGTMCDITKRPRHVILSYE
FT                   CSTNSDTPEITQYQEVSSCAYSMTIHVPGLCSLPAFKIQEDIPSEKIVCYNVIKEKSNE
FT                   VDHKDSQHVVDEVAQTSPPEVKEVETQSS"
FT   5'UTR           515661..515796
FT                   /locus_tag="SPAC227.12"
FT   5'UTR           complement(515675..517252)
FT                   /locus_tag="SPAC227.11c"
FT   CDS_pept        join(515797..515833,515896..517247)
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.12"
FT                   /product="U4/U6 x U5 tri-snRNP complex subunit Prp4 family
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.12.1"
FT                   /db_xref="GOA:Q9UTC7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036285"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC227.12"
FT                   /db_xref="PomBase:SPAC227.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC7"
FT                   /protein_id="CAB61461.1"
FT                   /translation="MNENEGISLGELETRPFSEGITRFTKEQAAYYAEQKEKDRIKALK
FT                   IPYEDSKVREYLRRYGEPITYFGEDALARRQRLQQLMIEKSLEGDNPLDVDQGASENIE
FT                   KETYVQGSHELLVARKKIALYSLEKAKLRLKKEREISEIPVPEIVLSGKSSIEHLQKAE
FT                   LMGSQIGGERPIAIVRFSNNGNHFASGSWGGQVKVWNSDNLSEVQLFRGHTDRVSGLDW
FT                   YPLCQAWDADSEQLTLATGAADNTVCLWKASQSTPLLRLEGHLARVGRVAFHPSGDYLV
FT                   SASFDTTWRLWDVHTGVELLMQEGHSEGIFSIACQPDGSLVSSGGNDAIGRIWDLRSGK
FT                   SIMVLDEHIRQIVAMAWSPNGYQLATSSADDTVKIWDLRKVSLAHTIPAHSSLVSDVRY
FT                   IESGVNRFIATSGYDGCVKLWNPLNCSLIKSMVGHEEKVMSVDGYGDRFISSGYDRTIK
FT                   LWYP"
FT   3'UTR           517248..517504
FT                   /locus_tag="SPAC227.12"
FT   3'UTR           complement(517416..517864)
FT                   /gene="isu1"
FT                   /locus_tag="SPAC227.13c"
FT   CDS_pept        complement(517865..518443)
FT                   /transl_table=1
FT                   /gene="isu1"
FT                   /locus_tag="SPAC227.13c"
FT                   /product="mitochondrial iron-sulfur cluster assembly
FT                   scaffold protein Isu1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.13c.1"
FT                   /db_xref="GOA:Q9UTC6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="PomBase:SPAC227.13c"
FT                   /db_xref="PomBase:SPAC227.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC6"
FT                   /protein_id="CAB61462.1"
FT                   /translation="MSVFRRSVQCVGVLPSILAQRSSLLARPANLQFLKTNSSKFVPQV
FT                   TANVSRRMYHKNVLDHYNNPRNVGTLPKGDPDVGIGLVGAPACGDVMRLAIRVNKDGVI
FT                   EDVKFKTFGCGSAIASSSYVTTMVKGMTLEEASKIKNTQIAKELCLPPVKLHCSMLAED
FT                   AIKSAVKHYRSKQLTPVGTTAGAIESATA"
FT   5'UTR           complement(518444..519017)
FT                   /gene="isu1"
FT                   /locus_tag="SPAC227.13c"
FT   misc_RNA        519257..520194
FT                   /locus_tag="SPNCRNA.658"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           join(520174..520694,520800..520932)
FT                   /locus_tag="SPAC227.14"
FT   CDS_pept        join(520933..521133,521215..521721)
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.14"
FT                   /product="uridine kinase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.14.1"
FT                   /db_xref="GOA:Q9UTC5"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC227.14"
FT                   /db_xref="PomBase:SPAC227.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC5"
FT                   /protein_id="CAB61463.1"
FT                   /translation="MALQVDAPDVSSYDELYNRAVELLKHQQRVLIGLAGGPGSGKSTL
FT                   CAILAKAWNERFGSEIVKIIPMDGFHYSLEELDRFDNPEKARALRGAEWTFDADLFYSL
FT                   VRLMKKITDRELYAPSFDHAIGDPVVDDICVEPKNRILIFEGNYLLLNKPPWSDACKLY
FT                   DIKAYLPVEHSVARARVAHRHLVSGLCATEEEAIERTDRNDMINLTFVEKNMVTPDIVL
FT                   QQLRLKTVKTSSL"
FT   3'UTR           521722..522766
FT                   /locus_tag="SPAC227.14"
FT   5'UTR           523097..523245
FT                   /locus_tag="SPAC227.15"
FT   CDS_pept        523246..525867
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.15"
FT                   /product="protein phosphatase regulatory subunit Reg1
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.15.1"
FT                   /db_xref="GOA:Q9UTC4"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="PomBase:SPAC227.15"
FT                   /db_xref="PomBase:SPAC227.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC4"
FT                   /protein_id="CAB61464.1"
FT                   /translation="MSNKPDANDQCMVKETISRMSMSKEKPFLRRNYSSPSFNDSVNSV
FT                   NDEFQTYQLPNGEFSDNMNDLYFPFRKGNESLMTENSNYPISEQDTQHNHISDFPSRRM
FT                   QLDGMNHSNNDTYSTAIPFSKDSSVFDAVGQQSSVPIHINPAYTNSHQNSYSLNETYLS
FT                   YDFFDNHRGASSSAVSKDGLASPRPTKDVDADDTTWYFTSSPSFQPLKDSDRSQTKNTH
FT                   EETSPIVSSPEDDADAAFKPSSLPSTSISASSNAFYKPAAPDNERPLDPHITPYLRLQL
FT                   LTTGADDNDIRKNALTQVDYLSYDWKETDIWASWREITKTKANYDNGIRLENASWRTWM
FT                   KHKFKLKTISPETLNWLKECDVTWLYGPLLHTSMPSRHHSHRKKEKEKEKSKAPRVTPL
FT                   THKTNDDEANHSETSSGSSLAKKPILKRRTPQELLLSGRDLTPWPQIRRFDSLLARNRG
FT                   DIFSNRNHATIRSALFSQRYPSHSKRHIHFNDRVQQCIAVDIDSLPSDSESASYNTDDA
FT                   NSVVSPSKDGISTTTVSSDATRSSQSSHFRIIEDLPDSKLKYSLEDQATYDQSSRYPGR
FT                   HFGKTGRSHFPRAPEYYGENDFEEDEVYRDDRHYENEHDEYDPNLIYYDNEPTEENRLV
FT                   FEDTNNTFIDTDSDDSNADESQFLEYANDSPNSSESLESLNNQSYSSSPYSVFSHPPPY
FT                   MGRQSLNDSPQTSDFKASNLNDSSSNVHSIFQTRETTSPSVQNKTPTKYHRELKSSKDG
FT                   HEQASPLVSSSPSGSFTSQISPAATTTATNLDAVSLSPSTVRTGSQISDIGNDAISTTR
FT                   KTVRAFLENANPYSTNNDGNPSNNTSDVEVNETSMNDNSEEPISSNWLVDLFQKSLKSF
FT                   RE"
FT   3'UTR           525868..526412
FT                   /locus_tag="SPAC227.15"
FT   misc_RNA        526641..528541
FT                   /locus_tag="SPNCRNA.659"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(527782..528002)
FT                   /gene="psf3"
FT                   /locus_tag="SPAC227.16c"
FT   CDS_pept        complement(join(528003..528064,528124..528269,
FT                   528326..528460,528567..528625,528673..528771))
FT                   /transl_table=1
FT                   /gene="psf3"
FT                   /locus_tag="SPAC227.16c"
FT                   /product="GINS complex subunit Psf3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.16c.1"
FT                   /db_xref="GOA:Q9UTC3"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="PomBase:SPAC227.16c"
FT                   /db_xref="PomBase:SPAC227.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC3"
FT                   /protein_id="CAB61465.1"
FT                   /translation="MDYYDIDSILSENQKVPCTSTVSIPGLGHEGRMVPTGSKVELPFW
FT                   LAEVLAINSFVSIHMPAPFSSVVRNALKANPNSVSIRDITTHYYHFAEKMLHLISDDSL
FT                   VQISLNTLRSRAMLIADASLNPQGALQQNSQFIEGLDDFEKHILRVSHNAHRSLINWQN
FT                   STS"
FT   5'UTR           complement(528772..528906)
FT                   /gene="psf3"
FT                   /locus_tag="SPAC227.16c"
FT   3'UTR           complement(529167..529800)
FT                   /locus_tag="SPAC227.17c"
FT   CDS_pept        complement(529801..530166)
FT                   /transl_table=1
FT                   /locus_tag="SPAC227.17c"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.17c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.17c.1"
FT                   /db_xref="GOA:Q9UTC2"
FT                   /db_xref="InterPro:IPR021475"
FT                   /db_xref="PomBase:SPAC227.17c"
FT                   /db_xref="PomBase:SPAC227.17c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTC2"
FT                   /protein_id="CAB61466.1"
FT                   /translation="MNNFKENDEKSTFGQYAELDKILDLKKGIPEDPCSLQYYFDQMAM
FT                   CLTVFSQMNHYYRYGEYNRCKGNFKDFKWCLSTKSKAHEEAQEGLRKRRLQQWMKFRQG
FT                   PNSEDIWKMRTSPKSSE"
FT   5'UTR           complement(530167..530275)
FT                   /locus_tag="SPAC227.17c"
FT   5'UTR           530261..530521
FT                   /gene="lys3"
FT                   /gene_synonym="SPAC2F7.01"
FT                   /locus_tag="SPAC227.18"
FT   CDS_pept        530522..531628
FT                   /transl_table=1
FT                   /gene="lys3"
FT                   /gene_synonym="SPAC2F7.01"
FT                   /locus_tag="SPAC227.18"
FT                   /product="saccharopine dehydrogenase Lys3"
FT                   /EC_number="1.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC227.18"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC227.18.1"
FT                   /db_xref="GOA:Q09694"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR027281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPAC227.18"
FT                   /db_xref="PomBase:SPAC227.18.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09694"
FT                   /protein_id="CAB61467.1"
FT                   /translation="MVAPHLWLRAETKPLEERSALTPRTAKILADAGFQITIERSSQRA
FT                   FKDKEFERLGFPMVPEGSWRHAPKDAYIIGLKELPENDNSPLKHTHIQFAHCYKNQEGW
FT                   REVLSRFPAGNGLLYDLEFLQDDNGRRVAAFGYHAGFAGSAISCLVWAHQLLHPNKQFP
FT                   AIRPFPNEKSLVRHVARQVRLALKKNNNQYPRILVIGALGRCGTGACDLASKIGIPFDN
FT                   ILRWDINETKKGGPFTEITESDIFVNCIYLSMPIPKFCTVESLNVPNRKLRVVCDVSCD
FT                   TTNPNNPIPIYNVNTTFDHPTVEVKGVTTPPPLEVISIDHLPTLLPRESSEAFSEALIP
FT                   SLLALKDVDNAPVWVRAKKLYETMVQKL"
FT   3'UTR           531629..531981
FT                   /gene="lys3"
FT                   /gene_synonym="SPAC2F7.01"
FT                   /locus_tag="SPAC227.18"
FT   3'UTR           complement(531794..532431)
FT                   /locus_tag="SPAC2F7.02c"
FT   CDS_pept        complement(532432..533409)
FT                   /transl_table=1
FT                   /locus_tag="SPAC2F7.02c"
FT                   /product="NLI interacting factor family phosphatase
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.02c.1"
FT                   /db_xref="GOA:Q09695"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PomBase:SPAC2F7.02c"
FT                   /db_xref="PomBase:SPAC2F7.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09695"
FT                   /protein_id="CAA90489.1"
FT                   /translation="MKSTKTQPSPEREREPSFFQKLFGNLCSCFQDASIDEKPTYTPAK
FT                   PVKKAPSVVQPRRVSRTLRSSESVHTNHGPERVFESPTPARTSISLESAISPNGTTNEQ
FT                   DIAQQGDMIDSHVHFGEQPTEPIDFADPPLPEVKRYGEGNWLLPPIAKEDEGKKCLILD
FT                   LDETLVHSSFKYIEPADFVVSIEIDGLQHDVRVVKRPGVDEFLKKMGDMFEIVVFTASL
FT                   AKYADPVLDMLDHSHVIRHRLFREACCNYEGNFVKDLSQLGRNLEDSIIIDNSPSSYIF
FT                   HPSHAVPISSWFNDMHDMELIDLIPFLEHLARVPDVSTVLNLQL"
FT   5'UTR           complement(533410..533731)
FT                   /locus_tag="SPAC2F7.02c"
FT   3'UTR           complement(534120..534461)
FT                   /gene="pom1"
FT                   /locus_tag="SPAC2F7.03c"
FT   CDS_pept        complement(534462..537725)
FT                   /transl_table=1
FT                   /gene="pom1"
FT                   /locus_tag="SPAC2F7.03c"
FT                   /product="DYRK family protein kinase Pom1"
FT                   /EC_number="2.7.12.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.03c.1"
FT                   /db_xref="GOA:Q09690"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC2F7.03c"
FT                   /db_xref="PomBase:SPAC2F7.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09690"
FT                   /protein_id="CAA90490.1"
FT                   /translation="MGYLQSQKAVSLGDENTDALFKLHTSNRKSANMFGIKSELLNPSE
FT                   LSAVGSYSNDICPNRQSSSSTAADTSPSTNASNTNISFPEQEHKDELFMNVEPKGVGSS
FT                   MDNHAITIHHSTGNGLLRSSFDHDYRQKNSPRNSIHRLSNISIGNNPIDFESSQQNNPS
FT                   SLNTSSHHRTSSISNSKSFGTSLSYYNRSSKPSDWNQQNNGGHLSGVISITQDVSSVPL
FT                   QSSVFSSGNHAYHASMAPKRSGSWRHTNFHSTSHPRAASIGNKSGIPPVPTIPPNIGHS
FT                   TDHQHPKANISGSLTKSSSESKNLSTIQSPLKTSNSFFKELSPHSQITLSNVKNNHSHV
FT                   GSQTKSHSFATPSVFDNNKPVSSDNHNNTTTSSQVHPDSRNPDPKAAPKAVSQKTNVDG
FT                   HRNHEAKHGNTVQNESKSQKSSNKEGRSSRGGFFSRLSFSRSSSRMKKGSKAKHEDAPD
FT                   VPAIPHAYIADSSTKSSYRNGKKTPTRTKSRMQQFINWFKPSKERSSNGNSDSASPPPV
FT                   PRLSITRSQVSREPEKPEEIPSVPPLPSNFKDKGHVPQQRSVSYTPKRSSDTSESLQPS
FT                   LSFASSNVLSEPFDRKVADLAMKAINSKRINKLLDDAKVMQSLLDRACIITPVRNTEVQ
FT                   LINTAPLTEYEQDEINNYDNIYFTGLRNVDKRRSADENTSSNFGFDDERGDYKVVLGDH
FT                   IAYRYEVVDFLGKGSFGQVLRCIDYETGKLVALKIIRNKKRFHMQALVETKILQKIREW
FT                   DPLDEYCMVQYTDHFYFRDHLCVATELLGKNLYELIKSNGFKGLPIVVIKSITRQLIQC
FT                   LTLLNEKHVIHCDLKPENILLCHPFKSQVKVIDFGSSCFEGECVYTYIQSRFYRSPEVI
FT                   LGMGYGTPIDVWSLGCIIAEMYTGFPLFPGENEQEQLACIMEIFGPPDHSLIDKCSRKK
FT                   VFFDSSGKPRPFVSSKGVSRRPFSKSLHQVLQCKDVSFLSFISDCLKWDPDERMTPQQA
FT                   AQHDFLTGKQDVRRPNTAPARQKFARPPNIETAPIPRPLPNLPMEYNDHTLPSPKEPSN
FT                   QASNLVRSSDKFPNLLTNLDYSIISDNGFLRKPVEKSRP"
FT   5'UTR           complement(537726..537869)
FT                   /gene="pom1"
FT                   /locus_tag="SPAC2F7.03c"
FT   5'UTR           537888..538394
FT                   /gene="pmc2"
FT                   /gene_synonym="med1"
FT                   /locus_tag="SPAC2F7.04"
FT   CDS_pept        join(538395..538628,538675..539322,539365..539847)
FT                   /transl_table=1
FT                   /gene="pmc2"
FT                   /gene_synonym="med1"
FT                   /locus_tag="SPAC2F7.04"
FT                   /product="mediator complex subunit Pmc2/Med1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.04.1"
FT                   /db_xref="GOA:Q09696"
FT                   /db_xref="InterPro:IPR019680"
FT                   /db_xref="PomBase:SPAC2F7.04"
FT                   /db_xref="PomBase:SPAC2F7.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09696"
FT                   /protein_id="CAA90491.1"
FT                   /translation="MDRPHLFSEVHFRRNASNPNQINWTRYWIDCLSSVPWNDISVTGF
FT                   EYLAKKYGLEVFQDSSKPNEVVLSLAGKIILIDITVPINASPKDINVVLAFANASGEQY
FT                   NNPVAEKLLKDAIYNCNTPLFEKNVKWLATFDHSSPSVQQSCFQYLDSLSSSLNAIYEA
FT                   ELSLLAQEENVIMHGNGKPLSNYEGQLGLRIVYWKLLDKTYSTQIFMDNLSHESLPHLL
FT                   FGYNLLNSPPILQSSKINWALENTLTPIPTTMELVFDDINLIIPEQGVKPLLDLLHVHD
FT                   ITIPWPVQNYSHMLGLPSKSTVNYKFINKNQAIQLTGFDVSARSLRHVPFHHPKQIRGI
FT                   LAIVRQYLLLQLILENIKSADLAETAASSSLHLSLYFKEHPIVHAQYQEINKLNNSEQI
FT                   IIVLSVLSDGRLNVDYMSSGGKELSKQQSHVFQKLIQQTCNIGLAIEVFIKKVVN"
FT   3'UTR           539848..540012
FT                   /gene="pmc2"
FT                   /gene_synonym="med1"
FT                   /locus_tag="SPAC2F7.04"
FT   3'UTR           complement(539919..540124)
FT                   /locus_tag="SPAC2F7.05c"
FT   CDS_pept        complement(540125..541312)
FT                   /transl_table=1
FT                   /locus_tag="SPAC2F7.05c"
FT                   /product="translation initiation factor eIF5 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.05c.1"
FT                   /db_xref="GOA:Q09689"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="PomBase:SPAC2F7.05c"
FT                   /db_xref="PomBase:SPAC2F7.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09689"
FT                   /protein_id="CAA90492.1"
FT                   /translation="MATINIRRDVKDSFYRYRMPKLQSKIEGKGNGIKTVIPNMSDIAK
FT                   ALGRPPLYVTKFFGFELGAQTTIIADMDRYIVNGAHDAGKLQDLLDVFIRRFVLCASCQ
FT                   NPETELSINKKDQTISYDCKACGYRGVIDGRHKLTGVIVKNPPAKKKSHKHKRDSPVAE
FT                   EEDGAEDELTRRIRQEAAELPTAEVVNDEDWAVDTSEEAVRARVQELEGNMKDSLTLSD
FT                   LRGDEEEAESSRYDQFGEWLEDNYPGVSDVEIYKKMKEENIHHKSKAIVVLVQCIITSP
FT                   YVGEFEKHGALFKKLCTTDKHERALLGGFERLMENTELVHIDVVPKVLLEIYQNDLVSD
FT                   DMFEKWGAKASKKYVSRETSKKIHEAAEPFLTWLAEASDESESEDEEEEEEDDDE"
FT   5'UTR           complement(541313..541640)
FT                   /locus_tag="SPAC2F7.05c"
FT   3'UTR           complement(541576..542036)
FT                   /gene="pol4"
FT                   /locus_tag="SPAC2F7.06c"
FT   misc_RNA        541795..543483
FT                   /gene_synonym="SPNG2AF10"
FT                   /locus_tag="SPNCRNA.552"
FT                   /product="antisense RNA (predicted)"
FT   misc_RNA        541797..544030
FT                   /locus_tag="SPNCRNA.660"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(542037..543557)
FT                   /transl_table=1
FT                   /gene="pol4"
FT                   /locus_tag="SPAC2F7.06c"
FT                   /product="DNA polymerase X family"
FT                   /EC_number="2.7.7.7"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.06c.1"
FT                   /db_xref="GOA:Q09693"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR019843"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR028207"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="PomBase:SPAC2F7.06c"
FT                   /db_xref="PomBase:SPAC2F7.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09693"
FT                   /protein_id="CAA90493.1"
FT                   /translation="MKILASSTNYVLHNRLSNSQYEDARSKIVNFGGEFTNDAAKADYI
FT                   FVNYSQINRVRRELRTIGTPLETCVSCKLIVKIDWLNEPKESLTPGNPYVIWHRKPEMK
FT                   VGSPYTPSTRPASHTEAPNDFENHETPNTENNNEVKSIDNVDQEGSVYPTTKEYPYVLE
FT                   IPRYACQRKTPLKCVNQAFVNALSVLKTCREVNGESVRTRAYGMAIATIKAFPLPIDSA
FT                   EQLEKMPGCGPKIVHLWKEFASTGTLKEAEEFQKDPASKILLLFYNIFGVGASHAAEWY
FT                   QKGWRTIEQVRKHKDSFTKQIKVGLEFYEDFCKTVTIEEATEIYETIVSRMPDGIKIQS
FT                   CLVGGFRRGKPVGADVDMVLSPSHTHSTKHLVDVLLRILDEEFQFRLISVQEHSCGGKK
FT                   GYVMLAVILSNSSKINRRVDIIVVPPAYIGSAVLGWSGGIFFLRDLKLYANSHLGLSYD
FT                   SFEIINLKTGKDICPDEFNEWKDPVEAEKDIFRYFSLEYIEPKFRNTG"
FT   5'UTR           complement(543558..543735)
FT                   /gene="pol4"
FT                   /locus_tag="SPAC2F7.06c"
FT   3'UTR           complement(544127..544416)
FT                   /gene="cph2"
FT                   /gene_synonym="rco1"
FT                   /locus_tag="SPAC2F7.07c"
FT   CDS_pept        complement(544417..546240)
FT                   /transl_table=1
FT                   /gene="cph2"
FT                   /gene_synonym="rco1"
FT                   /locus_tag="SPAC2F7.07c"
FT                   /product="Clr6 histone deacetylase associated PHD protein-2
FT                   Cph2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.07c.1"
FT                   /db_xref="GOA:Q09698"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="PomBase:SPAC2F7.07c"
FT                   /db_xref="PomBase:SPAC2F7.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09698"
FT                   /protein_id="CAA90494.1"
FT                   /translation="MDAKPWNHTSEAFQASILEDLKIIQKAGAERNAKSSHGSINSRSA
FT                   SPNKATSRRNRAQNGNSNGRASVDNSDDGSKDDLDYSPSVKRKHVNGEGAEKGDHDTSN
FT                   NGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKEN
FT                   KSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVY
FT                   SNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGPGNFLCCETC
FT                   PNSFHFTCIDPPIEEKNLPDDAWYCNECKHHSLYNELDEQEELESNVKEEGTMVDVWMQ
FT                   LCTYIDSHNPIQFHLPHSISSFFRGVGSGVMGEYIETDVLKHLKSSRRSNGEERDPLLL
FT                   KSKSGTPILCFRCHKSALVSQSILACDYCNSYWHPDCLNPPLATLPSNLRKWKCPNHSD
FT                   HVTPRYRLPEKAKVIRVGLPRGFKNKGNIVIDENEDEPSVQTIQLQGKIRVVPSKPFKL
FT                   NFLEQIRDNVINLRKMVEQDEQLCIETFSKFDFYATRDCELPLRILCDVANDNLENDDY
FT                   VLALRDLLRISKWDPNQPVPAPFDLANLLSY"
FT   CDS_pept        complement(546664..548562)
FT                   /transl_table=1
FT                   /gene="snf5"
FT                   /locus_tag="SPAC2F7.08c"
FT                   /product="SWI/SNF complex subunit Snf5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.08c.1"
FT                   /db_xref="GOA:Q09699"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="PomBase:SPAC2F7.08c"
FT                   /db_xref="PomBase:SPAC2F7.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09699"
FT                   /protein_id="CAA90495.1"
FT                   /translation="MDKDIGSAVAELQVCSTHYAMTIVSCGFHSPQSLMNADLQHCLLA
FT                   DQNYLLNNSNKNKGSIIEENTRKPFQSARNLQTSLKTHPESAITRYGLGYAGFGNGWTA
FT                   LKPKILFPSQKRRVKGRFTFPFSRRSNLAQSKLPVDLVPIRLEIDADRYKLRDSFTWNL
FT                   YDKCISLDQFAEQICIDYDIPLHNVHIVQNISKSIQAQINDYEPRKAQSNLSFVSDVSS
FT                   STSETVYAHEPSDSLAKASKQQIPTVQNDLRILIKLDITIGRLNLIDQFEWNLFAPESS
FT                   AEEFATVMCLDLGLSGEFCTAVAHSIREQCQMYIKYLSLIGYLFDGSEIEDEEVRSYIL
FT                   PPLKNTLRFSDMESSSFAPMIYELNDAEMERQDRGYDREARRMRRRQGRAKHGIMLPDL
FT                   RDIPKIHRSLFPSSSVPSDDDFMHALSLSTNSDGETLNEINTNNPEREHLIVRLKVDSQ
FT                   KLKIIVEQSQTLTLNNFQQRKLTPLPNSMSFDSLNEFESERNTPSTYGQNISPLPQFSS
FT                   PSLSSDAFLTNSNSSESALVHMQKLNLPDFTPSWVKRCVIETFAKFPNDRFNVIVKPAL
FT                   NPAERMTVRICCHDCINEYFTAGPGFTFGNFHIHLLSSSHQQKKEVRMNTVLDRNT"
FT   misc_RNA        548568..549658
FT                   /locus_tag="SPNCRNA.661"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(548768..550243)
FT                   /transl_table=1
FT                   /locus_tag="SPAC2F7.09c"
FT                   /product="mitochondrial GTPase related protein
FT                   (prediected)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.09c.1"
FT                   /db_xref="GOA:Q09700"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC2F7.09c"
FT                   /db_xref="PomBase:SPAC2F7.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09700"
FT                   /protein_id="CAA90496.1"
FT                   /translation="MSFTKFCRGCGQTLQSANESATGYIKPLKLSGIFSKGSVSNLLKK
FT                   NLDEQAIFNNAFKNLNPQIKKHFPNTTSFPFHEKEIGRTDLLWCQRCHDLKFHSRIRPK
FT                   ELLQEPQTTLPDIISTVNNDKSTCLIIQVIDVTEVIFQDFVSATQYTHFPVFHLFTHAD
FT                   VLPPKKPYWLFPGLGISSKYAMLYTSHSFNLVDKLLGRINPLLCSRGHVYVVGEANSGK
FT                   STLLKTLAKRGNGVFNELLLDSFLPGTTQAIKGYPTQYFGSCFKQLSEGLIFDTPGYRG
FT                   NLKSLLPWVDTKLLTSLVPKTRSRNKQLTSKPVQYRVRFGQSIILGGLVRVTPFEINED
FT                   GNHEVGKPIMFKKEDPSSTTIHFLFSTLKNKKTKGNTNNMKPLLIKLFTKLPAHITSIT
FT                   KLQSLENSTKNDNVPLVTHSPSPMHSSFTVSIKPTQLSENVFDPTSSGELVIHNFGFLS
FT                   FSASRPMNLLVESVNPKAVSWRSAKPVVPKFNK"
FT   5'UTR           complement(550244..550726)
FT                   /locus_tag="SPAC2F7.09c"
FT   5'UTR           550630..551010
FT                   /gene="akr1"
FT                   /locus_tag="SPAC2F7.10"
FT   CDS_pept        551011..552939
FT                   /transl_table=1
FT                   /gene="akr1"
FT                   /locus_tag="SPAC2F7.10"
FT                   /product="palmitoyltransferase Akr1 (predicted)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.10.1"
FT                   /db_xref="GOA:Q09701"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="PomBase:SPAC2F7.10"
FT                   /db_xref="PomBase:SPAC2F7.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09701"
FT                   /protein_id="CAA90497.1"
FT                   /translation="MGSLFLAASQGELDTVKNLISSEKIDVNATDEGGATALHWAALNQ
FT                   QIPICKFLLEHGADVNAIGGDLQAAPIHWAAKRGSVKTVHYLVQHGADPLLKDKQGFNC
FT                   LHLAVHAASPLLVVYLLHLDISVDLRDDQQHTPLMWASYHGNEPITNCLLRWGADVLAT
FT                   DEDKMTPLHWSIVGGNLKCMKLILKEGGIPCTAVTANLSGQLKTPWALASELRVSHLFK
FT                   QALISNGLKVKETSEEPEKWVVVPSKFQFSQKTFIIFCFLSSFIITGVFFFIMSICPMV
FT                   ISLIIAPLWIYFTFKYITTCIHANIDIVHFYLETPFLAGIFSSIFFWVWCHSLLYIVPK
FT                   TLPIKPLSSLLFVLISFTCIGLYVRTAFQNPGYVDKIGAVVQRREEISKLLDKDLFNQS
FT                   HYCLKCFQVKPPRSYHCGACKRCINRYDHHCPWTGNCVGARNHRTFLLFVFTLSTLIPI
FT                   YFYVAFYYLQNIPIQKKYESYRCLFISGTICQWSLKDMFVLVASLTLFVNWCWVVVLAF
FT                   TQICQVAHNVTTAEFRLFKRYGTLVPPTKQNSSPKNGHGIHGSFLRTVCGILGLDQCIL
FT                   LIRESNCFVRCFPSRAELGSQNSTSLSRNLSTVNPYDEGSIIKNCKTFWKQNFLNDGRQ
FT                   DEATRHV"
FT   3'UTR           552940..553595
FT                   /gene="akr1"
FT                   /locus_tag="SPAC2F7.10"
FT   5'UTR           555277..556630
FT                   /gene="nrd1"
FT                   /gene_synonym="msa2"
FT                   /locus_tag="SPAC2F7.11"
FT   misc_RNA        555300..556109
FT                   /gene_synonym="SPNG103"
FT                   /locus_tag="SPNCRNA.154"
FT                   /product="non-coding RNA (predicted)"
FT   CDS_pept        556631..558220
FT                   /transl_table=1
FT                   /gene="nrd1"
FT                   /gene_synonym="msa2"
FT                   /locus_tag="SPAC2F7.11"
FT                   /product="RNA-binding protein Nrd1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.11.1"
FT                   /db_xref="GOA:Q09702"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034195"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="PDB:2RT3"
FT                   /db_xref="PomBase:SPAC2F7.11"
FT                   /db_xref="PomBase:SPAC2F7.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09702"
FT                   /protein_id="CAA90498.1"
FT                   /translation="MSSSSPSSQSRLSVPGRTPHLPPLTIPHTVSAEGLATPNTPHALL
FT                   PTGLLMGSPFVQSPTSYTSMHGLPFSTTQMAAAPAHPTTGYNVSRVTSPNVANFAPGYF
FT                   PLPNNTTQPVKTVYVGNLPPNTPIDEILSCVRTGPIESAWILPEKNCAFISFLDPSHAT
FT                   AFFQDAALKRLTIRGTEVKVGWGKNSASNSSVLLAVQQSGACRNVFLGNLPNGITEDEI
FT                   REDLEPFGPIDQIKIVTERNIAFVHFLNIAAAIKAVQELPLNPKWSKRRIYYGRDRCAV
FT                   GLKQPAYFSKGQVGVVGGYPVMGYPPPSPVLQKPDLIMTGNRTVYIGNIHADTTIEEIC
FT                   NAVRGGLLHNIRYLQEKHICFVTFVDPVSAFRFFEMSNIHGLVIRNRRLKIGWGKHSGP
FT                   LPSNIALAVAGGASRNIYIGNADDSLTIERLKEDFEEFGEIEYVNFFREKNCAFVNFTS
FT                   LASAINAIDRIKQKKGYENYRISYGKDRCGNPPRTNSKSDVLSVSSDMSMPVDLVVPQQ
FT                   GISGFMPTNSNI"
FT   3'UTR           558221..559051
FT                   /gene="nrd1"
FT                   /gene_synonym="msa2"
FT                   /locus_tag="SPAC2F7.11"
FT   3'UTR           complement(558909..559316)
FT                   /gene="wrs1"
FT                   /locus_tag="SPAC2F7.13c"
FT   CDS_pept        complement(559317..560504)
FT                   /transl_table=1
FT                   /gene="wrs1"
FT                   /locus_tag="SPAC2F7.13c"
FT                   /product="tryptophan-tRNA ligase Wrs1 (predicted)"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.13c.1"
FT                   /db_xref="GOA:Q09692"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PomBase:SPAC2F7.13c"
FT                   /db_xref="PomBase:SPAC2F7.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09692"
FT                   /protein_id="CAA90500.1"
FT                   /translation="MSVEEQIVTPWDVKGSIVDGEEKGIDYERLIVQFGTRKITPEQLE
FT                   RFEKLTGKKPHLLLRRGAFFSHRDFDMILDRYEQKKPFYLYTGRGPSSDSMHLGHMIPF
FT                   MFCKWLQDVFQVPLVIQLTDDEKFLFKQGVSLEDCQRFARENAKDIIAVGFDPKKTFIF
FT                   MNSTYVGGAFYQNVVRIAKCITANQSKACFGFTDSDSIGKIHFASIQAAPSFSSSFPHI
FT                   FNGAKDIPCLIPCAIDQDPYFRLTRDVSGRLKFKKPALLHSRFFPALQGPQSKMSASKD
FT                   SSAIFMTDTPNKIKNKINRHAFSGGGATIEIHREKGGNPDVDVAYQYLSFFLDDDEKLK
FT                   QLYNTYKAGTLSTGEMKGECIKLLQQFVSDFQAARSKVDEATLDMFMDGSRKLEW"
FT   5'UTR           complement(560505..560549)
FT                   /gene="wrs1"
FT                   /locus_tag="SPAC2F7.13c"
FT   3'UTR           complement(560824..560977)
FT                   /locus_tag="SPAC2F7.14c"
FT   CDS_pept        complement(560978..561967)
FT                   /transl_table=1
FT                   /locus_tag="SPAC2F7.14c"
FT                   /product="exosome subunit Rrp4 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.14c.1"
FT                   /db_xref="GOA:Q09704"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="PomBase:SPAC2F7.14c"
FT                   /db_xref="PomBase:SPAC2F7.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09704"
FT                   /protein_id="CAA90501.1"
FT                   /translation="MVTILKPEEFYVSSEADIVNDVSMTEMEDEIMEDEQMGLVDGEDV
FT                   LEEFDKSIHQNLVTPGQLVTDDPQFMRGHGTYFEDGGIYASVAGSVQRVNKLISVKPLR
FT                   SKYVPEIGDLIIGKIAEVQPKRWKVDIGAKQNAVLMLSSINLPGGIQRRKLETDELQMR
FT                   SFFQEGDLLVAEVQQYFSDGSVSIHTRSLKYGKLRNGVFLKVPPALVVRSKSHAYALAG
FT                   GVDIILSVNGYVWVSKHNENQHSSVSITRLEEEASESIYSNENDEIDGYTRLNISRVSI
FT                   CIKGLASRSLPLTQASITNFYESSLVFSNLQDLTVPKNMDQIAMEAMQ"
FT   5'UTR           complement(561968..562179)
FT                   /locus_tag="SPAC2F7.14c"
FT   repeat_region   complement(563321..563628)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           563698..564169
FT                   /gene="rsm24"
FT                   /locus_tag="SPAC2F7.15"
FT   CDS_pept        join(564170..564464,564553..565034)
FT                   /transl_table=1
FT                   /gene="rsm24"
FT                   /locus_tag="SPAC2F7.15"
FT                   /product="mitochondrial ribosomal protein subunit S24
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.15.1"
FT                   /db_xref="GOA:Q09705"
FT                   /db_xref="InterPro:IPR017081"
FT                   /db_xref="InterPro:IPR019349"
FT                   /db_xref="InterPro:IPR039848"
FT                   /db_xref="PomBase:SPAC2F7.15"
FT                   /db_xref="PomBase:SPAC2F7.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09705"
FT                   /protein_id="CAA90502.1"
FT                   /translation="MAFNPLLSLLKADAIFLGQLSKSSFCATSRAFSVFYFTRFKRSAY
FT                   VSAPFGIEPHDEKELKTIDDNVHSNNLSWQKIQEHEVIRELYRKAAYELPGLTPYTQSF
FT                   KKPADSQIFRFESDVQMSSFEKMNPKVVVTFKVTNIPLLEEKQRHVLRLLVGPRYNPEE
FT                   DLVRISSDKYSSALQNKYHLIKILTSLIEESKRNAEKFSHVPLNTGHWKYKKCDKRMPQ
FT                   EWLADATTLTSKKKTTIGKQSHNTVLERESIATTDE"
FT   3'UTR           complement(565035..565167)
FT                   /gene="pld1"
FT                   /locus_tag="SPAC2F7.16c"
FT   3'UTR           565035..565073
FT                   /gene="rsm24"
FT                   /locus_tag="SPAC2F7.15"
FT   CDS_pept        complement(565168..569277)
FT                   /transl_table=1
FT                   /gene="pld1"
FT                   /locus_tag="SPAC2F7.16c"
FT                   /product="phospholipase D, Pld1"
FT                   /EC_number="3.1.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.16c.1"
FT                   /db_xref="GOA:Q09706"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="PomBase:SPAC2F7.16c"
FT                   /db_xref="PomBase:SPAC2F7.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09706"
FT                   /protein_id="CAA90503.1"
FT                   /translation="MTIHQGGNSVIDNVPYSLNTNVNDSIYSEKGTGRKDAEDHTPSKI
FT                   TDLEKNVDHSIPSFPENDPKNYSEFVNLNPPKRPDLEHTRGSSWHTASENVNDLAANDS
FT                   TRVQTPEFITQTMEDENVEVPPLERDERDAAAAHTSKANRNSARQMWAQLMASVRKFKR
FT                   EDEKPILKENLPAINLFEAGIPASLPIAKHFIRDKSGQPVLPIITDLIKVSVLDVEPKH
FT                   NRIHSTFTIQVEYGTGPHAIRWLIYRQLRDFINLHSHFLFFEFQHRFSGRRMKLPKFPK
FT                   EVLPYLVKLRGYQKILYSNPSDQLIDETHSISDISWESHSQDGDRTTGQPRHANNGRKK
FT                   HGNFWTIQGNTLGVYLQEMIHNLQFFPEVNVLYSFLEFSSLGLYLAGAGTFHGKEGFAT
FT                   LKRNYSPTQYMLCCNTTMMKTRSQPFWIIVSESCIILCDNMLSMQPADVFIWDVDFEIT
FT                   RKNFRKAHSKDTNEKIRLSHHSFKIKNRQKVMKLSVRSGRWLQQFINSVQVAQGLTAWC
FT                   EIHRFDSFAPVRTNVAVQWMVDARDHMWNVSRAIKNAKRCIMIHGWWLSPELQMRRPYS
FT                   MAHKWRIDRILNEKAHEGVMVYIMIYRNIDATIPIDSFHTKEHLQSLHPNIYVIRSPSH
FT                   FRQNALFWAHHEKLVVVDDAITFIGGIDLCFGRYDTPQHILYDDKPVADKTGLCEQTWR
FT                   GKDYSNARVHDFFDLTEPYKDMYDRLAVPRMGWHDVSMCIIGQPARDAARHFVQRWNYL
FT                   IQCKKPARKTPLLIPPPDFTTDQLTDSQLTGTCEVQVLRSAGLWSLGLVDTVEQSIQNA
FT                   YVTCIEKSEHFIYIENQFFVTSTTCEGTTIENRVGDALVERIIRAHKNNEKWRGVIMIP
FT                   LLPGFEGQIDLQEGGSLRLIVECQYRSICHGEHSIFGRLNAKGIDGSKYLRFYGLRGWA
FT                   HLGENHELVTEMIYVHAKILIADDRVAVIGSANINERSLLGNRDSEIAAVIRDTLTIDS
FT                   KMDGKPYKVGKFAHTLRKRLMREHLGLETDVLEQREYNMDGLDRDTEWKRVEVWTPDEG
FT                   NAINGSAYTAEELKMKYRSQSQFTTTPDILRKAEKSMKKLDQRVSLIPSSIEFNIKTQK
FT                   DKVEFEKNYEKSKKGPDVIANALVGGIPLSLKTKEDSLYELSKFSQCGEDQRPMVLKDP
FT                   DHLVPEPSRPHCGNGLVFYDDIPLLEVNPISGETIPKFDASSFEDPVCDEFFEDIWSKV
FT                   ASNNTTIYRHIFRCVPDDEMLTWESYNEWKKYGKRFKEEQARWRQEELSNLHETHEKSE
FT                   NDPKNPKAGSQGSGNTSASEDSKTEKPKTRTNNGLQVPDKRVVYDLLRGIRGQLVELPL
FT                   KWMSTESNARNWLSSIDKIPPLEIYD"
FT   5'UTR           complement(569278..569485)
FT                   /gene="pld1"
FT                   /locus_tag="SPAC2F7.16c"
FT   5'UTR           569550..570235
FT                   /locus_tag="SPAC2F7.17"
FT   CDS_pept        join(570236..570406,570549..570647,570885..571805)
FT                   /transl_table=1
FT                   /locus_tag="SPAC2F7.17"
FT                   /product="mitochondrial peptide chain release factor
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2F7.17"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2F7.17.1"
FT                   /db_xref="GOA:Q09691"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="PomBase:SPAC2F7.17"
FT                   /db_xref="PomBase:SPAC2F7.17.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09691"
FT                   /protein_id="CAA90504.1"
FT                   /translation="MLLTKKVLWYFRHGIEYQIRSIACKKGYSEHNVSRVLIEKARSLS
FT                   SEYLQFHQVNNKDQSAMTNDTDLAKRIARLRRVHNAYSKFKSLSEQISDLKQMEAQESD
FT                   AEVKMMAVTEINEISNKIPKSIEDLENTLLPQADSYALPALIEIRPGVGGTEAAIFANE
FT                   LVEMYFQYANFKGWNCKFISKSAVQGLEAITEAIFSIEGEGAYGHLMLEGGVHRVQRTP
FT                   ATETKGRVHTSTASVIVLPQVSNDESSSLYDSSEVKIEVMRSRGAGGQHVNRTESAVRL
FT                   THIPTGITVSMQDSRSQHQNKEKAFLVLNSRLAALNAAKENEAERLKRKNQVTSSDRSE
FT                   KLRTYNFNQNRVTDHRIGLSMHDLSTFMQGEEKFDEFLEKIRIWNREQLLLHSEIV"
FT   3'UTR           complement(570753..571993)
FT                   /gene="rga8"
FT                   /gene_synonym="SPAC2F7.18c"
FT                   /locus_tag="SPAC13A11.01c"
FT   3'UTR           571806..571876
FT                   /locus_tag="SPAC2F7.17"
FT   CDS_pept        complement(join(571994..574224,574269..574371))
FT                   /transl_table=1
FT                   /gene="rga8"
FT                   /gene_synonym="SPAC2F7.18c"
FT                   /locus_tag="SPAC13A11.01c"
FT                   /product="Rho-type GTPase activating protein Rga8"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13A11.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13A11.01c.1"
FT                   /db_xref="GOA:Q09697"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PomBase:SPAC13A11.01c"
FT                   /db_xref="PomBase:SPAC13A11.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09697"
FT                   /protein_id="CAA90505.2"
FT                   /translation="MISSFSNGFWSKDYATGVKKLFDCLDNGVEENEQVKNLLKLYKEA
FT                   NEEFGEKLQEITKECLKGKKPENTEDGATSNKAFEGLRSEIANQGKQHIRIAKDLETLI
FT                   IAPFSKMSIDHSQKLQTSQQVLTNQIKSYEKKYYTLKKTKSAYYNKCRNLEDYEEESKE
FT                   SNETTSEAITDLTTVSSPQQQSLLENDDDLIQLGFMEFRPEELKEVLAQVLQEIPLQDY
FT                   RVPILGTYPNTCSGNIIVSWLQENLPVPTLVAAEAFGQDLIAQGFLRHMGVGGSFVNST
FT                   NFHYQWKDKAFQFAGLNSVDSLVENAKALPLVGEYLSDYISHRKLYSSETQSQRLKREV
FT                   LDANKIYSESVVDLDKCRTLVEETIADHLQFLQKCETDRVLYYKDFFMDLSTIISNFLP
FT                   SMKLLADQIVVYQEIIQPESDIRYILESAATGPFLPRVEIYEDYYNDIKDQIFGVDVEF
FT                   LSHRDKKRVPIIVSTILSYLDLLYPTLASDEVRQNIWLVNSPLSSVHQLREALNHSSSV
FT                   TKEVLSQYTPSVVIGVLKLYFLELPDSIVPSSAFELIRSIYMNHSNDTPYRLRLLQNLL
FT                   SQLRRVNLATLSAIITHLNRLITLTPNKETFTINLANSLSLCISRPATWNLGIQHDKHP
FT                   TKFMEDLLTYGPSIFEELRKLNSSKRVSDRVLYQSSATPRSTDVSPTRPDSISSVRSHT
FT                   AVESPRSSFEELQPSEIPAESEFTLENVPTSLIRSSYALNTRKTRRNFSHSSASNESAA
FT                   IFIDQDAKIVNEAVASRDSSLSGS"
FT   intron          complement(574225..574268)
FT                   /gene="rga8"
FT                   /gene_synonym="SPAC2F7.18c"
FT                   /locus_tag="SPAC13A11.01c"
FT   5'UTR           complement(574372..574417)
FT                   /gene="rga8"
FT                   /gene_synonym="SPAC2F7.18c"
FT                   /locus_tag="SPAC13A11.01c"
FT   3'UTR           complement(574652..575134)
FT                   /gene="erg11"
FT                   /locus_tag="SPAC13A11.02c"
FT   CDS_pept        complement(575135..576622)
FT                   /transl_table=1
FT                   /gene="erg11"
FT                   /locus_tag="SPAC13A11.02c"
FT                   /product="sterol 14-demethylase (predicted)"
FT                   /EC_number="1.14.13.70"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13A11.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13A11.02c.1"
FT                   /db_xref="GOA:Q09736"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PomBase:SPAC13A11.02c"
FT                   /db_xref="PomBase:SPAC13A11.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09736"
FT                   /protein_id="CAA90803.1"
FT                   /translation="MAFSLVSILLSIALAWYVGYIINQLTSRNSKRPPIVFHWIPFVGS
FT                   AVAYGMDPYVFFRECRAKYGDVFTFVCMGRKMTAFLGVQGNDFLFNGKLADLNAEEAYS
FT                   HLTTPVFGKDVVYDIPNHVFMEHKKFIKSGLGFSQFRSYVPLILNEMDAFLSTSPDFGP
FT                   GKEGVADLLKTMPVMTIYTASRTLQGAEVRKGFDAGFADLYHDLDQGFSPVNFVFPWLP
FT                   LPRNRRRDRAHKIMQKTYLKIIKDRRSSTENPGTDMIWTLMSCKYRDGRPLKEHEIAGM
FT                   MIALLMAGQHTSAATIVWVLALLGSKPEIIEMLWEEQKRVVGENLELKFDQYKDMPLLN
FT                   YVIQETLRLHPPIHSHMRKVKRDLPVPGSKIVIPANNYLLAAPGLTATEEEYFTHATDF
FT                   DPKRWNDRVNEDENAEQIDYGYGLVTKGAASPYLPFGAGRHRCIGEQFAYMHLSTIISK
FT                   FVHDYTWTLIGKVPNVDYSSMVALPLGPVKIAWKRRN"
FT   5'UTR           complement(576623..577171)
FT                   /gene="erg11"
FT                   /locus_tag="SPAC13A11.02c"
FT   misc_RNA        577199..578150
FT                   /gene_synonym="SPNG105"
FT                   /locus_tag="SPNCRNA.155"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           578392..578520
FT                   /gene="mcp7"
FT                   /gene_synonym="mug32"
FT                   /locus_tag="SPAC13A11.03"
FT   CDS_pept        join(578521..578586,578681..579247)
FT                   /transl_table=1
FT                   /gene="mcp7"
FT                   /gene_synonym="mug32"
FT                   /locus_tag="SPAC13A11.03"
FT                   /product="meiosis specific coiled-coil protein Mcp7"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13A11.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13A11.03.1"
FT                   /db_xref="GOA:Q09739"
FT                   /db_xref="InterPro:IPR005647"
FT                   /db_xref="InterPro:IPR040453"
FT                   /db_xref="InterPro:IPR040661"
FT                   /db_xref="PomBase:SPAC13A11.03"
FT                   /db_xref="PomBase:SPAC13A11.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09739"
FT                   /protein_id="CAA90804.1"
FT                   /translation="MPPKGLSLAEKRRRLEAIFHDSKDFFQLKEVEKLGSKKQIVLQTV
FT                   KDVLQSLVDDNIVKTEKIGTSNYYWSFPSDAKRSRESVLGSLQAQLDDLKQKSKTLDEN
FT                   ISFEKSKRDNEGTENDANQYTLELLHAKESELKLLKTQLSNLNHCNPETFELKNENTKK
FT                   YMEAANLWTDQIHTLIAFCRDMGADTNQIREYCSIPEDLDDLQLPIL"
FT   3'UTR           579248..579948
FT                   /gene="mcp7"
FT                   /gene_synonym="mug32"
FT                   /locus_tag="SPAC13A11.03"
FT   3'UTR           complement(579353..579719)
FT                   /gene="ubp8"
FT                   /locus_tag="SPAC13A11.04c"
FT   CDS_pept        complement(join(579720..579789,579835..579899,
FT                   579953..580250,580296..580983,581084..581216,
FT                   581295..581390))
FT                   /transl_table=1
FT                   /gene="ubp8"
FT                   /locus_tag="SPAC13A11.04c"
FT                   /product="SAGA complex ubiquitin C-terminal hydrolase Ubp8"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13A11.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13A11.04c.1"
FT                   /db_xref="GOA:Q09738"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR037798"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PomBase:SPAC13A11.04c"
FT                   /db_xref="PomBase:SPAC13A11.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09738"
FT                   /protein_id="CAA90805.1"
FT                   /translation="MPGDVEGCQHLKLKPADVENYQKICTQIFSCHFVPRRCSTCKRIN
FT                   KRSIRCLSCHSVGCLWGHHGEEHAMEHTHMIGVDVKNGHTYCFGCQDYVYQTELETLRF
FT                   KIKNIKAWQSDHKRLPEKYNQMVCLEAYRKYPPVCATAGLRGIQNLGATCFMSVILQSI
FT                   LHNPLVRNLFFSGFHTSTDCKRPTCMTCAIDDMFSSIYNSKNKSTFYGPTAVLNLMWKL
FT                   SKSLCGYSQQDGHEFFVYLLDQMHTESGGGTSMPCTCPIHRIFSGSLKNVVTCLDCKKE
FT                   RVAVDPLMDISLDINEPTLQGCLERFVSKEKVQYSCHSCGSKNAIKQLVFDKLPPTICM
FT                   QLKRFEQNNFAMSTKIDKQVSYPAFLRMRYNFNQDDVDYQLYSVVCHKGTLDTGHYIAY
FT                   TYYQNQWFLLDDTTIVEVKESEVLNSQAYLLFYHERQILYSDEMTVKTEN"
FT   5'UTR           complement(581391..581553)
FT                   /gene="ubp8"
FT                   /locus_tag="SPAC13A11.04c"
FT   5'UTR           582273..582491
FT                   /locus_tag="SPAC13A11.05"
FT   CDS_pept        582492..584033
FT                   /transl_table=1
FT                   /locus_tag="SPAC13A11.05"
FT                   /product="peptidase family M17"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13A11.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13A11.05.1"
FT                   /db_xref="GOA:Q09735"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="PomBase:SPAC13A11.05"
FT                   /db_xref="PomBase:SPAC13A11.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09735"
FT                   /protein_id="CAA90806.1"
FT                   /translation="MKGLGLSTRTFNWSSLSSILLPRIPLATTKADSLILAVRHDKQVF
FT                   SEDYRQVVDQYFETSPKKNDIRLFWNTQGFVRLAIVQLEENVSEKSVRSAAAEAAKILK
FT                   SNGAKSIAVDGMGFPKDAALGAALATYDFSLRRDHLSVYQDEKVVEKENLFTSPAPERL
FT                   TFQLLSNTSEKKTATAEENAFKVGLIEAAAQNLARSLMECPANYMTSLQFCHFAQELFQ
FT                   NSSKVKVFVHDEKWIDEQKMNGLLTVNAGSDIPPRFLEVQYIGKEKSKDDGWLGLVGKG
FT                   VTFDSGGISIKPSQNMKEMRADMGGAAVMLSSIYALEQLSIPVNAVFVTPLTENLPSGS
FT                   AAKPGDVIFMRNGLSVEIDNTDAEGRLILADAVHYVSSQYKTKAVIEASTLTGAMLVAL
FT                   GNVFTGAFVQGEELWKNLETASHDAGDLFWRMPFHEAYLKQLTSSSNADLCNVSRAGGG
FT                   CCTAAAFIKCFLAQKDLSFAHLDIAGVMDKQLNSWDCDGMSGRPVRTIIEVARKY"
FT   3'UTR           584034..584402
FT                   /locus_tag="SPAC13A11.05"
FT   misc_RNA        complement(584478..587656)
FT                   /locus_tag="SPNCRNA.662"
FT                   /product="antisense RNA (predicted)"
FT   misc_RNA        complement(585266..587631)
FT                   /gene_synonym="SPNG2AF2"
FT                   /locus_tag="SPNCRNA.553"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           585355..585596
FT                   /gene_synonym="SPAC3H8.01"
FT                   /locus_tag="SPAC13A11.06"
FT   CDS_pept        585597..587312
FT                   /transl_table=1
FT                   /gene_synonym="SPAC3H8.01"
FT                   /locus_tag="SPAC13A11.06"
FT                   /product="pyruvate decarboxylase (predicted)"
FT                   /EC_number="4.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC13A11.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC13A11.06.1"
FT                   /db_xref="GOA:Q09737"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="PomBase:SPAC13A11.06"
FT                   /db_xref="PomBase:SPAC13A11.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09737"
FT                   /protein_id="CAA90807.2"
FT                   /translation="MSGDILVGEYLFKRLEQLGVKSILGVPGDFNLALLDLIEKVGDEK
FT                   FRWVGNTNELNGAYAADGYARVNGLSAIVTTFGVGELSAINGVAGSYAEHVPVVHIVGM
FT                   PSTKVQDTGALLHHTLGDGDFRTFMDMFKKVSAYSIMIDNGNDAAEKIDEALSICYKKA
FT                   RPVYIGIPSDAGYFKASSSNLGKRLKLEEDTNDPAVEQEVINHISEMVVNAKKPVILID
FT                   ACAVRHRVVPEVHELIKLTHFPTYVTPMGKSAIDETSQFFDGVYVGSISDPEVKDRIES
FT                   TDLLLSIGALKSDFNTGSFSYHLSQKNAVEFHSDHMRIRYALYPNVAMKYILRKLLKVL
FT                   DASMCHSKAAPTIGYNIKPKHAEGYSSNEITHCWFWPKFSEFLKPRDVLITETGTANFG
FT                   VLDCRFPKDVTAISQVLWGSIGYSVGAMFGAVLAVHDSKEPDRRTILVVGDGSLQLTIT
FT                   EISTCIRHNLKPIIFIINNDGYTIERLIHGLHASYNEINTKWGYQQIPKFFGAAENHFR
FT                   TYCVKTPTDVEKLFSDKEFANADVIQVVELVMPMLDAPRVLVEQAKLTSKINKQ"
FT   3'UTR           587313..587495
FT                   /gene_synonym="SPAC3H8.01"
FT                   /locus_tag="SPAC13A11.06"
FT   5'UTR           588543..588924
FT                   /locus_tag="SPAC3H8.02"
FT   CDS_pept        588925..590259
FT                   /transl_table=1
FT                   /locus_tag="SPAC3H8.02"
FT                   /product="sec14 cytosolic factor family
FT                   phosphatidylinositol transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.02.1"
FT                   /db_xref="GOA:Q10138"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="PomBase:SPAC3H8.02"
FT                   /db_xref="PomBase:SPAC3H8.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10138"
FT                   /protein_id="CAA93159.1"
FT                   /translation="MPEGAGRPWNLTELEEEKLKTMWSYLFKLFGITLLERTESWYTVK
FT                   THLSDDSSSSSSHRLSSVSYAKSRTRLELTSSSHGSDTRSFNDKTKNVHLERVEKIASE
FT                   WDPEGLRVCFWDAVNCDDPDGLLLRFLRARKWNVEAALEMFMKTVHWRSREMNVGEIVC
FT                   NADHLDKDDDFVRQLRIGKCFIFGEDKHNRPVCYIRARLHKVGDVSPESVERLTVWVME
FT                   TARLILKPPIETATVVFDMTDFSMSNMDYGPLKFMIKCFEAHYPECLGECIVHKAPWLF
FT                   QGVWSIIKSWLDPVVVSKVKFTRNYRDLQQYINPDNILKEFGGPNPWRYTYPEPCQNEA
FT                   EALKNVEARKSLRAKKDAIAKQYEEVTMDWILNNGDMAEVKQKRRKLASQLIDAYWNLD
FT                   KYIRARSVYDRMGLIAPQTSHTLLLSQPTNGDVKESMVEVTSSAT"
FT   3'UTR           590260..590751
FT                   /locus_tag="SPAC3H8.02"
FT   5'UTR           590691..591066
FT                   /gene="img2"
FT                   /locus_tag="SPAC3H8.03"
FT   misc_RNA        complement(590784..592586)
FT                   /locus_tag="SPNCRNA.663"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        join(591067..591246,591418..591555)
FT                   /transl_table=1
FT                   /gene="img2"
FT                   /locus_tag="SPAC3H8.03"
FT                   /product="mitochondrial ribosomal protein subunit Img2
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.03.1"
FT                   /db_xref="GOA:Q10139"
FT                   /db_xref="InterPro:IPR007740"
FT                   /db_xref="PomBase:SPAC3H8.03"
FT                   /db_xref="PomBase:SPAC3H8.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10139"
FT                   /protein_id="CAA93160.1"
FT                   /translation="MRSSLKPVLSNLRFNSTIASESLRFHVSRTPSKNLPVYLDYKQRG
FT                   TKILTLIRKIHGDSNALRLRLISTLKMSPKDVYVNKLTNQVVLKGNHIVTVREWLQDQG
FT                   F"
FT   3'UTR           591556..592152
FT                   /gene="img2"
FT                   /locus_tag="SPAC3H8.03"
FT   5'UTR           592226..592742
FT                   /locus_tag="SPAC3H8.04"
FT   CDS_pept        592743..593759
FT                   /transl_table=1
FT                   /locus_tag="SPAC3H8.04"
FT                   /product="chromosome segregation protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.04.1"
FT                   /db_xref="GOA:Q10140"
FT                   /db_xref="InterPro:IPR025261"
FT                   /db_xref="InterPro:IPR033473"
FT                   /db_xref="PomBase:SPAC3H8.04"
FT                   /db_xref="PomBase:SPAC3H8.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10140"
FT                   /protein_id="CAA93161.1"
FT                   /translation="MPACYCATSTSLENNELLYKNIRNLFSTSRSFPIEQEWMNLKSIS
FT                   QMKDFFSNFPGNSKANNHFLCNSPLKFEIFNNEKSVKPSNGPHLFTRCSCRCNKLLSGD
FT                   YITQQQPIDASAEHSLNAKGINTYSLKNCFQRSGFIGSYEESLFSGHMPYCSSVPFEFS
FT                   IEIGVISFCRCKPSLVFPPHLKINFVAYSLVGNVDNVQFPYIGRFRLRSQKSDKVMNKG
FT                   YPFGYRIPSVGQLQLILRQTNGLVIKVFLVPYNVSSMVDCSKTWIRQKHYLQQLDDKSG
FT                   KILSHLKFGLQLQIICTSAGHHYLYDSQRIIFVQQSLGGLYGNTKIVNETLLSESCR"
FT   3'UTR           593760..593906
FT                   /locus_tag="SPAC3H8.04"
FT   3'UTR           complement(593901..593976)
FT                   /gene="mms1"
FT                   /locus_tag="SPAC3H8.05c"
FT   CDS_pept        complement(join(593977..594731,594771..594859,
FT                   594900..597277))
FT                   /transl_table=1
FT                   /gene="mms1"
FT                   /locus_tag="SPAC3H8.05c"
FT                   /product="E3 ubiquitin ligase complex subunit Mms1
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.05c.1"
FT                   /db_xref="GOA:Q10141"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="PomBase:SPAC3H8.05c"
FT                   /db_xref="PomBase:SPAC3H8.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10141"
FT                   /protein_id="CAA93162.1"
FT                   /translation="MAEIIHHSNVFTWAFHVSEYDGAPLLLLGSFSSVASVSLKRSGDL
FT                   LLFERFTLPARTRSVALLSSHFLQSESGRHSIANILIATENGKCYLLQLVKTPEKAFPT
FT                   IRIRDEFVLDTRMYNHEQLGKSIDLCPNASLWATNSFAGDIVFFFSHHPSLSKQVFAQL
FT                   SIDGIILHTIFVPPKRSSSSCVTYVCLFLDSNSNPRINVYRWSKTETFSDASSYITFSI
FT                   PVPSEFSLASHIIPCSNIPDHFLVLLETKICLLSVPQIECGDLKFLQTDLPCSGSHNYP
FT                   LSIANDNETPNCCYLTYENGDLYRIRYSILSIDINLIGKTGSSLGNLILPCYPYIVFCG
FT                   DCSDTLVYDVSVSPMSFFGSLIACAPMWDFVYSSSRHNTLLDEDINCNTVYATAGIGKS
FT                   GCLVTMRYGCSSTTLLEAILTEGAVLSGIINSNHNSEFYAWLTYPWQTQILRLHLDGVV
FT                   EDVTESLFLDDIKALYVINYQNTFIIITGKSIYAVTPSCTKYNLLEVSGDEEFVLAAYN
FT                   ELIFIVKKDLMNFKSQLLTLKLNTLSNGTLELQSLPDSFDLHDVPTCITSFSLERKLLV
FT                   ILVHPSPYFECVFYDETSHSSVYKVPLTGFQFGYLPHSISYLRKSNRAVYVLISSNSTL
FT                   LTVYVTLTLEGVPDFKVYSNPISTDLPLTLQSPSDEFSTIYAWSDYLYIVGIDMETEQP
FT                   TLNQILEVNDSFTCVSGIYDIPNKFQNSESRIIVYYSNNTLYLSELWLPQRTFSSKLNL
FT                   AATPKRLLVDKYTNTLIIGCCHVLVNEITTSGLAFYDLTNSRLFPVNWPSMDIKGKPIF
FT                   KPEELLYSMSFWIVADDQKRKYRYLCIGTGVRKNGLTTGRLLILTMNKDHDSNAIELRN
FT                   VITINMKDPIYSVCSIGKHGLCYATGRKIGVKMLDLDSKKFCNSDCELPVRSPIVSMST
FT                   YKDYVYTSSLRDSVAVFQYDSENNSLNLVCSDTSSRLGIDCFYISQKKLLFSCDKDRLL
FT                   TCFKVEGEVCTSTREQMLQPILTTVSQTKTNALTNHLKYSVIRVDKDNHNIVWGLMGCT
FT                   LDGNIFKILMPNDPTSSDTIIYSDT"
FT   5'UTR           complement(597278..597586)
FT                   /gene="mms1"
FT                   /locus_tag="SPAC3H8.05c"
FT   misc_RNA        complement(597665..598076)
FT                   /locus_tag="SPNCRNA.664"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        597723..598290
FT                   /gene_synonym="SPNG106"
FT                   /locus_tag="SPNCRNA.156"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(598131..599439)
FT                   /locus_tag="SPNCRNA.665"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           598473..598915
FT                   /gene="aur1"
FT                   /locus_tag="SPAC3H8.06"
FT   CDS_pept        598916..600184
FT                   /transl_table=1
FT                   /gene="aur1"
FT                   /locus_tag="SPAC3H8.06"
FT                   /product="inositol phosphorylceramide synthase Aur1
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.06.1"
FT                   /db_xref="GOA:Q10142"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="PomBase:SPAC3H8.06"
FT                   /db_xref="PomBase:SPAC3H8.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10142"
FT                   /protein_id="CAA93163.1"
FT                   /translation="MSALSTLKKRLAACNRASQYKLETSLNPMPTFRLLRNTKWSWTHL
FT                   QYVFLAGNLIFACIVIESPGFWGKFGIACLLAIALTVPLTRQIFFPAIVIITWAILFYS
FT                   CRFIPERWRPPIWVRVLPTLENILYGSNLSSLLSKTTHSILDILAWVPYGVMHYSAPFI
FT                   ISFILFIFAPPGTLPVWARTFGYMNLFGVLIQMAFPCSPPWYENMYGLEPATYAVRGSP
FT                   GGLARIDALFGTSIYTDGFSNSPVVFGAFPSLHAGWAMLEALFLSHVFPRYRFCFYGYV
FT                   LWLCWCTMYLTHHYFVDLVGGMCLAIICFVFAQKLRLPQLQTGKILRWEYEFVIHGHGL
FT                   SEKTSNSLARTGSPYLLGRDSFTQNPNAVAFMSGLNNMELANTDHEWSVGSSSPEPLPS
FT                   PAADLIDRPASTTSSIFDASHLP"
FT   3'UTR           600185..600805
FT                   /gene="aur1"
FT                   /locus_tag="SPAC3H8.06"
FT   3'UTR           complement(600826..600882)
FT                   /gene="pac10"
FT                   /locus_tag="SPAC3H8.07c"
FT   CDS_pept        complement(join(600883..601282,601327..601425,
FT                   601475..601485))
FT                   /transl_table=1
FT                   /gene="pac10"
FT                   /locus_tag="SPAC3H8.07c"
FT                   /product="prefoldin subunit 3 Pac10 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.07c.1"
FT                   /db_xref="GOA:Q10143"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016655"
FT                   /db_xref="PomBase:SPAC3H8.07c"
FT                   /db_xref="PomBase:SPAC3H8.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10143"
FT                   /protein_id="CAA93164.1"
FT                   /translation="MSSSNPRGIPPAQFFEFKELSMEEAQGHLEKFQEAIAKYKFMETS
FT                   VVRRVASLDDKIPDIRKTLQSVQFLKERQGDSFTVTYELNDTLNAKAEVEAKDNVYLWL
FT                   GANVMLEYTVEEAEALLTQKLNSAEETLKACKEDLEFLRAQVTTMEVNTARVYNYTVLL
FT                   RKKTKM"
FT   5'UTR           complement(601486..601749)
FT                   /gene="pac10"
FT                   /locus_tag="SPAC3H8.07c"
FT   3'UTR           complement(601848..602059)
FT                   /locus_tag="SPAC3H8.08c"
FT   CDS_pept        complement(602060..603751)
FT                   /transl_table=1
FT                   /locus_tag="SPAC3H8.08c"
FT                   /product="transcription factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.08c.1"
FT                   /db_xref="GOA:Q10144"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPAC3H8.08c"
FT                   /db_xref="PomBase:SPAC3H8.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10144"
FT                   /protein_id="CAA93165.1"
FT                   /translation="MSSSPPALKKFRKRSPKSCLICRRRKVKCDRQQPCSRCKERNEVC
FT                   TYADDTIDKMNVGPHPSHSENASDSETTLEVSPDINPKKNEKFDFYGWRSLFELIKYRK
FT                   DSDMCSSRPSFSIQAYSSYKDNVVVESLANLLPPFCISQKIVNLFFKTLNVVCPIYDQE
FT                   TVEKSLNNIESPESFSYEDAFTLLPIIAATIQLSDLPDVILNFYNSAGITPLESSRLIN
FT                   LKLNEISEQEYKHLCLPDKEIIQMLLLRAYATKFRTRIRGVNTDLCRSIHVSTLVTPLF
FT                   QVTEKIGKNTSDLWFALCEIDGLECVLKYRPPFIQHDTYGRLKPLRCFFNDDISYNFHL
FT                   LLGRLLDCGVSIYKSVHSLTVSKFIDKLESYESQLSLILVDIEAKFYDPSNEDIQFRYI
FT                   FLKMVFWTARVNLYQCFITLDSGILEDEETIIGNLGESCIQCVRLLISQITILEKRGWL
FT                   LVALLEIIHALMLAAFCRDKGFEVPSDLGDITLYVQERMVDIVTFDDGMAVRFGYVLRF
FT                   INSMLHPNEPPMQDAEPETTEDPSKLFADIFDFTSNYFIPSALLDQ"
FT   5'UTR           complement(603752..603993)
FT                   /locus_tag="SPAC3H8.08c"
FT   misc_RNA        604128..606113
FT                   /locus_tag="SPNCRNA.666"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(604312..604495)
FT                   /gene="nab3"
FT                   /locus_tag="SPAC3H8.09c"
FT   CDS_pept        complement(join(604496..604959,605015..605355,
FT                   605438..606849))
FT                   /transl_table=1
FT                   /gene="nab3"
FT                   /locus_tag="SPAC3H8.09c"
FT                   /product="poly(A) binding protein Nab3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.09c.1"
FT                   /db_xref="GOA:Q10145"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034167"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PomBase:SPAC3H8.09c"
FT                   /db_xref="PomBase:SPAC3H8.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10145"
FT                   /protein_id="CAA93166.1"
FT                   /translation="MSSSSKDSSFQVETPVQNILETSTNSELQDQVSSPYEPDYNSPVK
FT                   QAAASISALQTQDDTLFNNVDERTLENKDGNKSDDANFDQVSGIPSGSLEIPILNSATS
FT                   NIRLTPSDTYNNIPVSDTNNEEISKNIYGAPILESTSSDFQSKDSLSTTQPSVSGGNGS
FT                   TSQSPPSLDVEQNKPFSISNEPVEQETENSSTKDLQVYDFQTASEHLPEQSLQNTTYYD
FT                   PSKTYSSVNFEEIEYGKSHEKLDLPYRTTDFIPYSKDLSTSPEAHRTSIYSYSANLPNY
FT                   YNEHNELHEHHNPQTPSSPESAYSPENLQLNHEAQNVEYLGNNAAEKSLQMNLEDEQRF
FT                   QQFLKDEESIMSNWYPGQFPSASRLFLGHLNTKSLSKRNLWKVFKIYGPLAQIVLKANY
FT                   GFVQFFTNEDCARALNAEQGNFVRGQKLHLEISKIQKKYQNQIENMKKGSHVTKSNQYS
FT                   EMIGNLPYPTSSRKRTRSPLMSKGKSYDRKGSISMSKNFSPDCEILVTEDCPKEFVWGV
FT                   EKVFQERRLNIHTTCLYRDSNLQVIIKSCIINSVKSIILINAGLAHLGKVSVQVFKDGS
FT                   SDSEVRCDEYAAVDVMVAASIVHHAKTSLMHSAASSTPSYNGERIVPDVPSPCISTNPN
FT                   LPALVGSLDSVNLHHLLGFIQNTYSTTSYIPTRVSFNPNDTGGSFGTITSQSQFVVNEM
FT                   PKNYARDNYEALHSQESRQRSSVAGNKQLQKILEQLAELKQPDF"
FT   5'UTR           complement(606850..607742)
FT                   /gene="nab3"
FT                   /locus_tag="SPAC3H8.09c"
FT   misc_RNA        complement(608406..608831)
FT                   /locus_tag="SPNCRNA.667"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           608893..608991
FT                   /gene="spo20"
FT                   /gene_synonym="sec14"
FT                   /locus_tag="SPAC3H8.10"
FT   CDS_pept        join(608992..609150,609199..609501,609698..609820,
FT                   609884..610159)
FT                   /transl_table=1
FT                   /gene="spo20"
FT                   /gene_synonym="sec14"
FT                   /locus_tag="SPAC3H8.10"
FT                   /product="sec14 cytosolic factor family Sec14"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC3H8.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC3H8.10.1"
FT                   /db_xref="GOA:Q10137"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="PomBase:SPAC3H8.10"
FT                   /db_xref="PomBase:SPAC3H8.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10137"
FT                   /protein_id="CAA93167.1"
FT                   /translation="MSETISDPYPLTNPNAPLGHPGHLNSTQQATLDSMRLELQKLGYT
FT                   ERLDDATLLRFLRARKFNLQQSLEMFIKCEKWRKEFGVDDLIKNFHYDEKEAVSKYYPQ
FT                   FYHKTDIDGRPVYVEQLGNIDLKKLYQITTPERMMQNLVYEYEMLALKRFPACSRKAGG
FT                   LIETSCTIMDLKGVGITSIHSVYSYIRQASSISQDYYPERMGKFYVINAPWGFSSAFNL
FT                   IKGFLDEATVKKIHILGSNYKSALLEQIPADNLPAKLGGNCQCPGGCELSDAGPWHEEQ
FT                   WMNKN"
FT   intron          609151..609198
FT                   /gene="spo20"
FT                   /gene_synonym="sec14"
FT                   /locus_tag="SPAC3H8.10"
FT   3'UTR           610160..610703
FT                   /gene="spo20"
FT                   /gene_synonym="sec14"
FT                   /locus_tag="SPAC3H8.10"
FT   5'UTR           610842..610885
FT                   /gene="rrp6"
FT                   /gene_synonym="SPAC3H8.11"
FT                   /locus_tag="SPAC1F3.01"
FT   CDS_pept        join(610886..611152,611211..613277)
FT                   /transl_table=1
FT                   /gene="rrp6"
FT                   /gene_synonym="SPAC3H8.11"
FT                   /locus_tag="SPAC1F3.01"
FT                   /product="exosome 3'-5' exoribonuclease subunit Rrp6
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.01.1"
FT                   /db_xref="GOA:Q10146"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="PomBase:SPAC1F3.01"
FT                   /db_xref="PomBase:SPAC1F3.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10146"
FT                   /protein_id="CAA93168.2"
FT                   /translation="MDESELFKGLMNSTAYCSELAKVDIPFYKSIDTEFNENIKSVSSR
FT                   FMRLIELLLSKVDRSRAEDIVDVEDIDNRWAEVSDTLDILFEKADYSIDKAQGLLKKPA
FT                   IETHASTSDVANKKPKKEKLPYKVIHAAHLTKPQLRFRVQPNNSREFVWSWKLTEKPHS
FT                   LVPLEKIIAQVKLDPSLKNSLPHPYEPEIQNSVYPPWVSEMSNPIDTGSVDETEPIWVS
FT                   TESQLSDMLKELQNSKEIAVDLEHHDYRSFRGFVCLMQISNREKDWIVDTLELREELEA
FT                   LNVVFTNPNIIKVFHGATMDIIWLQRDFGLYVVNLFDTYYATKVLGFEGHGLAFLLQKY
FT                   CDYDADKRYQMADWRIRPLPREMLKYAQSDTHYLLYIWDHLRNELISKSAERKENLMQS
FT                   VFNSSKQISLRKYELEPYDPIYGLGTDGWRNVLTKFGSSKIIGREALMIYRALHDWRDS
FT                   VARKEDESVRYVLPNRLLIAIAASKPVEAADVFSISKQLTPIARMYVEDIVKVVQEAEK
FT                   LYNEQVDREKSQFKEVEKQNQPLAVFSESNTLGDYKVDSSVFEISKQNRSKLKTLLANG
FT                   SAFWIEGQSQDDLRKARKERLFIVNQNIPFSLTLPCTQGHVESELNVKQSTVTEAANPS
FT                   LNGEKKQEPIVIRDLGLNKQKRDSSKLNHKEPSNPIEERNEDIEPSEASTSVSKKRKQK
FT                   KKKKNSGKLTIEAEHVSNDSPIINEAPFDYKNQKNFIADLDSDVGKNKFGKRGFNPLNK
FT                   VSLPKRNTRELKKRKVSDGKSTSY"
FT   3'UTR           613278..613338
FT                   /gene="rrp6"
FT                   /gene_synonym="SPAC3H8.11"
FT                   /locus_tag="SPAC1F3.01"
FT   3'UTR           complement(613369..613497)
FT                   /gene="mkh1"
FT                   /locus_tag="SPAC1F3.02c"
FT   CDS_pept        complement(613498..616848)
FT                   /transl_table=1
FT                   /gene="mkh1"
FT                   /locus_tag="SPAC1F3.02c"
FT                   /product="MEK kinase (MEKK) Mkh1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.02c.1"
FT                   /db_xref="GOA:Q10407"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC1F3.02c"
FT                   /db_xref="PomBase:SPAC1F3.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10407"
FT                   /protein_id="CAA94620.1"
FT                   /translation="MAADIGSQSSGSLEERFEQSLHLQNVDKQDWSLNSVLQFLKLYKF
FT                   NKEWEDVFIKSRIEMDLFINLADQSKAEEFAFKNKLSKESAIQLSSCIRKTLLAPSSTR
FT                   VPSKNSSYETLTYSAKDSSDDVFTETNSGFRSSNQNSSLKSFQSVPDSNVNVFGGFGGS
FT                   VVDNNELLSTGKNSHQTTSLNLEGSPINLHAYKGTVTSIINDDSRNINKKTLSKQPVSE
FT                   HKEKQTSFLRRFRVPGFSRDKDKTKDCPSSNSNPFHLASSNVKTLDASLDQGEWVPRIH
FT                   RLESQIGLISKKKSFVLATMDDMKFTVVDITNVQNATQLRKLIAKSMYLDISIDQFDLF
FT                   LTEVGGAQYIEILDDRKLDIARLYSDEFGTIKFFVKPSQNEESGMDSDTYLSFGTKSSS
FT                   TYKADDDSIYHRKEDFKKQPSYPVLTSDFEITDAGPNLSLSGHQPDNKYYKGFSSAPNL
FT                   AVVPELPSRRFRGFEKIRGAKGEMATKILDATEAQSEKNKFTVCRPHKKVTLKMPLNSG
FT                   SSAPQSPSSNTSASVLTRNFVAHRDPPPPPTETSSLRRKNTLTRRPSIRHARSSPYIDT
FT                   GHNEASKFSHTSFDPKASSKSSNSLKESVEALSEIPFEDAPALDESDLSGDPFWAIQPK
FT                   QSSSQVPKENHHNIQSKLSINTEAATDLKANELSSPKTPEYCRGDDRSISLSPLSYRLR
FT                   KSKHIRESPPSSKVINSGNWEVRPSADDLYEDVDRFFPRYDLDKVLVVDQSRMVSSPSK
FT                   VSIRPKMKSVRLLAREASEARKEIRHNARRNKSGNLLRRSSTKLWGSRIVELKPDTTIT
FT                   SGSVVSQNATFKWMKGELIGNGTYGKVFLAMNINTGELIAVKQVEIPQTINGRHDQLRK
FT                   DIVDSINAEISMIADLDHLNIVQYLGFEKTETDISIFLEYVSGGSIGRCLRNYGPFEEQ
FT                   LVRFVSRQVLYGLSYLHSKGIIHRDLKADNLLIDFDGVCKISDFGISKHSDNVYDNDAN
FT                   LSMQGSIFWMAPEVIHNDHQGYSAKVDVWSLGCVVLEMLAGRRPWSTDEAIQAMFKLGT
FT                   EKKAPPIPSELVSQVSPEAIQFLNACFTVNADVRPTAEELLNHPFMKCDEEFNFKDTNL
FT                   YDMLCKRKS"
FT   5'UTR           complement(616849..617324)
FT                   /gene="mkh1"
FT                   /locus_tag="SPAC1F3.02c"
FT   repeat_region   617366..617715
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           617816..617843
FT                   /locus_tag="SPAC1F3.03"
FT   CDS_pept        join(617844..617945,617993..618422,618471..620376,
FT                   620420..620996)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F3.03"
FT                   /product="Lgl family protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.03.1"
FT                   /db_xref="GOA:Q10408"
FT                   /db_xref="InterPro:IPR013905"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC1F3.03"
FT                   /db_xref="PomBase:SPAC1F3.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10408"
FT                   /protein_id="CAA94621.1"
FT                   /translation="MSFFKKKLSKGKEILSKSNLKTHTSSNASLSIDDLNRFGFSLNPV
FT                   LWCLDHQQGLLAIVSSTNRIYIYGKQHVQSVIVPDCSTIVHIALCAAYLIVIDSRNTVL
FT                   SYPLMKHRDLSKPAATYFLKQKVTCTVTDPTIDWVFFGMSDGSVVPWDVTRHCLGKFKV
FT                   PNLYVPRHEEWRMMGYSYAPVPGKLSPVVSVQIHPKDLGVILIAYPDGVVLYSIRTDEV
FT                   IRFYELEYAPGSTAAVLSPHNYRRPIVKGIEWSPWGDHFVSYYTDSTFAFWDVDQEYPV
FT                   QVRNFVDSNIHTYTPMQRNPPKTELEPIRSMRWCCCEDPTVSFILMLGGLPKEAPVKGI
FT                   SLFSYRNLPAKKDVETFAEFFANPNSQRFFPFIDIPPVRDMLVIPSSSPHYNGSHNPKN
FT                   LLLLSEDNSLSLLDISTGNISNMSLSIPPSLCFLASDFRVIAFQTVTKKVWNQIEDTIS
FT                   VNSHYSCLFGGSPSPGYLKKLDERNLLITSTGLSLSIWDISQGFMNPSLCVNLDFSSVM
FT                   RKHLTPSAFITTASFSTYNPEFSCADSFGRVIVCKRKNHKENLPAQLANGIYRLDDTLV
FT                   LEGTLHAQYYIDLKRGRVTLNQMSNIGFVCIGYQDGGITIIDMRGPHILCNTSISELGL
FT                   ERRGKPDPDFLTSAEFVVMNPKGSPSSIYVVTGTYRGMTLLFRIDPSSSGRFSAYFESS
FT                   RQLDIKNIYKICSLTQDGQIATATGSSLQSVGYPLPQEVFLVYIGDSGISVFNKINNQV
FT                   GNLDWRKPVCCRAALVLSTVSKHMGSVVCVNSDLSVNWYSLPNLREERKMQLPLDIDKN
FT                   RLKEGDILGNGDYIFPTLGAHELAFGCVLGSGRTLANLAPMMLITHNASHVPPRPSKSL
FT                   WNWLLGEQSTSAEELDILLGGENRAESKVHTLETPKVISARPAESVKQPLTPVPSMTSQ
FT                   SAQSYIPPRRQQQQKGFFAQINDHLAQRGNMLGGIENTMDDLEEMSAEWANEIKDSLAG
FT                   TKKDLILSGLKSYIP"
FT   3'UTR           620997..622703
FT                   /locus_tag="SPAC1F3.03"
FT   3'UTR           complement(621054..621188)
FT                   /gene="tsr3"
FT                   /locus_tag="SPAC1F3.04c"
FT   CDS_pept        complement(join(621189..621852,621989..622191))
FT                   /transl_table=1
FT                   /gene="tsr3"
FT                   /locus_tag="SPAC1F3.04c"
FT                   /product="SSU-rRNA maturation protein Tsr3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.04c.1"
FT                   /db_xref="GOA:Q10409"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR022968"
FT                   /db_xref="PomBase:SPAC1F3.04c"
FT                   /db_xref="PomBase:SPAC1F3.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10409"
FT                   /protein_id="CAA94622.1"
FT                   /translation="MGPRSSNRRSNAKDGFKGSNKASKFPLPLAMWDFGHCNPNACSGK
FT                   RLERLGCVRNLRIGQKFRGVVITPNGKVPVSPADKEYFDNGGASVVECSWARIEEIPFS
FT                   RIGGRCERLLPYLVASNPVNYGRPWRLNCAEALAACMYIVGYPNEARLLMDNFKWGHSF
FT                   FEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQRNQTTDDIWSAGNLNHKPTLN
FT                   TSSTHSNSEESRSPLHEPSEASLAHDEHSIPTDDNEETLTNLQANDVDEDEVWRKIVRM
FT                   KVHSTDT"
FT   5'UTR           complement(622192..622267)
FT                   /gene="tsr3"
FT                   /locus_tag="SPAC1F3.04c"
FT   5'UTR           623091..623271
FT                   /locus_tag="SPAC1F3.05"
FT   CDS_pept        join(623272..623305,623375..623462,623518..623593,
FT                   623752..625086)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F3.05"
FT                   /product="Golgi localized Arf binding gamma-adaptin
FT                   ortholog (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.05.1"
FT                   /db_xref="GOA:Q10410"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="PomBase:SPAC1F3.05"
FT                   /db_xref="PomBase:SPAC1F3.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10410"
FT                   /protein_id="CAA94623.1"
FT                   /translation="MRSSQTLSKYIDKATDQFNLEPNLALNIEIADLINEKKGNTPREA
FT                   ALLILKRVNSANPTVSYLALHLLDICVKNCGYPFHFQIASEEFLNGFVSRFPNHPISRM
FT                   NKIQSKMLEMLEEWNYMLCKNNRHREDFSRIHDIRELMAFRGYKFPAVDEDSIAVMKPN
FT                   NSLRSAQELAREDLEAHKAKLQELLRRGTPMDLAEANALMKVIAGYDEENTEDYSALAA
FT                   ADLESIRSKALRVKQFLVNQTVSLEEGTLADAVESLKVYQTKIARILREENEDEYYVQK
FT                   LLSLNDLLINVIEECSNSDLIHSGTNVVSSQPNVVESHVPPSSNDTKQESSLIDLMKLT
FT                   EEPAVPSPSLPTNVPANQSLSMLSSLSNSMSSTSNGALNSPSYSQAAIPNTNSSLTSIL
FT                   QSDSLMISTQLTSVQKSSGFASYSVQFSNCSLTWPVSEVVFQVAVVKSLKLQLLPHTGD
FT                   AIIAPGKQNAAHEIMNITNIPADASDLRIRWRVQWIIGTDHRVEQGESHLPL"
FT   3'UTR           625087..625407
FT                   /locus_tag="SPAC1F3.05"
FT   3'UTR           complement(625173..625429)
FT                   /gene="spo15"
FT                   /locus_tag="SPAC1F3.06c"
FT   CDS_pept        complement(625430..631303)
FT                   /transl_table=1
FT                   /gene="spo15"
FT                   /locus_tag="SPAC1F3.06c"
FT                   /product="sporulation protein Spo15"
FT                   /db_xref="GOA:Q10411"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10411"
FT                   /protein_id="CAA94624.1"
FT                   /translation="MSNQSSSGSNTSDLDEESASSLVSSAASPFIDSDLETPRPNISRA
FT                   STGQLAEDGDTSSQHEDSSEELKRQEVRGMRRHSDLSIDAKLGSSEGSTASSALPLTPR
FT                   SPSNASWLLVRGGLLDSPILDINSVTQKSNLLNELKQVRSKLAALEHENGILSLQLSSS
FT                   NKKDKNTSSVTTLTSEEDVSYFQKKLTNMESNFSAKQSEAYDLSRQLLTVTEKLDKKEK
FT                   DYEKIKEDVSSIKASLAEEQASNKSLRGEQERLEKLLVSSNKTVSTLRQTENSLRAECK
FT                   TLQEKLEKCAINEEDSKLLEELKHNVANYSDAIVHKDKLIEDLSTRISEFDNLKSERDT
FT                   LSIKNEKLEKLLRNTIGSLKDSRTSNSQLEEEMVELKESNRTIHSQLTDAESKLSSFEQ
FT                   ENKSLKGSIDEYQNNLSSKDKMVKQVSSQLEEARSSLAHATGKLAEINSERDFQNKKIK
FT                   DFEKIEQDLRACLNSSSNELKEKSALIDKKDQELNNLREQIKEQKKVSESTQSSLQSLQ
FT                   RDILNEKKKHEVYESQLNELKGELQTEISNSEHLSSQLSTLAAEKEAAVATNNELSESK
FT                   NSLQTLCNAFQEKLAKSVMQLKENEQNFSSLDTSFKKLNESHQELENNHQTITKQLKDT
FT                   SSKLQQLQLERANFEQKESTLSDENNDLRTKLLKLEESNKSLIKKQEDVDSLEKNIQTL
FT                   KEDLRKSEEALRFSKLEAKNLREVIDNLKGKHETLEAQRNDLHSSLSDAKNTNAILSSE
FT                   LTKSSEDVKRLTANVETLTQDSKAMKQSFTSLVNSYQSISNLYHELRDDHVNMQSQNNT
FT                   LLESESKLKTDCENLTQQNMTLIDNVQKLMHKHVNQESKVSELKEVNGKLSLDLKNLRS
FT                   SLNVAISDNDQILTQLAELSKNYDSLEQESAQLNSGLKSLEAEKQLLHTENEELHIRLD
FT                   KLTGKLKIEESKSSDLGKKLTARQEEISNLKEENMSQSQAITSVKSKLDETLSKSSKLE
FT                   ADIEHLKNKVSEVEVERNALLASNERLMDDLKNNGENIASLQTEIEKKRAENDDLQSKL
FT                   SVVSSEYENLLLISSQTNKSLEDKTNQLKYIEKNVQKLLDEKDQRNVELEELTSKYGKL
FT                   GEENAQIKDELLALRKKSKKQHDLCANFVDDLKEKSDALEQLTNEKNELIVSLEQSNSN
FT                   NEALVEERSDLANRLSDMKKSLSDSDNVISVIRSDLVRVNDELDTLKKDKDSLSTQYSE
FT                   VCQDRDDLLDSLKGCEESFNKYAVSLRELCTKSEIDVPVSEILDDNFVFNAGNFSELSR
FT                   LTVLSLENYLDAFNQVNFKKMELDNRLTTTDAEFTKVVADLEKLQHEHDDWLIQRGDLE
FT                   KALKDSEKNFLRKEAEMTENIHSLEEGKEETKKEIAELSSRLEDNQLATNKLKNQLDHL
FT                   NQEIRLKEDVLKEKESLIISLEESLSNQRQKESSLLDAKNELEHMLDDTSRKNSSLMEK
FT                   IESINSSLDDKSFELASAVEKLGALQKLHSESLSLMENIKSQLQEAKEKIQVDESTIQE
FT                   LDHEITASKNNYEGKLNDKDSIIRDLSENIEQLNNLLAEEKSAVKRLSTEKESEILQFN
FT                   SRLADLEYHKSQVESELGRSKLKLASTTEELQLAENERLSLTTRMLDLQNQVKDLSNIK
FT                   DSLSEDLRTLRSLEDSVASLQKECKIKSNTVESLQDVLTSVQARNAELEDEVSRSVDKI
FT                   RRRDDRCEHLSGKLKKLHSQLEEQHETFFRAEQQRMTQLGFLKETVKKQEKLLKKLNLR
FT                   QEQLIPRSSILVYESYIRDIEKEIIVLQERLNGIELSQQLPKGYFGYFFKTNRVEMEVL
FT                   DSFKQQVAKLQFLAGAEFIVKFKEDLEKCAAEEKEKQATFDNYSEKVENLGKSIEALYF
FT                   ALNREISFRKSLALSKSAYHNLLVRDSPKFNPDSQITYSIPVTNTKQSLLRSAILCVIS
FT                   LQRLRLLGQRHSFCEEVIENLSCV"
FT   5'UTR           complement(631304..631401)
FT                   /gene="spo15"
FT                   /locus_tag="SPAC1F3.06c"
FT   3'UTR           complement(631511..631555)
FT                   /gene="rsc58"
FT                   /locus_tag="SPAC1F3.07c"
FT   CDS_pept        complement(join(631556..632424,632499..632841))
FT                   /transl_table=1
FT                   /gene="rsc58"
FT                   /locus_tag="SPAC1F3.07c"
FT                   /product="RSC complex subunit Rsc58"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.07c.1"
FT                   /db_xref="GOA:Q10412"
FT                   /db_xref="PomBase:SPAC1F3.07c"
FT                   /db_xref="PomBase:SPAC1F3.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10412"
FT                   /protein_id="CAA94625.1"
FT                   /translation="MNAESCSLILSYISSAPAGNLVLNCTATTNKQTLEANLKSAVYQR
FT                   YPEFLEDWTNVCVHIIHSYFPKDADYWNVDKLYTSVNRITTLEQSKVVGKEIKNGFTFD
FT                   AENSTASLENDLQPQFRSHALFMVGSAGPLFSSTARTSRLDSRLPDGGIIAKPVALLPT
FT                   PSVANSQEYTLDKLSPPSTAKPPASVIEFNPSLAKLPTVKYLQSGPFSSIAPYKNSSSS
FT                   VIPDSSFHSVACYRASSHYKEAPVEKSIDIDIIQNNLSLLEEDSWTSVPIQGELVELNK
FT                   LLQHLQLLQNQRITSHNVLSDEERQISVQVQNLILKLAKDYDMSPEDFLMDDFTLSLTQ
FT                   YGAFYRGTLPLSAQPLELPSQQLLRSQSNAALRSNSLSMNGSLSPSSTNVPLQSYRRTT
FT                   KSRR"
FT   misc_RNA        632595..633291
FT                   /locus_tag="SPNCRNA.668"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(632842..633102)
FT                   /gene="rsc58"
FT                   /locus_tag="SPAC1F3.07c"
FT   CDS_pept        complement(633148..633474)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1F3.08c"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.08c.1"
FT                   /db_xref="GOA:Q10413"
FT                   /db_xref="PomBase:SPAC1F3.08c"
FT                   /db_xref="PomBase:SPAC1F3.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10413"
FT                   /protein_id="CAA94626.1"
FT                   /translation="MVIYCNWLELKGLLETNDFLYLMRCCYMYDTVSLVSNAPNIYSIP
FT                   FFYDRICYDYKNILLKYELFIIYYYYYLLICLSPHFFPIKRIRPFHENPLHSFVYRIMI
FT                   SSEA"
FT   5'UTR           633652..634936
FT                   /gene="mug161"
FT                   /locus_tag="SPAC1F3.09"
FT   misc_RNA        complement(633767..634868)
FT                   /locus_tag="SPNCRNA.669"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(634898..637022)
FT                   /gene="oct1"
FT                   /locus_tag="SPAC1F3.10c"
FT   CDS_pept        join(634937..634971,635069..635235,635349..636176,
FT                   636234..636314,636385..636959)
FT                   /transl_table=1
FT                   /gene="mug161"
FT                   /locus_tag="SPAC1F3.09"
FT                   /product="CwfJ family protein, splicing factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.09.1"
FT                   /db_xref="GOA:Q10414"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR040194"
FT                   /db_xref="PomBase:SPAC1F3.09"
FT                   /db_xref="PomBase:SPAC1F3.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10414"
FT                   /protein_id="CAA94627.1"
FT                   /translation="MIFYDKLKPADVLVIGSADGRVIEAIEYIADLHKQHGFKFAICLG
FT                   NLFSHKRTTSADVVKLKNEKVKVPIPVYFGVGTAGLPESIISHMAMYGPEVAPNLFCMG
FT                   ICGFMKTFYKFTIAQLGGSYNEEKYYQPPEKFEQSLNEKCFHRSDVQKLSKRCDILFSS
FT                   EWPEDVQENSTLPERKLPKGCMPLAALAANCMPQYFFVPGPVYYEREPYKNSAAINVNT
FT                   GTVTHFVALAPFKNSKNEKFSYAFTLYPLTTEYMQPAPPNCTASPFEHRPIPLKRASED
FT                   QIIPQQTNKFHKSKSSTALFKSKKDSSSSLNKMHKSESHSALNNLHKSESGTSLNNRRS
FT                   KVGPGSCFFCLSNPNVALHLIVAIGNEAYMALPKGPLTTTASNTPALASSGHVLIIPIA
FT                   HASALSTLSDTSYEKTLNEMNRFRKAVTDMYNACDSDALVYEISRANGVHLHWQMIPIP
FT                   KISSHRIESVFLEMAKEAGYDFEERDVEPHELNYFRVFLPSGKILIHRLQLRERFDLQF
FT                   GRRAAAKILGLEDRVDWRKCVQTEDEEKAESEAFKMCFKPYDFT"
FT   CDS_pept        complement(637023..639311)
FT                   /transl_table=1
FT                   /gene="oct1"
FT                   /locus_tag="SPAC1F3.10c"
FT                   /product="mitochondrial intermediate peptidase Oct1
FT                   (predicted)"
FT                   /EC_number="3.4.24.59"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1F3.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1F3.10c.1"
FT                   /db_xref="GOA:Q10415"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="PomBase:SPAC1F3.10c"
FT                   /db_xref="PomBase:SPAC1F3.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10415"
FT                   /protein_id="CAA94628.1"
FT                   /translation="MQVRTLLTLGKKKVIGNRQCILSLYRKYSNVQSRKAEDQLLRQIF
FT                   DDQNIAVNQITKRNGIQGVGLFRNHFLSDKDTGFLRLAETASEKCKAVIEDLLLEDTED
FT                   GSIVVSKFDRISNLLCSVIDLFEFVRCAHPDKMVVMKAEEAYSYLFELMNTLNTHQGLY
FT                   EKLKCSLQQTPTLKDTDPEAYTVGRVFLQDFEKSGVNLESSKRNSFVKKSSESATLGRA
FT                   FFNNSMNRPQRYLTISKQRLAGSDPYFVRSLSKNDKNFIMIPTVGYEGTQALISVANPD
FT                   VRKEIYMEGHKGTVEEVELLNSYLRSKAEVAKLVGKSSFADLQLIDKMANAPKHVVEFL
FT                   ENLSLKNSSVLKKILNNLALMKKKELNLNFLPSFDVWDREYYTARYKQSLINQKPSLNP
FT                   SITNYRRFFSVGTVIQGLSRLFSSLYGLRFVPADISPGEVWHPDVNKVNVYNENDHVMG
FT                   VIYFDLFARTGKTDGAAHFTIRSSRELDLTSFDDSISLGFDDATNIRVKDNKRYQIPVI
FT                   SLLCNFVRSSGMDPTFLDLWDVKTLFHEMGHAMHSILGHTKYQNLAGTRCATDFVELPS
FT                   IIMEFFMSNPAVLPLYARYEGTEIPLPVQVLNHHNMVENSSAPLDLQSQICMAMVDQLF
FT                   HSKVVLDPSFNSIDEVTNVTRKFSGFESAPPAAWYLQFSHLYGYSATYYSYIFDTVLAS
FT                   LIFSKLFAGNPLSREAGEKFRKAILRWGGSRSPWECVAEALEQPILATGGEEAMRRIGS
FT                   EGIKATSTF"
FT   5'UTR           complement(639312..639430)
FT                   /gene="oct1"
FT                   /locus_tag="SPAC1F3.10c"
FT   5'UTR           639405..639410
FT                   /gene_synonym="SPAC1F3.11"
FT                   /locus_tag="SPAC1D4.01"
FT   CDS_pept        639411..640175
FT                   /transl_table=1
FT                   /gene_synonym="SPAC1F3.11"
FT                   /locus_tag="SPAC1D4.01"
FT                   /product="human C9orf78 ortholog"
FT                   /db_xref="GOA:Q10148"
FT                   /db_xref="InterPro:IPR010756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10148"
FT                   /protein_id="CAA94629.3"
FT                   /translation="MNSIHIKKKSNRSFRRRKVFGNEKEFDLEELDDNDIRLRQALEAT
FT                   KRRKIRNSIIGINAEKLLNQETKKEKQLNTANEPHEANDQTSAQSSKLIEAQLPTVEDR
FT                   FAKQTNEVDINTHLLNFVEKKLKQERLAQNYSENGETNALNTKNESTVQNIKNSLHPNE
FT                   HSFIRDAAALGAIREVDLGIISTDVDNLKNGRKRQKKRARMKEKLDSKALRTSEDAARD
FT                   EFIEKMLKPISQDEESKGIYRRFRVYKDGTQD"
FT   3'UTR           complement(639545..640398)
FT                   /locus_tag="SPAC1D4.02c"
FT   3'UTR           640176..641280
FT                   /gene_synonym="SPAC1F3.11"
FT                   /locus_tag="SPAC1D4.01"
FT   CDS_pept        complement(join(640399..640947,640997..641184,
FT                   641281..641401,641448..641627))
FT                   /transl_table=1
FT                   /locus_tag="SPAC1D4.02c"
FT                   /product="human GRASP protein family Golgi protein
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.02c.1"
FT                   /db_xref="GOA:Q10149"
FT                   /db_xref="InterPro:IPR007583"
FT                   /db_xref="InterPro:IPR024958"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="PomBase:SPAC1D4.02c"
FT                   /db_xref="PomBase:SPAC1D4.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10149"
FT                   /protein_id="CAB56126.1"
FT                   /translation="MFGGLKNFIKEKSEALAGIHRESDESCGFRVLKVENDSKAYNARI
FT                   ESYYDFITAVNGILLNGDPSMFMALLRDSSPEVTLEVFSLKGQITRKVNIKINSDEKIG
FT                   MVLQWASIAPAVDAIWHILNVIDDSPVARASLVPYEDYIVGTPEGMMTGEKALSDLIES
FT                   HLNRPLRLYIYNHYRDSTRQVTIVPNRHWGGNGAIGCGVGHGVLHRLPAPLSGPPPQPG
FT                   DIVFSNPMLGGPDHKVSQPSETENFLPTPEPPKIASANAGSSNEISIPHYQRHKKSHKG
FT                   AIQDSSIQSYLDEEEKLSRELDHKTKDASSTNDSQTTPLPPPPPVAVNSTNDESAPQNE
FT                   ELVKN"
FT   5'UTR           complement(641628..641680)
FT                   /locus_tag="SPAC1D4.02c"
FT   3'UTR           complement(641845..641884)
FT                   /gene="aut12"
FT                   /locus_tag="SPAC1D4.03c"
FT   CDS_pept        complement(join(641885..642131,642218..643512))
FT                   /transl_table=1
FT                   /gene="aut12"
FT                   /locus_tag="SPAC1D4.03c"
FT                   /product="autophagy associated protein Aut12 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.03c.1"
FT                   /db_xref="GOA:Q10150"
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="PomBase:SPAC1D4.03c"
FT                   /db_xref="PomBase:SPAC1D4.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10150"
FT                   /protein_id="CAA93212.1"
FT                   /translation="MEPTSEHSSIKEEVENDNVHRSHESECGSLLLNPGNVLMAAPSVS
FT                   EDDQEVSRSTPELRSHVENVEQLLSDILHDNSSPLNVSTSVSSSSNNTAVDEIIKLLSL
FT                   ISFDLAKQKRTYLIFSSSGKPVFSNIVDDSIEPSTVGALQAIISSFEVSKEELTSFSTF
FT                   SNVIVVLSKNPLYLVGVSPSTTLSAAYLLSELNLLYCQILTGVTAKAMQLTLNSRPNFD
FT                   LRRLIGSNEQFLKELCDQLNDYELVPTLNAISPLPLRSSFRDQLSQLLLRETPKSLLFT
FT                   FIAIRGRLVCMVKAKKLLLHANDLYLLFLSLFRTQSFNDSMEHWVPVCFPTLNPDAYIY
FT                   IYSYFLCKDTVLIMGSSESGVFFEMQSVKCKVAQEIQDHGWLKKLIYCEEMDRTTPRNP
FT                   GSPCISHYLFYSKKYSQFYTPGYSFSTPNFNTRTLYAIYASLHDQAFHKKNSFSINMTV
FT                   HESLLLFTWSTASFDFHCIANATTSSQLLIANVNKILRWIRREENRLFIQTNLSF"
FT   5'UTR           complement(643513..643775)
FT                   /gene="aut12"
FT                   /locus_tag="SPAC1D4.03c"
FT   misc_RNA        complement(643960..644683)
FT                   /locus_tag="SPNCRNA.670"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   3'UTR           complement(644623..646592)
FT                   /locus_tag="SPAC1D4.05c"
FT   5'UTR           644667..644710
FT                   /gene="cct2"
FT                   /locus_tag="SPAC1D4.04"
FT   CDS_pept        join(644711..644713,644750..644881,644929..646377)
FT                   /transl_table=1
FT                   /gene="cct2"
FT                   /locus_tag="SPAC1D4.04"
FT                   /product="chaperonin-containing T-complex beta subunit
FT                   Cct2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.04.1"
FT                   /db_xref="GOA:Q10147"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012716"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="PomBase:SPAC1D4.04"
FT                   /db_xref="PomBase:SPAC1D4.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10147"
FT                   /protein_id="CAA93213.1"
FT                   /translation="MSLNPHQIFNESGIQERGENARLSSFVGAIAVGDLVKSTLGPKGM
FT                   DKILQSNSSGDIVVTNDGATILKSIALDNAAAKVLVNISKVQDDEVGDGTTSVCVFAAE
FT                   LLRQAEIMVNAKIHPQVIIDGYRIATKTAIDALRASSIDNSSDPAKFRSDLENIARTTL
FT                   SSKILSQNKNHFAQLAVDAVLRLKGSTNLDNIQIIKILGGKLDDSFLDEGFILNKTIGV
FT                   NCPKVMENANILIANTAMDTDKVKVFGARVRVDTTGKLAELERAEREKMKAKVEKIKSH
FT                   NINCFINRQLIYNWPEQLFADAGIMSIEHADFDGIERLSLVTGGEIASTFDHPELVKLG
FT                   HCKKIEEIIIGEDKMIKFSGVEAGEACTIVLRGATHQLLDESERAIHDALAVLSQTVAE
FT                   SRVTLGGGCAEMLMAKAVEEAATHEPGKKAVAVSAFAKALSQLPTILADNAGFDSSELV
FT                   AQLKAAHYDGNDTMGLDMDEGEIADMRAKGILEALKLKQAVVSSGSEGAQLLLRVDTIL
FT                   KAAPRPRERM"
FT   3'UTR           646378..646547
FT                   /gene="cct2"
FT                   /locus_tag="SPAC1D4.04"
FT   CDS_pept        complement(join(646593..647677,647730..647808))
FT                   /transl_table=1
FT                   /locus_tag="SPAC1D4.05c"
FT                   /product="Erd1 homolog (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.05c.1"
FT                   /db_xref="GOA:Q10151"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="PomBase:SPAC1D4.05c"
FT                   /db_xref="PomBase:SPAC1D4.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10151"
FT                   /protein_id="CAA93214.1"
FT                   /translation="MDLEVVEFPLHHKLALPFRIGLLVIVGTWLWSVCYHLIYILNRYQ
FT                   PISPNPRGSLNSKWYHLLQIPLSNRHTDLEENTEFKANLVSPVDFHAGYCFAAILSISW
FT                   ATGFILFLKKTQGDIGGLYSHPIYPLLWVITAFILIVFPFPWRYRSSQRGLRKSIIRVF
FT                   LFFQADFRSPYKDFIVSEIFTSYAKALGDFYIFGCVLQGHISKFTLRPDLKCDGTFFVP
FT                   LAMAYPFIVAILQCLHYGLSRRKHTFKINLLSALKHATALPVIYLSAIIHAKQTKFTLT
FT                   SGHGYLFWLWILSALLSSAYTFLWDVFIDWRIRFPFHKSINHKRFPMFIYAIGCFINFI
FT                   LRVTWSMKLHPRLHQFHEYEMGIFSFEMLEILRRFLWLFFHLDAISS"
FT   5'UTR           complement(647809..648097)
FT                   /locus_tag="SPAC1D4.05c"
FT   CDS_pept        complement(join(648301..648501,648614..648829,
FT                   648890..649393))
FT                   /transl_table=1
FT                   /gene="csk1"
FT                   /locus_tag="SPAC1D4.06c"
FT                   /product="cyclin-dependent kinase activating kinase Csk1"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.06c.1"
FT                   /db_xref="GOA:P36615"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PomBase:SPAC1D4.06c"
FT                   /db_xref="PomBase:SPAC1D4.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36615"
FT                   /protein_id="CAA93215.1"
FT                   /translation="MKSVGHFVPWLTDIRHLTDGTISEVFVGERKNSKKLYVIKVQGLV
FT                   FKRPPHDAMRGKLILESIGHPHIERIVDSFIDNEAGSVYLITSFKSFVLSDVMDEISID
FT                   TKCKIVLQISSALEYLEKHGILHRDIHPNNILLDSMNGPAYLSDFSIAWSKQHPGEEVQ
FT                   ELIPQIGTGHYRAIETLFGCHSYGHEVDRWTFGILIAELFSNQALFDDGSSEGWPSELR
FT                   LTSSIIQTLGTPNPSMWPELSTFPDWNKFIFHEYPPKPWSEILPSVDTSIQYIVSHLVT
FT                   YSNRASPSFVIESFPKVSARLSQYA"
FT   CDS_pept        complement(649449..649889)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1D4.07c"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.07c.1"
FT                   /db_xref="PomBase:SPAC1D4.07c"
FT                   /db_xref="PomBase:SPAC1D4.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10152"
FT                   /protein_id="CAA93216.1"
FT                   /translation="MISKTIKTLIITKIFFSFKQTKRKKNKNKKRILSILPYYKNSYSD
FT                   FISVLQMYKVHIRMVSIYIFLKALSNIFLASSCEITVRLSSGGHPSPPVHIYMSALIKV
FT                   CKKSKPHLQTHCIKRKTYCVKHLAISNFQSFILQRFSCFLFC"
FT   5'UTR           650465..650813
FT                   /gene="pis1"
FT                   /locus_tag="SPAC1D4.08"
FT   CDS_pept        join(650814..650893,651173..651848)
FT                   /transl_table=1
FT                   /gene="pis1"
FT                   /locus_tag="SPAC1D4.08"
FT                   /product="CDP-diacylglycerol--inositol
FT                   3-phosphatidyltransferase Pis1 (predicted)"
FT                   /EC_number="2.7.8.11"
FT                   /db_xref="GOA:Q10153"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10153"
FT                   /protein_id="CAA93217.1"
FT                   /translation="MRVKFLKLSNDFPFCSGQAMSGVLDTFILTLCLGFTRVFLVLISL
FT                   YFMSWHPNYCTIVYLYSSLLDAFDGWAARKLHQATNFGAILDMVTDRCATSCLLCFLCA
FT                   AYPKYAIIFQLLVSLDLASHYMHMYSTLHQGASSHKTVTKKHNWMLRLYYGNNKVLFIF
FT                   CAANEMFFVALYLLSFTPRTPPKLGYLPVPSFIYSTGELPLSYPTLLAVLCGPICLAKQ
FT                   IINVVQLVNAANALVKMDVEQRRAAKKLQ"
FT   3'UTR           651849..652224
FT                   /gene="pis1"
FT                   /locus_tag="SPAC1D4.08"
FT   3'UTR           complement(652225..652358)
FT                   /gene="rtf2"
FT                   /locus_tag="SPAC1D4.09c"
FT   CDS_pept        complement(join(652359..652529,652576..652698,
FT                   652763..653178,653222..653234))
FT                   /transl_table=1
FT                   /gene="rtf2"
FT                   /locus_tag="SPAC1D4.09c"
FT                   /product="replication termination factor Rtf2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.09c.1"
FT                   /db_xref="GOA:Q10154"
FT                   /db_xref="InterPro:IPR006735"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027799"
FT                   /db_xref="PomBase:SPAC1D4.09c"
FT                   /db_xref="PomBase:SPAC1D4.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10154"
FT                   /protein_id="CAA93218.1"
FT                   /translation="MGNDGGSLPTRNELVKEPGKVPPLDIDFKRSVKSSQFSQCAITDE
FT                   PLYPPIVSCGLGKLYNKASILQMLLDRSSVPKSPSHIKSLKDVVQLQVELDDSGKVLWL
FT                   CPITRHVMSDTYQFAYIVPCGHVFEYSALKQFGEKMCFQCNQVYEEKDVIPINPNAEQL
FT                   KTLSKRLLDLALSEKTHSLNKASKKSNKNGDKKRKHVSKSNSKHAKHELRTNRMLDGEN
FT                   VKSETSVTDMERVKRVKI"
FT   intron          complement(652530..652575)
FT                   /gene="rtf2"
FT                   /locus_tag="SPAC1D4.09c"
FT   5'UTR           complement(653235..653321)
FT                   /gene="rtf2"
FT                   /locus_tag="SPAC1D4.09c"
FT   5'UTR           653449..653773
FT                   /gene="trz1"
FT                   /gene_synonym="sptrz1"
FT                   /locus_tag="SPAC1D4.10"
FT   CDS_pept        join(653774..654158,654196..656240)
FT                   /transl_table=1
FT                   /gene="trz1"
FT                   /gene_synonym="sptrz1"
FT                   /locus_tag="SPAC1D4.10"
FT                   /product="3'-tRNA processing endonuclease tRNAse Z L2 Trz1
FT                   (predicted)"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.10.1"
FT                   /db_xref="GOA:Q10155"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR027794"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="PomBase:SPAC1D4.10"
FT                   /db_xref="PomBase:SPAC1D4.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10155"
FT                   /protein_id="CAA93219.1"
FT                   /translation="MSKTVNFRATKNFYLQFVSVSSRDTSCIPCIHLFFDSKRYVFGSV
FT                   GEGCQRAILSQQLRLSKIKDVFLMQGSSISSPDTYDSSSSSSTTSVSDMLQLDDRDKVI
FT                   VSERNSMCSTVNYPTWWDSCGGFPGFLLSLNDISEPGETGEASPFVLHGPSEVHQFLSS
FT                   MRHFTYHTNVNLTVQGYTSAEAPVFVDENICVTPVVVSLVKNSFKKRKHENINRGTNAR
FT                   PLKEDRANTSPHWYSHVSNDTSFVVENAMYNTPAPLEPDKPELFISYIVQSHPTPGKFD
FT                   AAKAKSLGITKGLDCGRLARGEPVTLENGKTVYPKEVIGPSIPGSSFFIIHCPNELVID
FT                   LVIENHKWTNAPKPVCVIHSVTPEVYKNPRYQSWISSFPSEVSHLIASTEVNEVINYPR
FT                   SAVAIATLNLLDSKVFPLGFNCYEVKNVQKNNRIAFAKPKLRFAFGKKTGIDDSEVGVS
FT                   IEELKDKILKEKPDYKSFVEEAQKYVSDKPKAPSFAGSDIQICTLGTGSAMPSLYRNVS
FT                   STYVRIPVDKKCMEDSAISMKNILLDCGEGTLGRLSRQYGDNLKYEIASLRWIYISHMH
FT                   ADHHAGVIGVLKAWTKYSDGRSKLFITAPPQFEFWLLEYSRIDYLPLSNIVFISNSALR
FT                   TDRKPSALESSRLSSLFKEFDLVSFRTVPAIHCPYSYCMEITNSSGWKIAYSGDTRPSE
FT                   DFANIAKDSTLLIHEATLEDSMHEIAIKKQHSTYSEALEVAKKAGTKNVILTHFSQRYP
FT                   KLPDIDISTEDLHIALAFDGMTLKISDISLFRYFGKPLAYLFNEENLKEESDPLKF"
FT   3'UTR           complement(656076..656759)
FT                   /gene="lkh1"
FT                   /gene_synonym="kic1"
FT                   /locus_tag="SPAC1D4.11c"
FT   3'UTR           656241..656657
FT                   /gene="trz1"
FT                   /gene_synonym="sptrz1"
FT                   /locus_tag="SPAC1D4.10"
FT   CDS_pept        complement(656760..658832)
FT                   /transl_table=1
FT                   /gene="lkh1"
FT                   /gene_synonym="kic1"
FT                   /locus_tag="SPAC1D4.11c"
FT                   /product="dual specificity protein kinase Lkh1"
FT                   /EC_number="2.7.11.1"
FT                   /EC_number="2.7.10.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.11c.1"
FT                   /db_xref="GOA:Q10156"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC1D4.11c"
FT                   /db_xref="PomBase:SPAC1D4.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10156"
FT                   /protein_id="CAD29835.2"
FT                   /translation="MHSLKRRRNHAPDWQDFYKNGVPQEVIVIEDSASPRLTPNLPPPF
FT                   SVHQLQSFVPPQPPSSSSPSTTGTVAVPINGANAVYPSTNSVSLPQSYDPWLDANGVVP
FT                   LPHDVASHPSYMVQSPTSYHACSNNQSPFPHSHHPPLHNPLPVSCQPVLRPPPVPQVPS
FT                   HWYPVSLPSPNLPHQPISKPPVIPNLPKLQVHPNRLPHPIHNHPYSSPTSYPPPLCPAT
FT                   YCPSNPPQLAPATAIAPSSQSSQHKSVNYSVTPSSINNHTAVPLSPTLAVWLPMTQPTF
FT                   QPPSANVYQPASNANQVITPVSISDYRPPKKRKRAAWPPYKKVDRVNVPVVHDTTAFDP
FT                   STFDDDDGHYKVVPNSKFANRYTVVRLLGHGTFGKVIQCYDQSTGRHCAIKVTRAIPKY
FT                   REASLIELRVLQTIAHSDPTNENKCIQLRDYFDYRKHICIVTDLFGWSVFDFLKNNNYI
FT                   PFPLKHIQMLSQQLFKSVAFLHSLGLVHTDLKPENVLLVSNASRTIRLPYRNYSQKVLN
FT                   SCEIRLIDFGSATFEDEYHSSVVSTRHYRAPEIILGLGWSYPCDVWSIGCILVELFTGQ
FT                   ALFQTHEDSEHLCMMEKILGPFDRNMISRSSRTSQRFFKSDGKVRYPLSNTPKKSINYL
FT                   QSLQTLEQIFAVSSPEVALLLDLLKKVFVYDPKRRITAKEALWHPFFTQPISSNL"
FT   5'UTR           complement(658833..660381)
FT                   /gene="lkh1"
FT                   /gene_synonym="kic1"
FT                   /locus_tag="SPAC1D4.11c"
FT   misc_RNA        660084..664108
FT                   /locus_tag="SPNCRNA.671"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        complement(660778..664180)
FT                   /locus_tag="SPNCRNA.672"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        complement(663144..663352)
FT                   /locus_tag="SPNCRNA.79"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           664310..664781
FT                   /gene="rad15"
FT                   /gene_synonym="rhp3"
FT                   /locus_tag="SPAC1D4.12"
FT   misc_RNA        complement(664677..665246)
FT                   /locus_tag="SPNCRNA.673"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        664782..667100
FT                   /transl_table=1
FT                   /gene="rad15"
FT                   /gene_synonym="rhp3"
FT                   /locus_tag="SPAC1D4.12"
FT                   /product="transcription factor TFIIH complex subunit Rad15"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.12.1"
FT                   /db_xref="GOA:P26659"
FT                   /db_xref="InterPro:IPR001945"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR010643"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC1D4.12"
FT                   /db_xref="PomBase:SPAC1D4.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26659"
FT                   /protein_id="CAA93221.1"
FT                   /translation="MKFYIDDLPILFPYPRIYPEQYQYMCDLKHSLDAGGIALLEMPSG
FT                   TGKTISLLSLIVSYQQHYPEHRKLIYCSRTMSEIDKALAELKRLMAYRTSQLGYEEPFL
FT                   GLGLTSRKNLCLHPSVRREKNGNVVDARCRSLTAGFVREQRLAGMDVPTCEFHDNLEDL
FT                   EPHSLISNGVWTLDDITEYGEKTTRCPYFTVRRMLPFCNVIIYSYHYLLDPKIAERVSR
FT                   ELSKDCIVVFDEAHNIDNVCIESLSIDLTESSLRKASKSILSLEQKVNEVKQSDSKKLQ
FT                   DEYQKLVRGLQDANAANDEDQFMANPVLPEDVLKEAVPGNIRRAEHFIAFLKRFVEYLK
FT                   TRMKVLHVIAETPTSFLQHVKDITFIDKKPLRFCAERLTSLVRALQISLVEDFHSLQQV
FT                   VAFATLVATYERGFILILEPFETENATVPNPILRFSCLDASIAIKPVFERFRSVIITSG
FT                   TLSPLDMYPKMLQFNTVMQESYGMSLARNCFLPMVVTRGSDQVAISSKFEARNDPSVVR
FT                   NYGNILVEFSKITPDGLVAFFPSYLYLESIVSSWQSMGILDEVWKYKLILVETPDPHET
FT                   TLALETYRAACSNGRGAVLLSVARGKVSEGVDFDHHYGRAVIMFGIPYQYTESRVLKAR
FT                   LEFLRDTYQIREADFLTFDAMRHAAQCLGRVLRGKDDHGIMVLADKRYGRSDKRTKLPK
FT                   WIQQYITEGATNLSTDMSLALAKKFLRTMAQPFTASDQEGISWWSLDDLLIHQKKALKS
FT                   AAIEQSKHEDEMDIDVVET"
FT   3'UTR           667101..667647
FT                   /gene="rad15"
FT                   /gene_synonym="rhp3"
FT                   /locus_tag="SPAC1D4.12"
FT   5'UTR           667815..668152
FT                   /gene="byr1"
FT                   /gene_synonym="ste1"
FT                   /gene_synonym="ste3"
FT                   /locus_tag="SPAC1D4.13"
FT   misc_RNA        complement(667910..669749)
FT                   /locus_tag="SPNCRNA.674"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        668153..669175
FT                   /transl_table=1
FT                   /gene="byr1"
FT                   /gene_synonym="ste1"
FT                   /gene_synonym="ste3"
FT                   /locus_tag="SPAC1D4.13"
FT                   /product="MAP kinase kinase Byr1"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.13.1"
FT                   /db_xref="GOA:P10506"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC1D4.13"
FT                   /db_xref="PomBase:SPAC1D4.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10506"
FT                   /protein_id="CAA93222.1"
FT                   /translation="MFKRRRNPKGLVLNPNASVKSSDNDHKEELINNQKSFESNVEAFM
FT                   EQCAHMNRRPAWISDLDNSSLEVVRHLGEGNGGAVSLVKHRNIFMARKTVYVGSDSKLQ
FT                   KQILRELGVLHHCRSPYIVGFYGAFQYKNNISLCMEYMDCGSLDAILREGGPIPLDILG
FT                   KIINSMVKGLIYLYNVLHIIHRDLKPSNVVVNSRGEIKLCDFGVSGELVNSVAQTFVGT
FT                   STYMSPERIRGGKYTVKSDIWSLGISIIELATQELPWSFSNIDDSIGILDLLHCIVQEE
FT                   PPRLPSSFPEDLRLFVDACLHKDPTLRASPQQLCAMPYFQQALMINVDLASWASNFRSS
FT                   "
FT   3'UTR           669176..669742
FT                   /gene="byr1"
FT                   /gene_synonym="ste1"
FT                   /gene_synonym="ste3"
FT                   /locus_tag="SPAC1D4.13"
FT   repeat_region   complement(669786..670131)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           670203..670378
FT                   /gene="tho2"
FT                   /gene_synonym="SPAC22F3.14c"
FT                   /locus_tag="SPAC1D4.14"
FT   CDS_pept        join(670379..670427,670483..675320)
FT                   /transl_table=1
FT                   /gene="tho2"
FT                   /gene_synonym="SPAC22F3.14c"
FT                   /locus_tag="SPAC1D4.14"
FT                   /product="THO complex subunit Tho2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1D4.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1D4.14.1"
FT                   /db_xref="GOA:Q09779"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="InterPro:IPR032302"
FT                   /db_xref="InterPro:IPR040007"
FT                   /db_xref="PomBase:SPAC1D4.14"
FT                   /db_xref="PomBase:SPAC1D4.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09779"
FT                   /protein_id="CAA93223.2"
FT                   /translation="MTSLPEKDQQGEVSVSENQKKLSEEWEPYIDKLVASNRTRDERVE
FT                   SIQELFQKCVIEEKLPVDIFFSIFSLAFERLEEKNTLASYVIDTLWLFDTEWIKNFHEG
FT                   SHDKAEKRLVSIGKGLKEFLPEEWLLSRLDCKFLENINVVPNGDFLNRKIVRTNTSLLY
FT                   RQKKFNLLREESEGFSHLMINFFDALTCLRNKSLNEDYLIVQVNKSIISTIGAFDLDPN
FT                   KVLDLILLLFSENLLDSWRFFLSILRNSPWGPNKERKFWNQLPDREKETFLNNLSNANG
FT                   IFNFDERFTNTKSIMSQVLGHNLQYMYKEDDENLESYFMMVALLIKYNFISIDNIWAHL
FT                   SPSDEELGKELGKYKDKLDEQTFKAKGNALTMAAPLPDDEIEDGETMDGQKAEAVPEIK
FT                   KAKPSQKLGLLKSLLSIGDLSSSLLILGRYPFLLRAYPELSNLYHKLLHISISSIYANY
FT                   SPLKLLPNDVRERLKQPKFIPEDSRLREITLRPPKEKNLVFSLDPFADRFNKTESEVFY
FT                   YFENYDEDIPILRNLTEFYNIAIPWLRLSGLALCHDPVIVTKLCRIGQKCVDNSSESRT
FT                   LWLDIIRSLLLPLITLIDVNTGLSYELFELLSKFDSSTRYALYGEWSSTSMKKFPELKL
FT                   QNSITEKETKGILRRLTKTNVKQFGRLLAKVCHSNPCTVFSIALNQIETYDNLVEVVVD
FT                   SARFITALDFDALTFIILSSFSNEFKKRLKSDGTSIAHWLQGLASFCGRVFRRYSSLDC
FT                   TSIVEYVIKQFKVNQMFDLVILKELLSQMTGLQPWTNLSDNQIQGAAGGPVLRQLSLSL
FT                   IYENPDVVRKSSMRLFNTLQKNGLATQLLVLLSQKYSTCIYDVTDENSHLKLISSLQDE
FT                   CSDVLYLLMEFLNMVCSPKSYYKLIPSFEQLIQDFHIQPQVAFYLSRYKNLDHSLTGSN
FT                   TEDAMDIDYENTSSPNTASNPVWSIDNSVITELLPKQIWDYFSPNFYLTFWKLSLYDVF
FT                   VPLERYEFERSRAFDQIRQTDAANTFYSRHRHDRQKIMQLSNSLQNELKEHINSLESVR
FT                   KVLQGDCVKWFIPNGVFPNGTRLEHARFNCARYLWTLCIAPRLKMSPHDALYCAKFVKL
FT                   LHSLGTPNFSTMSFLEILFNSQLPSFIFSMTQREADNFGRFLYEVLYDITSWYRDKILY
FT                   ERECLANGALPGFRLYWSDEQNDPDLSAVLPYNKFVLLFSKWHKYLTSYFESCLLSTEY
FT                   MHIYNSVIILEKILPCFPLIIESGSALKRAAERLKDEEKREDLKVLALGYFAKLSKKQP
FT                   EWVSFNSFSGTVRPSNSEKLQRPQQLSVAATSAVDSKTASISEEQAKIDKQKVALNPSA
FT                   PEFVPDSTPSDAVASETDNKNLVENKAVEKRVEARSSANERKQEERRRKTTPEGNRRAL
FT                   RTRTPTNEDIQRSDSKLREDQSRDRTPQSRSFTNENNDNLRSVSRHTRREPQQAQNLNA
FT                   RREHESQKSDRWRQNGNVNRNPRVSNNNSTNVSRERSSEANHRTSNDNKRDEVTEGKDK
FT                   NKRQDISGESNSRQNNAISRAGRSNGSNRGNDSRDADGRRSTHYASNKRPRSSDSQSPS
FT                   NLREEDERENSRRRARQDDRRDRDSRQQRDRPRDRTSRSAREEKRRKIQ"
FT   3'UTR           complement(673984..675538)
FT                   /gene="tsc1"
FT                   /locus_tag="SPAC22F3.13"
FT   3'UTR           675321..675444
FT                   /gene="tho2"
FT                   /gene_synonym="SPAC22F3.14c"
FT                   /locus_tag="SPAC1D4.14"
FT   CDS_pept        complement(675539..678238)
FT                   /transl_table=1
FT                   /gene="tsc1"
FT                   /locus_tag="SPAC22F3.13"
FT                   /product="hamartin"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.13.1"
FT                   /db_xref="GOA:Q09778"
FT                   /db_xref="InterPro:IPR007483"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4KK0"
FT                   /db_xref="PDB:4KK1"
FT                   /db_xref="PomBase:SPAC22F3.13"
FT                   /db_xref="PomBase:SPAC22F3.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09778"
FT                   /protein_id="CAA91078.1"
FT                   /translation="MPLQSLVKALWNVLHEEESEGYPDLTELIAEVESYQQRYPKQNPT
FT                   NSQKIRHILDEIYEKTPFNNTRRRILWLAVLKTVIPLLILDRQAVGEWWDQIFFPFLNS
FT                   PTQLKPVFSDLKSILFYILIFHDEDEWGGDLRRECAEETITRLVDLYVSKAIENLGDVE
FT                   SQEQRNQTIECLVNVLVHYGIQRPKELSSCFCHHFLNPPTRIPILSVMVEVIRRQGPRL
FT                   YEIPQTGFYDLVLKCAEFDTSPILLSYALSFILMILSHICNSLDDSLYRLFCIYLRFSM
FT                   IDPTSGFPSSTASGNWEVFHDFMSTYASTTTSQTDSSYNDVHDIVGSSQPDYLESLDYS
FT                   QLFSILYALYPINFLEFLRDPKLYASKHNFQIRYSFNQELLSTKSDGLLGRHLAHSNFL
FT                   KYTAETELTDKSRWTRLDSIAVVALCNSLNAVGIAESVMDPFGGKLPTTYEETSSATGL
FT                   LAYPNESHDIASEPFSISWPQNPSISGSVHSATTFDKAQLSNTEDSYDNISHGTSYSEG
FT                   VSSIHMVKGERGSNNLELTSESLSSTNDTIRRLQRDLLFLQNELRFEKFVRQQHLQNIG
FT                   KLHREHILDMAVESERQKLLLTNKRYKAQIELLNSEIDKHRSESQAALNRRVKWENDFN
FT                   NKIKALREEKKAWKSEESELKSSIESLISQLESIRNSQIDIAFSKNQLELKLQLYETKL
FT                   KEYEQHLSCVNISKKQVSSSSDTSFGNTKMDSSMILSNSEAVSDEQERELIESEKHRMK
FT                   LESENLHLQANIELLKKDLEAINVVYEAKIFDLEKRLSSEANAPELHNPVNLNYDAQLS
FT                   KISEIKENYDELLTRYRELEGKFLESQAEVEELKNFQKPLVDTGSSIHSSPGLQQSKFI
FT                   IRNDSLHPKVGPPRRQSTDTSRSTFRQY"
FT   5'UTR           complement(678239..678307)
FT                   /gene="tsc1"
FT                   /locus_tag="SPAC22F3.13"
FT   misc_RNA        complement(678571..680480)
FT                   /locus_tag="SPNCRNA.675"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        678585..679442
FT                   /gene_synonym="SPNG118-19"
FT                   /locus_tag="SPNCRNA.158"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           679062..680175
FT                   /gene="rgs1"
FT                   /locus_tag="SPAC22F3.12c"
FT   CDS_pept        680176..681621
FT                   /transl_table=1
FT                   /gene="rgs1"
FT                   /locus_tag="SPAC22F3.12c"
FT                   /product="regulator of G-protein signaling Rgs1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.12c.1"
FT                   /db_xref="GOA:Q09777"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="PomBase:SPAC22F3.12c"
FT                   /db_xref="PomBase:SPAC22F3.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09777"
FT                   /protein_id="CAA91077.1"
FT                   /translation="MPALHNPSSPPPSYEAVTSYRNGNSIDSGDKRQQCSRLMKITSNG
FT                   RPYSKDFLELFSTMVISTNFSRNRYRFSYVENSCTLLQLLSTLENLQLSQVNRIKSRCG
FT                   SKVLKSTTKFTIPKTAAKCLCNTFLNARLLQIVNNPSARKFSNEKCLLQLTRKGYSVVS
FT                   EFLQHNGHNSQAELYASKWNHSAPVIVSISRFSSTDQILKDSSFCEMLLVRMLGSVHEI
FT                   GKSKNPLLVPVYSVSSPSPKDSLSKVTKYQMFGIDIAEWLMCNTMLLDWSEMETVASDL
FT                   LIHSYIAYENNSETPLKFSYAKGVSYFLTGKGIATLGWTKNVSNNKLINKINEVEKGST
FT                   NKEILETILRKPNLQTYFFEFLKKNFCDENQRFYSEVCEFNDYFSHANETNDHEAIRES
FT                   FAHACGIYNCFLSSNAPNAVNLPSDLYEKITNHMALAMEVEPLNEWLQLIHILLLEAQT
FT                   AVLDLMAGDSLLKFLELNGGLGI"
FT   3'UTR           681622..681890
FT                   /gene="rgs1"
FT                   /locus_tag="SPAC22F3.12c"
FT   5'UTR           682835..682873
FT                   /gene="snu23"
FT                   /locus_tag="SPAC22F3.11c"
FT   CDS_pept        join(682874..683034,683102..683109,683160..683446)
FT                   /transl_table=1
FT                   /gene="snu23"
FT                   /locus_tag="SPAC22F3.11c"
FT                   /product="U4/U6 x U5 tri-snRNP complex subunit Snu23
FT                   (predicted)"
FT                   /db_xref="GOA:Q09776"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09776"
FT                   /protein_id="CAA91076.3"
FT                   /translation="MDRYNPPRRNGNSKKNEVVITGGRTQRIDFEKDVNKTTILPRWSF
FT                   GRPKRPWSCTQHLRKTRTVIIEKRATLEEVKERMEYWRRQLLEPEKGSEEYSLKERVER
FT                   YHQELEAKKLRRKQKKVNKEKNSPRLVGENTELAAIMGISSFGSTNL"
FT   3'UTR           683447..683660
FT                   /gene="snu23"
FT                   /locus_tag="SPAC22F3.11c"
FT   5'UTR           683990..684009
FT                   /gene="gcs1"
FT                   /gene_synonym="apd1"
FT                   /locus_tag="SPAC22F3.10c"
FT   CDS_pept        join(684010..684093,684345..686270)
FT                   /transl_table=1
FT                   /gene="gcs1"
FT                   /gene_synonym="apd1"
FT                   /locus_tag="SPAC22F3.10c"
FT                   /product="glutamate-cysteine ligase Gcs1"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.10c.1"
FT                   /db_xref="GOA:Q09768"
FT                   /db_xref="InterPro:IPR004308"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="PomBase:SPAC22F3.10c"
FT                   /db_xref="PomBase:SPAC22F3.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09768"
FT                   /protein_id="CAA91075.1"
FT                   /translation="MGLLVLGTPLDWPESKKYCDYVRENGIMQFLHMYDTYISKKQDVL
FT                   LWGDEIECIVVSMDDKSKKARVSLRQEDILNALGKYEETFRHVDFGPVYAALRNETCPK
FT                   KIDAILSEVAKNPADYVERIGGNSNKDTIEITSSTKPHAQNAVPTFHPEYGRYMLESTP
FT                   GAPYGSTLKDFTFVEYNMRLRRKIIENHLLPNELPLTITNFFRLGTPGFTDPEVEANGA
FT                   ISRSFFLPDDVINTHVRFPTLTANIRQRRGRKVAMNVPIFFDKNTIKPFHDPTVPWDRN
FT                   LFPEDANARDGAALDNHIYMDSMGFGMGCCCLQITFQAKSCDEARLLYDQLTPITPLML
FT                   ALSAGTPAFRGYLADQDCRWNVIAGAVDDRTEEEMKTVPKSRYDSVDLYISNDKRNLPE
FT                   YNDVPVVINQDCYDKLIKDCIDERLAKHMAHIFSRDPLVIFSDSILQDNSVSNAHFENL
FT                   NSTNWQSMRFKPPPPGSDIGWRVEFRSMEIQITDFENAAYSIFVVMLSRAILSFNLNLY
FT                   MPISLVDENMKAAHARDAIHRKKFWFRCNPFPDASTDDESGQFRQLTIDELFNGEHREN
FT                   GFPGLITIVRSYLYSCNPDAKTICLIERYIRLISQRANGQCLTAASWIRNFITTHPSYK
FT                   QDSVVNDEINYDLIRRIAKIVDGDYDDTLLGKCS"
FT   3'UTR           686271..686347
FT                   /gene="gcs1"
FT                   /gene_synonym="apd1"
FT                   /locus_tag="SPAC22F3.10c"
FT   5'UTR           686543..686592
FT                   /gene="res2"
FT                   /gene_synonym="mcs1"
FT                   /gene_synonym="pct1"
FT                   /locus_tag="SPAC22F3.09c"
FT   CDS_pept        join(686593..686824,686989..688730)
FT                   /transl_table=1
FT                   /gene="res2"
FT                   /gene_synonym="mcs1"
FT                   /gene_synonym="pct1"
FT                   /locus_tag="SPAC22F3.09c"
FT                   /product="MBF transcription factor complex subunit Res2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.09c.1"
FT                   /db_xref="GOA:P41412"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR029793"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="PomBase:SPAC22F3.09c"
FT                   /db_xref="PomBase:SPAC22F3.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41412"
FT                   /protein_id="CAA91074.1"
FT                   /translation="MAPRSSAVHVAVYSGVEVYECFIKGVSVMRRRRDSWLNATQILKV
FT                   ADFDKPQRTRVLERQVQIGAHEKVQGGYGKYQGTWVPFQRGVDLATKYKVDGIMSPILS
FT                   LDIDEGKAIAPKKKQTKQKKPSVRGRRGRKPSSLSSSTLHSVNEKQPNSSISPTIESSM
FT                   NKVNLPGAEEQVSATPLPASPNALLSPNDNTIKPVEELGMLEAPLDKYEESLLDFFLHP
FT                   EEGRIPSFLYSPPPDFQVNSVIDDDGHTSLHWACSMGHIEMIKLLLRANADIGVCNRLS
FT                   QTPLMRSVIFTNNYDCQTFGQVLELLQSTIYAVDTNGQSIFHHIVQSTSTPSKVAAAKY
FT                   YLDCILEKLISIQPFENVVRLVNLQDSNGDTSLLIAARNGAMDCVNSLLSYNANPSIPN
FT                   RQRRTASEYLLEADKKPHSLLQSNSNASHSAFSFSGISPAIISPSCSSHAFVKAIPSIS
FT                   SKFSQLAEEYESQLREKEEDLIRANRLKQDTLNEISRTYQELTFLQKNNPTYSQSMENL
FT                   IREAQETYQQLSKRLLIWLEARQIFDLERSLKPHTSLSISFPSDFLKKEDGLSLNNDFK
FT                   KPACNNVTNSDEYEQLINKLTSLQASRKKDTLYIRKLYEELGIDDTVNSYRRLIAMSCG
FT                   INPEDLSLEILDAVEEALTREK"
FT   intron          686825..686988
FT                   /gene="res2"
FT                   /gene_synonym="mcs1"
FT                   /gene_synonym="pct1"
FT                   /locus_tag="SPAC22F3.09c"
FT   3'UTR           688731..689179
FT                   /gene="res2"
FT                   /gene_synonym="mcs1"
FT                   /gene_synonym="pct1"
FT                   /locus_tag="SPAC22F3.09c"
FT   5'UTR           689345..689482
FT                   /gene="rok1"
FT                   /locus_tag="SPAC22F3.08c"
FT   CDS_pept        689483..690928
FT                   /transl_table=1
FT                   /gene="rok1"
FT                   /locus_tag="SPAC22F3.08c"
FT                   /product="ATP-dependent RNA helicase Rok1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.08c.1"
FT                   /db_xref="GOA:Q09775"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC22F3.08c"
FT                   /db_xref="PomBase:SPAC22F3.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09775"
FT                   /protein_id="CAA91073.1"
FT                   /translation="MDALKLLTTNVKFKNKVPQPSIKEKEAKKLQGITKGKAKVTGNNP
FT                   VDPIEEFPEGILCENLKKQNITECTTIQRYAIPTIGSKRDLLACAPTGSGKTIAYLFPI
FT                   LQKLQLHVPGGYRAIIVAPTRELCEQIYRQAEKLSFGTSLKIIELSKSNEKIQEKAPKL
FT                   REKYDMCIGTPMRLVQAIQTGLSFEKVEFFVMDEADRLFEPGFIEQTDHILSACTSSNI
FT                   CKSLFSATIPSRVEELAKVVTVDPIRIIVGLKDAATDSIDQRLLFVGSDTSKIVILRQM
FT                   ISNGELKPRVVIFVQDIERAKALYTELLFDEIHVGVIHGELPQAKREEALAKFRKGEIW
FT                   VLIATDLLARGIDFHGVKMVINFDFPQSVHSYIHRIGRTGRAGNTGQAVTFFTKEDGEY
FT                   IKLIAGVMRSSGCEVPNWVMALPKPSKEMKKKLKKSPPKRKRITTRASYDRQKEQRKKE
FT                   YIKKVKKEASIKKHNEATGDSGQ"
FT   3'UTR           690929..691122
FT                   /gene="rok1"
FT                   /locus_tag="SPAC22F3.08c"
FT   5'UTR           691472..691529
FT                   /gene="atp20"
FT                   /locus_tag="SPAC22F3.07c"
FT   CDS_pept        join(691530..691656,691706..691803,691853..691984)
FT                   /transl_table=1
FT                   /gene="atp20"
FT                   /locus_tag="SPAC22F3.07c"
FT                   /product="F0-ATPase subunit G (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.07c.1"
FT                   /db_xref="GOA:Q09774"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="PomBase:SPAC22F3.07c"
FT                   /db_xref="PomBase:SPAC22F3.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09774"
FT                   /protein_id="CAA91072.1"
FT                   /translation="MFSTSRIISRINYNFLRKSHYSTKTVAEQAKGRFTPLIQKLSAVQ
FT                   QPIMYWANVSKELVQQVYHSQKIAPPSNTHSPFLFWKSQSSEAWGRNFFIAVEIVGIFC
FT                   AGQMVGRRKITPYH"
FT   3'UTR           691985..692077
FT                   /gene="atp20"
FT                   /locus_tag="SPAC22F3.07c"
FT   CDS_pept        join(692567..692725,692849..693061)
FT                   /transl_table=1
FT                   /locus_tag="SPAC22F3.15"
FT                   /product="GatB/YqeY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.15.1"
FT                   /db_xref="GOA:C6Y4B8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="PomBase:SPAC22F3.15"
FT                   /db_xref="PomBase:SPAC22F3.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6Y4B8"
FT                   /protein_id="CBA11491.1"
FT                   /translation="MYNTYAIIVHVSKLRNSHLFANASAIPNLQAVIRKKLLDSMKSRQ
FT                   KDVASTLKVFLSEIEYANKSSKPVTTDLDVLRVLKKNIKKRKQAIEQFRKAERLDLAEK
FT                   EESQIQTLRQFLPEHASNI"
FT   5'UTR           693514..693830
FT                   /gene="lon1"
FT                   /locus_tag="SPAC22F3.06c"
FT   CDS_pept        693831..697034
FT                   /transl_table=1
FT                   /gene="lon1"
FT                   /locus_tag="SPAC22F3.06c"
FT                   /product="Lon protease homolog Lon1 (predicted)"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.06c.1"
FT                   /db_xref="GOA:Q09769"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027503"
FT                   /db_xref="PomBase:SPAC22F3.06c"
FT                   /db_xref="PomBase:SPAC22F3.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09769"
FT                   /protein_id="CAA91071.1"
FT                   /translation="MITRLSGACLRRSGAKRNWPREHLVHRSLLASFSTTQRVLKCSVG
FT                   PFRTSNVVFKSKEPKDNKPLDNKNDPKKTHNEDESHTNESLPSTDKKKKKDNDDFKQNL
FT                   KSSSNKTEEKYSATQASKSKNDEFELGGEENEDEMPLNGEFNKNVPAKYSVPDVYPQLL
FT                   ALPIARRPLFPGFYKAIVTKNPSVSEAIKELIKKRQPYIGAFLLKDENTDTDVITNIDQ
FT                   VYPVGVFAQITSIFPAKSGSEPALTAVLYPHRRIRITELIPPKEDADSAASSDAAELET
FT                   DKSSNLSSNGEVKSDLKQDNGKEEPEKEVESTPSILQNFKVSLVNVENVPNEPFKRQDP
FT                   VIKAVTSEIMNVFKDIANVSPLFREQIANFSISQTSGNVFDEPAKLADFAAAVSAADHR
FT                   ELQEVLEATNIGDRLQKALYVLKKELLNAQLQHKINKEIEQKITQRHKEYLLTEQLKQI
FT                   KRELGQELDSKEALVTEFKKRTESLSMPDHVKKVFNDELSKFQHLEPMAAEFNITRNYL
FT                   DWITQLPWGKRSVENFDLDHAKEVLDRDHYGLKDVKDRVLELVAVGKLRGTMQGKIMCL
FT                   VGPPGVGKTSVGKSIASALNREFFRFSVGGLTDVAEIKGHRRTYIGAMPGKIVQALKKV
FT                   QTENPLILIDEIDKVGKSHQGDPASALLELLDSEQNSAFLDYYMDIPLDVSSVLFVCTA
FT                   NTIDTIPPPLLDRMEVIELSGYVSAEKVNIAKGYLIPQAKAACGLKDANVNISDDAIKG
FT                   LISYYAHESGVRNLKKSIEKIFRKTSFSIVKEIDDELNSKEKSTGKSGKKTSPQSSEDA
FT                   ANKEASSVPLKVPDKVNIEIEEKDLTKYLGPPIYTSQRLYDTTPPGVVMGLGWTPMGGV
FT                   SMYVETIVKNILSSNSTPSLERTGQLGDVMKESSEISYSFSKSFLSKHFPNNKFFEHAR
FT                   LHMHCPEGSISKDGPSAGITMATSLLSLALDTPVPATTAMTGELTLTGKILRIGGLREK
FT                   TVAAKLSGMKEILFPKSNLADWEQLPDYVKEGLTGVPVAWYDDVFKRVFSNIDAEKCNN
FT                   LWPNLIKSSSKQHQISPSH"
FT   3'UTR           697035..697130
FT                   /gene="lon1"
FT                   /locus_tag="SPAC22F3.06c"
FT   5'UTR           697191..697290
FT                   /gene="alp41"
FT                   /locus_tag="SPAC22F3.05c"
FT   misc_RNA        complement(697195..697871)
FT                   /locus_tag="SPNCRNA.676"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        join(697291..697355,697401..697455,697496..697568,
FT                   697621..697766,697805..697885,697928..698068)
FT                   /transl_table=1
FT                   /gene="alp41"
FT                   /locus_tag="SPAC22F3.05c"
FT                   /product="ADP-ribosylation factor Alp41"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.05c.1"
FT                   /db_xref="GOA:Q09767"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC22F3.05c"
FT                   /db_xref="PomBase:SPAC22F3.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09767"
FT                   /protein_id="CAA91070.1"
FT                   /translation="MGLLTILRQQKLKEREVRVLLLGLDNAGKTTILKCLLNEDVNEVS
FT                   PTFGFQIRTLEVEGLRFTIWDIGGQKTLRNFWKNYFESTEAIIWVVDSLDDLRLEECRN
FT                   TLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKILNISKYKSSHWRIFSVSALTGL
FT                   NIKDAISWLANDLKEIKLGTIDY"
FT   3'UTR           complement(697960..698032)
FT                   /gene="mug62"
FT                   /locus_tag="SPAC22F3.04"
FT   CDS_pept        complement(join(698033..698177,698223..698441,
FT                   698480..698841,698884..699104,699148..699363,
FT                   699410..702533))
FT                   /transl_table=1
FT                   /gene="mug62"
FT                   /locus_tag="SPAC22F3.04"
FT                   /product="AMP binding enzyme (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.04.1"
FT                   /db_xref="GOA:Q09773"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR037337"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="PomBase:SPAC22F3.04"
FT                   /db_xref="PomBase:SPAC22F3.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09773"
FT                   /protein_id="CAA91069.1"
FT                   /translation="MKPSENEKIHPVRHSKYEDKSKLPFETIPDPVLKYVKRARDAELQ
FT                   PQLAKVSQKLFADISTATAAEKLQFTVPRRARFEINDPRNPTFSMMALQDIISVLEYRR
FT                   NKNPTSTAHICIDKKGKEAVSYSWDKILNRAKQFASVAQNHVGLKPGTRVILYYRKSEA
FT                   SEYIISIFGCLLLGIVVIPLSPSSSSESLKLVVNEEKVRVAFTTEATYRIFIKDTEVNN
FT                   AKSLAWWKSNDFTNYKFEQIKQYRMRANDTVLIDYTFSSSTYNDIKAVYTTKTFLSQMR
FT                   NLTSSMITNPARQAGWKLHNFEDSKDVLITNFHPSMPLGLIMGVFNSVFAGYCTIFCDE
FT                   EVLKTPGLLAYLITKYRCTYSLFDYAGLKQTVYNYQEDPKSTLSFKKNYTPNLSSLKLC
FT                   MVECEVVDPEFNIIVSDRWLQPLGTNNSKEVITPILCLRKFGGIPISFKDWMISYTNRQ
FT                   KHERQMADTCYQEILVLKSSIEKEKVEIVPFLDIRKYSPNEVLCMSPFWYPIPEASVAV
FT                   VNEDSKNICKVGEVGEIWVYSDCLPKLKAASVINNPQGEQLTDYENNQENKFEKNNSFM
FT                   DSGLKGFLHNEKIFVLGNKDEQIRQYRKTMVADKLMEEKYVHYSHYLIKKIMKYVPEIF
FT                   DGVAFEIEIDKAVYSVLVLESPIIKRSLIRNNRLKGRDLFSELVKITESSFQVTQDIFK
FT                   LDVLSILIAPYKSLPRSRYMGIQAINTNKCKLAFLSGNLPVSYVRFFMDSALPKSKINL
FT                   NNSKGIWSKDASKHHREIISLNVKQKMDPYKHQNKVSKARENLLNHFTILDFLKTKSAK
FT                   TPTSPAILTFNAIEKTKVELTWAHFELKVASHVEYMQLSVKAKARSHILLLYYDPLEFL
FT                   ISIHSCFHLGVIPIPFQIREISQLIGEIEEFTKIAKAFNVEAILVDHKVLISLKSRDIS
FT                   NHFQQTCIDLNMKAPKIFETTGIPISKRAKKALNLITPGELNNKGKVALISINKLEDGS
FT                   IIPTQFSHSSLLAFCHEQKEFVIGNEEKPIIGGIEFSSGMGLLHTALLGVYAGVPTLLI
FT                   KQENLCNNGSLLFEAIEQNSLSKVMIPLNICQKSFSTAQGCNSIVINSTLSSIIVPCYD
FT                   RPISSRVNSIIEDIARIGLAPNKVKLAYSHPINPFVCWNADSSMEKMKDYFDANQLRSG
FT                   LVNVREDVLRNRQPLLYGSGTSTLYNEICIVHPEEKYICQEGEIGEIWINGKHGSYCEN
FT                   NELNSGCELLVQETLDKKSYSRTGQLGFIHHLKKKDQNMEKVPVLYTLDFIWNTLELNG
FT                   LNHSVKDIEETIELVHPNICTDGCILFQASGSVVILLEVHSQQKFASLIPIIVATALAA
FT                   HEIILDCVAFVPKGTFLRRPTGEKRRADILKQWTGGDLKHMTSYLIRQDFLLNEDFVGT
FT                   ELIGTTDSYDYSDENLIINSSQLNLL"
FT   3'UTR           join(698069..701453,701508..703040)
FT                   /gene="alp41"
FT                   /locus_tag="SPAC22F3.05c"
FT   tRNA            complement(703075..703147)
FT                   /locus_tag="SPATRNAVAL.02"
FT                   /product="tRNA Valine"
FT   5'UTR           703669..703788
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   CDS_pept        join(703789..703967,704015..704113,704205..704280,
FT                   704322..704536,704573..704763,704816..704889,
FT                   704925..705056,705095..705158,705195..705293,
FT                   705333..705490,705529..705601,705637..706252,
FT                   706292..706361,706404..706652,706688..706828)
FT                   /transl_table=1
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT                   /product="ATP-dependent DNA helicase Rdh54"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.03c.1"
FT                   /db_xref="GOA:Q09772"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="PomBase:SPAC22F3.03c"
FT                   /db_xref="PomBase:SPAC22F3.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09772"
FT                   /protein_id="CAA91068.3"
FT                   /translation="MKRRATFQCPLIESTIKHQSTNYTKTETATTSHEVSENANEHKGK
FT                   SNIDINKIAYYNVVWRKITMKKHKTWEGDGFLVREDSNLTLYNSDFTRLGSCHSRVPQI
FT                   KEGELLRISGKEISIEKEISAESYEAGTHIDDSLRDVHMPEMKRKFKPPLRPNTMYQTI
FT                   SALPKPRHDPTVLGALVMSRPKTWDPRTHVDVVIDPFLSKHLYSHQREGVSFLYDCLLG
FT                   MEGKCGYSAILADEMGLGKTLQTITVVWTLLKQSYYANRSSTINNAMVVAPVTLLKNWE
FT                   NEFYNWLGHERIHVYIARCAEDFQEFTSNKTYSIIITGYETVCTYLRNYGCGIDIDLLI
FT                   CDEAHRLKSMSSQTWITLNKLKTRKRLLLTGTPLQNDLSEYFSMVNFIIPGSLGTPNSF
FT                   KAQYERPILRSRSMNASSRDISLGAARLQRLFEFTSNFTLRRKANILAKHLPPRTDIVL
FT                   FIKPTHQQENVYGHVLDGFKSSVDQKGYYLKILTRLSKICNSTILLRNEKENFLSTELQ
FT                   DKHVFEQENMLLSSSKLQILAALLKSFQRGCQKAVIVSQYKETLELIELFLSILHVRFC
FT                   KLLGSTPFSERDLIVHNFNTSSFKEFSVLLLSSKAGGCGLNLTGSTRLIIYEPSWNPAQ
FT                   DLQALSRIYRSGQKRPVCIYTFLSSGMLDERIFIRQNTKQGLSSSFIDSDASQKKNFFT
FT                   GEDIKTLFSYSKTETCLTYELAFDSDEIDSLTKKKDPLTKIDHTIDSPNTKEKDKEISS
FT                   WKKASEYMDTNLGKKCPENAFQGWTWQFPNDLSIMNGVEDYIPLEPLPINCLMHKKFE"
FT   intron          703968..704014
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          704114..704204
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          704281..704321
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          704537..704572
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          704764..704815
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          704890..704924
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   3'UTR           complement(705042..706843)
FT                   /gene="atf31"
FT                   /locus_tag="SPAC22F3.02"
FT   intron          705057..705094
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          705159..705194
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          705294..705332
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          705491..705528
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          705602..705636
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          706253..706291
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          706362..706403
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   intron          706653..706687
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   3'UTR           706829..707990
FT                   /gene="rdh54"
FT                   /gene_synonym="tid1"
FT                   /gene_synonym="mug34"
FT                   /locus_tag="SPAC22F3.03c"
FT   CDS_pept        complement(706844..707473)
FT                   /transl_table=1
FT                   /gene="atf31"
FT                   /locus_tag="SPAC22F3.02"
FT                   /product="transcription factor Atf31"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22F3.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22F3.02.1"
FT                   /db_xref="GOA:Q09771"
FT                   /db_xref="InterPro:IPR002112"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="PomBase:SPAC22F3.02"
FT                   /db_xref="PomBase:SPAC22F3.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09771"
FT                   /protein_id="CAA91067.1"
FT                   /translation="MTYETNTPTEESIIPKHEDGEEYNSIYLSRFEKDISISQTLDFSQ
FT                   FMQTQILLTAKRKALELGDDRSPINNDPYNIRRSDFDELSEYTASKSPSIISEASHNSP
FT                   SRELDDSGDENTSKLTGTKQSMLKARNRQAAQKCRIKKKKYLQTLQDQVNYYTSENKEL
FT                   LQSANDLREEIIKLRTLVFAHRDCPVSKACSKALFLMGKEKPLTPP"
FT   5'UTR           complement(707474..708014)
FT                   /gene="atf31"
FT                   /locus_tag="SPAC22F3.02"
FT   3'UTR           complement(707948..708054)
FT                   /gene_synonym="SPAC22F3.01"
FT                   /locus_tag="SPAC1296.01c"
FT   CDS_pept        complement(join(708055..708127,708168..708931,
FT                   708979..709339,709428..709644,709745..709830,
FT                   709896..710023))
FT                   /transl_table=1
FT                   /gene_synonym="SPAC22F3.01"
FT                   /locus_tag="SPAC1296.01c"
FT                   /product="phosphoacetylglucosamine mutase (predicted)"
FT                   /EC_number="5.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1296.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1296.01c.1"
FT                   /db_xref="GOA:Q09770"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="PomBase:SPAC1296.01c"
FT                   /db_xref="PomBase:SPAC1296.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09770"
FT                   /protein_id="CAA91066.2"
FT                   /translation="MSDAEDSDSIVNEFVTAIVRESDKFAKVHSYPMQYGTGGYRADAE
FT                   LLSSVAFRTGVIASFLSAKLHGQPVGLMVTASHNASSENGLKIVNILSSLDSSKWEAYL
FT                   DQVVNADSADELTVCLTSILKKAKIIPGSEARVFVGYDSRSTSEILAQAVIDGIVVCKA
FT                   KYENFGLLTTPQLHYMVKASQTYGTPDAIGEPTERGYFEKLSKAYQSLMTGKKIKGTVL
FT                   IDAANGVGAAKIKELAKYIDPKLFPIEIVNDNIDNPELLNNSCGADFVRTQQKPPNGIS
FT                   APKHARCASFDGDADRIVYFAFGSHSFHLLDGDKICALFAQFLIDLIRSTGLDLQVGIV
FT                   QTAYANGASTAFFQKTLKVPVLCVSPGLKHLYHAAQAYDVGVFFEANGHGTILVSHAAL
FT                   SKIISHEVLSPAQFNALKTLKTVFELINQTDGDAITNLLLVEVILAHKNCTLKEWNQLY
FT                   SEIPSRLIRCEVEDRSIYTTTDAEQKLVTPEGLQEKIDALVAKYTGGRAFVRSSGTEDA
FT                   VRVYAEASSRGESEDLALRIVELLH"
FT   5'UTR           complement(join(710024..710366,710413..710479))
FT                   /gene_synonym="SPAC22F3.01"
FT                   /locus_tag="SPAC1296.01c"
FT   5'UTR           711238..711300
FT                   /gene="cox4"
FT                   /locus_tag="SPAC1296.02"
FT   CDS_pept        join(711301..711412,711768..712150)
FT                   /transl_table=1
FT                   /gene="cox4"
FT                   /locus_tag="SPAC1296.02"
FT                   /product="cytochrome c oxidase subunit IV (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1296.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1296.02.1"
FT                   /db_xref="GOA:P79010"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="InterPro:IPR020893"
FT                   /db_xref="InterPro:IPR036972"
FT                   /db_xref="PomBase:SPAC1296.02"
FT                   /db_xref="PomBase:SPAC1296.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79010"
FT                   /protein_id="CAB36508.1"
FT                   /translation="MFMNSMLRVSRQRAAVRSTVSLYRGFVSASIRRNEQNVVKAAAQE
FT                   LANAKEPSDLIGPGGRDGEVPTDLEQATGLERYELLSELSGRDAFDMKPLDASRKGTLT
FT                   DPIMVTSLDPYRHIGCTGSPSGSHNLIWMTVYKDKLRRCPECGSVYKLKFMGDPNAEHS
FT                   H"
FT   intron          711413..711767
FT                   /gene="cox4"
FT                   /locus_tag="SPAC1296.02"
FT   3'UTR           712151..712354
FT                   /gene="cox4"
FT                   /locus_tag="SPAC1296.02"
FT   3'UTR           complement(712217..712490)
FT                   /gene="sxa2"
FT                   /locus_tag="SPAC1296.03c"
FT   CDS_pept        complement(712491..714014)
FT                   /transl_table=1
FT                   /gene="sxa2"
FT                   /locus_tag="SPAC1296.03c"
FT                   /product="serine carboxypeptidase Sxa2"
FT                   /EC_number="3.4.16.5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1296.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1296.03c.1"
FT                   /db_xref="GOA:P32825"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="PomBase:SPAC1296.03c"
FT                   /db_xref="PomBase:SPAC1296.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32825"
FT                   /protein_id="CAB36509.1"
FT                   /translation="MLSLFLKSLFAIIIIELTIIHALPTYTVHWKCSIQQANTSSASSN
FT                   QTVQPRQHAAPSSDRIKSLPEFKGSLPELYSGYLEANSDKSLFYTYAPAVVDSETFIVW
FT                   LQGGPGCAGTLGFFSENGPIEISQSSPSPSLNPESWTNFANMLWLDQPFGTGYSQGQAA
FT                   YTTTIEEASSDFVNALKSFYQKFPHLMKKKLYLVGESYGSIWSANFAEALLSEPSLNIN
FT                   FMGVGIVSGLTADYETQEQITASIWVEHISKLGYYFNNTSSTISEEFKKRNKECQYDSV
FT                   LNRLTFPTEQYPIWRPEYNFSTSTSLRKREALDGEDIGNVFNSISGCDLYSLSNFLLYL
FT                   ENSCVITYDVSLDCSFNEYNDPLITYLNREDVRSSLHATKASTALTSGEGVFADGCNFD
FT                   LYKKIVSNNVESVLVEIIPRLTEKYKVSFLAGALDLQILWTGTLLALQNTTWNGWQGFT
FT                   QSPGSLETTNGFTLDERNLAFTLSNSVGHMAPSKDPQMVREWLENTLLY"
FT   5'UTR           complement(714015..714070)
FT                   /gene="sxa2"
FT                   /locus_tag="SPAC1296.03c"
FT   5'UTR           715377..715479
FT                   /gene="mug65"
FT                   /locus_tag="SPAC1296.04"
FT   CDS_pept        join(715480..715535,715583..715721,715994..716146,
FT                   716223..716621)
FT                   /transl_table=1
FT                   /gene="mug65"
FT                   /locus_tag="SPAC1296.04"
FT                   /product="spore wall assembly protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1296.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1296.04.1"
FT                   /db_xref="GOA:O94611"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="PomBase:SPAC1296.04"
FT                   /db_xref="PomBase:SPAC1296.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94611"
FT                   /protein_id="CAB36510.3"
FT                   /translation="MTESERTSHLDILYENQRGIMLCGVPYFSEKSLLNFDPAPWVDQH
FT                   FVASPVSTKTATCPDPSWEWAWQRWYIDMSGDVDESGWQYGFSFTMNNWHGKPVSLHSF
FT                   VRRRRWIRKRKKKELRRDELPLVPESFTISSSYPIQRSSTQTRSSFEDDSSDFDLSEVT
FT                   TIPALLRALQDSRIDREKLEALATFLASASIDEKVYVKNCKKDLLKNFVFEHSCRKANE
FT                   LLNASLTAAEASTSQVALRESPTPQD"
FT   intron          715536..715582
FT                   /gene="mug65"
FT                   /locus_tag="SPAC1296.04"
FT   intron          715722..715993
FT                   /gene="mug65"
FT                   /locus_tag="SPAC1296.04"
FT   3'UTR           716622..716978
FT                   /gene="mug65"
FT                   /locus_tag="SPAC1296.04"
FT   3'UTR           complement(716874..716939)
FT                   /locus_tag="SPAC1296.05c"
FT   CDS_pept        complement(join(716940..717585,717674..717804))
FT                   /transl_table=1
FT                   /locus_tag="SPAC1296.05c"
FT                   /product="cyclin L family cyclin (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1296.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1296.05c.1"
FT                   /db_xref="GOA:O94612"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="PomBase:SPAC1296.05c"
FT                   /db_xref="PomBase:SPAC1296.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94612"
FT                   /protein_id="CAB36511.1"
FT                   /translation="MADSLVHSLASSSQLEAFDSFEYAEELCTLGSEWIQEAGVLLNLT
FT                   QNCVIVCLILFRRYCTLYPPRVPDLDAIVMACVSIGSKTTETPASVQDICNVVVYLKER
FT                   FKDTNFEARGFIAHDLYSEEMYSSRNRLSNMELEVLRALNFDTHIVIPHKLAIHYLQTL
FT                   QLIDNKKLLQITWNFLNDASRTRLCVLYPPFSLACGCIAMAARVIGMKLPKDWYRVFDT
FT                   TKEEIDSLTSILENFYKTSAIAHKTLYLIFTEQVSA"
FT   5'UTR           complement(717805..718168)
FT                   /locus_tag="SPAC1296.05c"
FT   tRNA            complement(718119..718190)
FT                   /locus_tag="SPATRNAGLU.01"
FT                   /product="tRNA Glutamic acid"
FT   3'UTR           complement(719090..721616)
FT                   /gene="vps17"
FT                   /locus_tag="SPAPJ696.01c"
FT   5'UTR           719380..719446
FT                   /gene="tah18"
FT                   /locus_tag="SPAC1296.06"
FT   CDS_pept        join(719447..719581,719663..719740,719791..719888,
FT                   719926..720024,720066..721410)
FT                   /transl_table=1
FT                   /gene="tah18"
FT                   /locus_tag="SPAC1296.06"
FT                   /product="NADPH-dependent diflavin oxidoreductase, involved
FT                   in iron-sulfur cluster assembly Tah18 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1296.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1296.06.1"
FT                   /db_xref="GOA:O94613"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR028879"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="PomBase:SPAC1296.06"
FT                   /db_xref="PomBase:SPAC1296.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94613"
FT                   /protein_id="CAB36512.3"
FT                   /translation="MKNSHIYILYGSETGTAEGLAESLFRSLTRMGYDVLVNSMDDFNL
FT                   ENLLRPLQCVFICSTTGQGEMPLNMRKFWRFLLRKKLPNTFLNDMQYAVFGCGDTSYTR
FT                   FNWASKKLDSRLRQLGAQSFSSRGEGDEQHPDGVEGVFAYWCNHLYSQLAAIKTPSRPA
FT                   FGEFDLLPPSFQIIIDESLGCKVKGFEDNNIVRHSRGKIEATLVHNKRISNIKHWQDVR
FT                   HLAFKIPNFERWKPGDVAVLYPWNDDMSVNSFIECMGWESIKYSPLIISSNVAERKLPW
FT                   FPNILNVFNLVKYVLSIHSVPSRTFFEMASHFSNNKMHKERLQEFSSYKNIDDYYDYTT
FT                   RPRRTVLETLQEFKSVQIPIEYALDAFPVIRGRQYSIANRCDNSTGILELAVALVKYQT
FT                   ILKSPRQGICSRWICDLHENTSFNIDILPGFLNLSYQSNKPLIMVGPGTGVAPLRALIQ
FT                   ERIYNGLKENLLFFGCRNKSMDFLFEKDWEKYTEEGTLKLFCAFSRDQEKKKYVQHSIQ
FT                   ENGELVYNLLNEKDGMFFVSGSSGKMPSSVKDAIAGIVSKYSGCSISDGYSFVTSLEKK
FT                   NRYYQETW"
FT   3'UTR           721411..721549
FT                   /gene="tah18"
FT                   /locus_tag="SPAC1296.06"
FT   CDS_pept        complement(join(721617..722243,722288..722493,
FT                   722542..722995,723063..723425))
FT                   /transl_table=1
FT                   /gene="vps17"
FT                   /locus_tag="SPAPJ696.01c"
FT                   /product="retromer complex subunit Vps17"
FT                   /db_xref="EnsemblGenomes-Gn:SPAPJ696.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAPJ696.01c.1"
FT                   /db_xref="GOA:Q9URW7"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR014461"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR037907"
FT                   /db_xref="PomBase:SPAPJ696.01c"
FT                   /db_xref="PomBase:SPAPJ696.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URW7"
FT                   /protein_id="CAB62421.1"
FT                   /translation="MSSQHSTDDLMNSHVFSGGFSTLDDKGFQDVPIHTDMPGSISVEP
FT                   SSEDANVGSVNGNINETPVFEADRLIAEATMNPSAASSTTGENSISQTGSGPFLRIRIV
FT                   DIEAENSKDPVIKMNVQTTLPAYRSKLYKNVRRTHAEFKKFAKYLISTHPECLIPAVPE
FT                   AKTSVSSGIKEDLIYLKSGLQSWLNYVSTNPNLLYDPELQLFVESDYGYSPLINTGNPT
FT                   SGLKRKALKQFPLPPDPCQALANLRPIVKSFYKNAKDAEIKLEKLVNRKQSLALTHADL
FT                   GQSLIDYSVEEQHNGLANALNRVGKMLQAISDVRIMQSSKQLVTLADSLCYASDNAFVV
FT                   KEILSNRHILMRDLISSKNQTNSYLSAANRLQDSPKISKARTDDALQALEVARVHEKLL
FT                   SDKVDFVTLNLVKESKTYTKKTSVSLQKAIREYVEKEAYYERRLLSIMESIRPHIRNID
FT                   PFGGLSRLGREEYPRRLSNPPPSQKTNQDAWTNRKRPGYSSSFDGSSQSTFNPSNNDGA
FT                   HNTSENADELVEPPIGNERLDPKSVANLLNAI"
FT   5'UTR           complement(723426..723684)
FT                   /gene="vps17"
FT                   /locus_tag="SPAPJ696.01c"
FT   5'UTR           724145..724288
FT                   /locus_tag="SPAPJ696.02"
FT   CDS_pept        join(724289..724325,724378..724418,724506..725720)
FT                   /transl_table=1
FT                   /locus_tag="SPAPJ696.02"
FT                   /product="actin cortical patch component Lsb4 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAPJ696.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAPJ696.02.1"
FT                   /db_xref="GOA:Q9URW6"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="InterPro:IPR033643"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="PomBase:SPAPJ696.02"
FT                   /db_xref="PomBase:SPAPJ696.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URW6"
FT                   /protein_id="CAB62422.1"
FT                   /translation="MGLHNPLPSSLKSECKKAGKILTSFVDPRQTLGAQEVIPPSVLTN
FT                   AKGLVIMTVLKAGFLFSGRIGSGLIVARLDDGTWSAPSAVMTGGMGVGAQIGSELTDFV
FT                   IILNSKAAVQTFARLGSITLGGNLSIAAGPLGRNAEAGGGASVGGMAPMFSYSKTKGLF
FT                   AGVSLEGSVLVERRDANRSLYRGDITAKRLLSGQVAQPAAADPLYRVLNSKIFNLNRGD
FT                   EGDIYNDVPIYADDEPEDIWGPSSKSTKRRDSADRSSSYSRRGDSYRSNRSRAHDDDDE
FT                   DDYSFSRSKSLSRKTAGGSLRSSKMDNRRSKYADTPSPRRSRSYSDEDEESVYSSDVST
FT                   ESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFAGEQPGDLSFQKGDIID
FT                   IVERSGSHDDWWTGRIGYREGIFPANYVKLS"
FT   3'UTR           725721..725946
FT                   /locus_tag="SPAPJ696.02"
FT   3'UTR           complement(725865..726080)
FT                   /gene_synonym="SPAPJ696.03c"
FT                   /locus_tag="SPAC22G7.01c"
FT   CDS_pept        complement(join(726081..727731,727846..727901,
FT                   727987..728076))
FT                   /transl_table=1
FT                   /gene_synonym="SPAPJ696.03c"
FT                   /locus_tag="SPAC22G7.01c"
FT                   /product="iron responsive transcriptional regulator,
FT                   peptidase family (predicted)"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.01c.1"
FT                   /db_xref="GOA:Q09795"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="PomBase:SPAC22G7.01c"
FT                   /db_xref="PomBase:SPAC22G7.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09795"
FT                   /protein_id="CAB62423.3"
FT                   /translation="MVVHTGNRLNKLRELMKERGYTLYVVPSEDAHSSEYTCDADARRA
FT                   FISGFDGSAGCAVIGETSAALFTDGRYFNQASQQLDENWTLMKQGFTGVPTWEEYCTQM
FT                   TKCNEKVGIDSSLITFPAAKALRESLFLKSGAVLVGDHDNLVDIVWGASRPKEPLEKLI
FT                   VQEIKYAGLGVDEKLHNLREAMKEQKIEAFVVSMLDEVAWLYNLRGADVPYNPVFFAYS
FT                   LVTLDEAFLYVDERKVTPEVSKHLDGFVKILPYDRVFSDAKNSNLTRIGISSKTSWCIA
FT                   TSFGETKVMPILSPISQAKGIKNDAELKGMKECHIRDGCALVEYFAWLDEYLNSGNKIN
FT                   EFDAATKLEQFRRKNNLFMGLSFETISSTGPNGAVIHYSPPATGSAIIDPTKIYLCDSG
FT                   AQYKDGTTDVTRTWHFGEPSEFERQTATLALKGHIALANIVFPKGTTGYMIDVLARQYL
FT                   WKYGLDYLHGTGHGVGSFLNVHELPVGIGSREVFNSAPLQAGMVTSNEPGFYEDGHFGY
FT                   RVENCVYITEVNTENRFAGRTYLGLKDLTLAPHCQKLIDPSLLSPEEVKYLNEYHSEVY
FT                   TTLSPMLSVSAKKWLSKHTSPI"
FT   intron          complement(727732..727845)
FT                   /gene_synonym="SPAPJ696.03c"
FT                   /locus_tag="SPAC22G7.01c"
FT   intron          complement(727902..727986)
FT                   /gene_synonym="SPAPJ696.03c"
FT                   /locus_tag="SPAC22G7.01c"
FT   5'UTR           complement(728077..728242)
FT                   /gene_synonym="SPAPJ696.03c"
FT                   /locus_tag="SPAC22G7.01c"
FT   5'UTR           728335..728419
FT                   /gene="kap111"
FT                   /locus_tag="SPAC22G7.02"
FT   CDS_pept        join(728420..728452,728494..728619,728664..730685,
FT                   730726..730963,731004..731188,731227..731322,
FT                   731369..731550,731616..731706)
FT                   /transl_table=1
FT                   /gene="kap111"
FT                   /locus_tag="SPAC22G7.02"
FT                   /product="karyopherin Kap111 (predicted)"
FT                   /db_xref="GOA:Q09796"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09796"
FT                   /protein_id="CAA91126.1"
FT                   /translation="MDGNEIAHAKKLVYDLYSGSLSPSAIAATEKELQKAQRSQQGWNI
FT                   GLFMLQSKDVYEQFFGALTLQMKINTQLETLSDKDLVQLFVQLLQKLLWDDGLPALVER
FT                   KVICTLASLTIKYELEKKEEASLKVIYCLFCNKLEFFNADMNAASVLNNLFPPASSRNA
FT                   QLTASYINELLLELSFSIYTKENEDALFNNVFRPCSNIIVSVLVFIFTNYSLDLSKEKN
FT                   VAALEEALNCMIAISSYLAKASVSVQSVLPAFTECMDLTVNCIALDEVSEKAMNCLADL
FT                   LANYSNFITQPTIERLWTILTGPWGETHLQQELEDPDSGEENDYSFLNIVIGFAEAMLP
FT                   QIIDHIQEEKSIRLLYILASLLSFPGYAIVEEKVSWRTLEFWTTLIEDFSMSKAATDPS
FT                   KDEIFKQIAFSVVEKAWWKMLLPSPEQWNSWPSSSRDSFNSYRRDLGDLLESSYSIFGE
FT                   RLYAMYITTIENFFSDGTGSPQSLEVSFYCLCCILEYDTNDSDTLDAWLTRLFETSFAI
FT                   KASAFQNPQLLKTCSQLLSSCSCFLQNHPQYLNISLPVLFDALHISETSIQMTVSRSIH
FT                   TLCTTCASHLLTEIDGFMAVVEELTPKLVYVPSVLEKIYSSVGYVTQRIEDIELRISYL
FT                   MRLLNCILAQLQPSLYPNLEIFENVLKSCLQSVAGVALSQSPIGESPIIDVEQSTQETT
FT                   FWQQSCIAEFQAKLISFLTHSESMALQYSDVVGLICKIMIAGLNEVEPSPFSLPIVTTI
FT                   QYFCDRFTEFPAAVLLTLGSAILTCPYGQTDIIDKVLIDMCSSIQNSVVIINEESFMNN
FT                   IDITVELYHFFSIILQKHPSFLETMYPDFTQLILNRAINLLGKPERLLESAAGQFIISF
FT                   ITSEKSDLLNTHTDFVNAIRSPLIAKILLGFGGNASRSSLPLLSDILGKLKAQNFSATR
FT                   ACLTQSLEEEGFPSRNVSNEIKRRFLTDLLKARIKDKVKQFWILCKGLESTPYGNSSWT
FT                   F"
FT   misc_RNA        complement(729850..732457)
FT                   /locus_tag="SPNCRNA.677"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           731707..731867
FT                   /gene="kap111"
FT                   /locus_tag="SPAC22G7.02"
FT   5'UTR           731933..731937
FT                   /locus_tag="SPAC22G7.03"
FT   CDS_pept        731938..732648
FT                   /transl_table=1
FT                   /locus_tag="SPAC22G7.03"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.03.1"
FT                   /db_xref="GOA:Q09797"
FT                   /db_xref="PomBase:SPAC22G7.03"
FT                   /db_xref="PomBase:SPAC22G7.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09797"
FT                   /protein_id="CAA91127.1"
FT                   /translation="MQQLIKEHFGNGGKVRSTSIEYPIFVHSGSISAMLLTLVNALECN
FT                   DVDEGVLVYPTGSTNPMENILRMENPFDGFLAKEAYSIHFQSVLERIQLIPCSHVDDLE
FT                   KIVEVRLKHAKLILGIADISKLLKIRGCLNGRYLSRYLMLCLQNSKILIVCETGGLQER
FT                   IPIIEDISINEDTQRTVSLETIYATWIPTFWESKRKSHEKDEGRLVDRRHKVLVDWLAN
FT                   TCFRGMSLKDHSAL"
FT   3'UTR           732649..732759
FT                   /locus_tag="SPAC22G7.03"
FT   5'UTR           732826..732879
FT                   /gene="ubp13"
FT                   /gene_synonym="pan2"
FT                   /locus_tag="SPAC22G7.04"
FT   CDS_pept        join(732880..732897,732942..733040,733085..733251,
FT                   733369..733495,733536..734113,734151..735457,
FT                   735495..736465)
FT                   /transl_table=1
FT                   /gene="ubp13"
FT                   /gene_synonym="pan2"
FT                   /locus_tag="SPAC22G7.04"
FT                   /product="ubiquitin C-terminal hydrolase, poly(A)-specific
FT                   ribonuclease complex subunit Pan2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.04.1"
FT                   /db_xref="GOA:Q09798"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028881"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR030843"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PomBase:SPAC22G7.04"
FT                   /db_xref="PomBase:SPAC22G7.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09798"
FT                   /protein_id="CAA91128.2"
FT                   /translation="MDAWKEITKTTENDGVSTCSLSSIAFDPYSELVWTGHKNGQIKSS
FT                   FGPSLTSYTQFIGHEGPVHQVLPQERGVFSLSSKSLRLSNRKGTIRWRYQDSDCIDYRA
FT                   MFYQSRNNPEVVIGGYHQKLTVVNAERGISIHKDKNVSDIFIMRRNRLLCCGSTNGEII
FT                   LRDPNSFQPVNKVVAHTGTISDIDTSGNLLLSCGYSLRHGTYMLDPFVKVWDLRNLSSL
FT                   VPIPFPAGPTIIRMHPKLSTTAVVCSCSGQFHIVDTGNPLDAKLMQIPLTSYLTGMDIA
FT                   STGDAMVFTDVEDNIHLWSPLENPSFSDLKLPIQLPNTSTETVQLENNDPLNSIGLPYY
FT                   KDELLSSWSKYLIFDVGKPILDSNLLIAKQISENSHPVPQEIKSFHRNQIIEVPWLNRK
FT                   LISEGATPKFHSERQKDIMSGNDIEGSASYFEEIEDTISGPDSIPKFYQRPVIKYSKFG
FT                   IEDFDFGFYNKTKYAGLETDITNSYCNSVLQLLSYVPSFSKAAISHSLGPCDLMECLLC
FT                   ELGFLFAMLKESTGRNCQATNFLRAFSNSSFAQSLGIVFDDYSDGTFPDSFVIQKFTKF
FT                   MLTEISRIADYEDKKDGTSFPVSFLLKSFCIPEMQTYRCGICGITSQKIKSSLYIIDLH
FT                   YPSQQLESILSFEWLFKMSLDRRVDLPPGWCEYCLAHQPFLLRSFIRSLPDCLFINTQV
FT                   KHHEHWKLWARKNWLPKKLHLRRVNDTMQCVSQKISNLDKDQQSLSVYVLRGIIYEIRQ
FT                   NGEEPHFVSTIRVSDNTSSDNPDDNRWYIFNDFLVKEVTEEEALTVHGPWKIPIIVYYE
FT                   KLDTKIPQWDEVSDYTLLYQPYSLNKNPPINKIQPLTTDEMLYPKMLVGIDSEFVALQQ
FT                   EETEVRSDGTKSTIKPSKLSLARVSVLRGEGPNKGLPFIDDYVATDDKVTDYLTEYSGI
FT                   HPGDLDPDRSPYNVVPLKVAYKKLRLLVNAGCIFVGHGLQKDFRIINLLVPPEQVVDTV
FT                   DLFFLSSRQRKLSLKFLAWYLLDEEIQLTEHDSIEDALTALKLYDCYDKLKSQGKLEET
FT                   LDNIYEVGRRFKFRPPSVASMSLEDRNSYGDESVISNQTN"
FT   3'UTR           736466..736603
FT                   /gene="ubp13"
FT                   /gene_synonym="pan2"
FT                   /locus_tag="SPAC22G7.04"
FT   misc_RNA        complement(736520..738893)
FT                   /locus_tag="SPNCRNA.678"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           736722..736796
FT                   /locus_tag="SPAC22G7.05"
FT   CDS_pept        join(736797..737037,737165..738720)
FT                   /transl_table=1
FT                   /locus_tag="SPAC22G7.05"
FT                   /product="krr family protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.05.1"
FT                   /db_xref="GOA:Q09799"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="InterPro:IPR024626"
FT                   /db_xref="PomBase:SPAC22G7.05"
FT                   /db_xref="PomBase:SPAC22G7.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09799"
FT                   /protein_id="CAA91129.1"
FT                   /translation="MPRKKSAAKKAREALVQKKVINSNVPTDKKSIDQLQENVTSKSHL
FT                   LEESSSEDEEINSFQINEEYAKRFEHNKKREELQKLEAKYGEQMANGVDGEGSDESSSE
FT                   EEEDSDGELVTPEVDAAILRMIVKIRNKDPDLYDSQQKYFDEVEKDVQGSLKSKDGFRS
FT                   VTLKDYHRQKLLSGEILDAEEDEPMPNDANPTHVEEQERLRKETIAAFHDVNGNKDAVS
FT                   NESDEDGDFLVKKEKTKKQLEEEEHGYERFLLESAQSKEARKVLEDLSSSYVKQRPSVL
FT                   VNTEDDENGIKPSDEDFLLKYMMNRGWRTSNTKQPSYEEIIDEVDAENRFDEDAEEFEN
FT                   KFNFRFEEEAGSQIVSHPRNVADSLRRKDDSRKRARDRKKERLEEASQKRLEEVNRLKN
FT                   LKRKELEEKLNQVIEIAGSKNIDVSKLDLDEDFDPEKWESKMSEIFNENYYEEDSAKKP
FT                   EFGDDIDIDDIAQVDNGSEDLGSIENKTVEDTGNREKSKKSLRKDIREKKRKIDEYVEE
FT                   KYGVPEAVIVKNSKFRYQQVAPETFGLDILDILNASDADLNNYVGLKKMTPYRTPEEIA
FT                   RDKKKYGKKKRLREWKKQVFGK"
FT   3'UTR           738721..738782
FT                   /locus_tag="SPAC22G7.05"
FT   3'UTR           complement(739167..739299)
FT                   /gene="ura1"
FT                   /locus_tag="SPAC22G7.06c"
FT   CDS_pept        complement(739300..746034)
FT                   /transl_table=1
FT                   /gene="ura1"
FT                   /locus_tag="SPAC22G7.06c"
FT                   /product="carbamoyl-phosphate synthase (glutamine
FT                   hydrolyzing), aspartate carbamoyltransferase Ura1"
FT                   /EC_number="6.3.5.5"
FT                   /EC_number="2.1.3.2"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.06c.1"
FT                   /db_xref="GOA:Q09794"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="PomBase:SPAC22G7.06c"
FT                   /db_xref="PomBase:SPAC22G7.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09794"
FT                   /protein_id="CAA91130.1"
FT                   /translation="MSGLLPSLSSSFPLVQSEALGMPRTHGPKPSENDPKEPTCSPSPA
FT                   FYSVNGEMKDYKLMALELEDKSVLQGYSFGADHSVSGELVFQTGMVGYPESLTDPSYRG
FT                   QILVFTFPTVGNYGVPDRRILDEISGLPKYFESNQIHVAAIIISSYSQNYSHFLAHSSL
FT                   GEWLKEQGIPGIFGIDTRALTKKIRDQGSMLGRLLIQKDESPINPSSITGLGKDWSTAF
FT                   EDIPWKNPNTENLTSQVSIKEPKLYEPHPTTAIKKADGKIIRILVIDVGMKYNQIRCFL
FT                   NRGVELLVVPWDYDFTKETYDGLFISNGPGDPSLMDLVVDRVKRVLESKTVPVFGICFG
FT                   HQIMARAAGASTTKMKFGNRGHNIPCTCMISGRCYITSQNHGYAVDASSLSNGWKELFV
FT                   NANDGSNEGIYNTEYPFFSVQFHPESTPGPRDTEFLFDVFIDVVKRSADAKSLQPFKLP
FT                   GGTIEENRSRHPLVDAKRVLILGSGGLSIGQAGEFDYSGSQAIKALREEGIYTILINPN
FT                   IATIQTSKGLADKVYFLPVNADFVRKVIKQERPDSIYVTFGGQTALNVGIELKDEFEQL
FT                   GVKVLGTPIDTIITTEDRELFARAMDEINEKCAKSASASSIEEAIKVSKDISFPVIVRA
FT                   AYALGGLGSGFADNEAELIDLCTLAFATSPQVLIERSMKGWKEIEYEVVRDAFDNCITV
FT                   CNMENFDPLGIHTGDSIVVAPSQTLTDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPF
FT                   TKEYCIIEVNARLSRSSALASKATGYPLAFTAAKLGLNIPLNEVKNSVTKVTCACFEPS
FT                   LDYVVVKIPRWDLKKFTRVSTQLSSAMKSVGEVMSIGRTFEEAIQKAIRAIDYSNTGFN
FT                   VKDALMSIDTELQTPSDQRLFAIANAMASGYSVDRIWELTRIDKWFLEKLMGLIRTSQL
FT                   ISKHDISSLPISLLKTAKQLGFADVQIAAFMNSTELAVRRIRTEAGIRPFVKQIDTVAA
FT                   EFPAFTNYLYTTYNAVEHDIHFNDKGVMVLGSGVYRIGSSVEFDWCAVRAVRTLRDRGV
FT                   KTIMVNYNPETVSTDYDEADRLYFENIGLETVLDIYEQESSSGIIIAMGGQTANNIALP
FT                   LHRENVKILGTSPEMIDGAENRFKFSRMLDDIGVDQPKWKELTSFDEADKFCDTVGYPV
FT                   LVRPSYVLSGAAMNTVYSQSDLHSYLQQAVAINKDHPVVISKYIENAKEIELDAVAREG
FT                   KMVMHVISEHVENAGVHSGDATLVLPPQDLAPTTIERIVDAAAKIGEALNITGPYNIQF
FT                   IAKDNEIKVIECNVRASRSFPFVSKVIGVDMISMATDVIMGNPIQPYPDVDLPRDYVAV
FT                   KVPQFSFSRLSGADPVLGVEMASTGEVACFGHNKFEAYLKAMISTGFRLPKKNILISIG
FT                   SYKEKAELLPYVKKLYENNYNIFATAGTSDYFMESGVPCKYLADLPAEEANNEYSLSAH
FT                   LANNMIDMYINLPSNNRYRRPANYISSGYKSRRLAIDYSVPLVTNVKCAKLMIEAICRN
FT                   LDFSLSTVDFQSSFQTANLPGLINISAFLPEFTSEAVSDYTKECIASGFTMARFLPFST
FT                   SSTLADKDSLSAVKKLALDHAHCDYNFSVIASSTNEVTISELTSESGCLFFHFEKDDSG
FT                   IDHVTAVASHFNVWPDTQTVMTDAKSTTLASLLLLASLHNRRIHITNVSSKDDLNLIVL
FT                   AKQRSLPVTFDVSVYSLFLNQNDYPGATFLPTADDQVEIWNKLSYIDCFSIGSIPSRLA
FT                   KFVGNTAFTGFGVREAIPLLLTAVNEGRLTLKDVVDRFYSNPKAIFRLHDQDDSGVQLE
FT                   VDRSVSWSSKDWTPFNGKKLYGSIQSVQFDGHDVFFDGELNFEHTYGRDYSSASLADKS
FT                   KATRKVSALMSPGLPHAAPSLAEAFGQAPENKAHPDISLNMTPNFKPSHELVQLINSSP
FT                   FYRKHIISVHQVTRSDLHVLFAIAHQMRIIVERQGVIDLCYGKLLCTMFFEPSTRTSSS
FT                   FDAAMQRLGGKVVAVTASASSVNKGESLADTIRTLGCYGDAIVLRHPSIESARIAANFS
FT                   PVPIINGGNGSKEHPTQAFLDLYTIREELGSVNGLTITFIGDLKYGRTVHSLARLLAFW
FT                   HVELHLVSPEQLALPDDVKDDIRANGLNFIEHRELTKEVVAQSDVLYCTRVQKERFASV
FT                   DEYEKLKDSFIVDNSVLASAKSHCIVMHPLPRNREISEEVDFDQRRAAYFRQMRYGLYI
FT                   RMALLACVMGATEVAN"
FT   5'UTR           complement(746035..746117)
FT                   /gene="ura1"
FT                   /locus_tag="SPAC22G7.06c"
FT   3'UTR           complement(746537..747142)
FT                   /locus_tag="SPAC22G7.07c"
FT   CDS_pept        complement(747143..748402)
FT                   /transl_table=1
FT                   /locus_tag="SPAC22G7.07c"
FT                   /product="mRNA (N6-adenosine)-methyltransferase
FT                   (predicted)"
FT                   /EC_number="2.1.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.07c.1"
FT                   /db_xref="GOA:Q09800"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PomBase:SPAC22G7.07c"
FT                   /db_xref="PomBase:SPAC22G7.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09800"
FT                   /protein_id="CAA91131.2"
FT                   /translation="MPCILYMDDTSCLIDLPTSLQFNKHILPTRTKPVVKPYLLPEKST
FT                   SDYENSGKGTVGQVLQSLQRVRRALQLRSLDDNQSTDKSHHVQFQDIVYRSNTSASEIH
FT                   FQAENAPLVQWYSDIFKVLVKAPVIQFEDQCLQWLKMLNTIPPSYSFITIKSKDTVELG
FT                   LEEIYQQCVQNDGASAIKLKLKGSKVITESSETNCRDSIYYIPARSSFIMGDVEKTAQI
FT                   LLEAIDGHLEKPKCIIIDPPWPNKSVARSSVYKVNRNLGYLKALPIQESLSKTGVVAVW
FT                   CTNKEKYVNFVKKVLFKKWNLTLVSTWTWLKITAFGEPLFDVYSNMRKPWEQLLIGVTS
FT                   EYTSVYSDKIPPTFTIIGIPDYHSRKPSLKPFISRWFNCSANESLPVLEIFGRSLTPNW
FT                   ITWGREPLLFMHELYWSSDN"
FT   5'UTR           complement(748403..748971)
FT                   /locus_tag="SPAC22G7.07c"
FT   5'UTR           749523..749929
FT                   /gene="ppk8"
FT                   /locus_tag="SPAC22G7.08"
FT   CDS_pept        join(749930..749995,750113..751588)
FT                   /transl_table=1
FT                   /gene="ppk8"
FT                   /locus_tag="SPAC22G7.08"
FT                   /product="serine/threonine protein kinase Ppk8 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.08.1"
FT                   /db_xref="GOA:Q09792"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC22G7.08"
FT                   /db_xref="PomBase:SPAC22G7.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09792"
FT                   /protein_id="CAA91132.1"
FT                   /translation="MAVITEENSNNLFCTDSLELTSNKQDDQVISNYLKPVRSYPYIKY
FT                   SRSSLLLTASTTLPENFVISFTNSIESEESDKSDYLLDHAHSLQELSTTHSSLSSTLTS
FT                   MSEESSSTESKFATLNDGINGGNPYSRLYRKNPSSDPNDIPPQFHFKKKSKSFYSSMYD
FT                   KMKIRINILPNGNDNFIKKRNSGFALAPIACYNHTSDLRKLLKHKVTGSNASIFKRINP
FT                   RSRKRVVNPECSVTDTPYGKLNNVIGEGASSFIRVINDRNKLPIYVAKVFRPPLDTSLL
FT                   RRYVRYFIAEYTFASTLRHPNIIKVLDIIYKRHTILQIIEYVPYDLFTFITKGHCSALK
FT                   ADQMFFQLLDGVAYMHSLGIAHRDIKLDNIMLDENLNVKIIDFGTAFVFHYPFESTTLM
FT                   SDGVVGSKPYVAPEVLTQKPYDPSAVDVWSCAIVYCCIALKRFPWKVPHTSDKRFNLYV
FT                   TQRNDPNTKSQLIESLPMNSRDTIYHMLDIDFNTRCSISGARSTTWMQQVRKTLI"
FT   3'UTR           751589..751846
FT                   /gene="ppk8"
FT                   /locus_tag="SPAC22G7.08"
FT   3'UTR           complement(751647..751672)
FT                   /gene="nup45"
FT                   /locus_tag="SPAC22G7.09c"
FT   CDS_pept        complement(join(751673..751800,751840..752131,
FT                   752188..752296,752343..752429,752473..753079,
FT                   753156..753210))
FT                   /transl_table=1
FT                   /gene="nup45"
FT                   /locus_tag="SPAC22G7.09c"
FT                   /product="nucleoporin Nup45"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.09c.1"
FT                   /db_xref="GOA:Q09793"
FT                   /db_xref="InterPro:IPR024882"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="PomBase:SPAC22G7.09c"
FT                   /db_xref="PomBase:SPAC22G7.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09793"
FT                   /protein_id="CAA91133.2"
FT                   /translation="MFGLNKTPSFGSTGTQNQNTGTSAGTGLFSSNTFGNNTQANTPAS
FT                   TGFGGVTGGAFGQTKPQTGGSLFGNKPNATSTTPGLNLFGQNPQAAPGGSLFGASTTKP
FT                   QAPGGLFNQNQTQAQPAQAAPTGGLFGLSGQNQTQSQTQPAQANTSLFGQSNIGTTGGL
FT                   FDQNRPNTSTFGQFSTQPASAGLFGQSTQPSGSTGFGLSNNTQTTPFFSAAQQQPSTTQ
FT                   LPSNPAINATTRYSSLNANTQKFLDDLDKEIFSQIQLAEELQTKLGTVSELVESVPNDV
FT                   AEVQRRLSSVSTALLIDSDEIETTKRVVDEDTSNARISSRILDVFKTPGATYPFASNDP
FT                   LMNYFEQFTENAKKRTDLYAATIGELEQHLEQVETTPQNNSPEALLKTIKEEHKLFMAL
FT                   SNRFAQVHDEVKRLQVNTSTSLPFIS"
FT   intron          complement(751801..751839)
FT                   /gene="nup45"
FT                   /locus_tag="SPAC22G7.09c"
FT   5'UTR           complement(753211..753492)
FT                   /gene="nup45"
FT                   /locus_tag="SPAC22G7.09c"
FT   5'UTR           753624..753703
FT                   /locus_tag="SPAC22G7.10"
FT   CDS_pept        join(753704..753841,753887..753939,753987..754830)
FT                   /transl_table=1
FT                   /locus_tag="SPAC22G7.10"
FT                   /product="mRNA cleavage and polyadenylation specificity
FT                   factor complex subunit, Fip1 homolog (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.10.1"
FT                   /db_xref="GOA:Q09801"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="PomBase:SPAC22G7.10"
FT                   /db_xref="PomBase:SPAC22G7.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09801"
FT                   /protein_id="CAA91134.1"
FT                   /translation="MSNADQHMDVDEDEYLYGETIEERNDGVTVSNAKSPEQASEESDD
FT                   SDIEFIIETKPGERAEPLGGSIATLGSTRPSAKPQVEKTAVEVKTTEPQDLSTAETAPK
FT                   VDIDAVPTIDGKNIFEIDLESFDDKPWRKPGADISDYFNYGFDEFTWAAYCAKQTTLRD
FT                   DFSPQKFMASLAQIPGPLPSGNVPSPAEFQAMMASGFPPFMPIPPPIGGPQEDMGYSRN
FT                   FPVHASSNYNTTHTSGGGVHSGAATPNAYVNNNPSSSRRESESPANSPNITSSAGMTHA
FT                   QPTHNPTSSYGNGASTNYNASRPPSNHPHSSNYPSSSRRKPSPDRYSNYSSRGSGGRYR
FT                   RNRY"
FT   3'UTR           754831..755676
FT                   /locus_tag="SPAC22G7.10"
FT   3'UTR           complement(754932..755079)
FT                   /gene_synonym="SPAC4G8.01c"
FT                   /locus_tag="SPAC22G7.11c"
FT   CDS_pept        complement(755080..755502)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC4G8.01c"
FT                   /locus_tag="SPAC22G7.11c"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22G7.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22G7.11c.1"
FT                   /db_xref="GOA:Q09802"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="PomBase:SPAC22G7.11c"
FT                   /db_xref="PomBase:SPAC22G7.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09802"
FT                   /protein_id="CAA91135.2"
FT                   /translation="MPDPNRVLAGKKATLHNPNVSQQAKERAEDYIESHSSGQETGDYS
FT                   AQAGGRDLDYEDLGDYDEDADFDNEEGLNVLGDESGFVDDPMKTGDLVEEDQLEGKNIE
FT                   NVRGGYKATMHNPNVSKQAKTRAQRALEEIDDETQA"
FT   5'UTR           complement(755503..755637)
FT                   /gene_synonym="SPAC4G8.01c"
FT                   /locus_tag="SPAC22G7.11c"
FT   3'UTR           complement(756479..756597)
FT                   /gene="sss1"
FT                   /locus_tag="SPAC4G8.02c"
FT   CDS_pept        complement(join(756598..756610,756779..756881,
FT                   756989..757085))
FT                   /transl_table=1
FT                   /gene="sss1"
FT                   /locus_tag="SPAC4G8.02c"
FT                   /product="translocon gamma subunit Sss1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.02c.1"
FT                   /db_xref="GOA:Q09827"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="PomBase:SPAC4G8.02c"
FT                   /db_xref="PomBase:SPAC4G8.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09827"
FT                   /protein_id="CAA91203.1"
FT                   /translation="MADNADDLFQIPKNFYKEGSHFIKRCVKPDRKEFLSISKAVATGF
FT                   VLMGLIGYIIKLIHIPINKVLVGGA"
FT   intron          complement(756611..756778)
FT                   /gene="sss1"
FT                   /locus_tag="SPAC4G8.02c"
FT   intron          complement(756882..756988)
FT                   /gene="sss1"
FT                   /locus_tag="SPAC4G8.02c"
FT   5'UTR           complement(757086..757153)
FT                   /gene="sss1"
FT                   /locus_tag="SPAC4G8.02c"
FT   3'UTR           complement(757915..758207)
FT                   /locus_tag="SPAC4G8.03c"
FT   CDS_pept        complement(758208..760550)
FT                   /transl_table=1
FT                   /locus_tag="SPAC4G8.03c"
FT                   /product="RNA-binding protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.03c.1"
FT                   /db_xref="GOA:Q09829"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="PomBase:SPAC4G8.03c"
FT                   /db_xref="PomBase:SPAC4G8.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09829"
FT                   /protein_id="CAA91204.1"
FT                   /translation="MVNRDAYNELNLNKKSQETNRKPSPLSSYTSISRELDYANQSPFS
FT                   SNSFSPTELKARTSATFDVRSASTSPINASDFHKYSHDPFQRLFKAKGNASFSKTKSFP
FT                   SSVTYSPSEETFPLTSGMNKSVHEYPFTLSESAISSSHKSSIPERRNFDSSVSVSNPLL
FT                   HWNNVDTLLRDGSLENVNNSRQDQFLPYKTFSSTISNSDFLHRESSFSSLIDEESKLAS
FT                   LRNLNINDRPPLPVLKNSERNLLHRQLLSNHPFFSQNNVSLSTNSKNYSTDFTKIQSDS
FT                   SLLQNRQQNHRIETDQLSHFPDHLDPSRIPSPYQPSSLQPLESRKLHSKVDVHSKKLNA
FT                   LSQLNPILRSENVLQNDNHHSSLSMDNDPTNVSTKNRNNQTVGEHPYVDDNKKKKKGPA
FT                   KPKEKATLGKTVNSFFGSHSTSNYSKVPLSAKLTGEKSDDLSNLLKNKGKKKSQDNQIP
FT                   HLVGFLGHLSTICKDQYGCRYLQKLLDENPKVNASLFFPEIRQSVVQLMIDPFGNYMCQ
FT                   KLFVYASREQKLSMLNGIGEGIVDICSNLYGTRSMQNIIDKLTSNEQISLLLKIIIPSL
FT                   TTLACDNNGTHVLQKCIAKFPPEKLEPLFLSMEENLITLATNRHGCCILQRCLDRTNGD
FT                   IQERLVNSIIKSCLLLVQNAYGNYLVQHVLELNIQPYTERIIEKFFGNICKLSLQKFSS
FT                   NAIEQCIRTASPSTREQMLQEFLSFPNIEQLLDDCYANYVMQRFLNVADESQKFLILRS
FT                   ISHVIPKIQNTRHGRHILAKLTSSTSS"
FT   5'UTR           complement(760551..762714)
FT                   /locus_tag="SPAC4G8.03c"
FT   misc_RNA        762720..764810
FT                   /locus_tag="SPNCRNA.679"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        765526..767503
FT                   /locus_tag="SPNCRNA.680"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           767446..767708
FT                   /locus_tag="SPAC4G8.04"
FT   CDS_pept        join(767709..769748,769812..770090)
FT                   /transl_table=1
FT                   /locus_tag="SPAC4G8.04"
FT                   /product="GTPase activating protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.04.1"
FT                   /db_xref="GOA:Q09830"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="PomBase:SPAC4G8.04"
FT                   /db_xref="PomBase:SPAC4G8.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09830"
FT                   /protein_id="CAA91205.1"
FT                   /translation="MQPSVSDSSVYLSSAPTKPIASGSVATGIDSMPSKVDITPCDLLE
FT                   NSKSSAPLFVECNQESLHSIPGSLHLVPDASIERLIEKHGAVNLLRQLAKDVAERDSFI
FT                   SDLKFHFESREYVFRELLREHGLDPVLANTKLSQRHSASFFPSSQEPSIPENPSSLTGE
FT                   KPHLYARIDSAINEPFTPSDRLSPSSLVPLLKLPALDHAVSSSSSSDLPSDPNSASYIA
FT                   SSKQKASSLKLTSSLKKFYSWTSSSSLQHTRENLHDSTSSLRDHDPSLLSSSKFFRSSP
FT                   RCSTPSVSSTFVSATSEPEVETYSVSTKNSSSNKNLRSSLSKLLSTSNLNNKPLSLSST
FT                   APSMPSIGSVELGNMIPKETQPPSMRNDWKDYLDNNSKEILDQFGFLQKRPSHDTPLCP
FT                   EDIKLNQKQTLSFYESNYGLVDDFFGNELDGLNDSPLLLNKKDILLDMKESTRQKNWSL
FT                   FFQRLYKKYKITDEDTIGLLGISSIGVKGRHGKKRWHKFRELVKNGVPLCYKAKVWLEC
FT                   SGAYQLHSPGYYEELLSRTDEVESASVAQIDMDINRTMAKNVFFGGKGPGIPKLRRILV
FT                   AYSRHNPHIGYCQGMNVIGAFLLLLYASEEDAFYMLMSIIENVLPPKYFTPDLMTSRAD
FT                   QLVLKSFVKESLPEIYSHLELLGVDLDAISFHWFLSVYTDTLPTNISFRIFDMLFCDGY
FT                   VCLFRVALTILKSLKQQILACNSSSAIYSFLSDLVQYSFQPDSFIKEAADRWSKLVTEK
FT                   SIERKRNLAISSLNLAVNY"
FT   3'UTR           770091..770246
FT                   /locus_tag="SPAC4G8.04"
FT   5'UTR           770502..770622
FT                   /gene="ppk14"
FT                   /locus_tag="SPAC4G8.05"
FT   CDS_pept        770623..772323
FT                   /transl_table=1
FT                   /gene="ppk14"
FT                   /locus_tag="SPAC4G8.05"
FT                   /product="serine/threonine protein kinase Ppk14
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.05.1"
FT                   /db_xref="GOA:Q09831"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PomBase:SPAC4G8.05"
FT                   /db_xref="PomBase:SPAC4G8.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09831"
FT                   /protein_id="CAA91206.1"
FT                   /translation="MNELHDGESSEEGRINVEDHLEEAKKDDTGHWKHSGTAKPSKFRA
FT                   FIRLHFKDSRKFAFSRKKEKELTSEDSDAANQSPSGAPESQTEEESDRKIDGTGSSAEG
FT                   GDGSGTDSISVIKKSFFKSGRKKKDVPKSRNVSRSNGADTSVQREKLKDIFSPHGKEKE
FT                   LAHIKKTVATRARTYSSNSIKICDVEVGPSSFEKVFLLGKGDVGRVYLVREKKSGKFYA
FT                   MKVLSKQEMIKRNKSKRAFAEQHILATSNHPFIVTLYHSFQSDEYLYLCMEYCMGGEFF
FT                   RALQRRPGRCLSENEAKFYIAEVTAALEYLHLMGFIYRDLKPENILLHESGHIMLSDFD
FT                   LSKQSNSAGAPTVIQARNAPSAQNAYALDTKSCIADFRTNSFVGTEEYIAPEVIKGCGH
FT                   TSAVDWWTLGILFYEMLYATTPFKGKNRNMTFSNILHKDVIFPEYADAPSISSLCKNLI
FT                   RKLLVKDENDRLGSQAGAADVKLHPFFKNVQWALLRHTEPPIIPKLAPIDEKGNPNISH
FT                   LKESKSLDITHSPQNTQTVEVPLSNLSGADHGDDPFESFNSVTVHHEWD"
FT   3'UTR           772324..772666
FT                   /gene="ppk14"
FT                   /locus_tag="SPAC4G8.05"
FT   3'UTR           complement(772650..772672)
FT                   /gene="trm12"
FT                   /locus_tag="SPAC4G8.06c"
FT   CDS_pept        complement(772673..773929)
FT                   /transl_table=1
FT                   /gene="trm12"
FT                   /locus_tag="SPAC4G8.06c"
FT                   /product="tRNA methyltransferase Trm12 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.06c.1"
FT                   /db_xref="GOA:Q09832"
FT                   /db_xref="InterPro:IPR026274"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="PomBase:SPAC4G8.06c"
FT                   /db_xref="PomBase:SPAC4G8.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09832"
FT                   /protein_id="CAA91207.1"
FT                   /translation="MISFLVQKSEAKYWKDVVQNKNKFLKNIGIISGPKLVDTYSNQFE
FT                   ADFLKKCVLIPTSYNKEDLPKDILDCPRIYLIEEEVKSVQTDEKLQIKVLRYVSQILHT
FT                   TVSEEQYPVPSRFVIYPPLALLSLNSFGTKEWHLFFQSYANVDVKAGLFDIFAREWNVS
FT                   HIAINEPIPVGDVMRRPLSLKPLYGDFGVLIDGNPSEQDFQKAFWVSCRQNGIYQTWAP
FT                   LYTMFSRGNSIEKARVLNFSYIKDEIIADLYAGIGYFTFSYVKAGASTVFCWEINPWSV
FT                   EALRRAALKNGWSIYVVRNGENYEFKVGTHRIVVFLESNVYAAERFSKMNISARHINLG
FT                   MLPSSEKSWSTATSILKRESHSFIHVHENVKDEDIETYSSEVNSCFSKMLAKNTVCVTN
FT                   CVKSFSPRVSHIVYDIETV"
FT   5'UTR           complement(773930..774027)
FT                   /gene="trm12"
FT                   /locus_tag="SPAC4G8.06c"
FT   CDS_pept        complement(join(774000..774023,774155..774403,
FT                   774453..775290,775414..775513,775641..776013))
FT                   /transl_table=1
FT                   /locus_tag="SPAC4G8.07c"
FT                   /product="tRNA (m5U54) methyltransferase Trm2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.07c.1"
FT                   /db_xref="GOA:Q09833"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025795"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="PomBase:SPAC4G8.07c"
FT                   /db_xref="PomBase:SPAC4G8.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09833"
FT                   /protein_id="CAA91208.1"
FT                   /translation="MYPYCLKYLTNGLRSKQMINFLCIQNILSARTLKICRFRFLPTPS
FT                   HPTHKMAQETRAISSISEAANKRARKLSKRRAKKPVEEGSSGHVLLLEIENLIEKPVLA
FT                   NVPFERFQEIEVKISYLSSSGDGIGLVCNDQYAVVVPFTLPGDIVKAKLHFLADTYALA
FT                   DFLEVISPSEDRDDTLIKCPYFAKCGGCQYQMLSYDKQLLQKKRVVEKAFQYYSKLDSS
FT                   LLPAIKDTVGSPLQYNYRTKITPHFDVPKGGTKGPLIIGFQEKGRRRVMDIEECPIATK
FT                   TINEEYPKIIEDVQSRANTFKRGATILMRDSATEDGKHCVITDHKMIVREQFGDLSFTF
FT                   PAGAFFQNNNSILEKFTSYVREQLLNPFGRKEHQRPKYFVDAYCGSGLFSVACSKGFLS
FT                   VIGVEISADSVRYAEENAKRNNVSNATFIVGQAEKIFSSIETPPNETAMVIDPPRKGCD
FT                   QSFLNQLLEYSPYRIVYISCNVHTQARDVGFLLSQEKGRSYKIDEIRGFDLFPQSHHVE
FT                   SILTLTKVVS"
FT   5'UTR           complement(776014..776062)
FT                   /locus_tag="SPAC4G8.07c"
FT   misc_RNA        776184..777243
FT                   /locus_tag="SPNCRNA.681"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        join(776272..776539,776589..776758,776829..777066)
FT                   /gene_synonym="SPNG135"
FT                   /locus_tag="SPNCRNA.159"
FT                   /product="non-coding RNA (predicted)"
FT   intron          776540..776588
FT                   /gene_synonym="SPNG135"
FT                   /locus_tag="SPNCRNA.159"
FT   intron          776759..776828
FT                   /gene_synonym="SPNG135"
FT                   /locus_tag="SPNCRNA.159"
FT   5'UTR           777177..777258
FT                   /locus_tag="SPAC4G8.08"
FT   CDS_pept        join(777259..777287,777338..777731,777891..778283)
FT                   /transl_table=1
FT                   /locus_tag="SPAC4G8.08"
FT                   /product="mitochondrial iron ion transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.08.1"
FT                   /db_xref="GOA:Q09834"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="PomBase:SPAC4G8.08"
FT                   /db_xref="PomBase:SPAC4G8.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09834"
FT                   /protein_id="CAA91209.1"
FT                   /translation="MDVQTLMAASAGAVASRLLCHPIDTITVHKQTIGKFSFKTMPLKA
FT                   YYRGLPISLTLITPATCLYLSTYVEAKRRFKPSVGEGAILYSICGMTAEVVSSFVWTPL
FT                   EVIKARTQISQKGSVINTISTLARSEGLKGFYRGYWMGVAIYLPTTVSWWVCYEESKKY
FT                   LQKQSNWDISVIAPICSALGTVVATTISTPLDIVKTRYQVATSSAMRKAEYGLQAEKEL
FT                   GILEIAKLLFSKHGVKGFTRGLFTRMCYIMPSGMISMSVFESFKSKDID"
FT   misc_RNA        complement(777800..778374)
FT                   /locus_tag="SPNCRNA.682"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           778284..778498
FT                   /locus_tag="SPAC4G8.08"
FT   5'UTR           778431..778531
FT                   /locus_tag="SPAC4G8.09"
FT   CDS_pept        778532..781156
FT                   /transl_table=1
FT                   /locus_tag="SPAC4G8.09"
FT                   /product="mitochondrial leucine-tRNA ligase (predicted)"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.09.1"
FT                   /db_xref="GOA:Q09828"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="PomBase:SPAC4G8.09"
FT                   /db_xref="PomBase:SPAC4G8.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09828"
FT                   /protein_id="CAA91210.1"
FT                   /translation="MLKSVGTNGRKVPKIASLCNFLKFNKNIHSNPDFLAIAENWKSYW
FT                   KSHYPFVKNDKGKKKYILSMFPYPSGLLHIGHVRVYTISDILSRYYRMKGYKVIHPMGW
FT                   DAFGLPAENAAIENGISASSWTYENIKKMKEQTYHMNIYFDWDREISTCNPDYYKWSQY
FT                   LFLQMFHKGLAYQAEATVNWDPVDCTVLANEQVDSHGRSWRSGAIVEKKNLRQWFLKIS
FT                   DYSDQLLDDLETLPKWPDKVKKMQRNWIGRTTGFEISFPLLNDKETLTVFTTKPETIID
FT                   VSFIALSKNHKLVLLESQKDPSLAEHLRNESLLDKGYQLPCFAKNPVTGKALPIFYAPY
FT                   VLDCYGTGAVMGAPIHDRRDFEFAKRNNIIFSKESCIGSYFTNEGKELLNHHDSSNLMD
FT                   IKQKMLQQKIVSYLEEKKLAKRVKNYRLKDWLISRQRFWGTPIPMVHCETCGAVPVPES
FT                   ELPVKLPDLDKIYEKGTSPLSNLETWMKTTCPKCHGPATRETDTMDTFVDSSWYYFRFL
FT                   DSKNSELPVGLASASSLMPVDIYIGGVEHSILHLLYSRFFSKFMKDIGLWNGDKYLNEP
FT                   FTQLITQGMVHGLTYTTMSDERILNPKEVQKIGDEYFLISNPKEKVQLSYQKMSKSKHN
FT                   GVDPIRTIQKYGSDIIRAYIIFSAPVEGVLLWNENAIMGTKRWLTKIWNCVHQLLEREK
FT                   KMSDAMRQTKLTIVDDHNSRKLESQYNEFISQCSAHYENVFSLNLVISDAMKLTNNIAD
FT                   ALKNNKVNIGTIKASLEVLVKCIAPIIPCFSSECWLLLGHNSSVYSNWPISKNKKENME
FT                   EPVTIPVQINGKVRFKIEMPKLNDENEILNFVLETNDGKRWLSNKKVLKSFVKQKIISL
FT                   VTD"
FT   misc_RNA        complement(778805..781335)
FT                   /locus_tag="SPNCRNA.683"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           781157..781324
FT                   /locus_tag="SPAC4G8.09"
FT   3'UTR           complement(781347..782141)
FT                   /gene="atp10"
FT                   /locus_tag="SPAC4G8.11c"
FT   5'UTR           781348..781486
FT                   /gene="gos1"
FT                   /locus_tag="SPAC4G8.10"
FT   CDS_pept        781487..782035
FT                   /transl_table=1
FT                   /gene="gos1"
FT                   /locus_tag="SPAC4G8.10"
FT                   /product="SNARE Gos1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.10.1"
FT                   /db_xref="GOA:Q09835"
FT                   /db_xref="InterPro:IPR023601"
FT                   /db_xref="PomBase:SPAC4G8.10"
FT                   /db_xref="PomBase:SPAC4G8.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09835"
FT                   /protein_id="CAA91211.1"
FT                   /translation="MKSMLLRDSVKKASQFQRSLHSDPNQAKILLEERRKLLEEANSSA
FT                   DENDSHSMATIKSHFERLKRDEQLLNGVLKKYDAKQEVLSPEELRDAQNFLEMQEANSL
FT                   DNSIRGTNELLERAYATREDFDYQNSVLGNVTNRINGAAMSIPFINQILRKTSIRRRRD
FT                   SIILALLISVLMLLFLFFH"
FT   3'UTR           782036..783419
FT                   /gene="gos1"
FT                   /locus_tag="SPAC4G8.10"
FT   CDS_pept        complement(join(782142..782336,782438..782704,
FT                   782803..783144))
FT                   /transl_table=1
FT                   /gene="atp10"
FT                   /locus_tag="SPAC4G8.11c"
FT                   /product="F1-F0 ATPase assembly protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.11c.1"
FT                   /db_xref="GOA:Q09836"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="PomBase:SPAC4G8.11c"
FT                   /db_xref="PomBase:SPAC4G8.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09836"
FT                   /protein_id="CAA91212.1"
FT                   /translation="MAYNYLKNLVIPRLIVKHQFKLRSFSTKSLNDTKEKAPSALIPVG
FT                   LLVKPTMLSEVQKPTLWEKLTKPASTSSPEQRQKELLNEMKRSTIQDFNEVRRFNGKLF
FT                   YSPPRLFKEKSALWMYNFHGKSLRNQYKELYKDWQGSPFFFALFSNAFGENQCRNWIQH
FT                   LAPFDYLPVRYANVQSNLIKYWLQKIFIGKVKRSIPEKCWNEYITAYDNKFSFPEIGWN
FT                   NKLVGNVYLIDDSCKIRWLGTGDPTNVEIENLKTAIKFLVNKNVG"
FT   5'UTR           complement(783145..783634)
FT                   /gene="atp10"
FT                   /locus_tag="SPAC4G8.11c"
FT   3'UTR           complement(783822..784674)
FT                   /locus_tag="SPAC4G8.12c"
FT   CDS_pept        complement(join(784675..785632,785698..785855,
FT                   785896..786062,786161..786229,786274..786399,
FT                   786440..786563))
FT                   /transl_table=1
FT                   /locus_tag="SPAC4G8.12c"
FT                   /product="alpha-1,2-mannosyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.12c.1"
FT                   /db_xref="GOA:Q09837"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="PomBase:SPAC4G8.12c"
FT                   /db_xref="PomBase:SPAC4G8.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09837"
FT                   /protein_id="CAA91213.1"
FT                   /translation="MFKNRKYAIIYTFLLILRFWFSQGSSYIHPDEHLQSFQIFANKLF
FT                   GWKVELPWEFTTKKPIRSVVPLNVMLLPIFLLCRCICKSNCSPYPILLFTRLYMCLISL
FT                   LIDLSIWNIVPLNARWSALLLYSSSFMATTFQTHTFTNSIETIFFFLTILFLSKLNSVP
FT                   LNKKISYLYTFLLAIVSVLGFFTRITFLAFVIAPYIYFSVRCFKKNVNNPKDIFLHLCI
FT                   FVSVSFATVLACILEDYKFYGVFVITFWNNLKYNSQIENLSQHGLHSRLTHFFTNMPLL
FT                   CGPLIFVPKLWDVRKPATWLWLLPVFILSLFPHQEPRFLLPAASIFIVNSGCLVRSYWI
FT                   KFLFVMYAVVLAVFFGIMHQNGVIPAVLEVKNIIEQRNVTTMENCNLYFNPEMPTTIYF
FT                   WKIYSAPTWMLARPKFSQINTSHLYNYSTKQMISKFWETYYEEVKVVNLPEENTTEFQA
FT                   STLLVCPVAMLQTSSYLQNLTMLHYIPYHVDLDDTDELPLAELIMNHGIGIFTAKEICE
FT                   NNTITNELPTVLRSVG"
FT   5'UTR           complement(786564..786724)
FT                   /locus_tag="SPAC4G8.12c"
FT   3'UTR           complement(786778..787118)
FT                   /gene="prz1"
FT                   /locus_tag="SPAC4G8.13c"
FT   CDS_pept        complement(787119..789164)
FT                   /transl_table=1
FT                   /gene="prz1"
FT                   /locus_tag="SPAC4G8.13c"
FT                   /product="calcineurin responsive transcription factor Prz1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC4G8.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC4G8.13c.1"
FT                   /db_xref="GOA:Q09838"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PomBase:SPAC4G8.13c"
FT                   /db_xref="PomBase:SPAC4G8.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09838"
FT                   /protein_id="CAA91214.1"
FT                   /translation="MERQRSEEANRRFKDLNPSSLYDNLSKPDLGGSSELHTYMNDTSL
FT                   ADIPLFEDTLASEVSSSLISNPSKNNIQHLHPNTSEPFKTSSKSDEYDSYPRTGNVPTF
FT                   SFTELNDTSVSGFGSQAVFENSVSPLSNPSNSPQAFDLTQGSSSTHNANDFTVNNVGSR
FT                   RQSIYEFNIGIPSSNIDSSQFLPVSRAIAASEISPSSSPQLLTSFLPSGSVSNPSSPYL
FT                   QGSVGALYEADAFNFVDVMSQASGTEVDSERFPSVDFEDPSLLMENQQNITGTGSFADY
FT                   LQPPSSGSLGAFTNASPGESNTGIDFDTDNTNLNPSVDLLSNHSTPSFIFENSPSAEFS
FT                   HQSSPYLVPNSGRTLNSENARESTIRSVNSPFSEDHADASLTTHVFDPISPTALSNSVL
FT                   NYDSNNFSGTPQINVVPSSPSKSQSGPSLPANPLLQTDISITYSQSASPVSGQPAMNEN
FT                   SYDLQNANLCAPEMSPTYTARHRSNSAGSRFDAYEPIPQLYTHFSHSSECLSVNQDTEL
FT                   LGKIENDNSKSNDYLSVRNTRPRSRSLNSLVGNKSENSSSSKAKSESKSQGNYVCTFAG
FT                   CNKRFTRAYNLKSHMNTHTNYRPFQCSICKKSFARQHDKRRHEQLHTGIKAFACVTCNQ
FT                   RFARMDALNRHYKSEVGQNCLRTATERGIQVPPSRKTAVASTSKQK"
FT   5'UTR           complement(789165..790219)
FT                   /gene="prz1"
FT                   /locus_tag="SPAC4G8.13c"
FT   misc_RNA        790209..790793
FT                   /locus_tag="SPNCRNA.684"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(790245..790883)
FT                   /gene_synonym="SPAC4G8.14c"
FT                   /locus_tag="SPAC16C9.01c"
FT   misc_RNA        790798..791645
FT                   /locus_tag="SPNCRNA.685"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(join(790884..791851,792014..792091,
FT                   792129..792168))
FT                   /transl_table=1
FT                   /gene_synonym="SPAC4G8.14c"
FT                   /locus_tag="SPAC16C9.01c"
FT                   /product="carbohydrate kinase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC16C9.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC16C9.01c.1"
FT                   /db_xref="GOA:Q09839"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034094"
FT                   /db_xref="PomBase:SPAC16C9.01c"
FT                   /db_xref="PomBase:SPAC16C9.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09839"
FT                   /protein_id="CAA91215.3"
FT                   /translation="MDYPSKDVEFVTTGMFIIDEIEFDGGKKIKDIIGGAGSFALIGAR
FT                   LWTSEPESQQLGMIVDKGSDFPQVILDELNDLHTGIVYRETPWRKTTYGYNRLRDNGFR
FT                   LFEYLTPKKPIRAPDLLETGLIYAKTIHIITNPKTFVSVCEELAKYGNLKNRPKIVWEP
FT                   TPESCLPENWHILQKALKYCDIFSPNEVDSANLLGIDISESKSRAKEFVSAFQEFQIGH
FT                   DSQGWVVLRNGSDGCLIGACTSSTNATSDAVVPVREILHLPSVQMKNGSVLDTTGAGNA
FT                   FCGAAILEYYRTGNIIEACAKATVAASFVIQQHGLPAHTKNSEGIDLWNGESVFQRLKE
FT                   YYEFLASHEASAIKELTKRGV"
FT   5'UTR           complement(792169..792274)
FT                   /gene_synonym="SPAC4G8.14c"
FT                   /locus_tag="SPAC16C9.01c"
FT   misc_RNA        792378..794001
FT                   /locus_tag="SPNCRNA.686"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(792521..792688)
FT                   /locus_tag="SPAC16C9.02c"
FT   CDS_pept        complement(join(792689..792949,793049..793609,
FT                   793659..793760))
FT                   /transl_table=1
FT                   /locus_tag="SPAC16C9.02c"
FT                   /product="S-methyl-5-thioadenosine phosphorylase
FT                   (predicted)"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="2.4.2.28"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC16C9.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC16C9.02c.1"
FT                   /db_xref="GOA:Q09816"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="PomBase:SPAC16C9.02c"
FT                   /db_xref="PomBase:SPAC16C9.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09816"
FT                   /protein_id="CAA91190.1"
FT                   /translation="MNKQAEPILLGVIGGSGFYDLPGFDIVESVNPITPWGYPASPISI
FT                   ARTTSGFLIAFLARHGVGHIYTPTEVPSRANIAALKSLGVLAIVSFSAVGSLREDIPPE
FT                   DFVLPTQIIDRTLCARPNTFFESGCVAHVSFGDPFDQDLYEILSSCGSNLKNGSKLHTK
FT                   RKGDDLTVVCMEGPAFSTRAESNLYRSWGASIINMSVIPEAKLAREAEIAYQMVCMATD
FT                   YDCWRMNEEPVTVETVMEHISNNKDNAKIFLLEAVKKLEAPLLQGFLGRNLRESVQNGI
FT                   QTNHKHRNPDAIRRLQFLFPNLTIPH"
FT   5'UTR           complement(793761..793937)
FT                   /locus_tag="SPAC16C9.02c"
FT   5'UTR           794866..795083
FT                   /gene="nmd3"
FT                   /locus_tag="SPAC16C9.03"
FT   CDS_pept        795084..796580
FT                   /transl_table=1
FT                   /gene="nmd3"
FT                   /locus_tag="SPAC16C9.03"
FT                   /product="export adaptor Nmd3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC16C9.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC16C9.03.1"
FT                   /db_xref="GOA:Q09817"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="PomBase:SPAC16C9.03"
FT                   /db_xref="PomBase:SPAC16C9.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09817"
FT                   /protein_id="CAA91191.1"
FT                   /translation="MDMDSGSMGVAFQPSEPIASTILCCECGVPTPPNAAAMCMDCIKM
FT                   TTDITSGIPRESTVNHCRECERYMQPPNNWMIAPLESRELMAICLKKLRGLNQVRLVDA
FT                   NFIWTEPHSRRIKVKLTVQKEAFTNTILQQSFQVEFYVNNTQCPDCARTYTPHIWKAVC
FT                   QVRQKVLHKRTFLYLEQIILKHKAHMNTVNIKETKDGIDFYFGQRAHAIKMVEFLSAVV
FT                   PIRYKGSEELISEDFKSNTANYKFTYSIEIVPICKDDLVCLPKTVAKAHGNIAQLVVCT
FT                   KVGPTIRFLDPLTLQTCDMLPSIYWRTPFPALADIPELTEFIVADVDLLGPTNGKYALA
FT                   DVELIKSSDGSTHLTRTHLGGILNAGNTVLAYHLAVTNFNNEVYDTLREDSIPEVVIVK
FT                   KTYPQTKKKNRNWRLKTIGMQKAEDVKKQDIERQERDYELFLQNLEEDPELRQGVNLYK
FT                   APVKAIAVADTDMDEEDEVDEDIPQISVDELLDDVEAMHI"
FT   3'UTR           796581..796821
FT                   /gene="nmd3"
FT                   /locus_tag="SPAC16C9.03"
FT   3'UTR           complement(796876..796992)
FT                   /gene="mot2"
FT                   /locus_tag="SPAC16C9.04c"
FT   CDS_pept        complement(join(796993..798229,798318..798497,
FT                   798548..798600))
FT                   /transl_table=1
FT                   /gene="mot2"
FT                   /locus_tag="SPAC16C9.04c"
FT                   /product="CCR4-Not complex subunit Mot2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC16C9.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC16C9.04c.1"
FT                   /db_xref="GOA:Q09818"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR034261"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039515"
FT                   /db_xref="InterPro:IPR039780"
FT                   /db_xref="PomBase:SPAC16C9.04c"
FT                   /db_xref="PomBase:SPAC16C9.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09818"
FT                   /protein_id="CAA91192.1"
FT                   /translation="MLKTQEIYSSEDEDDMCCPLCMEEIDISDKNFKPCQCGYRVCRFC
FT                   WHHIKEDLNGRCPACRRLYTEENVQWRPVTAEEWKMDLHRKNERKKREKERKEVELSNR
FT                   KHLANIRVVQKNLAYVNGLSPKVANEENINVLKGPEYFGQYGKIIKIAINKKAAANSAN
FT                   GHVGVYITYQRKEDAARAIAAIDGSVSDGRHLRASYGTTKYCTSYLRNQQCPNPSCMYL
FT                   HEPGDEVDSYTKEDLASLQHTRPLSTKPNVVNGATHSPSPSLPFKTPLLPVTKTPLEEA
FT                   NSSPAAQNQHITTVDHVHPQVSMTPSLSTNNTATSVPAPYSSAASVNVVPGHATTILHH
FT                   EESSALPPTAAWAKLSPSVLQERLRAAVNQQPLDALKSSSTQTSIPKIQKLKAAKLPSE
FT                   EENTTKWLNKAINDLVSSLSKINFSTEGTEFDKKQIEMIQNLPPLFVFNARSVIDKEVV
FT                   PEQEKSAENQPPTSLGINNGNPVMPPPGFQS"
FT   5'UTR           complement(798601..798833)
FT                   /gene="mot2"
FT                   /locus_tag="SPAC16C9.04c"
FT   5'UTR           799341..799549
FT                   /gene="cph1"
FT                   /locus_tag="SPAC16C9.05"
FT   misc_RNA        complement(799485..800012)
FT                   /locus_tag="SPNCRNA.687"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        799550..800764
FT                   /transl_table=1
FT                   /gene="cph1"
FT                   /locus_tag="SPAC16C9.05"
FT                   /product="Clr6 histone deacetylase associated PHD protein-1
FT                   Cph1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC16C9.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC16C9.05.1"
FT                   /db_xref="GOA:Q09819"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="PomBase:SPAC16C9.05"
FT                   /db_xref="PomBase:SPAC16C9.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09819"
FT                   /protein_id="CAA91193.1"
FT                   /translation="MASSINNSSQPTVPSISNNSHGDSFVNEGPPSNFKNNSLTSSTHS
FT                   STDHVNVLPISQDKEMDISSPVKKQKASYSNKSPNKAPIQKSRGSSLKSHLETESQQTP
FT                   VKRRRRKATIRNVDYCSACGGRGLFICCEGCPCSFHLSCLEPPLTPENIPEGSWFCVTC
FT                   SIKSHHPPKHPLSIWSQLYDWIDSQNPSQYRLPDDLVHYFHGISRGDTGAYKETEGEMD
FT                   TDEFSALPTGSSITNLAYCGYCSKPSMGACWVYGCQLCDTFYHKNCKEHAKKCSHDSIG
FT                   KKGMRVPKNAVVIRTPLVLDTTSNTLNPKVMISGWQFLMGEFPSDELLYFPRLPVSCLY
FT                   KVSEDGLIKDFLYAIGIEAKKFNNERKKRELEVIPPDVKSALLPARTHPNLPIALRTLF
FT                   NKART"
FT   3'UTR           800765..800981
FT                   /gene="cph1"
FT                   /locus_tag="SPAC16C9.05"
FT   3'UTR           complement(801141..801309)
FT                   /gene="upf1"
FT                   /locus_tag="SPAC16C9.06c"
FT   CDS_pept        complement(801310..804087)
FT                   /transl_table=1
FT                   /gene="upf1"
FT                   /locus_tag="SPAC16C9.06c"
FT                   /product="ATP-dependent RNA helicase Upf1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC16C9.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC16C9.06c.1"
FT                   /db_xref="GOA:Q09820"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040812"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="PomBase:SPAC16C9.06c"
FT                   /db_xref="PomBase:SPAC16C9.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09820"
FT                   /protein_id="CAA91194.2"
FT                   /translation="MSLGLQPNNDISSLVSSKNMTSENGLEHQFEELLVEKQYSEEHCA
FT                   YCHIKNPNSILKCLHCNKWFCNVRGKSGASHIISHLVRARHKQVALHSHSSLSDTVLEC
FT                   YNCGTRNVFLLGFIPAKAKTVVVLLCRQPCARASIAKDMNWDLTQWQPIISDRQFLPWL
FT                   ITPPSEEEQKLAIPITSQQMVRLEELWRKDPNANLEDLDKPIEDDSLPSVELRYKDAHA
FT                   YQAVLSPLIQAEADYDKRLKESQTQKDVVVRWDQAINKRYTAWFLLPKLESGEIRLAIG
FT                   DEMKLTYEGELRAPWSSTGYVIKIPNNVSDEVGLELKRSDKVPIECTHNFSVDYVWKST
FT                   SFDRMQTALRLFATDGSRLSSFLYHKLLGHDIPPSFLKPKLPSDLSVPNLPKLNASQSE
FT                   AVRAVLSKPLSLIQGPPGTGKTVTSASVVYHLATMQSRKRKSHSPVLVCAPSNVAVDQL
FT                   AEKIHRTGLRVVRVAAKSREDIESSVSFLSLHEQIKNYKFNPELQRLLKLRSENNELSI
FT                   QDEKKLRILVAAAEKELLRAAHVICCTCVGAGDRRISKYKFRSVLIDEATQASEPECMI
FT                   PLVLGAKQVVLVGDHQQLGPVVMNKKVALASLSQSLFERLIILGNSPFRLVVQYRMHPC
FT                   LSEFPSNTFYEGTLQNGVTTSERIARHVDFPWIQPDSPLMFYANFGQEELSASGTSFLN
FT                   RTEASTCEKIVTTFLRSNVLPEQIGIVTPYDGQRSYIVQYMQNNGSMQKDLYKAVEVAS
FT                   VDAFQGREKDFIILSCVRSSEHQGIGFVNDPRRLNVALTRAKYGVIVLGNPKVLAKHAL
FT                   WYHFVLHCKEKGYLVEGTLNSLQKFSLTLTPPQKPQKFKRDLNVQRSLSPIQNAGSAML
FT                   PSFSNLPNLYSSSYLEEWNVFAQYKRRESNATDFEDFRSQVGDDESKFDEPTRF"
FT   5'UTR           complement(804088..804123)
FT                   /gene="upf1"
FT                   /locus_tag="SPAC16C9.06c"
FT   5'UTR           804574..804995
FT                   /gene="pom2"
FT                   /gene_synonym="ppk5"
FT                   /gene_synonym="SPAC2G11.01"
FT                   /gene_synonym="mug189"
FT                   /locus_tag="SPAC16C9.07"
FT   CDS_pept        804996..807506
FT                   /transl_table=1
FT                   /gene="pom2"
FT                   /gene_synonym="ppk5"
FT                   /gene_synonym="SPAC2G11.01"
FT                   /gene_synonym="mug189"
FT                   /locus_tag="SPAC16C9.07"
FT                   /product="serine/threonine protein kinase Pom2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC16C9.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC16C9.07.1"
FT                   /db_xref="GOA:Q09815"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC16C9.07"
FT                   /db_xref="PomBase:SPAC16C9.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09815"
FT                   /protein_id="CAA91195.2"
FT                   /translation="MVGLISTSETLPKQESKSSSAPVSNFLSPNNLTEQTCSPLRAHST
FT                   FKEPVFLLSQRQYSHNSKILTELINSVKRPNKPDQNEEKSAVGIEEKSFKDEHLAQKKG
FT                   LHHFADLKEIFLNKNLSTLDGLQDASLHDNIQSGKLDNPVISQNRRIVLEKLANPNSSK
FT                   EYETIPTVENRHPLNKLSKTKTLAYEETINQLDETPGGTNYPMNKKKTLSSETNKYEYP
FT                   QQSKFHECSQFASPRSSIVNGPRTLGKNSKRADDTARMASRMKPSNFNNNIQSSSYGHA
FT                   SQSTKLTSQRDNDHQKDLNFSPYKSIPLNNRPYSPMSEIVGFSGSTTPLDTYGNRPSGK
FT                   KFNKNSKFRPPGSTISSYSSASTLRRLPRAPGSKVHAERQNSTFNSGISLRALRKEMGN
FT                   TAPVSSNQLLKDADLVMENLSTRNTEKVLREVNILKRLRESCVAITAKSYDTLDERKIR
FT                   SLTTFEYLEIKNFQKIYFTGSENCQKLSKQIPLDECNEALFDDDNGDYKAIQGDHLLYR
FT                   YEIIDTVGKGSFGQVLKCIDHKRGQVVAIKVIKNRQKFHGQTLVEVGILKRLCEADPAD
FT                   KNNVIRYLSHFDFRGHLCIVTELLGSNLFDVIRENNYKGLPLIVVKSFALQGLQALRLL
FT                   QGQNIIHCDLKPENLLLSHPLKARIKLIDFGSSCFYNEKVYTYLQSRFYRAPEIILGLE
FT                   YGKEIDIWSFGCILAELFTGVPLFPGGNETEQLGYIMEVLGPPPMALIRNSTRSKAYFD
FT                   SEGKPHPITDSHNRLLVPSTRTFSQLLNTKQASFLDFLSKCLKWDPKDRITVDSALQHE
FT                   FILGKTSQKPMVSKGSHPLPDLPV"
FT   3'UTR           807507..807722
FT                   /gene="pom2"
FT                   /gene_synonym="ppk5"
FT                   /gene_synonym="SPAC2G11.01"
FT                   /gene_synonym="mug189"
FT                   /locus_tag="SPAC16C9.07"
FT   5'UTR           807894..808027
FT                   /gene="urb2"
FT                   /locus_tag="SPAC2G11.02"
FT   CDS_pept        join(808028..808197,808256..812042)
FT                   /transl_table=1
FT                   /gene="urb2"
FT                   /locus_tag="SPAC2G11.02"
FT                   /product="ribosome biogenesis protein Urb2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.02.1"
FT                   /db_xref="GOA:Q09804"
FT                   /db_xref="InterPro:IPR018849"
FT                   /db_xref="PomBase:SPAC2G11.02"
FT                   /db_xref="PomBase:SPAC2G11.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09804"
FT                   /protein_id="CAA91167.1"
FT                   /translation="MSLQTLTKRIRDKNGSREDQIDLANKLFRGEVDVYFPNKEEFIIN
FT                   FLLDRLKENSNLTCVNIGYWQLFLNIWKSDKLSGSFRVSAIRRQSLYPIILNAFEYLIK
FT                   EFKKDVFLKISDVFVCVYSNLNILYISRSFPDQISLLFSRYCYLIASKIDDLLDSHPNE
FT                   VFKETLICVIQSAVHSQASSTKAQTQFLHQTLGSILALLCKTQKGDPYFSFLNAVLMKC
FT                   VLTQHTLDVLLLTKKDSSMTLCSLLNAISFEPINLKAIPLFFIICADSINFHLSSVEKS
FT                   ISQQKASELMYKLFSEHIAFLLSLKNLPEEATLDCMLSICQVFENDNLHRGHSDEYTFA
FT                   MLEQLLELSVKTLRQNTCWSTSWEMLSSLLAIDFDVLLPHSKILWECIKSVSHQDDIHA
FT                   LKFLKRWVRASAKARILDSFCIDWHLNVQTMSERSILTNRDFITSFSAVAEVSLSQISI
FT                   KKLVTWLMSSESIMSENSNRFVVYYSLCKSLKRESYPAHLVPNFELFTRSIFNASLKNF
FT                   NILDERSQALLCMCQISHVQFFSSDMSISASVGMKTLFEDLMAEKSRGLSSTVWSLQLL
FT                   LCYLEQCLRLNTLHEDTTFPMRVVNYALEYSSKALDKFAENSHLILLDMVDVGKPDLVL
FT                   TLLCRWLHMVHLYSSRTSITSWIYSIASKFYFIDSLNLETKDSVLESNWERFISSTETY
FT                   ELDSIRDSLIDCLIRLLCYSSNNAIDPVSAPGNLDFDNSAELCSSLTRFTPKNIDFVLK
FT                   SLIHIPIHSITKNQRTRLLNLLIIHEKLLSDKDNSAHISLRKIIYTLMKTPCSSGFYRD
FT                   PKIIIDLMQFGKTDLSFHKVHVLIMRSWIQHLDEGNKSEVILKLLQLILADFRELPLET
FT                   ITLIFNALVDSLPTSKHIKNSNDILSSVFTINDMLIDEMTAYLSKKESLCSGTFSCLLA
FT                   CCNSVLRTQNLTSESLNKLHILKVGIEEKAISLKLNELPFLENWILFQCLLSFGGDDFL
FT                   KVVAYMVYYRRTVGEMSFRVSDFELALSRLSTNDADYAILNILNLLTSNECDEFDYSVL
FT                   MKVVGVFANYSDCFQRNRHLVHMVLLCCTHVFYNQTLKPATLIDSALDVFLCFVQKTSK
FT                   FISLDSFNTILTALSTILNLKELECEPKDHANLILKIIQILNGLLFNHRSYMSGRFHVF
FT                   YSILKSLLYSMVQHDSEMKKIKGIALMNFYKPKKVPIHVVQSFCRLLTTWMNPNLMHDS
FT                   NKKNSSLTDAERLFVKATTKHFVFLLTDFMSAQTVYQIDIQVKELLTNCFYNVYENLSN
FT                   HEKQMALVAMNAPSKSLYQKFVNDYLIFAKWNEA"
FT   3'UTR           complement(811443..812106)
FT                   /gene="vps45"
FT                   /locus_tag="SPAC2G11.03c"
FT   3'UTR           812043..812194
FT                   /gene="urb2"
FT                   /locus_tag="SPAC2G11.02"
FT   CDS_pept        complement(join(812107..812139,812192..813472,
FT                   813559..813766,813816..813970))
FT                   /transl_table=1
FT                   /gene="vps45"
FT                   /locus_tag="SPAC2G11.03c"
FT                   /product="vacuolar sorting protein Vps45"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.03c.1"
FT                   /db_xref="GOA:Q09805"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="PomBase:SPAC2G11.03c"
FT                   /db_xref="PomBase:SPAC2G11.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09805"
FT                   /protein_id="CAA91168.1"
FT                   /translation="MDLVSASQSYFKRIFQEVSDLKILLLEEDTTKIVSSCITQSNLLE
FT                   QQIYLTVLLGNKREKLRHLKCVAFLRPTPTTLRLLCEELRDPKYAEYHLYFTNVIPKSF
FT                   LERLAESDDFEAVKSIQEFFLDYLVVNNDLASFNIPHIIEDSPDNWQDGAFHRTHQGII
FT                   SLLLSLKKKPVIRYDNNSLLCLKLAEEVSYTIQHESQLFNFRKPDTAPILLLLDRKNDP
FT                   ITPLLTQWTYQAMVHELFGIDNGRVSFSNSTSDNEKSTEIVLNPTLDPFYKETRFDNFG
FT                   DLGVKIKDYVSHLQTKSTKKASEIESIADMKQFLEAYPEYRRLSGNVSKHVSLVSEISQ
FT                   VVQRENLLEVGEVEQSLVCNEPQSTDFNDIQRLLFSNISENTKLRLAALYSLRFERIDP
FT                   AKVSALQQMLIAGGVNPLKVSVIPTLLHVAGYSFRQGDVFPPSNLFSRARSGLKGLRGV
FT                   ENVYIQHNPFLKSILLDLIQGRLKETTHPFLNSETRAQTSNEKPQDIIVVIVGGATYEE
FT                   AHFVSEFNATQPGVRIILAGTTILNSTAYIDDIMYMSTRIK"
FT   5'UTR           complement(813971..814228)
FT                   /gene="vps45"
FT                   /locus_tag="SPAC2G11.03c"
FT   5'UTR           814218..814450
FT                   /locus_tag="SPAC2G11.04"
FT   CDS_pept        814451..815356
FT                   /transl_table=1
FT                   /locus_tag="SPAC2G11.04"
FT                   /product="RNA-binding protein, G-patch type (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.04.1"
FT                   /db_xref="GOA:Q09806"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR040052"
FT                   /db_xref="PomBase:SPAC2G11.04"
FT                   /db_xref="PomBase:SPAC2G11.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09806"
FT                   /protein_id="CAA91169.1"
FT                   /translation="MGFMLYEGIDSKSIEEITEESEKTKTDLQKANTPNKTEAVHSLNN
FT                   TCSEQNSGTKDYLNSLQFLPSNFRPKTHKKKKSVSSYLSSTIQKNANENIPHVQCRNDS
FT                   QSTVTTRNPTPFKIEVGIYPSKPNNLNKEPPASTVHSDNLGDAVEHEWVELYDPLFPTS
FT                   YSVFKESDYANLCETNWSHYVNQVPSLSIEAKLSNIVNASKSGIGPPPSLLSHATLARP
FT                   SESMVLSNNIAAEDLDFFKKSPPVPAISKKENVALKMLQRCGWKEGQGLGQHNQGIINP
FT                   LHVEISGFVTETKHSKINDK"
FT   3'UTR           815357..815490
FT                   /locus_tag="SPAC2G11.04"
FT   3'UTR           complement(815388..815514)
FT                   /locus_tag="SPAC2G11.05c"
FT   CDS_pept        complement(815515..817620)
FT                   /transl_table=1
FT                   /locus_tag="SPAC2G11.05c"
FT                   /product="BRO1 domain protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.05c.1"
FT                   /db_xref="GOA:Q09807"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="PomBase:SPAC2G11.05c"
FT                   /db_xref="PomBase:SPAC2G11.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09807"
FT                   /protein_id="CAA91170.1"
FT                   /translation="MEFLNIPTKNTFHWSCDPLFNELKRLSCFKSFTYENDLKTFKALR
FT                   SQLCLSHPSINSLSSFQTYHQLLCVLEQKHLSECVAPFVWTLSSSSNERESFENLIFEH
FT                   ACLIYRLACTYHTTAISLCNEKPPNLVQACQYFQLSAGCFRYINDFYIYTKSLDFNENL
FT                   LKAWEIYCLAEAQTCIFSKANSNDTTSESIIVKILAKVFLLYEDAYKLFKNATGAPSIF
FT                   VHWTYIQKLFYQTITYQIISRTSYSLNKYGENISYLRLSLLHCKEALKTRFDFGFNVKV
FT                   YEKLEKLESSLQFELKRNERDNDFIHLQPEIPVGSFPLLDTVTMVQSITPDVLTDKTAA
FT                   YPYFSTCLDKEFMDLIEEHEKNILDAAVKSIDCLTKEGTEKLFALMEEIKSVNDNRYIT
FT                   ETSNKVMENFTEIKNLGGLEFLRSEASSLDCLIDKVNGTYRHCCQALDEIINSVKSSQN
FT                   MKEKGFYSDVIKLHEEVSLLKVNVENSQNAKDTIQKDISAFGKDIFELSAQSERILSNL
FT                   AEKKNPNTDQLLLQANSYLAQWDLLKDERNMLKKLGSNDYFNISMYSNHTDIHSLLKCF
FT                   REAVDAKWNFRRQRERQEIIIQNVEKLKSYLNSFKVQAECSEISKILSFSQETEKKYKF
FT                   LLQTVRNETEIARELYNIICRAEERYSQYENRYENENRLNKIKLQHSSSNAFNPEIHKI
FT                   KFKSSKK"
FT   5'UTR           complement(817621..817984)
FT                   /locus_tag="SPAC2G11.05c"
FT   5'UTR           817996..818116
FT                   /gene="vps4"
FT                   /locus_tag="SPAC2G11.06"
FT   CDS_pept        join(818117..818140,818207..818318,818429..818915,
FT                   818975..819650)
FT                   /transl_table=1
FT                   /gene="vps4"
FT                   /locus_tag="SPAC2G11.06"
FT                   /product="AAA family ATPase Vps4 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.06.1"
FT                   /db_xref="GOA:Q09803"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="PomBase:SPAC2G11.06"
FT                   /db_xref="PomBase:SPAC2G11.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09803"
FT                   /protein_id="CAA91171.1"
FT                   /translation="MSNPDCLSKAISLVKTAIDNDNAEQYPDAYKYYQSALDYFMMALK
FT                   YEKNEKSKEIIRSKVIEYLDRAEKLKVYLQEKNNQISSKSRVSNGNVEGSNSPTANEAL
FT                   DSDAKKLRSALTSAILVEKPNVRWDDIAGLENAKEALKETVLLPIKLPQLFSHGRKPWS
FT                   GILLYGPPGTGKSYLAKAVATEAGSTFFSISSSDLVSKWMGESERLVRQLFEMAREQKP
FT                   SIIFIDEIDSLCGSRSEGESESSRRIKTEFLVQMNGVGKDESGVLVLGATNIPWTLDSA
FT                   IRRRFEKRIYIPLPNAHARARMFELNVGKIPSELTSQDFKELAKMTDGYSGSDISIVVR
FT                   DAIMEPVRRIHTATHFKEVYDNKSNRTLVTPCSPGDPDAFESSWLEVNPEDIMEPKLTV
FT                   RDFYSAVRKVKPTLNAGDIEKHTQFTKDFGAEG"
FT   misc_RNA        complement(818362..819834)
FT                   /locus_tag="SPNCRNA.688"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   3'UTR           819651..819739
FT                   /gene="vps4"
FT                   /locus_tag="SPAC2G11.06"
FT   3'UTR           complement(819768..820162)
FT                   /gene="ptc3"
FT                   /locus_tag="SPAC2G11.07c"
FT   CDS_pept        complement(join(820163..821005,821045..821118,
FT                   821377..821704))
FT                   /transl_table=1
FT                   /gene="ptc3"
FT                   /locus_tag="SPAC2G11.07c"
FT                   /product="protein phosphatase 2c homolog 3"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.07c.1"
FT                   /db_xref="GOA:Q09173"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PomBase:SPAC2G11.07c"
FT                   /db_xref="PomBase:SPAC2G11.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09173"
FT                   /protein_id="CAA91172.1"
FT                   /translation="MGQTLSEPVTEKHSVNGSNEFVLYGLSSMQGWRISMEDAHSAILS
FT                   MECSAVKDPVDFFAVYDGHGGDKVAKWCGSNLPQILEKNPDFQKGDFVNALKSSFLNAD
FT                   KAILDDDQFHTDPSGCTATVVLRVGNKLYCANAGDSRTVLGSKGIAKPLSADHKPSNEA
FT                   EKARICAAGGFVDFGRVNGNLALSRAIGDFEFKNSNLEPEKQIVTALPDVVVHEITDDD
FT                   EFVVLACDGIWDCKTSQQVIEFVRRGIVAGTSLEKIAENLMDNCIASDTETTGLGCDNM
FT                   TVCIVALLQENDKSAWYKKIADRVAANDGPCAPPEYAENHGPGWRSGDNNKKVIVPPNF
FT                   HQVKLNGSDGYDKDANENSKEDDSTNGSLAAGFRWKEHFFPHKAEEENSSSETDIVNSN
FT                   KDVADDHKEAVSAAD"
FT   intron          complement(821006..821044)
FT                   /gene="ptc3"
FT                   /locus_tag="SPAC2G11.07c"
FT   intron          complement(821119..821376)
FT                   /gene="ptc3"
FT                   /locus_tag="SPAC2G11.07c"
FT   5'UTR           complement(821705..821920)
FT                   /gene="ptc3"
FT                   /locus_tag="SPAC2G11.07c"
FT   3'UTR           complement(822092..822331)
FT                   /gene="smn1"
FT                   /gene_synonym="yab8"
FT                   /locus_tag="SPAC2G11.08c"
FT   CDS_pept        complement(join(822332..822429,822489..822849))
FT                   /transl_table=1
FT                   /gene="smn1"
FT                   /gene_synonym="yab8"
FT                   /locus_tag="SPAC2G11.08c"
FT                   /product="SMN family protein Smn1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.08c.1"
FT                   /db_xref="GOA:Q09808"
FT                   /db_xref="InterPro:IPR040424"
FT                   /db_xref="PDB:4RG5"
FT                   /db_xref="PomBase:SPAC2G11.08c"
FT                   /db_xref="PomBase:SPAC2G11.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09808"
FT                   /protein_id="CAA91173.1"
FT                   /translation="MDQSQKEVWDDSELRNAFETALHEFKKYHSIEAKGGVSDPDSRLD
FT                   GEKLISAARTEESISKLEEGEQMINQQTETTLEGDTHIQQFADNKGLSDEKPETRAAET
FT                   HQEFMEVPPPIRGLTYDETYKKLIMSWYYAGYYTGLAEGLAKSEQRKD"
FT   5'UTR           complement(822850..823278)
FT                   /gene="smn1"
FT                   /gene_synonym="yab8"
FT                   /locus_tag="SPAC2G11.08c"
FT   5'UTR           823493..823738
FT                   /locus_tag="SPAC2G11.09"
FT   CDS_pept        join(823739..823784,823894..826229)
FT                   /transl_table=1
FT                   /locus_tag="SPAC2G11.09"
FT                   /product="DUF221 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.09.1"
FT                   /db_xref="GOA:Q09809"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR027815"
FT                   /db_xref="InterPro:IPR032880"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PomBase:SPAC2G11.09"
FT                   /db_xref="PomBase:SPAC2G11.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09809"
FT                   /protein_id="CAA91174.2"
FT                   /translation="MAFNGYGIFDSDPRKNPSSDLRTQFWLAFLLGASACVFFCFFRKR
FT                   WKVLYAPRTTIEGLNLPTLSSSYYKWLMDLVNIPDDVVQNCAGLDGYVFLLFFKMGIKF
FT                   LSFASLLGVLIIMPVNKHFRGDAFGNITLSMPAKSEYFFSSPLVKKSIVQSPIIANGSE
FT                   LNVGVLGPSLFNPIGNLSDIPGLPQPGDGFLYLYVLFTYFISIFLLYVLFSSTKSIADI
FT                   RQSYLARQNRLTDRTVFISGLPNELCSTENLKAYFDKLDVGSIDSLSICRNYSYMDILL
FT                   SKKSKYVKKLEKYWSIYLSNCKKLGISTLPPSNYLSPNRAELESTPEQLLEVPWQHHQC
FT                   HPLIKTHFFGIFGQKIDAIDFYSAKLYKISQQIENARSFDYPTTGQAFITFESMATAQI
FT                   VAQTHIDSKSLMGLHIELAPAANDIQWHNTYIGRWHKFFQGWFITLVTFMIILLWTVPV
FT                   GAIAVFINLDTIRRLWPELGRMIEDLPFLNSLLRTFLPTLVYSLFISISPFLFRWLSSM
FT                   QGLSSRAEEEIYAVGKNYAYLFVNFFLVYVIAGSTSIWELAKDTTSFAHFLANRLPHQA
FT                   QFFIDLIVLQGIGMFPLKLIQLGKLSSYFVRRSFVPYSIASKKFETPDSFSVGIFLPQP
FT                   MFIMLICLCYSIISPLILVFGLIYFIIGFLVYKYELIYQMEHPQHSTGELWSTIFLRMI
FT                   FGCVIMQLTMMGLMSLRKAYWLSTVIFPLLCFTVISAYNFSTMIRSSMQFVSLYYIRTH
FT                   QSNTLSSESESRNSESSGSYVHPGFDLSNEELPLIDLNTA"
FT   3'UTR           826230..826399
FT                   /locus_tag="SPAC2G11.09"
FT   3'UTR           complement(826313..826537)
FT                   /locus_tag="SPAC2G11.10c"
FT   CDS_pept        complement(join(826538..827420,827465..827678,
FT                   827903..828011))
FT                   /transl_table=1
FT                   /locus_tag="SPAC2G11.10c"
FT                   /product="thiosulfate sulfurtransferase, URM1 activating
FT                   enzyme (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.10c.1"
FT                   /db_xref="GOA:Q09810"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR028885"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="PomBase:SPAC2G11.10c"
FT                   /db_xref="PomBase:SPAC2G11.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09810"
FT                   /protein_id="CAA91175.1"
FT                   /translation="MNPQEKIICSSNGLELSLDEYSRYGRQMLLSEIGLPGQLSLKRSS
FT                   VLVIGAGGLGCPAMQYLVAAGIGTLGIMDGDVVDKSNLHRQIIHSTSKQGMHKAISAKQ
FT                   FLEDLNPNVIINTYLEFASASNLFSIIEQYDVVLDCTDNQYTRYLISDTCVLLGRPLVS
FT                   ASALKLEGQLCIYNYCNGPCYRCMFPNPTPVVASCAKSGILGPVVGTMGTMQALETVKL
FT                   ILHINGIKKDQFDPYMLLFHAFKVPQWKHIRIRPRQQSCKACGPNKMLSREFMESSPKE
FT                   YTTICDYVPTLSKQLAPIRRISALDLKNLIETSPHITFLDVREPVQFGICRLPLFKNIP
FT                   LSEVDSLQNLSGKVCVICRSGNTSQTAVRKLQELNPQADIFDVVAGLKGWSTEVDPNFP
FT                   LY"
FT   misc_RNA        826579..828205
FT                   /locus_tag="SPNCRNA.689"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(828012..828123)
FT                   /locus_tag="SPAC2G11.10c"
FT   3'UTR           complement(828321..829213)
FT                   /gene="prh1"
FT                   /locus_tag="SPAC2G11.11c"
FT   CDS_pept        complement(join(829214..829312,829356..829424,
FT                   829508..831499))
FT                   /transl_table=1
FT                   /gene="prh1"
FT                   /locus_tag="SPAC2G11.11c"
FT                   /product="ATP-dependent RNA helicase Prh1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.11c.1"
FT                   /db_xref="GOA:Q03319"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC2G11.11c"
FT                   /db_xref="PomBase:SPAC2G11.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03319"
FT                   /protein_id="CAA91176.1"
FT                   /translation="MVKVSGKLRNGGSITKQNLTDGLVGGQRIKAPNKKKNRKASKNTT
FT                   KKSTVSVVNFLEQDTDFGANEVVGSDNSSPEKRSENSPSKRKDILEQRKNLPIWEAHDT
FT                   LCQQIQDNRVIVVVGETGSGKSTQIPQFLNECPYAQEGCVAITQPRRVAAVNLAKRVAA
FT                   EQGCRLGEQVGYSIRFDDTTSKKTRIKYLTDGMLLRELINDPILSQYHTLILDEAHERT
FT                   LMTDMLLGFVKKIIKKRPALRVIIMSATLNAERFSEFFDGAEICYISGRQYPVQIHYTY
FT                   TPEPDYLDACLRTIFQLHTKLPPGDILVFLTGQDEIEALEALIKSYSKQLPSNLPQIQA
FT                   CPLFASLPQEQQLQVFLPALANHRKVVLSTNIAETSVTISGIRYVIDTGLAKIKQFNSK
FT                   LGLESLTVQPISQSAAMQRSGRAGREAAGQCYRIYTEADFDKLPKETIPEIKRIDLSQA
FT                   VLTLKARGQNDVINFHYMDPPSKEGLLRALEHLYSIGALDDNGHINDLGYQMSLIPLLP
FT                   SLARAVLAAREHNCLSEVIDVVSCLSTDSMFLFPQEKRDEAIEARLKFLHSEGDLLTCL
FT                   NALRQYLESSHDSRKQWCSQNFINRRALKTILDIRKQLREHCLKDGWELNSSPEVNSEN
FT                   LLLSFLSGYITNTALLHPDGSYRTIIGNQTISIHPSSSLFGKKVEAIMYHELVFTTKSY
FT                   VRGVSSIRSNWLNAVAPHYLARRST"
FT   misc_RNA        829234..831663
FT                   /locus_tag="SPNCRNA.690"
FT                   /product="antisense RNA (predicted)"
FT   intron          complement(829313..829355)
FT                   /gene="prh1"
FT                   /locus_tag="SPAC2G11.11c"
FT   intron          complement(829425..829507)
FT                   /gene="prh1"
FT                   /locus_tag="SPAC2G11.11c"
FT   5'UTR           complement(831500..831629)
FT                   /gene="prh1"
FT                   /locus_tag="SPAC2G11.11c"
FT   5'UTR           831918..832026
FT                   /gene="rqh1"
FT                   /gene_synonym="hus2"
FT                   /gene_synonym="rad12"
FT                   /gene_synonym="rec9"
FT                   /locus_tag="SPAC2G11.12"
FT   CDS_pept        832027..836013
FT                   /transl_table=1
FT                   /gene="rqh1"
FT                   /gene_synonym="hus2"
FT                   /gene_synonym="rad12"
FT                   /gene_synonym="rec9"
FT                   /locus_tag="SPAC2G11.12"
FT                   /product="RecQ type DNA helicase Rqh1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.12.1"
FT                   /db_xref="GOA:Q09811"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PomBase:SPAC2G11.12"
FT                   /db_xref="PomBase:SPAC2G11.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09811"
FT                   /protein_id="CAA91177.1"
FT                   /translation="MTVTKTNLNRHLDWFFRESPQKIENVTSPIKTLDFVKVKVSSSDI
FT                   VVKDSIPHKSKNVFDDFDDGYAIDLTEEHQSSSLNNLKWKDVEGPNILKPIKKIAVPAS
FT                   ESEEDFDDVDEEMLRAAEMEVFQSCQPLAVNTADTTVSHSTSSSNVPRSLNKIHDPSRF
FT                   IKDNDVENRIHVSSASKVASISNTSKPNPIVSENPISATSVSIEIPIKPKELSNNLPFP
FT                   RLNNNNTNNNNDNNAIEKRDSASPTPSSVSSQISIDFSTWPHQNLLQYLDILRDEKSEI
FT                   SDRIIEVMERYPFSSRFKEWIPKRDILSQKISSVLEVLSNNNNSNNNNGNNGTVPNAKT
FT                   FFTPPSSITQQVPFPSTIIPESTVKENSTRPYVNSHLVANDKITATPFHSEAVVSPLQS
FT                   NIRNSDIAEFDEFDIDDADFTFNTTDPINDESGASSDVVVIDDEEDDIENRPLNQALKA
FT                   SKAAVSNASLLQSSSLDRPLLGEMKDKNHKVLMPSLDDPMLSYPWSKEVLGCLKHKFHL
FT                   KGFRKNQLEAINGTLSGKDVFILMPTGGGKSLCYQLPAVIEGGASRGVTLVISPLLSLM
FT                   QDQLDHLRKLNIPSLPLSGEQPADERRQVISFLMAKNVLVKLLYVTPEGLASNGAITRV
FT                   LKSLYERKLLARIVIDEAHCVSHWGHDFRPDYKQLGLLRDRYQGIPFMALTATANEIVK
FT                   KDIINTLRMENCLELKSSFNRPNLFYEIKPKKDLYTELYRFISNGHLHESGIIYCLSRT
FT                   SCEQVAAKLRNDYGLKAWHYHAGLEKVERQRIQNEWQSGSYKIIVATIAFGMGVDKGDV
FT                   RFVIHHSFPKSLEGYYQETGRAGRDGKPAHCIMFYSYKDHVTFQKLIMSGDGDAETKER
FT                   QRQMLRQVIQFCENKTDCRRKQVLAYFGENFDKVHCRKGCDICCEEATYIKQDMTEFSL
FT                   QAIKLLKSISGKATLLQLMDIFRGSKSAKIVENGWDRLEGAGVGKLLNRGDSERLFHHL
FT                   VSEGVFVEKVEANRRGFVSAYVVPGRQTIINSVLAGKRRIILDVKESSSKPDTSSRSLS
FT                   RSKTLPALREYQLKSTTASVDCSIGTREVDEIYDSQMPPVKPSLIHSRNKIDLEELSGQ
FT                   KFMSEYEIDVMTRCLKDLKLLRSNLMAIDDSRVSSYFTDSVLLSMAKKLPRNVKELKEI
FT                   HGVSNEKAVNLGPKFLQVIQKFIDEKEQNLEGTELDPSLQSLDTDYPIDTNALSLDHEQ
FT                   GFSDDSDSVYEPSSPIEEGDEEVDGQRKDILNFMNSQSLTQTGSVPKRKSTSYTRPSKS
FT                   YRHKRGSTSYSRKRKYSTSQKDSRKTSKSANTSFIHPMVKQNYR"
FT   3'UTR           836014..836094
FT                   /gene="rqh1"
FT                   /gene_synonym="hus2"
FT                   /gene_synonym="rad12"
FT                   /gene_synonym="rec9"
FT                   /locus_tag="SPAC2G11.12"
FT   5'UTR           836206..836382
FT                   /gene="atg22"
FT                   /locus_tag="SPAC2G11.13"
FT   misc_RNA        complement(836307..837262)
FT                   /locus_tag="SPNCRNA.691"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        836383..837972
FT                   /transl_table=1
FT                   /gene="atg22"
FT                   /locus_tag="SPAC2G11.13"
FT                   /product="vacuolar amino acid efflux transporter Atg22"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.13.1"
FT                   /db_xref="GOA:Q09812"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPAC2G11.13"
FT                   /db_xref="PomBase:SPAC2G11.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09812"
FT                   /protein_id="CAA91178.1"
FT                   /translation="MNSPIQLHKKFSTTVWHVLSWILYAVGAGPTAIISMGVYVPLIVM
FT                   KNAHDHGFLRTDHTIPCSLYPEEPCSLNIVGPLWIDVSSIVFAASAISTFLQMAMMVSL
FT                   GVICDYGNNRRYILFSCVIIGSISGIILSWSPSSFLLGKIVFLILVDLNFIISQSCYDS
FT                   FLPIFLRFYPITRGPITLESALQDETDDLDSYITNTTIDSSEEEPYLLEHSLILNESAP
FT                   PADVEDEHKAKIAARLSSVGFGSFFGAAILFQIIFTPILYKTNNNPIILPITVTVCSCW
FT                   WLILSTPLCTIVTLPVENHSSDAILTLLYNSVKESYHSFKHAMSISSIRLFLFSRLFIN
FT                   CGIQTSLSSAVIFGKARLNLSNFQLTLLGMGISSFALLGTVIIPYLTEYFQLNSLQVVM
FT                   IISILLPMAPLYGLLGYIPGFENAGIRTSADVFRATLFFGFFLGGAHSYCRSVYAQLVP
FT                   SGKETRFFALYALISQTGVLFSHISLTLISNYTSDLRAVYIFVIVVMTLPLSSLWIMYQ
FT                   HSKTPNLHRSSS"
FT   3'UTR           837973..838256
FT                   /gene="atg22"
FT                   /locus_tag="SPAC2G11.13"
FT   5'UTR           838228..838319
FT                   /gene="taf111"
FT                   /gene_synonym="taf1"
FT                   /gene_synonym="taf130"
FT                   /gene_synonym="kat4"
FT                   /locus_tag="SPAC2G11.14"
FT   CDS_pept        join(838320..838382,838425..838995,839044..839192,
FT                   839231..841387)
FT                   /transl_table=1
FT                   /gene="taf111"
FT                   /gene_synonym="taf1"
FT                   /gene_synonym="taf130"
FT                   /gene_synonym="kat4"
FT                   /locus_tag="SPAC2G11.14"
FT                   /product="transcription factor TFIID complex subunit
FT                   Taf111"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.14.1"
FT                   /db_xref="GOA:Q09813"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="InterPro:IPR040240"
FT                   /db_xref="InterPro:IPR041670"
FT                   /db_xref="PomBase:SPAC2G11.14"
FT                   /db_xref="PomBase:SPAC2G11.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09813"
FT                   /protein_id="CAA91179.1"
FT                   /translation="MSFDGLIVENENTKSGYNDGNDLTDLFKQNGTDMSVINSLLGDTN
FT                   NPGMNESPKILDSSFENSNPQDGPNYEDFDFMGSIHKEFGNNINEMDDMEDVSDDNLPE
FT                   EEQAVNYTGDKDDEDFGKLLAKEMGEEAAGQVLSGVGFSIPSGLVPPSEPSKTVSSTTE
FT                   ELQNEAQIRESIVKTFFPTFERGVLLNFSELFKPKPVKLAPPKKKTPKVCVPGRLTLEV
FT                   DTDYAIIFNSKKSLPLKRNVVSPISTHTKKRRRTANTSQRNDGLDLNTVFTTNDWEKNI
FT                   IYDESDVNKTNQSSFFIDKSLVDIDFAFDENIFDGDTGTSKVVLNLNDPKLLLQPQLPK
FT                   KEDSQRSFADTHQRNSLAWKFNISNDPAYEMLKQNHQSKVRNTLSQLAIEHAAFAEKLT
FT                   FPYYKTRLSKRAVRSYHRPTMSFKPNAAIVFSPLIVRKRSKDKHKSERELIPTTKEITM
FT                   GDTTHAILVEFSEEHPAVLSNAGMASRIVNYYRKKNEQDESRPKLEVGESHVLDVQDRS
FT                   PFWNFGSVEPGEITPTLYNKMIRAPLFKHEVPPTDFILIRNSSSYGSKYYLKNINHMFV
FT                   SGQTFPVTDVPGPHSRKVTTASKNRLKMLVFRLIRRSPNGGLFIRQLSKHFSDQNEMQI
FT                   RQRLKEFMEYKKKGDGPGYWKLKSNEVVPDEAGTRSMVSPETVCLLESMQVGVRQLEDA
FT                   GYGKTMDEINDDEDEEQPAEQLLAPWITTRNFINATQGKAMLTLFGEGDPTGIGEGYSF
FT                   IRTSMKGGFKPAGETADDKPEPQTKNAHAYNVAKQQRAYEEEINRIWNAQKRGLSINNL
FT                   EELAKKYGINSIHDDYVESNEETTREETPSSDKVLRIVRLYRDKNGNLERKQETIHDPI
FT                   VIHAYLKKRREIDEQSTALDAVVPTGDEAIDRRNRRRLEQELAKSQKNWERRRARHAAK
FT                   EGINLNGEGRKPTTRKCSNCGQVGHMKTNKICPLFGRPEGGLATMLDKN"
FT   3'UTR           841388..841562
FT                   /gene="taf111"
FT                   /gene_synonym="taf1"
FT                   /gene_synonym="taf130"
FT                   /gene_synonym="kat4"
FT                   /locus_tag="SPAC2G11.14"
FT   3'UTR           complement(841471..841571)
FT                   /gene="tgs1"
FT                   /gene_synonym="SPAC521.01c"
FT                   /locus_tag="SPAC2G11.15c"
FT   CDS_pept        complement(join(841572..841859,841908..842053,
FT                   842126..842241,842321..842490))
FT                   /transl_table=1
FT                   /gene="tgs1"
FT                   /gene_synonym="SPAC521.01c"
FT                   /locus_tag="SPAC2G11.15c"
FT                   /product="RNA methyltransferase Tgs1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC2G11.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC2G11.15c.1"
FT                   /db_xref="GOA:Q09814"
FT                   /db_xref="InterPro:IPR019012"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PomBase:SPAC2G11.15c"
FT                   /db_xref="PomBase:SPAC2G11.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09814"
FT                   /protein_id="CAA91180.2"
FT                   /translation="MNKNEELDEDELLKKCIICPPVPKALKKYWNNRYNLFSRFDEGIW
FT                   LDYQSWYSVTPEKVAVAIAKSVVDFIQPELIIDAFSGCGGNTIQFAKYCPVISIEIDPI
FT                   KIAMAKHNLEIYGIPSSRVTFIQGDVLDTFKSLQFAKDYRSLVFMSPPWGGPSYSGKTV
FT                   YSLNDLNPYAFDVLFKEATRISPYVAAFLPRNTDVKELAAYGSIHNKPYITNFLFEGYA
FT                   KAICCYFNMKGAIARKI"
FT   intron          complement(841860..841907)
FT                   /gene="tgs1"
FT                   /gene_synonym="SPAC521.01c"
FT                   /locus_tag="SPAC2G11.15c"
FT   intron          complement(842054..842125)
FT                   /gene="tgs1"
FT                   /gene_synonym="SPAC521.01c"
FT                   /locus_tag="SPAC2G11.15c"
FT   intron          complement(842242..842320)
FT                   /gene="tgs1"
FT                   /gene_synonym="SPAC521.01c"
FT                   /locus_tag="SPAC2G11.15c"
FT   5'UTR           complement(842491..842624)
FT                   /gene="tgs1"
FT                   /gene_synonym="SPAC521.01c"
FT                   /locus_tag="SPAC2G11.15c"
FT   misc_RNA        complement(843102..844243)
FT                   /locus_tag="SPNCRNA.692"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           843197..843232
FT                   /locus_tag="SPAC521.02"
FT   CDS_pept        843233..844084
FT                   /transl_table=1
FT                   /locus_tag="SPAC521.02"
FT                   /product="WLM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC521.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC521.02.1"
FT                   /db_xref="GOA:Q9P7B5"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="PomBase:SPAC521.02"
FT                   /db_xref="PomBase:SPAC521.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7B5"
FT                   /protein_id="CAB86466.1"
FT                   /translation="MIAILYLYYILTTSILLSVSFMLRINDDDHPNEKIGFISAIKGDF
FT                   HDLSSDYLKRIAAMAFPIMKEHGFGVTSLDEVAYNAKFWGRNWNKGECIELVLRDASNR
FT                   WLPFEFVMDVFLHELCHIWQGPHDRRFFSHLSTLRAALIALYAKGYKGPGKYMTWDSFV
FT                   LANVVGNYNTVVFNGITLERSTMHGVETCGGSLQRKKKIRRKPTPSSTKKRKLTRTGQK
FT                   LGTDMNIRLELLKSPAKPQAQSMRGREARIAAALLRVDNSNEYKPKDHNSSTTLENYFV
FT                   VE"
FT   3'UTR           844085..844165
FT                   /locus_tag="SPAC521.02"
FT   5'UTR           844948..845144
FT                   /locus_tag="SPAC521.03"
FT   CDS_pept        845145..845924
FT                   /transl_table=1
FT                   /locus_tag="SPAC521.03"
FT                   /product="short chain dehydrogenase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC521.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC521.03.1"
FT                   /db_xref="GOA:Q9P7B4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPAC521.03"
FT                   /db_xref="PomBase:SPAC521.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7B4"
FT                   /protein_id="CAB86467.1"
FT                   /translation="MSRLDGKTILITGASSGIGKSTAFEIAKVAKVKLILAARRFSTVE
FT                   EIAKELESKYEVSVLPLKLDVSDLKSIPGVIESLPKEFADIDVLINNAGLALGTDKVID
FT                   LNIDDAVTMITTNVLGMMAMTRAVLPIFYSKNKGDILNVGSIAGRESYVGGSVYCSTKS
FT                   ALAQFTSALRKETIDTRIRIMEVDPGLVETEFSVVRFHGDKQKADNVYKNSEPLTPEDI
FT                   AEVILFALTRRENVVIADTLVFPSHQGGANHVYRKQA"
FT   3'UTR           845925..846142
FT                   /locus_tag="SPAC521.03"
FT   3'UTR           complement(846022..846330)
FT                   /locus_tag="SPAC521.04c"
FT   CDS_pept        complement(846331..848976)
FT                   /transl_table=1
FT                   /locus_tag="SPAC521.04c"
FT                   /product="calcium permease (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC521.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC521.04c.1"
FT                   /db_xref="GOA:Q9P7B3"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="PomBase:SPAC521.04c"
FT                   /db_xref="PomBase:SPAC521.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7B3"
FT                   /protein_id="CAB86468.1"
FT                   /translation="MSQPADINQSESSAETITQGRRADRPEETPSSSVYEQNLRFGDFL
FT                   MPTVGDADATDSLSQSTNDRDIYSPREIDQYTRKVSSRTDPSTSTISNARQHPRNSVSR
FT                   LSRSSSNVRQQRDIPKQNFKVRPLSPLRGQSPASLRSEESFTLKERQNAINKTRAFGMR
FT                   LWKPALYKKFRSINRDADIDIHDEPLKRPNTSISNVIWLICFGAPLFLVIFICYIFFTV
FT                   LSFFNVPDAIVYSKLCRGLMFYLLYPFGQHVRHKVKRLSVRSPAHPIYQTQHSHYDETP
FT                   TSHHPDPARLNFLSFSFCVNPMNQSLDCNTTPHRRNASSIIYTLMYYLIIAPTLLITSA
FT                   ICMFTIFFVPCARTLWAICRHLRTCPLSLSFRPNLALPLSMDSSDVVLLCVKKAASWKY
FT                   YKYTIDGIYIIYFDMLALIIPTIFFGFFGSQGHWFTSSVFLFTASLVSIIPLAYFIGMA
FT                   VASISAQSSMGMGAFINAFFGSVIEVFLYSVALRKGNAGLVEGSVIGSILAGLLLMPGL
FT                   SMCAGAIRKKFQFFNIKSAGATSTMLLFAVLGAFAPTMLFRIYGPFRLDCEPCGANCQK
FT                   CTKHYVLENDSLYKNRVLPFTYCCSIMLVLAYAIGLWFTLRTHASHIWQNFTADDISFL
FT                   KAEEEVGEPVNQDTAGNMSDSSEGGEAVVNGNSQHHHNRDDASSGLSSNGSENESLEHE
FT                   PTNELPQRPLVNQSQNSHGDDAPNWSRSKSAIILLSATFLYSLIAEILVEHVDTVLDKF
FT                   AISEKFLGLTLFALVPNTTEFMNAISFALNENIALSMEIGSAYALQVCLLQIPCLMGYS
FT                   LFQYYRSGDSISFKHLFTMVFPTWDMICVMICVFLLTYVHSEGKSNYFKGSILVLAYLV
FT                   SMLGFTFFNY"
FT   misc_RNA        848371..849443
FT                   /locus_tag="SPNCRNA.693"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           complement(848977..849480)
FT                   /locus_tag="SPAC521.04c"
FT   5'UTR           849421..849519
FT                   /gene="rps802"
FT                   /gene_synonym="rps8-2"
FT                   /locus_tag="SPAC521.05"
FT   CDS_pept        849520..850122
FT                   /transl_table=1
FT                   /gene="rps802"
FT                   /gene_synonym="rps8-2"
FT                   /locus_tag="SPAC521.05"
FT                   /product="40S ribosomal protein S8 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC521.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC521.05.1"
FT                   /db_xref="GOA:Q9P7B2"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="InterPro:IPR042563"
FT                   /db_xref="PomBase:SPAC521.05"
FT                   /db_xref="PomBase:SPAC521.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7B2"
FT                   /protein_id="CAB86469.1"
FT                   /translation="MGITRDSRHKRSATGAKRAQYRKKRKFELGRQPSNTRIGPKRIHE
FT                   VRVRGGNKKFRALRLDSGNFSWGSEGVSKKTRIIQVAYHPSNNELVRTNTLTKSAIVQI
FT                   DAAPFRVWYETHYGILMGSKGKKATATPTPKSKHVQRKHSARLGDSKVDSALETQFAAG
FT                   RLYAVVSSRPGQSGRCDGYILEGEELHFYLRRMAPKK"
FT   3'UTR           850123..850259
FT                   /gene="rps802"
FT                   /gene_synonym="rps8-2"
FT                   /locus_tag="SPAC521.05"
FT   5'UTR           850591..850675
FT                   /gene="rpb2"
FT                   /gene_synonym="SPAC521.06"
FT                   /locus_tag="SPAC23G3.01"
FT   CDS_pept        join(850676..850691,850730..854346)
FT                   /transl_table=1
FT                   /gene="rpb2"
FT                   /gene_synonym="SPAC521.06"
FT                   /locus_tag="SPAC23G3.01"
FT                   /product="RNA polymerase II complex subunit Rpb2"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.01.1"
FT                   /db_xref="GOA:Q02061"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="PDB:3H0G"
FT                   /db_xref="PDB:5U0S"
FT                   /db_xref="PomBase:SPAC23G3.01"
FT                   /db_xref="PomBase:SPAC23G3.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02061"
FT                   /protein_id="CAB86470.2"
FT                   /translation="MSYEDYQYNETLTQEDCWTVISSFFEETSLARQQLFSFDEFVQNT
FT                   MQEIVDDDSTLTLDQYAQHTGAQGDVTRRYEINFGQIYLSRPTMTEADGSTTTMFPQEA
FT                   RLRNLTYSSPLYVDMRKKVMVAADSNVPIGEEEWLVEEEDEEPSKVFIGKIPIMLRSTF
FT                   CILNGVSDSELYDLNECPYDQGGYFIINGSEKVIIAQERSAANIVQVFKKAAPSPIAYV
FT                   AEIRSALERGSRLISSMQIKLMARNTENSGQTIRATLPYIRSDIPIVIVFRALGVVPDR
FT                   DILEHICYDPNDFQMLEMMKPCIEEAFVIQDKDIALDYIGKRGSTTGVTREKRLRYAHD
FT                   ILQKELLPHITTMEGFETRKAFFLGYMIHRMLLCALERREPDDRDHFGKKRLDLAGPLL
FT                   ASLFRMLFRKMTRDVYKYMQKCVETNREFNLTLAVKSNIITNGLRYSLATGNWGDQKRS
FT                   MVNRVGVSQVLNRYTFASTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGMVCPAETPEGQ
FT                   ACGLVKNLSLMSYVSVGSPSAPIIEFLEEWGLETLEDYNPSASPNATKVFVNGVWLGVH
FT                   RDPAHLTETLRSLRRRLDISAEVSIVRDIREKELRLFTDAGRICRPLFIVDNNPNSERR
FT                   GELCIRKEHIQQLIEDKDRYDIDPEQRFGWTALVSSGLIEYLDAEEEETVMIAMSPEDL
FT                   EASRQMQAGYEVKEELDPAQRVKPAPNPHVHAWTHCEIHPAMILGILASIIPFPDHNQS
FT                   PRNTYQSAMGKQAMGVYLTNYQVRMDTMANILYYPQKPLATTRSMEYLKFRELPAGQNA
FT                   IVAILCYSGYNQEDSIIMNQASIDRGLFRSIFYRTYTDQEKKIGMTVMEEFERPVRSTT
FT                   LRMKHGTYDKLEDDGLIAPGTRVSGEDIIIGKTAPIPLDHEELGQRTQLHAKRDVSTPL
FT                   RSTESGIVDQVMVTTNQEGLKFVKVRMRSTRIPQIGDKFASRHGQKGTIGMTYRHEDMP
FT                   FSAQGIVPDIIINPHAIPSRMTVAHLVECQLSKVSALSGFEGDATPFTDVTVEAVSKLL
FT                   RSHGFQSRGFEVMYHGHTGRKLVAQVFLGPTYYQRLKHLVDDKIHARARGPVQILTRQP
FT                   VEGRSRDGGLRFGEMERDCQISHGCSSVLRERLFDCSDAYRVIVCDICGLIAIASYKKD
FT                   SYECRSCQNRTRFSQVYLPYAAKLLFQELMSMNIAPRLFTKNHK"
FT   3'UTR           854347..854385
FT                   /gene="rpb2"
FT                   /gene_synonym="SPAC521.06"
FT                   /locus_tag="SPAC23G3.01"
FT   3'UTR           complement(854453..854522)
FT                   /gene="sib1"
FT                   /locus_tag="SPAC23G3.02c"
FT   CDS_pept        complement(join(854523..862924,863155..869527))
FT                   /transl_table=1
FT                   /gene="sib1"
FT                   /locus_tag="SPAC23G3.02c"
FT                   /product="ferrichrome synthetase Sib1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.02c.1"
FT                   /db_xref="GOA:Q9P7T1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="PomBase:SPAC23G3.02c"
FT                   /db_xref="PomBase:SPAC23G3.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7T1"
FT                   /protein_id="CAB72227.1"
FT                   /translation="MKNSNEEDAFSTQISQLGPMRPSSDAPYHVLSLPFSHPYSAFLDA
FT                   WSWLFCGITGGEVSFFFFPVSDDVIPNTNPKNCQCYLYHSTNSQLEPLEVFHLHKLHSA
FT                   VFTSRRDPSFADDLFESSKPCLNQLLSYFSDITAFRSMDVVADIAFVCSPNFLTLKWNS
FT                   SLFDDDLARLLFFMINSKITNYDLPFSILNSPCSDLCLNSSSLANYLHGCFYHNTLSHP
FT                   YQDALKFIYEIGDDLEDTFRSFSFLELHSLAIKLSKLVTCKNEVVPIMVSHSPALFVGI
FT                   LAILYSGNAYCPIDVETRTERVHFISKDVDASFAIVSEEFVNRFPNNTIILKVPEYNES
FT                   MEIKVDDEIPPFPFPESLDSVAYVLYTSGSTGNPKGVAISHRAATNSIKSHGYLYPMFG
FT                   LERGDAWLQFANVTFDVSVFEIFGNWNNGLTLVTSKRQNLIGNLEYLIYDYKIAALELT
FT                   PTVANVISLDENKELFTSVRMLITIGELLTNRIIDFWGERLVNAYGPTEAAIHVTLNPS
FT                   KALTTVYLVGVPLQSATICVVSLPTEDSQPHVLHEGFLGEVCIAGPQLSSGYINRPEIN
FT                   AKAFVEVQYNEQTLSIYRTGDLGRIINGKLYIFGRIAGDMQIKIRGRRIEIGEIESKLA
FT                   PSVDSLAIEKIGDNLVAFYVGDEMKLRKHAESHLASWMCPTKYVGLPGFPRLASGKTDR
FT                   KALKIQFSASDKHSTDFSSFNQSELLVANVLHEICEKRFNSVVSISRFSSIFDLGLDSL
FT                   DIVYFVRKIRSLGFEANPSIVLTSKVVFKIAESLILLKPNEVQSKNNFLNKCTPLQKGM
FT                   LYESFSNNGNLYFNHTVFKIAASPEKVKLAWEKLLDTHTILSNGFALDENEGFTRFILE
FT                   KKPPLYSYSKNCLECIQKHFTTKEFDEQFLNSGPLDAAVIYDSSNCYLSIVWHHALYDG
FT                   WSIDIIMQQLFMLIHDRRLTIVPQFEDYVQELESLRRLNYKNCISFWKKYLKDFKFKSL
FT                   SYQREKMGVVELSSNISLLSVENICKQLQTTPLSFFLTAWSTVLSSYLKTNDFLVGTVV
FT                   SGRVNSLLPNVDYVIGPCMQTLPVRIKLDDELSYKNLCQNLFKELSFVLKHSVMAISDF
FT                   QEELLVSNLFESILIYQQSGIPSVDESFISLIHSTDHVEQPLLIEIEKNKGYKFKLTGY
FT                   LSSELLNNLLNDFDKILNFILYNIESKIQTHASFNVTITEHNHVESKARTGFSKREEKL
FT                   VRSCLSKILGNTVLSADVFENLQNYGFDSLCAMRFFSLLRKSSGIGNLKIPNMKSNPTI
FT                   ASLCELLVLPTETLSADNEITFYEVSDIQHEANLDIESFQYFPCTPMQQALLASSEKNG
FT                   VEYYYNKYLFETGKSSQEEIYLLFKTLLNNLPILRTCFFVTRSKKYPYCQVVLNEPNFY
FT                   FQVLPYKGESLSKYNLAEIPLLDSKKVPIQIFFLQGENKNYVLFCIHHVLYDAWAFQLI
FT                   MDDINHLLRKENPKGSQSMLKFISYLHRYNKNVDLEIWSKIFLGFKPSKFPELCKDINP
FT                   EQRTYKCNLSISLSQIDDLCNGFSFTTSTFLQCCWAKTLSFLLNSRDICFGNIISGRDV
FT                   PVDEVVSLVAPTFNSFPLRVLLDSKLSFAEVCGQLQRLKETLQEHQMTSVQSICKSLTV
FT                   KSLFDTVFIIQPQLLSDRTGPWKLLNESSSMDMRFIIELLLGSDDSPLTLVGTGTGKSG
FT                   KLVCNLYKTILKHYVHYGLSTSVPLYTSLEKHNLISRSPSSPPPIHTNFDTNADIITLF
FT                   EKEANEHPSSIALHFVYNVDKENIYSYKFFSEYSIKASYWLHSIGIKKNDVVAVFIDKS
FT                   LDYYSLMLGVLRIGAFFFPLEHCSSLNFAKENLLRTNVKLLIVDKFLPFEDVNQVEIDK
FT                   FRQVVDKLPTVEIPNESRSSAFIFPSYELAEGLTMMESSSFMDSIISFIDSTCFPSSSR
FT                   WFQYAPSSTACQMFDCFMCWFFGCTLISGPQLFLKNNLKPLLLATHASHLITTSSIAAS
FT                   LKGEDIPSIQRLYCYEGPINNYMIKSWGSRLSYIYAFKPLICSCVPATEYLESNIMMVG
FT                   IPLKGLIFAVVNSDTNTLAPIGSSGELCIASVKKSGNTMMDSQRVFTFENRSYYRTGDI
FT                   VRILAGGEFEYIKKKSFIFIDSMPLDIEGKINVDKLRDLLNDDNYIFKVDNDEFPKNDN
FT                   ILDGFQEKVILTISDFASIPFEKLSLNTKLSTIGIDSISAIQLSKDLREIFHLRISALD
FT                   ILNSSTINSLIRKLKRRRTESHTRNDKIHESIDQFFKDIRKQILIPQTLCDKIEQILPC
FT                   LASQCSMLSRFYTNGGKDYLNYSVFHLQKYNDPLLLRSSWENVISNVSILRTKFQTTKH
FT                   KRSPFCQVTYSKVDIPWSMELHAASVEKVLNEYLELQRRDLLQGKNVLPYSLIFVRTFS
FT                   QETFLIIIMHHALYDESSLRKILGLVEKSLNSPIGKFNHEPIVRQIELLKANYEEAKAF
FT                   WIKQLLSFQPTNFPSLTACRIDNEDRMLTKKPCALNYTNLTKWCNAHDVTLQVLGQLVW
FT                   AKILASYCAENYAVFGTVLSGKSVLTDVDDNIFPTVTTIPCVVKLQGTVEDCLRQLQKF
FT                   NLDANKFQFTSLLDIKKWLNLGPSEKLFSSLFSIYVDNDIPLKLFNDECKAQGFIEFPV
FT                   ALEMRFSESTSELTLNSAVNYIPQAHASLILDQFNAILTTIFNNPLQQIEILENSLPTQ
FT                   LLSIKPAIVGDYPTEIKYLHQFVEYFAQKSPNSCALEFALDINQDSVQLIRLTYSELNE
FT                   RANKLAHNLKSYGFRVGSIIAVYFDKCIEAFISMLAILKAGCCFLALDVSAPTERIRYI
FT                   VTDSTAVLVMSTGELYTKLLNASINVTILDASDPGNYSNNIENPYTKDFEDSNLAYVLY
FT                   TSGSTGKPKGCCLTHHNVVQCMLAFQDQFAGEWDTNSRFLAFASFHFDVSVLEQYFSWS
FT                   TGITLVAAPQSLILQDLPTAISALKITHVDLTPSLASILTPKTAPLLRVFITGGEQIKQ
FT                   ELLNIWGDTRVLYNFWGPTELTIGASAFRKVPKNAKVSNIGPPFPNCSTYILSKETKVP
FT                   VLLGGLGEICMGGNQVAKGYLNLPEQTDAKFYFDRRFNDRIYHTGDLGRLLKDNNSLEF
FT                   CGRTDDQIKLRGQRIEIGEINAVIKSSSEKILGVYTLAVVHPVLRKQQLVAFIHVKGIS
FT                   ASHLIVHDHKDPSLIGFINSACKASLAKYMVPSFYVFISSVPLTPTNKFDKKKVIEEFS
FT                   RLSLGQLSSFAPAREENDNEGSNVVEPKLLKIIADFSDVKVTDISPQTSVFELGLDSIS
FT                   AVALSGLLRKSGYDNANPSLILTSSTISNLGFALNTQTNEELEDSIKVNSIIKLPSCSQ
FT                   FPFHQYIELINPCLPLVEGLLFELERSNNENYYNSFFFLFEKREQADQFINNFKLLRKQ
FT                   YEVLRSSFLKSDGEYFQVVWKSDFIAEVDVLNNDSLIKTVRYSLKCEKGFFLVTVTLFH
FT                   GIYDGWSLDLLLNDLARLCSRKTLAPRPRYSKIVRQLLINTSLKKDTKEYWLNLFRSKN
FT                   IYVPIFQGKLDMAITLGHKLSISSAKLSTICRSVLKASVNSALLTSWICFLNSIGAINC
FT                   VGIVVSGRSEISMDCLEVMGPLFNTIPFPLFLEKDESFDCLVRRCQLTLASMIPYHQTS
FT                   LREIKKWLRRSELFNVLFTYNLHPSVIKQCEFPWSFSSESTDTGYPLALEIEEDVDGTM
FT                   NLHLSSNFKYIGQTEIIGLLDSYDCYLSSLLETSNAKISSRPNVLMPNQPEVKQYIPNV
FT                   WNDVLKKLITILSPKVIITKLDFERDTFVHEFGIDSIDLIWLASKVSEAGIGKLDIGLL
FT                   MEKPTFYRILQLLCETSANHSTSLKHEFGTLNTLLSKYLTDQDAEDCYPATPIQSGLLL
FT                   ETMNQKNLYQNDVLFSLDAEISLEKLQNSWKRLCQKNAILRTHFAISEDSSEPMVIQIV
FT                   DKFEARSCLNQIKILPSRFTNIEDTLRFLRHDEEAKRFLDPFKNPPYYVQFFEIGAKNY
FT                   MFVQMHHSLYDGWSLSLMYDELMQLYRDEQGNSRKPFKDYIIQLYSLKYDYDFWFKYFE
FT                   NLSIPKPLPFLSNNGKFMSSMMSTVSLPSVRLACQLYGVSIQSLVFFTWGYYIASVLNC
FT                   PDIVFHTVLSGRTYIEGAETVMGPCMNTIPVRIKFEGALQTLKKTSRMLINLAKQQHTP
FT                   LSWIYKTYGNVAAIPMESILVYQHLPDSSQSETFLNVVTDNSAVDYPIAIQFEIQGDTL
FT                   NWLTSLDLARVDGDVANQLLQTIDKIFSNLTKGSFEKLTFNFSNFVKYRQYQINLKDFR
FT                   ENLLLTEEAISDCDLLIIDERVLVVFILFPEPDAKFPYLVLNEEIIRMLKSYIKKFRLT
FT                   LSSAMVPDILVPVSYLPRSLDHSENEGKLLNIYNSISADNLKILSAVHEIHLNETEKIL
FT                   LEGFSKIICLPQDSVDISNNFFQLGMDSIRSIHLCSYLRNKGLNVSVSDILQHSSIEKL
FT                   AHYLQYEKKESSSSFDIASFQLDEYLNTLPSNIPINLVQKILPCSAGQMYALNAWYNTE
FT                   KKKYFHTFFYTTEEKIELLKLKLAWAKLVKSSDILRTTFIRSSSPCYPLLQIVLKSFEC
FT                   PWEHYITDNLHDTCLKIQKRELVTNTTLQEVPLRIATIETSGKFVFCLTIHHALYDGWS
FT                   LDIMINYLSKMYYDDSLTIVQQNSQLFLSTVLDPAVGLSRKKFWNNYLTNYKPYTFLEK
FT                   PSASQEITLFFPKLFSLDTVYSSVRSRGLTVQSVSFAVFARLLANEVKQEDVVFGIYVS
FT                   GRTLDVDNIDELLFPTFNVVPLRVTDTFRPLGEIALEIQSFLNEISGNLQYISLLDLPV
FT                   HGMMDIAVNFLSTGDNNEPSKVFSVYPLKLNNAELKINEVETTIDGCEILFGNKPKLDF
FT                   ELAIRDGYLEIGLFCQSSIFSKREASVFINNFVTIIKEIEL"
FT   5'UTR           complement(869528..869704)
FT                   /gene="sib1"
FT                   /locus_tag="SPAC23G3.02c"
FT   5'UTR           join(870740..870880,870953..871024)
FT                   /gene="sib2"
FT                   /locus_tag="SPAC23G3.03"
FT   CDS_pept        871025..872320
FT                   /transl_table=1
FT                   /gene="sib2"
FT                   /locus_tag="SPAC23G3.03"
FT                   /product="ornithine N5 monooxygenase (predicted)"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.03.1"
FT                   /db_xref="GOA:Q9P7T0"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PomBase:SPAC23G3.03"
FT                   /db_xref="PomBase:SPAC23G3.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7T0"
FT                   /protein_id="CAB72228.1"
FT                   /translation="MTEPLDLAIIGFGPASLSFLIALHDHSEEPLKNKKIRVFEKLPTF
FT                   SWHEGMLIPGSNMQISFVKDLATPRDPTSYFTFLNYLHSHGQERLSGFLNMSTLEPSRY
FT                   EYHDYLCWAASHFSKFVEYNANINKLHYDAATDLYIVGHGDTQWQAKNIIITTGCQPYI
FT                   PPLYKSVDSPLIVHSSKFMSDHSQKLLRNSKHGILVVGCGQSAAEIWKHCHYSLDPKTP
FT                   LAMCFRNLAPVPSDSSPFVNSLYFDSHNSHWWYNLPTEARLKGLSVGRTTNYSVVKESL
FT                   LEEMFKECYLQKLRYGQEFHQIMGDTDIQSIKNEGDHLVVQLTSQMDKSKKPETRKIDV
FT                   LYVATGYDHESFDVLMSSLFPNSQGAQISEEYCVLNAPSKQGKVYVAGITSNQHGIGET
FT                   LLSWAAIRAGGLAKELFGPSKPTARVPASYLN"
FT   3'UTR           872321..872773
FT                   /gene="sib2"
FT                   /locus_tag="SPAC23G3.03"
FT   misc_RNA        complement(872757..873497)
FT                   /locus_tag="SPNCRNA.694"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           872883..873166
FT                   /gene="ies4"
FT                   /locus_tag="SPAC23G3.04"
FT   CDS_pept        873167..873751
FT                   /transl_table=1
FT                   /gene="ies4"
FT                   /locus_tag="SPAC23G3.04"
FT                   /product="Ino80 complex subunit Ies4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.04.1"
FT                   /db_xref="GOA:Q9P7S9"
FT                   /db_xref="InterPro:IPR013175"
FT                   /db_xref="PomBase:SPAC23G3.04"
FT                   /db_xref="PomBase:SPAC23G3.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S9"
FT                   /protein_id="CAB72229.1"
FT                   /translation="MSETLVLHLKVPTERFREVLSSLKEKQNFTASPSSQPKPQERPFQ
FT                   MKKPRAPYGMGPRAMKRREKAEKEKLGVVNDELAESSKPSSGAATPTRSAPKSSAGLIN
FT                   SGLRALDRSGKPCRRWEKKPISIRSISTIVWKLPLWIGTPDSIPNTPELPVKTTLDSVN
FT                   EIAAALSTHAESSPMDATSPVDSMPESATGI"
FT   3'UTR           873752..874248
FT                   /gene="ies4"
FT                   /locus_tag="SPAC23G3.04"
FT   3'UTR           complement(874160..874531)
FT                   /locus_tag="SPAC23G3.05c"
FT   CDS_pept        complement(874532..875563)
FT                   /transl_table=1
FT                   /locus_tag="SPAC23G3.05c"
FT                   /product="regulator of G-protein signaling (RGS) domain
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.05c.1"
FT                   /db_xref="GOA:Q9P7S8"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="PomBase:SPAC23G3.05c"
FT                   /db_xref="PomBase:SPAC23G3.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S8"
FT                   /protein_id="CAB72230.1"
FT                   /translation="MASAPRVSEVLTKKNLPPLSLYNFYIYIRDEENAIEFLDLFLDIM
FT                   LHKFLFREHIRGLYKAGVTSTSLNTESSSTLGPHHFTRFRSASLSLEDLSTVYWPNFGP
FT                   LLLEELSNEQTINSSDLLLSKDRAAYLKNLLTSNIQSLTQESTVISKEQVKMFTQIIIE
FT                   KYFNPASPHEVMLPPQLVQPILDCKEHQRQDELRLFEDVETYLLNFLLKPAYYRFLNHK
FT                   FKHNLNPLTCTGRFIIGYVSTFAAYWLGFCGIFLDYSRRKRVWTLLPFAFGFYNLICTW
FT                   SKHDPVLALLGYSEVKPFHYEKVLQPSIRLSLNRRAIFVLSIIVLIVGANTAIFSCVPS
FT                   IRL"
FT   5'UTR           complement(875564..875763)
FT                   /locus_tag="SPAC23G3.05c"
FT   5'UTR           876862..876946
FT                   /locus_tag="SPAC23G3.06"
FT   CDS_pept        join(876947..876962,877004..877106,877175..878582)
FT                   /transl_table=1
FT                   /locus_tag="SPAC23G3.06"
FT                   /product="U3 snoRNP protein Nop58 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.06.1"
FT                   /db_xref="GOA:Q9P7S7"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="PomBase:SPAC23G3.06"
FT                   /db_xref="PomBase:SPAC23G3.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S7"
FT                   /protein_id="CAB72231.1"
FT                   /translation="MFILTETAAGYAIFKAKDKLLKKRDALIEDLKSPEGASNLLKLQS
FT                   FAKFESTVDALDNVSALVEGKVSSKLSSLLEGLSDSKSSTLVVADPKLGNAINKLPGLE
FT                   FEIISDSSVQDLYRGIREHLSSLISGLAPSDLNAMSLGLSHSLSRHKLKFSPDKVDTMI
FT                   VQAIALLDDLDKELNTYAMRVREWYGWHFPEMGKIIQDNLAYARVIKAMGMRTKCSETD
FT                   FSDILPEEIEATLKSAAEISMGTEITEEDLDNIVMLADQVLELASYRAQLSEYLRNRMQ
FT                   AIAPNLTALVGELVGARLIAHAGSLMNLAKQPASTIQILGAEKALFRALKTKHSTPKYG
FT                   LIYHASLVGQANSKNKGKIARVLATKAALSLRVDALSDKDTTNGNIGLENRIRVENRLR
FT                   SLEGGKLLPLPTAPVQQSKVQINGTSAYSTATDAVTKDAEESQEDVEMDIVIEKKKKKS
FT                   SKLKEADGESSKKEKKEKKDKKHKKSKRKSEESEDGESPKKKKKSKKSKD"
FT   3'UTR           878583..878930
FT                   /locus_tag="SPAC23G3.06"
FT   3'UTR           complement(879147..879213)
FT                   /gene="snf30"
FT                   /locus_tag="SPAC23G3.07c"
FT   CDS_pept        complement(join(879214..879835,879987..880189))
FT                   /transl_table=1
FT                   /gene="snf30"
FT                   /locus_tag="SPAC23G3.07c"
FT                   /product="SWI/SNF complex subunit Snf30"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.07c.1"
FT                   /db_xref="GOA:Q9P7S6"
FT                   /db_xref="PomBase:SPAC23G3.07c"
FT                   /db_xref="PomBase:SPAC23G3.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S6"
FT                   /protein_id="CAB72232.1"
FT                   /translation="MSFVSKSPPIVNSASPTGQVNPMEVEKANKLLEINRLILWKCLEL
FT                   QHIKTAQNSTLEQRALSTELFNSYIQRLKANLAFVVSIASPRQMQVLTPPLSCPESLPQ
FT                   LEPLYKELRQYFQIAQTSTLSYPPSNGDSSSYANGTDLHGNTGTMQQEEKANPSLTRSD
FT                   SVSSGSYITMQGANSLKAQQDLLNSFTGAPSNNSHNIPDPNLSQTFSATSMGPPNNNYS
FT                   KFRTDNYLARSSNRSGTPNIQNEQSRFFDSQQAQVQARALMQRYQQGMEFNK"
FT   5'UTR           complement(880190..880546)
FT                   /gene="snf30"
FT                   /locus_tag="SPAC23G3.07c"
FT   3'UTR           complement(880660..881022)
FT                   /gene="ubp7"
FT                   /locus_tag="SPAC23G3.08c"
FT   CDS_pept        complement(881023..883650)
FT                   /transl_table=1
FT                   /gene="ubp7"
FT                   /locus_tag="SPAC23G3.08c"
FT                   /product="ubiquitin C-terminal hydrolase Ubp7"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.08c.1"
FT                   /db_xref="GOA:Q9P7S5"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PomBase:SPAC23G3.08c"
FT                   /db_xref="PomBase:SPAC23G3.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S5"
FT                   /protein_id="CAB72233.1"
FT                   /translation="MPHSNTLIVPSTNPFDDPSSIKNGLNNLTSSELVNQMKKESLAAS
FT                   VKTPSTPPKECSHLKKGVKLSHLKGNARALRDPSKHLCFICTTEKIKREDYELTLCANC
FT                   GYLFCCNHESDHSRKHFEKNKKHCVFVNIITLKCHCYSCDADIVIFDKKNLVVRDVQQF
FT                   ICSNLVSSLTKAPNVLKSNSSHFKKEKKSKHSSGKSSKKYKVISPGLKNLGATCFFNST
FT                   LQVLCACEALHDVISPFQYSHSSVIVRKLTKSPESSLLSAFIKFLETFYKSDGTISVYR
FT                   PTTFFGEFRRLHPQFSESVQQDAHELLRLLLDDLISEEFRVLRFNLNSVSRSLQLSPCL
FT                   TDDEQLSKSLTSFKQVNVTDASLSPNSHNTSDNEQNNEDYVSVSSLVGSETEDITYSKE
FT                   LSQSSDSSQHQHDSFLPANSSPLAASSTKSLPSSELLDSSSDKGQQVFKGQHEVAGTNS
FT                   FEDPNSHFNVSNSSNHEEASPKKEVLKSPQFQRRSLDILRLGELSSDDMMLDKATMDEF
FT                   SSSLVIKSIFTGRLTSVVMCQSCNEITNTPEPIQDLSIPIHYPSSRVSRRHRFHRALRS
FT                   RFSRSPKKSSVKIVVDNANDDTDQAPTTNSSSLNENLLGGHASENDKSLKQSPFQKLTR
FT                   RLSDLSVNSSGQISKQDFDNSNSIFSESSLSSPIIEEPKTLIDCLKNFTHVEELSGENM
FT                   FACENCCNQPNEVGSPAKGGLTSDNDKYSFNNSVYRNAYKRMLLDDPLPPVFIIHLKRF
FT                   FQEISHDGYANPKKISDFIEFEQELDLNEFVMPHLRASSSFRYRLFGVIVHSGTLNYGH
FT                   YVAYVLSHKFLDLSAPSTNSKDFRSEAGIPERRWLYISDNIVRESSWDEVSKVEAYMLF
FT                   YERV"
FT   5'UTR           complement(883651..884231)
FT                   /gene="ubp7"
FT                   /locus_tag="SPAC23G3.08c"
FT   5'UTR           884365..884444
FT                   /gene="taf4"
FT                   /locus_tag="SPAC23G3.09"
FT   CDS_pept        884445..885542
FT                   /transl_table=1
FT                   /gene="taf4"
FT                   /locus_tag="SPAC23G3.09"
FT                   /product="transcription factor TFIID complex subunit Taf4
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.09.1"
FT                   /db_xref="GOA:Q9P7S4"
FT                   /db_xref="InterPro:IPR007900"
FT                   /db_xref="PomBase:SPAC23G3.09"
FT                   /db_xref="PomBase:SPAC23G3.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S4"
FT                   /protein_id="CAB72234.1"
FT                   /translation="MDLNNPPSKRFGDDDDIPANKRPKNEEYPEIPGYLGNRKPSYTQN
FT                   PNSGPGKLHYASPRPNNVSSSVGVASGGDRQEADQLQDALISCGIQLKEEELNLSTSFY
FT                   DPSSLNTFALTTEDRSRKSDFLNSFVLMQTVSNIVNLHRLKSMDSDIHALISMAVRDYL
FT                   ANLLQKMIVESHHRTSQLHTDNYKQVDNVRQTLANFAYKEYESEERRRTVLNIRRAEHE
FT                   ARLAELNSASTNEEGSSRRRKEQSSSAAAKNISEDAQNRMTNATASIMAGSALPSGGKK
FT                   YSWMATDMTPMTPAVGGGFGIRKKDSNSLKPSSRDGVLPLQQEEKGIITIRDALAVLEM
FT                   DREGAGRIFGRGAKAMMRAYIRLKD"
FT   3'UTR           complement(884513..885894)
FT                   /gene="ssr3"
FT                   /locus_tag="SPAC23G3.10c"
FT   3'UTR           885543..885989
FT                   /gene="taf4"
FT                   /locus_tag="SPAC23G3.09"
FT   CDS_pept        complement(885895..887172)
FT                   /transl_table=1
FT                   /gene="ssr3"
FT                   /locus_tag="SPAC23G3.10c"
FT                   /product="SWI/SNF and RSC complex subunit Ssr3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.10c.1"
FT                   /db_xref="GOA:Q9P7S3"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="PomBase:SPAC23G3.10c"
FT                   /db_xref="PomBase:SPAC23G3.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S3"
FT                   /protein_id="CAB72235.1"
FT                   /translation="MSNNSRLPENGVQSGNGEDAELKKSMRIIEREIPDSLLEKIPEAE
FT                   DYIALQDLERKLDSLIVRKRFDLQDSLSRNSHKTRILRMYIHSTVANQSWQQKGENQEN
FT                   NSGDINSLPIPEWTLHIEGRLLVNPDDEDDKAFELAPFTNFFRKIAIQILRSDDLYPSG
FT                   NYVEWNKLPDNSNTSNGITVTRKGDQSVDVKIMLYPEEHPERYKLSKAFANILGIREGT
FT                   RPDIVSYLWQYIKFHRLQDMEEKRLINCDKALRDLFEADRLYFPRIPELMNRFLEPIDP
FT                   IVIPYTINVSEHTVEKVTIFDIRINTEDPRHSQIRSFLATMMSQDKIRSIDDKLTELIQ
FT                   AITYSQSKYDFMKKFSESPIEFINEWIESQSRDLEIVLDGTNMNYAEKRSADYYQQPWV
FT                   HESAFHYLNLLNSKKQQSVLNASAKK"
FT   5'UTR           885944..887660
FT                   /gene="rpn6"
FT                   /locus_tag="SPAC23G3.11"
FT   5'UTR           complement(887173..887531)
FT                   /gene="ssr3"
FT                   /locus_tag="SPAC23G3.10c"
FT   CDS_pept        join(887661..887836,887899..887981,888027..889033)
FT                   /transl_table=1
FT                   /gene="rpn6"
FT                   /locus_tag="SPAC23G3.11"
FT                   /product="19S proteasome regulatory subunit Rpn6
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23G3.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23G3.11.1"
FT                   /db_xref="GOA:Q9P7S2"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040773"
FT                   /db_xref="InterPro:IPR040780"
FT                   /db_xref="PomBase:SPAC23G3.11"
FT                   /db_xref="PomBase:SPAC23G3.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S2"
FT                   /protein_id="CAB72236.1"
FT                   /translation="MSSKSSLELANNAVKSNDIEKAIDLYKEVLNKGVSKDEKVANEQE
FT                   QALTNLSDLYVRENRHNDLAQLVQQSRPLMANFSKAKSAKIVRTLIDKFSGEKKSLPLQ
FT                   IEVANDCIKWAIKEKRTFLRQALETKLISLYYDNSSYTDAINLINTLLSELKRMDDKML
FT                   LTEVHLLESKVYHAIRNIPKARASLTAAKTSANAVYCPPMLQGNLDLQSGILHADDMDF
FT                   KTAYSYFYEAYEGFTSLDDDKKALSSLKYMLLSQIMLNSVSEVKSLLTGKHAIRYAGRD
FT                   IEAMRAIAQAHENRSLADFEKALQDYKPELASDPIIRSHLSSLYDNLLEQNLLRVVEPF
FT                   SRVEVSHIAELIGLSTVQVEGKLSQMILDKIFYGILDQGSGCLIVYDEPQQDKTYEAAL
FT                   EVIKNMGTVVDLLIENKASALL"
FT   3'UTR           889034..889096
FT                   /gene="rpn6"
FT                   /locus_tag="SPAC23G3.11"
FT   3'UTR           complement(889058..889129)
FT                   /locus_tag="SPAC23G3.12c"
FT   CDS_pept        complement(889130..892120)
FT                   /transl_table=1
FT                   /locus_tag="SPAC23G3.12c"
FT                   /product="serine protease (predicted)"
FT                   /db_xref="GOA:Q9P7S1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7S1"
FT                   /protein_id="CAB72237.1"
FT                   /translation="MSIKKRARAGSKSDDIGNKTPKKNGIEHEATKSSETVIEMTPSGP
FT                   IAESKKWKESIARVVKSVVSIRFSQVAAFDTDESGTGEASAFVVDAKNGYMLTNRHVVC
FT                   AGPFVGHAVFDNHEEVEVFPVYRDPVHDFGFLRFDPKKIRYMNVEQLELRPDLAKVGTE
FT                   IRVVGNDAAEKLSILAGWISRIDRNVPDYGELTYCDFNTNYIQAAANASGGSSGSPVVE
FT                   RNGNVVALQAGGHMIAATDYFLPLDRPLRALRCLQNNTPITRGTIQAQFLIKTFDECSR
FT                   LGLDSAMEEKVRTLFPEATSMLVVETVLPEGPSFKKLKEGDILLYVNSMILINLIELES
FT                   ILDESVGKDVVLTVQRGSELVELTCTAQSTHDIAPDRYVEVCGAKFHNLSYQLARQYAL
FT                   PVKGVFISEPAGSFRLEGPEYGYILDSIAYKPVPDLDTFIEVMRDIPDRSRVAVGYHFI
FT                   HDKHSLITDVVEIDRHWLKAFRMVTRNDETGLWDFKNLGDPLPAEPSKPCTTSIPKLNV
FT                   ENFGPTANIINCFVKVLYYMPLHLDGSRKSRKKGTALVLDKDKGLAVTSRSTVPYDLGD
FT                   LTITVADSIQIPAEVVHLHPTQNLAFIKYDPKLLGDTPIQAAKLKDYYVSQGDPVNFFG
FT                   FNSKSRVVAAKTSVTDVITMVIPSSPMPRFRAINFESITVESNLSTQCGSGVLTDDDGL
FT                   VVALWLTHYGEQTSRGTDVKYHLGLASPVVLSTLRRLQSGVNVNPRILNVEFRAIQLAQ
FT                   ARSLGLPAERIRKIETESGKKHQLFMITHVEAGTPRILTDGDIIISANGKSITRIRDLQ
FT                   VDDVTEVDMEILREGKVQTVKVPTFPSDNCETNRVVICWGATLQAPHRAVRLQIEDLPS
FT                   NVFVTNRGRGSPADQYDLGAAQFITAVNGVTTLNLEDFVREIRKIDDNSYVRVSTSTFD
FT                   KVPVVLTIKMNKHYFPTIDLVQDAKAENGWRAVQYDEVGEKKNPSMGFTIDEEVDDNTF
FT                   DTEGEQQ"
FT   5'UTR           complement(892121..892211)
FT                   /locus_tag="SPAC23G3.12c"
FT   3'UTR           complement(893278..893718)
FT                   /gene="mug35"
FT                   /gene_synonym="SPAC23G3.13c"
FT                   /locus_tag="SPAC22H12.01c"
FT   CDS_pept        complement(893719..894423)
FT                   /transl_table=1
FT                   /gene="mug35"
FT                   /gene_synonym="SPAC23G3.13c"
FT                   /locus_tag="SPAC22H12.01c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22H12.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22H12.01c.1"
FT                   /db_xref="GOA:O94435"
FT                   /db_xref="PomBase:SPAC22H12.01c"
FT                   /db_xref="PomBase:SPAC22H12.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94435"
FT                   /protein_id="CAB72238.2"
FT                   /translation="MTNERHDELACLGIFPLKNPKQLDGVVTPILQLRVKFLAPTDRWW
FT                   EGLVINKDLSKEESEELWKFLQSFDPRSAKFVGRGTPEDHVISYLFEAGKYEFEVFFYQ
FT                   KDHSLKLMGLYDKTQKQLLRRDSSGDLTSTDKERDVSPVSHSEKPYWDRYDLDQPSNQD
FT                   VEESRNLVQEPKHRSKKYDRLGLDELVMEQTASLWKICSRNGMSVDEFLRFIRMGLESN
FT                   FQHSNQVIPTHF"
FT   5'UTR           893996..895365
FT                   /gene="tfg3"
FT                   /gene_synonym="taf14"
FT                   /locus_tag="SPAC22H12.02"
FT   5'UTR           complement(894424..894532)
FT                   /gene="mug35"
FT                   /gene_synonym="SPAC23G3.13c"
FT                   /locus_tag="SPAC22H12.01c"
FT   CDS_pept        join(895366..895407,895597..895765,895823..895974,
FT                   896039..896401)
FT                   /transl_table=1
FT                   /gene="tfg3"
FT                   /gene_synonym="taf14"
FT                   /locus_tag="SPAC22H12.02"
FT                   /product="transcription factor TFIIF complex subunit Tfg3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22H12.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22H12.02.1"
FT                   /db_xref="GOA:O94436"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="PomBase:SPAC22H12.02"
FT                   /db_xref="PomBase:SPAC22H12.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94436"
FT                   /protein_id="CAA22554.1"
FT                   /translation="MTTVKRTVRLITDQNVLPGGEAAVLNDQSFPVREWSIKLVCLNPQ
FT                   GEETDASFVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYADKGGEHRF
FT                   LHYLHFQQEHYHEDIELNINATRPGLLKALTATGEVPGYSDEGEEARKDKRKNESEVGA
FT                   GKKKAKAKPVDMDKLAEGLQKLQEDDLLQVVQMVNENKTPDMYVRNDIEGGEFHIDLYT
FT                   LPDNLLLLLYSFCAKRVTM"
FT   3'UTR           896402..896547
FT                   /gene="tfg3"
FT                   /gene_synonym="taf14"
FT                   /locus_tag="SPAC22H12.02"
FT   5'UTR           896668..896876
FT                   /locus_tag="SPAC22H12.03"
FT   CDS_pept        join(896877..897163,897242..897767)
FT                   /transl_table=1
FT                   /locus_tag="SPAC22H12.03"
FT                   /product="mitochondrial hydrolase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22H12.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22H12.03.1"
FT                   /db_xref="GOA:O94437"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PomBase:SPAC22H12.03"
FT                   /db_xref="PomBase:SPAC22H12.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94437"
FT                   /protein_id="CAA22555.1"
FT                   /translation="MSLKPVKLAFEKYSATVAKHPPVLIFHGLLGSKRNWRSLAKKFSC
FT                   KLDRDIYAIDQRCHGDSPCVAPLSYSAMALDAFQFMKDHKLDKASIIGHSMGAKTAMVT
FT                   ALKWPDKVEKLVVVDNSPWYQDLPRDYGAYFRKMIQIDEANITKYSEADKMMSTVEKDI
FT                   LVRSFLLSNLKKDSNNSNTFKFRVPIELISKSLKTIEGFPASLNDLVYDSPTLVIRALK
FT                   APFIPDSALPVFKKFFPKYELVSLDCGHWVHFEKPKEFSESIINFLNN"
FT   3'UTR           join(897768..897781,897829..897900)
FT                   /locus_tag="SPAC22H12.03"
FT   3'UTR           complement(898045..898190)
FT                   /gene="rps102"
FT                   /gene_synonym="rps1-2"
FT                   /gene_synonym="rps3a-2"
FT                   /locus_tag="SPAC22H12.04c"
FT   CDS_pept        complement(898191..898949)
FT                   /transl_table=1
FT                   /gene="rps102"
FT                   /gene_synonym="rps1-2"
FT                   /gene_synonym="rps3a-2"
FT                   /locus_tag="SPAC22H12.04c"
FT                   /product="40S ribosomal protein S3a (predicted)"
FT                   /db_xref="GOA:O94438"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94438"
FT                   /protein_id="CAA22556.1"
FT                   /translation="MAVGKNKRLSKGKKGIKKRVVDPFSRKEWYDIKAPAFFEVKNVGK
FT                   TLVNRTAGLKNANDSLKGRILEVSLADLQKDEEHAFRKVKLRVEDIQGKSCLTSFNGLS
FT                   ITSDKLRSLVRKWQTTIEADQTIKTTDGYLCRVFVIGFTRRRANQVKKTTYAQSSQIRA
FT                   IRQKMFQVIQNQTSSCSMRELVQKLIPEVIGREIERATGSIFPLQNVLVRKVKILKAPK
FT                   HDAQKLLELHGESQDVGTKVVKDVAPLESV"
FT   5'UTR           complement(898950..898994)
FT                   /gene="rps102"
FT                   /gene_synonym="rps1-2"
FT                   /gene_synonym="rps3a-2"
FT                   /locus_tag="SPAC22H12.04c"
FT   3'UTR           complement(899283..899566)
FT                   /locus_tag="SPAC22H12.05c"
FT   CDS_pept        complement(899567..901753)
FT                   /transl_table=1
FT                   /locus_tag="SPAC22H12.05c"
FT                   /product="fasciclin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC22H12.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC22H12.05c.1"
FT                   /db_xref="GOA:O94439"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="PomBase:SPAC22H12.05c"
FT                   /db_xref="PomBase:SPAC22H12.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94439"
FT                   /protein_id="CAA22557.1"
FT                   /translation="MNLQFRLYLLFILLFISFANGKNEYEDKSTSIIDLLSSKSQFSKL
FT                   IRRLQRNRLVPYLNRNKGLTLFAPLNEAFPDDSIEPNLLYYIVNTTELDRSVLRTQLKS
FT                   SDGQQIALKIHYKAETGRAYDKVNNAQIVQSNWRADSGVVQVIDNIIDLPPPALEILSS
FT                   EKDFSIFHRLSVAWVGEYSSVTMLVPDSSAFLNVYTNTELAYLYSMYAAEDVKTLIHQH
FT                   ILVNQRVYAEDVIEPKTFHYKNGISISMKFDKDQKKLFINDVSTTKYDLLTFSGAIHTV
FT                   SSLINPEIISFTPAKYLIGIGAAWFSEKLSRERKSISVDKTSKRAILAPTNWAYREIID
FT                   IDYHIIENFDLPAPNKYALYVTNIKSGNSVGEDTNALVRIATGSAGEMYVNVETRSIQS
FT                   ENIGNVSLYVLDKDIEPPQPLLSQLILVDEISFSVRYLASLGLGDYTKVTWFLVKNSAW
FT                   TQLGLVHLVLQQNLELLESVMLDYAFEGIAFYGSSDEAWASGNYTTLSNKEFLIEGVYE
FT                   DSNSRNKRDLLRINNEIYEVQTRDLLVKDGVVHLVDKVKLPFSVSQKDMIIAGGRKEFL
FT                   ELLDKFEMLDMLDSGYPVVVPSLTGSDVNTKDSSFAERHIIDPEKRNFVISGSRLSVDS
FT                   SPWISIQDYGYSELGNVYFVQNAIPTKRQNRWRITFISISGLLLSVGICVLCYKIYFKF
FT                   FRNRFMNQGEREPLLAPADSDTMAGRRNSSSLSV"
FT   5'UTR           complement(901754..902080)
FT                   /locus_tag="SPAC22H12.05c"
FT   5'UTR           903042..903100
FT                   /gene="rpc19"
FT                   /gene_synonym="rpa17"
FT                   /gene_synonym="SPAPYUL23.01"
FT                   /locus_tag="SPAC1687.01"
FT   CDS_pept        join(903101..903172,903246..903343,903392..903468,
FT                   903546..903676)
FT                   /transl_table=1
FT                   /gene="rpc19"
FT                   /gene_synonym="rpa17"
FT                   /gene_synonym="SPAPYUL23.01"
FT                   /locus_tag="SPAC1687.01"
FT                   /product="DNA-directed RNA polymerase I and III subunit
FT                   Rpc19"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.01.1"
FT                   /db_xref="GOA:Q09177"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR033898"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="PomBase:SPAC1687.01"
FT                   /db_xref="PomBase:SPAC1687.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09177"
FT                   /protein_id="CAB50921.2"
FT                   /translation="MAAMTDVTDPSSVAMESATEKIIILPGHSADLTSVTFQIQKEDHT
FT                   LGNSLRYVIMKNPEVEFCGYSIPHPSEAKMNFRIQTAPSTTAVDVLRKGLDDLIDLCDA
FT                   VTEKFTEQLPRDTSTTMEVDG"
FT   intron          903173..903245
FT                   /gene="rpc19"
FT                   /gene_synonym="rpa17"
FT                   /gene_synonym="SPAPYUL23.01"
FT                   /locus_tag="SPAC1687.01"
FT   3'UTR           903677..903861
FT                   /gene="rpc19"
FT                   /gene_synonym="rpa17"
FT                   /gene_synonym="SPAPYUL23.01"
FT                   /locus_tag="SPAC1687.01"
FT   5'UTR           904026..904265
FT                   /locus_tag="SPAC1687.02"
FT   CDS_pept        join(904266..904628,904680..905132)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.02"
FT                   /product="CAAX prenyl protease (predicted)"
FT                   /EC_number="3.4.22.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.02.1"
FT                   /db_xref="GOA:O94448"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR039731"
FT                   /db_xref="PomBase:SPAC1687.02"
FT                   /db_xref="PomBase:SPAC1687.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94448"
FT                   /protein_id="CAA22596.1"
FT                   /translation="MRVYLISFFFTAIYVVSLYTFPVARPRPSLNRNDPKVITARCISV
FT                   LLASSVCCILTRLIIGPSLNVFTFPTDQVLKSLLHAATIFIGPLYEVWIVDKEYRLFFI
FT                   HLKDCLSNAIAWRNIIIGPLSEELTFRCCIVPICEAAGWSRLKIIFVAPLLFGMAHIHH
FT                   TYEFLLAYPNAYIAAALQTVVQFSYTTVFGWYTTHLFLSTHSLFPSFLVHAFCNSMGLP
FT                   TLYGKIGNRNQTRIYYTLLLLGVLIFYMTWGITDFNNHQDFEPRLVPLN"
FT   3'UTR           complement(905077..905128)
FT                   /gene="rfc4"
FT                   /locus_tag="SPAC1687.03c"
FT   CDS_pept        complement(join(905129..905977,906033..906144,
FT                   906288..906355))
FT                   /transl_table=1
FT                   /gene="rfc4"
FT                   /locus_tag="SPAC1687.03c"
FT                   /product="DNA replication factor C complex subunit Rfc4
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.03c.1"
FT                   /db_xref="GOA:O94449"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC1687.03c"
FT                   /db_xref="PomBase:SPAC1687.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94449"
FT                   /protein_id="CAA22597.1"
FT                   /translation="MSNAVSSSVFGEKNNSVAYELPWVEKYRPIVLDDIVGNEETIDRL
FT                   KVIAKEGNMPHLVISGMPGIGKTTSILCLAHALLGPAYKEGVLELNASDERGIDVVRNR
FT                   IKAFAQKKVILPPGRHKIIILDEADSMTAGAQQALRRTMEIYSNTTRFALACNQSNKII
FT                   EPIQSRCAILRYSRLTDQQVLQRLLNICKAEKVNYTDDGLAALIMTAEGDMRQAVNNLQ
FT                   STVAGFGLVNGENVFRVADQPSPVAIHAMLTACQSGNIDVALEKLQGIWDLGFSAVDIV
FT                   TNMFRVVKTMDSIPEFSRLEMLKEIGQTHMIILEGVQTLLQLSGLVCRLAKSQMKPESF
FT                   II"
FT   3'UTR           905133..906347
FT                   /locus_tag="SPAC1687.02"
FT   5'UTR           complement(906356..906465)
FT                   /gene="rfc4"
FT                   /locus_tag="SPAC1687.03c"
FT   5'UTR           906778..906883
FT                   /gene="mcb1"
FT                   /locus_tag="SPAC1687.04"
FT   misc_RNA        complement(906863..908571)
FT                   /locus_tag="SPNCRNA.695"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        join(906884..907045,907090..908433)
FT                   /transl_table=1
FT                   /gene="mcb1"
FT                   /locus_tag="SPAC1687.04"
FT                   /product="MCM binding protein homolog Mcb1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.04.1"
FT                   /db_xref="GOA:O94450"
FT                   /db_xref="InterPro:IPR019140"
FT                   /db_xref="PomBase:SPAC1687.04"
FT                   /db_xref="PomBase:SPAC1687.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94450"
FT                   /protein_id="CAA22598.1"
FT                   /translation="MVIALSDSFIENPRSFLQRFQDALFAGSKPDLQGTLGIDEEVSNI
FT                   FATEERIRKIPNYLDCKWSELKTGQLLRLQGMVQDTNFGHEFFAGAVEVNENIWRGCRY
FT                   ILDFSEDEMHLDESKIVLDERYSLFLTNVPGERTLPVIEALGNWGSESLKERSLKYSNR
FT                   LQASNDTGVCVKCYGGMETKVQVCQAIDVIGIYEEPSEYSDGLPILHMLCFKDYTQSAT
FT                   QAPSPQQAEIIRPKILKYFEKVLGENIAAESLMLALLSNVVHKTTGLVIGGFTLNLTNC
FT                   TSELVSQLVSVLRPLIKRMVIQKVNVAELNRKPLYPLSDGETLDTSHLQVAPGTLIVLD
FT                   ETELSSGTLNDVGCRNVQFLSSLISQQDLTFFYPFSSFTVHSNVRIIILSHGRSILPAD
FT                   VGCRCRGDSPDTIEFPTDSDELQEFCNFFHMWNMRANIPENMLDYIQSTYVSSRQYNKE
FT                   INEKTLSLQINCSRLYAKSFGRQLVSRIDFEAARSLINHWTVN"
FT   3'UTR           908434..908799
FT                   /gene="mcb1"
FT                   /locus_tag="SPAC1687.04"
FT   5'UTR           908736..908838
FT                   /gene="pli1"
FT                   /locus_tag="SPAC1687.05"
FT   CDS_pept        join(908839..908871,908924..911074)
FT                   /transl_table=1
FT                   /gene="pli1"
FT                   /locus_tag="SPAC1687.05"
FT                   /product="SUMO E3 ligase Pli1"
FT                   /db_xref="GOA:O94451"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR023321"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR038654"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94451"
FT                   /protein_id="CAA22599.1"
FT                   /translation="MNQANFLQELPNVLKRLETGLIIPQLKDILRVFGLRLSGTKAELI
FT                   TRIKQLIERIAIENNTTSWEALKKAIDGDVTSAVCILKYNTYQIYSAAAPIAPPSSASG
FT                   NRSYSRPFAPVVHSRIRFRKSPFYDILEQFNAPFVVPACVGTRNTISFSFHVTPPALSK
FT                   LLNDPKQYRVYLFSTPSETIGFGNCLMEFPTPQMELRINNQVAHANYRRLKGKPGTTNP
FT                   ADITDLVSKYAGPPGNNVVIYYMNSTKSYSVVVCFVKVYTIENLVDQIKSRKAESKEKI
FT                   IERIKNDNQDADIIATSTDISLKCPLSFSRISLPVRSVFCKHIQCFDASAFLEMNKQTP
FT                   SWMCPVCASHIQFSDLIIDGFMQHILESTPSNSETITVDPEGNWKLNTFDEPVESSEDE
FT                   FVPKEKVIELSDGEGISTMANKSNDQPTRRASTHNSGPPAKRKRESLVIDLTISDDDEN
FT                   VATSTTESPSNATKENSLSRNVQSPNIDTAISNRSTNVRHGHPGFKDYTVENSPASRER
FT                   STSESAQSSVHMGYAGEGGLLSGALRAPSQQNNNNSNTQHSINLHTIVPSPYEPPLSVT
FT                   PSTAITNLSIPESNRTNSSASSKSFTMNDLILPPLHLKNTTQTNNAHEDAQSSNLSQNH
FT                   SLFYERIPQRPSYRIEKQNKGIYEDENEQSISAMPIPRAHPQLPKNLLSQTAGPLWDEQ
FT                   QDAQVDWNSELQSNNSYHNSGFEGTGNTFQSID"
FT   3'UTR           911075..911854
FT                   /gene="pli1"
FT                   /locus_tag="SPAC1687.05"
FT   3'UTR           complement(911227..911273)
FT                   /gene="rpl44"
FT                   /gene_synonym="rpl28"
FT                   /locus_tag="SPAC1687.06c"
FT   CDS_pept        complement(911274..911678)
FT                   /transl_table=1
FT                   /gene="rpl44"
FT                   /gene_synonym="rpl28"
FT                   /locus_tag="SPAC1687.06c"
FT                   /product="60S ribosomal protein L28/L44 (predicted)"
FT                   /db_xref="GOA:O14069"
FT                   /db_xref="InterPro:IPR002672"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14069"
FT                   /protein_id="CAA22600.1"
FT                   /translation="MSVSNDLIWQVIRDNNRFLVKRPEFGGIQFNREPVNVSGKNAQRF
FT                   SGLCNDKAVGVQANSPRGVVLITKTNPKNAQKPAKLFRKDVIANASSRKTYKSIAGRIG
FT                   RTGYRDDLVKVSVARASAILSSQRPKKTVA"
FT   5'UTR           complement(911679..911720)
FT                   /gene="rpl44"
FT                   /gene_synonym="rpl28"
FT                   /locus_tag="SPAC1687.06c"
FT   rRNA            complement(912230..912396)
FT                   /locus_tag="SPRRNA.12"
FT                   /product="5S rRNA"
FT   CDS_pept        913657..914031
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.07"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.07.1"
FT                   /db_xref="GOA:O14068"
FT                   /db_xref="InterPro:IPR018559"
FT                   /db_xref="PomBase:SPAC1687.07"
FT                   /db_xref="PomBase:SPAC1687.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14068"
FT                   /protein_id="CAA22601.1"
FT                   /translation="MASFHIIVSYVTVVLAIIIAITFAARRFWISRYRSIRYSPVENSF
FT                   EADFNNGLNSSSFDIAQNILAQDTRAGLDEAATSQIRGLMKQLQCSFDQARLIYIRKVM
FT                   SDNNVDSTGMPLDNKAVTKL"
FT   CDS_pept        914328..914618
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.08"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.08.1"
FT                   /db_xref="GOA:O14067"
FT                   /db_xref="PomBase:SPAC1687.08"
FT                   /db_xref="PomBase:SPAC1687.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14067"
FT                   /protein_id="CAA22602.1"
FT                   /translation="MFIFNVLTIRCTFHVLFAICYFCDHLLQYISNSRDSKAGLKIFLV
FT                   FELAVTIFNTVMLQLANRVKNGLTLAILIVSVVMFVYHQQLIVNCKKMLAL"
FT   5'UTR           914940..915091
FT                   /locus_tag="SPAC1687.09"
FT   CDS_pept        915092..919231
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.09"
FT                   /product="ENTH/VHS domain protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.09.1"
FT                   /db_xref="GOA:O14066"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="PomBase:SPAC1687.09"
FT                   /db_xref="PomBase:SPAC1687.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14066"
FT                   /protein_id="CAA22603.1"
FT                   /translation="MDAIHPVSLRNSKRHPLLHSERNLSRRAVSPSISRSFFQHSNGSF
FT                   PLFQNHRKSLPSAIYKSVDPYVDANPLDPLAAAKASFADFPEQDDSQSSTSPLSSKYHT
FT                   KKNKQIFVEDSRRGGAASNAAAIAAKKSGYYERTSTRKRSLTVPTPRTSFPHHPRSRRF
FT                   SLKNAAIATSYHKFKPLSSNSLSSSGMHFSASKQAFNSPLLQTFSPSPSVSPFSNPAVE
FT                   KLKTSASKQAAEAQSLREFDFFTPTPEPSDKNLEKLKNGASKQASESQSLKNMESLSLA
FT                   RSSPILTSEKLKNGASKQAIESPPFRASEPLPSSNIIPNPAMERLKNGASKLAIESQPF
FT                   KSAEPLSSAIPLPNPMSEKMRNGASKQAIMAQSSKINPLPPLTASISDPSFEKLKNTAS
FT                   KQAIESQSLMNSGPELLEPSISDPMLEKMKTDAGKQTVESLSLKSSDATIPKPSVSDLG
FT                   VEKLKNDASKCAVESQSLMINDPSVSSTSFYNPNMEKLKNGAIKQAIEHQALNAAILNK
FT                   TQLPYFHQSSSELPISASKRAALSQQTESASKSSSNISEMCDSHPPSNFSISASQQASK
FT                   DRFSEATSSIDLDLSPGRSLSLASSKLSVKEAGARVYNRSVATPVMTPSNPFEISKSAS
FT                   QLASIAQVPVSEPAKTSEVNLKKSLSLASSKLSFQEAGTSLKEKTANVQHSPEVLNDRS
FT                   LASLSASRHADAISSKSKQHTEIAQPAFNTTGTVLMKTKSNLSDSALSTPQHSDSVLFD
FT                   ITSKAARLASTCAKTDLHRKPRRKHKSFTLENYFGHNAEDESPQSDEVESQTPPSGYSE
FT                   NDIGGTDIYPFALQGAALAAAKDFSRREASLSDSQSAASMDMLPMKKKLSHSSASSTRS
FT                   IKSLLTNANQKHIHSSINETDDIPTMAAHIVATGQKNKEKAPSFSNDQALDHLLGSAHK
FT                   RIPSNKTEWSSSSLHIPSHNSFSDIHHRKIAAHAAAITAASEKLTPSIEETSYSSSKAH
FT                   DASLSAATLVANKDKLIHAPTPQVLAPVLPKVSLPHRHSVSLGQIRGESEVEGDVFYDA
FT                   PSDKEDLGSSNAPLDVPHGANRSSMDEVNGSKYDYSDGILDGSGQYTDSDMSDDENSLK
FT                   DSQSSVLSFSAVPTKVLKFKLRDVLGSEYSPSPQLLASSSDVSGSSSAVRAAMKADKIF
FT                   PAVHENPPPLKTKQSIAKPSPHTLRVPQKKHKHFYHRDDGKYKSGTNLRKSETVDLPQF
FT                   FIDENRRKLYEGLWAANKGYLLSKSEYSKPNDLICNIVVRELWSRSGAPTSVLAKIYDL
FT                   VDRHHTGVLGRDEFIVGMFLIDQYLKGRKLPLKVPDSVWLSSKRMGDMLWRLEKLQKKT
FT                   DNKKPFFKKKKKKRKHLKKFFDFNTTAKVNEGAMTD"
FT   3'UTR           919232..919775
FT                   /locus_tag="SPAC1687.09"
FT   5'UTR           919726..919972
FT                   /gene="mcp1"
FT                   /locus_tag="SPAC1687.10"
FT   misc_RNA        complement(919783..920837)
FT                   /locus_tag="SPNCRNA.696"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        join(919973..920716,920769..922010)
FT                   /transl_table=1
FT                   /gene="mcp1"
FT                   /locus_tag="SPAC1687.10"
FT                   /product="sequence orphan"
FT                   /db_xref="GOA:O94452"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94452"
FT                   /protein_id="CAA22604.1"
FT                   /translation="MELAKIGDRLNNYYNNIYTLSEKLGYSFTKISFNNIILDALSGHQ
FT                   RKLEIKIINIESKCNELSSEISLLRKRLGIIEEIEIPRTLIDQYECLVTYHNGIRAIYN
FT                   TKKNEAKNMYKEIERLSVILGESVDEVNFVNGDFEDISDIKLEQLSAKLNELHQIYRLR
FT                   KEKNIEIKEELKKLQDSLSIKLSMPADDLSKNGIKHLIIYKEKLRFSLESRKSRVDEIV
FT                   NEMKNMCGKNPTSELPTNYSDKTLTLWENELSSMRKVYFVKYKTEYEFLQKRYLSLARI
FT                   MFVSKKEMLFTSQFKEIPNVNRELIQSMKQEIGNLEVDLHLQGELNNMIRRYLLLESRV
FT                   YKESQRMKVLSGSASQPFTLKRLQKDFQLLKAKLICALREWEEDNEKKIYVFGKPLSSR
FT                   LLMIHSPPILQNQENISSNDNSKSSPESSPPARKTTGKIENKKLRNIDVQSKKSIRFPL
FT                   RLASHEEPLIDRMVNQSPDTRSVSKSKRLVRETSSGCLFKNHSKSNTLSPRRKGSRHGP
FT                   REPCLSPDASSSSIPVTDIKEILPSQHDTPHNSVKLTGSSTTPASVSLRQMIEPLLSRT
FT                   PPKGEFTNSLDDTPTQSNVEKVDRFLENHDWETCSESSSASEDQSLCKQLSSFSLSSSD
FT                   ISKKLKNNLNGLHFSSDEGSKLPTFL"
FT   3'UTR           922011..922098
FT                   /gene="mcp1"
FT                   /locus_tag="SPAC1687.10"
FT   5'UTR           922271..922313
FT                   /gene="spb1"
FT                   /locus_tag="SPAC1687.11"
FT   CDS_pept        join(922314..922383,922425..922518,922571..922747,
FT                   922893..924960)
FT                   /transl_table=1
FT                   /gene="spb1"
FT                   /locus_tag="SPAC1687.11"
FT                   /product="rRNA methyltransferase Spb1 (predicted)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GOA:O42832"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012920"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR024576"
FT                   /db_xref="InterPro:IPR028589"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42832"
FT                   /protein_id="CAA22605.1"
FT                   /translation="MGKSQKKTAKGRLDKWYKLAKEQGYRSRAAFKLVQLNQKYSFLEK
FT                   AKVIIDLCAAPGGWLQVASKTCKPGSLIVGVDLAPIKPIPNCHTFVEDITSDKCRSQLR
FT                   GYLKTWKADVVLHDGAPNVGSAWLQDAYGQAQLVLMSMKLACEFLVAGGTFVTKVFRSR
FT                   DYNNLLWVFKQLFNKVEATKPPSSRNVSAEIFVVCRGYKAPKKLDPRFTDPRTVFEEVQ
FT                   EPVTNVDAKVFHPEKRKRSREGYADDDYTLHKTVLASEFVTANDPIQILGTSAEIVFPK
FT                   DDEECQRLYNLDVTTEEILLCCSDLQVLGKKEFRDILRWRLKIRDEMGIGKKVEDEQKT
FT                   VVEEIPEMDEEERLDQELQDLSEAERVKLKRERRKANQRKQREIVRMQMGMLAPMDIGL
FT                   EHEAMGEDSLFGLATAEKHGLKELENGTLPVTESVDEEVSTDNEVEYDSDDERDRLEAD
FT                   LDSMYSDYTKRKAESDVKYRVKKARGDLDDEEWNGIDNGTESDDSQIAETNFATPDKDR
FT                   LTTSLLDKGSTKDGLSRKARMFFDQDIFDGIEDADADVEIMSMNRAAIKKREAELASQN
FT                   NDDGSKGDQSEDSNDHIEVVPVASAHDEDDDWNSDSDNDENNVEIVTAEAMTLAQDIAS
FT                   RRKSKADLIDEGYNRWSFQSKEGLPDWFLDEETTVNKPNKPITKEAVLALREKMKALNA
FT                   RPIKKVLEAQGRKKMRTIKRLQRVAKKAEGISESGDMTESEKAKEISRLVSRATKSKPK
FT                   AKPTLVVAKGPNKGLKSRPKGVKGKYKMVDSRMKKDLRAQKRLAKKGRR"
FT   3'UTR           924961..925133
FT                   /gene="spb1"
FT                   /locus_tag="SPAC1687.11"
FT   3'UTR           complement(925111..925211)
FT                   /gene="coq4"
FT                   /locus_tag="SPAC1687.12c"
FT   CDS_pept        complement(join(925212..925446,925503..925857,
FT                   925962..926066,926122..926245))
FT                   /transl_table=1
FT                   /gene="coq4"
FT                   /locus_tag="SPAC1687.12c"
FT                   /product="ubiquinone biosynthesis protein Coq4 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.12c.1"
FT                   /db_xref="GOA:O94453"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="InterPro:IPR027540"
FT                   /db_xref="PomBase:SPAC1687.12c"
FT                   /db_xref="PomBase:SPAC1687.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94453"
FT                   /protein_id="CAA22606.1"
FT                   /translation="MFYLNAHLEINKVVDVVMSLSKKFLKPSVASNQLRLLFTAAERKV
FT                   NYPGHVPLSPLQRIFLVAGSAIMGLKAPWRGGDMISVLGDASGQPFFLHRLLNKMLVDK
FT                   TGREILKDKPRMTSKSLNLPFLRTLPPNTLGKIYVDWIDKEHVGPDTRSPTRFVDDPEE
FT                   AYVMQRYRESHDFYHAICNMPTNIEGELAIKWLEFVNMGLPVGALSALFGPLRLNCEQA
FT                   SRFRRVYIPWSIRNGLNAKTLINVYWEKELTNDIEDVRRRIRIEAAPPLV"
FT   5'UTR           complement(926246..926289)
FT                   /gene="coq4"
FT                   /locus_tag="SPAC1687.12c"
FT   3'UTR           complement(926394..926500)
FT                   /gene="csn5"
FT                   /locus_tag="SPAC1687.13c"
FT   CDS_pept        complement(join(926501..926671,926736..927381,
FT                   927489..927571))
FT                   /transl_table=1
FT                   /gene="csn5"
FT                   /locus_tag="SPAC1687.13c"
FT                   /product="COP9/signalosome complex subunit Csn5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.13c.1"
FT                   /db_xref="GOA:O94454"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="PomBase:SPAC1687.13c"
FT                   /db_xref="PomBase:SPAC1687.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94454"
FT                   /protein_id="CAA22607.1"
FT                   /translation="MNNQLENVFRFDEEKERAKIRESPWKHDPEFFRSVKISAVALLKM
FT                   LRHVSQGMPLEVMGYVQGKVEGASLIILDSFALPVEGTETRVNAHEEAQEYSVQYHTLC
FT                   KSVYRHENVIGWYHSHPNYGCWLSGVDVETQRQNQKYQDPFVAVVLDPKRSLESPYVNI
FT                   GAFRTYPVGNDGSIRTKSRHHPSVLFKNLPSSKIEDAGAHAEAYYSLPITYFHSKAEKK
FT                   VTEFLRNRNWSRSITECSILQNNEFLHDSEKLIDHLIHETGNNELPVASAYEQSKACCN
FT                   ELSTFLSQIDVQDKLFKE"
FT   intron          complement(927382..927488)
FT                   /gene="csn5"
FT                   /locus_tag="SPAC1687.13c"
FT   5'UTR           complement(927572..927671)
FT                   /gene="csn5"
FT                   /locus_tag="SPAC1687.13c"
FT   3'UTR           complement(927801..928212)
FT                   /locus_tag="SPAC1687.14c"
FT   CDS_pept        complement(928213..928443)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.14c"
FT                   /product="EF hand family protein, unknown role"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.14c.1"
FT                   /db_xref="GOA:O94455"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="PomBase:SPAC1687.14c"
FT                   /db_xref="PomBase:SPAC1687.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94455"
FT                   /protein_id="CAA22608.1"
FT                   /translation="MSVSTKRLEMDEEAEEAFDLFDVTHKGYIDFEDLRRSCAQLGENL
FT                   TKEQLQLMLDLAGTNGKVSREEFAELWIHIS"
FT   5'UTR           complement(928444..929011)
FT                   /locus_tag="SPAC1687.14c"
FT   3'UTR           complement(929156..929158)
FT                   /locus_tag="SPAC1687.23c"
FT   CDS_pept        complement(929159..929473)
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.23c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.23c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.23c.1"
FT                   /db_xref="GOA:Q9C118"
FT                   /db_xref="PomBase:SPAC1687.23c"
FT                   /db_xref="PomBase:SPAC1687.23c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C118"
FT                   /protein_id="CAC34405.1"
FT                   /translation="MWILEKKNIFFKIIHIKSSRKFDFSNAIRIVLLPFSSNCCRNSYT
FT                   VNNGTFTGRQIYTSICKSRIPPCLKGKNGKTTKSESEPMSQKHLKYVKKYINKVRILKK
FT                   "
FT   5'UTR           complement(929474..929654)
FT                   /locus_tag="SPAC1687.23c"
FT   5'UTR           929843..929938
FT                   /gene="gsk3"
FT                   /gene_synonym="skp1"
FT                   /locus_tag="SPAC1687.15"
FT   CDS_pept        join(929939..929957,930006..930196,930678..931631)
FT                   /transl_table=1
FT                   /gene="gsk3"
FT                   /gene_synonym="skp1"
FT                   /locus_tag="SPAC1687.15"
FT                   /product="serine/threonine protein kinase Gsk3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.15.1"
FT                   /db_xref="GOA:Q10452"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="PomBase:SPAC1687.15"
FT                   /db_xref="PomBase:SPAC1687.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10452"
FT                   /protein_id="CAA22609.1"
FT                   /translation="MNHGTKIPVDPFRIIKETARDGSTGEVKQLSYTSSKVVGSGSFGV
FT                   VMQVHLIESDSKAAIKRVLQDKRFKNRELQIMRIMKHPNIVDLIAYYYTTGDNSDEVYL
FT                   NLVLEFMPETIYRASRLYTRQKLSMPMLEVKLYIYQLLRSLAYIHASGICHRDIKPQNL
FT                   LLDPENGILKLCDFGSAKILVAGEPNVSYICSRYYRAPELIFGATDYTHAIDIWSTGCV
FT                   MAELMLGHPLFPGESGIDQLVEIIKILGTPSREQIKTMNPNYMEHRFPQIRPQPLSRVF
FT                   SRSVPLDALDLLSKMLQYTPTDRLTAAEAMCHPFFDELRDPNTKLHNSRNPDASPRHLP
FT                   ELFNFSPFELSIRPDLNQKLIPSHARDALPVKLDDFVPIPIHRARID"
FT   intron          930197..930677
FT                   /gene="gsk3"
FT                   /gene_synonym="skp1"
FT                   /locus_tag="SPAC1687.15"
FT   3'UTR           931632..932197
FT                   /gene="gsk3"
FT                   /gene_synonym="skp1"
FT                   /locus_tag="SPAC1687.15"
FT   3'UTR           complement(932425..933051)
FT                   /gene="erg31"
FT                   /gene_synonym="erg3"
FT                   /locus_tag="SPAC1687.16c"
FT   CDS_pept        complement(933052..933954)
FT                   /transl_table=1
FT                   /gene="erg31"
FT                   /gene_synonym="erg3"
FT                   /locus_tag="SPAC1687.16c"
FT                   /product="C-5 sterol desaturase Erg31"
FT                   /EC_number="1.14.21.6"
FT                   /db_xref="GOA:O94457"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94457"
FT                   /protein_id="CAA22610.1"
FT                   /translation="MDYLLNYADQYALDSIYNAVYPLARDNIVRQSISLFFLTWFGGMF
FT                   LYLTFASLSYQFVFDKSLMDHPKFLKNQVFMEVLTALQNLPGMALLTVPWFLAELHGYS
FT                   YLYDNISDYGLKYFLCSLPLFVMFSDFGIYWAHRFLHHRYVYPRLHKLHHKWIICTPYA
FT                   SHAFKSADGFLQSLPYHLFPFFFPLHKLTYLALFTFVNFWSIMIHDGKYISNNPIINGA
FT                   AHHNGHHIYFNYNYGQFTTLFDRLGNSFRAPDEAWFDKDLRQNEDVLRVELMEYEAIRN
FT                   EVEGDDDREYIANSAKKNH"
FT   5'UTR           complement(933955..934021)
FT                   /gene="erg31"
FT                   /gene_synonym="erg3"
FT                   /locus_tag="SPAC1687.16c"
FT   misc_RNA        934056..934503
FT                   /gene_synonym="SPNG153"
FT                   /locus_tag="SPNCRNA.160"
FT                   /product="non-coding RNA (predicted)"
FT   tRNA            complement(934665..934738)
FT                   /locus_tag="SPATRNAALA.01"
FT                   /product="tRNA Alanine"
FT   3'UTR           complement(934941..935248)
FT                   /locus_tag="SPAC1687.17c"
FT   CDS_pept        complement(join(935249..935668,935747..935812,
FT                   935860..935899,935943..935989))
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.17c"
FT                   /product="Der1-like (degradation in the ER) family
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.17c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.17c.1"
FT                   /db_xref="GOA:O94458"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="PomBase:SPAC1687.17c"
FT                   /db_xref="PomBase:SPAC1687.17c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94458"
FT                   /protein_id="CAA22611.2"
FT                   /translation="MAILPEFISQTPPVTRYIVLGTLFTTLAVNFGYVSDLKIFFNWKL
FT                   FLAKGEYWRAITTFLYVGPFGLELILYLSFLLRFMSMLERSSPPPQTQSFLKTVLIVWF
FT                   SLLVTSYFSYMPFAASYFSFTMLYIWSWKHPLYRISILGLFDVKAPYVPWVMVLLRWLR
FT                   TGIFPLLDLISALIGHVYFFVTDFSTV"
FT   5'UTR           complement(935990..936081)
FT                   /locus_tag="SPAC1687.17c"
FT   3'UTR           complement(936188..936270)
FT                   /gene="ssl3"
FT                   /locus_tag="SPAC1687.18c"
FT   CDS_pept        complement(join(936271..936371,936453..937719,
FT                   937760..937891,937928..938107))
FT                   /transl_table=1
FT                   /gene="ssl3"
FT                   /locus_tag="SPAC1687.18c"
FT                   /product="cohesin loading factor Ssl3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.18c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.18c.1"
FT                   /db_xref="GOA:O94459"
FT                   /db_xref="InterPro:IPR019440"
FT                   /db_xref="PomBase:SPAC1687.18c"
FT                   /db_xref="PomBase:SPAC1687.18c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94459"
FT                   /protein_id="CAA22612.1"
FT                   /translation="MTGLNETDARILVTSRHLFLWPLAETYFKNAEKVLQDCGVCDSFG
FT                   RLLSTGLQCLYSVLMDTKMEPRVELLTRKRICEVLLSHTVEYADVEAILNRALIIAEQH
FT                   NLTEYKFSLQLLLSRVFCRTSPKAAKVLLTRCVREAEEYAKVAEIYHSNNQSNPHRWVY
FT                   EFLLATLEFQNVSQVANSIHNYANHHKHQHLQLLAMILNQSLPMDEISTDSDQISILCL
FT                   VTQIAQCLRKGEILLAREILPKIHSKLESETFVWPSSYIDFFIDDTSKISIKWMSINQL
FT                   YLLIYLISGFCYISDSTSGRASRFLQEGLRITGDFKHQERCVLEYLESQKWINNITKDM
FT                   KYYLIATYLSRSRLSKAERILQSTEDDQTGFLGILKGMYLQKRGDLKKAEVHYRETAKN
FT                   FSFRTDTFIISTLNLINILEDSAAASRCLESIEPLCNKHEKKIFKLWLLVLKVIREGPQ
FT                   VHQSNVLPRVIQQSSEYANTQLQYISLTELSERFGKLEHAEKMAISALELAKKSKDELW
FT                   CLISGRILEDFYRSVQKYDKMRQQALENSAYSKLIEDIYSFV"
FT   5'UTR           complement(938108..938157)
FT                   /gene="ssl3"
FT                   /locus_tag="SPAC1687.18c"
FT   3'UTR           complement(938311..938447)
FT                   /locus_tag="SPAC1687.19c"
FT   misc_RNA        938390..939912
FT                   /locus_tag="SPNCRNA.697"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(join(938448..938958,939002..939575,
FT                   939630..939759))
FT                   /transl_table=1
FT                   /locus_tag="SPAC1687.19c"
FT                   /product="queuine tRNA-ribosyltransferase (predicted)"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.19c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.19c.1"
FT                   /db_xref="GOA:O94460"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="PomBase:SPAC1687.19c"
FT                   /db_xref="PomBase:SPAC1687.19c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94460"
FT                   /protein_id="CAA22613.1"
FT                   /translation="MASSFPALQFKVVARCSTTRARVTDIQLPHGLVESPVFMPVGTQA
FT                   SLKGVLPEQLDALGCKIMLNNTYHLGLKPGQEVLDTVGGAHRFQSWNKNILTDSGGFQM
FT                   VSLLKLATITEDGVTFLSPRDGTPMLLTPEHSISLQNSIGSDIMMQLDDVVHTLTESKR
FT                   MEEAMYRSIRWLDRCIQAHKRPETQNLFCIIQGGLDKRLREICCREMVKRNTPGIAVGG
FT                   LSGGEEKHAFCETVYTCTSILPDNKPRYLMGVGYAEDLVVCVALGMDMFDCVYPTRTAR
FT                   FGNALTRKGVINLRNQKFRNDIGPLEEGCSCPCCKTELEGGWGITRAYFNSLVSKETVG
FT                   ANLMTIHNVHFQLQLMRDMRESIIKDEFPSFVKNFFHEWNHGDKSNYPSWAVDALRMVN
FT                   IDLLA"
FT   5'UTR           complement(939760..939831)
FT                   /locus_tag="SPAC1687.19c"
FT   3'UTR           complement(939770..939870)
FT                   /gene="mis6"
FT                   /locus_tag="SPAC1687.20c"
FT   CDS_pept        complement(939871..941889)
FT                   /transl_table=1
FT                   /gene="mis6"
FT                   /locus_tag="SPAC1687.20c"
FT                   /product="inner centromere protein, CENP-I ortholog Mis6"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.20c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.20c.1"
FT                   /db_xref="GOA:P87227"
FT                   /db_xref="InterPro:IPR012485"
FT                   /db_xref="PomBase:SPAC1687.20c"
FT                   /db_xref="PomBase:SPAC1687.20c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P87227"
FT                   /protein_id="CAA22614.1"
FT                   /translation="MESFENKGFLDIEEGIQWIKKNSENLSSSKKTILARLQQFHKLCS
FT                   EVGLNQHSISSLLDVILSKKTHFDKNHVQLLIKCLYPNELISQTIAIRIISSLDPHGLR
FT                   CSYAIQAKLLNWLIHVYEFLDGNNLLCRYYGVLFHFLDFLTLRPYISNLLVLLTKHYHV
FT                   KSFRIHQLLALYQKPGNTADPYLLALILTYKQHFPDVIVGSYTYRKHGSVRLDSEWIAA
FT                   TKAILNRQSEDVPLETWSSEKRKRQSSLIPDLITMKNTSSSYSLEELTSVQQMGLVYEK
FT                   IVFPSRIAAVLKSKLFLIFLFLKNKNVYYSRLDEWLHITLNYGLALRSGSNNQEEEVLH
FT                   LLYKYLLFSPKFPKSLLQYVITFFSKPNITEENYNLLTLLVTHIPITTDSSYFNSLLKE
FT                   FEQFILQKNAEFCSKHLNILWLWLFRMLNLRIASMGNNHTLLEKCLLITNHATFLVSHF
FT                   SWDVSLAYQLSRLFQLYYKILTKIRKQIEPNIPPKELIYVLFFQPSAFYINSMVGLLLL
FT                   TKNYQERLMDSRIDAISKFTHSYLKSLSEIILLKEKRAILSFLQLWEPFKSDYSQFLPI
FT                   ATRIANDHPYAQRVFSLTCAPQFFSYINGYQIYLQQTNPATGSIPLKPIQEETFGAFQS
FT                   NLHLSDSWEDFQKNFIIYLKKKGYLAISDFLLSTLNR"
FT   5'UTR           complement(941890..941944)
FT                   /gene="mis6"
FT                   /locus_tag="SPAC1687.20c"
FT   5'UTR           join(941942..941989,942215..942239)
FT                   /gene_synonym="SPAC222.01"
FT                   /locus_tag="SPAC1687.21"
FT   CDS_pept        join(942240..942296,942451..942573,942615..942680,
FT                   942727..942748,942805..943166)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC222.01"
FT                   /locus_tag="SPAC1687.21"
FT                   /product="phosphoglycerate mutase family (predicted)"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.21"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.21.1"
FT                   /db_xref="GOA:O94461"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PomBase:SPAC1687.21"
FT                   /db_xref="PomBase:SPAC1687.21.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94461"
FT                   /protein_id="CAA22615.1"
FT                   /translation="MKVFLIRHGQTDQNKRGILQGSVDTNLNETGRLQAKLLAQRLLPL
FT                   DIDQIFCSSMKRCRETIAPYLELKPEVPIVYTDLIRERVYGDLEGMNVVEAKKLLNANH
FT                   PDHYGEGLSHLTSRLLKFWDEYVVPLQGKKKCVIVLCHGGVINVLRTHFMEEKGFTFDK
FT                   SKLESKIITFNTSITEIEVTEHGTGHIHTFGDASHLESEETGKLIA"
FT   3'UTR           943167..943335
FT                   /gene_synonym="SPAC222.01"
FT                   /locus_tag="SPAC1687.21"
FT   3'UTR           complement(943265..943624)
FT                   /gene="puf3"
FT                   /gene_synonym="SPAC222.02c"
FT                   /locus_tag="SPAC1687.22c"
FT   CDS_pept        complement(join(943625..943692,943741..943904,
FT                   943961..945927))
FT                   /transl_table=1
FT                   /gene="puf3"
FT                   /gene_synonym="SPAC222.02c"
FT                   /locus_tag="SPAC1687.22c"
FT                   /product="RNA-binding protein Puf3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC1687.22c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC1687.22c.1"
FT                   /db_xref="GOA:O94462"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="PomBase:SPAC1687.22c"
FT                   /db_xref="PomBase:SPAC1687.22c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94462"
FT                   /protein_id="CAA22616.2"
FT                   /translation="MFTAVNSNPNASESISGNSAFNFPSAPVSSLDTNNYGQRRPSLLS
FT                   GTSPTSSFFNSSMISSNYTFPHGSNKQASLESPVSYSNPIPSLTWLSLDGDSPDSLVST
FT                   PTAPSANHHGNPFPNGKQSIKAMPSLVNLQEDSVISKFPNSLEVPFRKRSESTSSSLSG
FT                   LHSDLRPLKTELYGQLNSECGARFPQTLKSPLTPIGGDSARTVSASTARTSDKFFPRHT
FT                   RAHSDFWIPATSKPSRHASHSSIGDLTTITQSSISSGSGSFKPSWDGSFDSSLMAHQSY
FT                   GTSPAFANGNSPTLKNDSSFFGSASVRPTVSPIGTSFRQSLPDISAFGIPKTETNPSEV
FT                   VAPGTIPISVLPTSNFSAATPANPSLINQNGQEFLQQSRVLYLFHANKQRHFELSDILG
FT                   NVVLFSTDQHGSRFIQQKLATATEEEREAVFQEIASTSCLQLMMDIFGNYVVQKYFEFG
FT                   NEKQKQILLSQIKGHVFSLSLQMYGCRVVQKAIEYISPEHQVQLIQELDGHVLDCVCDQ
FT                   NGNHVIQKAIECIDTGHLQFILRALRPQIHVLSAHPYGCRVIQRAIEHCHSERKLIIEE
FT                   LLPHILKLTQDQYGNYVVQHILRTGSESDKKYIFDLMIDHLLFLSCHKFASNVVERCIS
FT                   YISDVDRRRILNKIISEKAENCSILMLMMKDKYANYVIQKLLDASPEEERDLLISYIYP
FT                   HISVLKKFTYGKHLIMSVERFRQKSISAVPKLASKECK"
FT   5'UTR           complement(945928..946909)
FT                   /gene="puf3"
FT                   /gene_synonym="SPAC222.02c"
FT                   /locus_tag="SPAC1687.22c"
FT   misc_RNA        complement(946892..947942)
FT                   /locus_tag="SPNCRNA.698"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   3'UTR           complement(947876..947963)
FT                   /gene="tim10"
FT                   /locus_tag="SPAC222.03c"
FT   CDS_pept        complement(join(947964..948132,948481..948581))
FT                   /transl_table=1
FT                   /gene="tim10"
FT                   /locus_tag="SPAC222.03c"
FT                   /product="Tim9-Tim10 complex subunit Tim10 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.03c.1"
FT                   /db_xref="GOA:Q9UTE9"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR027100"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="PomBase:SPAC222.03c"
FT                   /db_xref="PomBase:SPAC222.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE9"
FT                   /protein_id="CAB60695.1"
FT                   /translation="MSMFGIGKNNQTINPQNIAMAEQEVEMMSDIFNRLVMTCHKKCIS
FT                   PKYYEADLTKGESVCIDRCVSKYFEANQSLSQHMQKRGQENPTP"
FT   5'UTR           complement(948582..948800)
FT                   /gene="tim10"
FT                   /locus_tag="SPAC222.03c"
FT   misc_RNA        948715..949365
FT                   /locus_tag="SPNCRNA.699"
FT                   /product="intergenic RNA (predicted)"
FT   CDS_pept        join(949646..949680,949729..950047)
FT                   /transl_table=1
FT                   /gene="tam1"
FT                   /locus_tag="SPAC222.19"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.19"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.19.1"
FT                   /db_xref="GOA:G2TRJ4"
FT                   /db_xref="PomBase:SPAC222.19"
FT                   /db_xref="PomBase:SPAC222.19.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRJ4"
FT                   /protein_id="CCD31310.1"
FT                   /translation="MSVSQQLSELASKEKTVLYVADQNLEEVLCFPESTDRTTLVQLTD
FT                   ACLHANELAKHLEFGKPLSITNQYSRGSCVLQIAKEKKDGSGMVVSTTIAAHNALRGAL
FT                   KCSNALDQVISQL"
FT   intron          949681..949728
FT                   /gene="tam1"
FT                   /locus_tag="SPAC222.19"
FT   3'UTR           complement(950120..950297)
FT                   /gene="ies6"
FT                   /locus_tag="SPAC222.04c"
FT   CDS_pept        complement(950298..950651)
FT                   /transl_table=1
FT                   /gene="ies6"
FT                   /locus_tag="SPAC222.04c"
FT                   /product="Ino80 complex subunit Ies6"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.04c.1"
FT                   /db_xref="GOA:Q9UTE8"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="InterPro:IPR029525"
FT                   /db_xref="PomBase:SPAC222.04c"
FT                   /db_xref="PomBase:SPAC222.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE8"
FT                   /protein_id="CAB60696.1"
FT                   /translation="MEKNSSVDSLDISLLARPFRNPNYKAQPRRNRNLRQIIQNDPVQN
FT                   EPSKFSYSSIEAPPSVLPQPKYCDVTGLLAIYTDPKTRLRYHNKEIYGLIRELPSGADQ
FT                   EYLKLRSSDVVLK"
FT   5'UTR           complement(950652..950813)
FT                   /gene="ies6"
FT                   /locus_tag="SPAC222.04c"
FT   3'UTR           complement(950912..951053)
FT                   /gene="mss1"
FT                   /locus_tag="SPAC222.05c"
FT   misc_RNA        951028..952560
FT                   /locus_tag="SPNCRNA.700"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(join(951054..952394,952454..952603))
FT                   /transl_table=1
FT                   /gene="mss1"
FT                   /locus_tag="SPAC222.05c"
FT                   /product="mitochondrial GTPase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.05c.1"
FT                   /db_xref="GOA:Q9UTE7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="PomBase:SPAC222.05c"
FT                   /db_xref="PomBase:SPAC222.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE7"
FT                   /protein_id="CAB60697.1"
FT                   /translation="MRILNRVFLNTFQACFRRFVHQIPTIYALSTPPGTSAVAIVRISG
FT                   PNACKVAKTLAGSVPKPRIASLRTIKHPVRSEVIDKALMLYFKKPSSFTGEDVVELQLH
FT                   GGTAVVDVTLEAIKQSGIPNIRYAKPGEFSERAFYNGRADLTQLEGLIDVINAQTAEQL
FT                   YSANKEAHGSIYDICFRWRKKLIEYRAFLEASIDFSEEHELDDIETIKLFEELNEMKDE
FT                   IDAHIEGGKCKEVLRKGINVAILGPSNAGKSSLINLLANRRISIVSPQSGTTRDAIEVL
FT                   VDINGFPVLLSDTAGLRKGEDVQEIEKIGIEIAKARAEESQLTLFVFPINYHSFSESLK
FT                   QSEILETIKDCLRQRKPIHFLINKVDCVSDYTTMFKPIKAYLQKNFLIPENRIHAVSCK
FT                   TKEGLIDFLQALSSTFECMVNPLTNNKIQANLGWNERQRQCLSSCSSHLSLALQKSSDI
FT                   VVAAEEVKLATEDIGRVTGAVDMENVFSVIFSKFCVGK"
FT   5'UTR           complement(952604..953006)
FT                   /gene="mss1"
FT                   /locus_tag="SPAC222.05c"
FT   5'UTR           953095..953112
FT                   /gene="mak16"
FT                   /locus_tag="SPAC222.06"
FT   CDS_pept        join(953113..953174,953228..954074)
FT                   /transl_table=1
FT                   /gene="mak16"
FT                   /locus_tag="SPAC222.06"
FT                   /product="nuclear HMG-like acidic protein Mak16
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.06.1"
FT                   /db_xref="GOA:Q9UTE6"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="PomBase:SPAC222.06"
FT                   /db_xref="PomBase:SPAC222.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE6"
FT                   /protein_id="CAB60698.1"
FT                   /translation="MQQDEVIWQVVGHEFCSYRIKGEAQNFCRNEYNVTGLCNRQSCPL
FT                   ANSRYATVREDNGKLYLYMKTIERAHFPSKLWQRIKLSKNYAKALEQIDQQLLYWPGRQ
FT                   IHRCKQRLTRLTQYLLKARRLALKHQPALIPIKPKQAHREASRERKALIAAKLEKNIEK
FT                   ELVKRLKSGVYGDQPLNVNEEIWNKVLAAREGLIDEGEEEEEREEAELEFVSDDEDEEE
FT                   ISDLEDWLGSDQSMETSESEEEESSESESDEDEDEDNKGKIRKRKTDDAKKSRKKRAPH
FT                   IHIEYEQERENEKIPAVQHSW"
FT   intron          953175..953227
FT                   /gene="mak16"
FT                   /locus_tag="SPAC222.06"
FT   3'UTR           954075..954325
FT                   /gene="mak16"
FT                   /locus_tag="SPAC222.06"
FT   3'UTR           complement(954279..954354)
FT                   /gene="hri2"
FT                   /locus_tag="SPAC222.07c"
FT   CDS_pept        complement(join(954355..955585,955650..956184,
FT                   956234..956272,956360..956474))
FT                   /transl_table=1
FT                   /gene="hri2"
FT                   /locus_tag="SPAC222.07c"
FT                   /product="eIF2 alpha kinase Hri2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.07c.1"
FT                   /db_xref="GOA:Q9UTE5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC222.07c"
FT                   /db_xref="PomBase:SPAC222.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE5"
FT                   /protein_id="CAB60699.1"
FT                   /translation="MRFFNAHKSAEDGNYSETTNAISLKNERQSRDLSVNKHGRMLLTA
FT                   LLENFCQLYDNNPAKSKRLFALICHTLQKIGILEEEYIEELAAVRSNYQDALHHLILQA
FT                   REAIRLDDAEERLLALPDPTNVFEKFPQETALSKFSVDGLNVRQFRFRDLTLESWLQSR
FT                   NSRYIEDFEEYSLLGRGGFGSVYHVRNKIDGAEYAMKKINSTFQQMSYSKIFREIKCLA
FT                   KMDHPNVIRYFSSWVESTTEATQMPIVMSKNSSRVLGTSSYCDVNGMDSIIFEPTESSA
FT                   LTDDILFAEDPGTESIISTSRKSSYSSTTESSNFENLESPRNLHDSNVSTFNNTTILDD
FT                   DYSSSMHISKTGPTHSFIIYIQMQLCFDDLESYLIRRNHFLSFPLCKEQIQLHTDLFRM
FT                   IINGVMYVHEGVNLIHRDIKPSNIFLAKSLPEDRGSVPLISYNDKNDLKEYITPKIGDF
FT                   GLVVENKKNTETALSFLERNHLPNLQDETQHIGTATYAAPELLDAMSSQHNKFTKKIDT
FT                   FSLGMVLFELLHPFQTNMERATKLQDLRRGNLPEEFVEQHICESSLILWMTAKDPTKRP
FT                   SLLEVLNCGLLLPNQVSMPNISNIVSTNHLDVETQMKLIMDENQRLREQIAVLRSRIQH
FT                   LETR"
FT   5'UTR           complement(956475..956707)
FT                   /gene="hri2"
FT                   /locus_tag="SPAC222.07c"
FT   tRNA            957183..957254
FT                   /locus_tag="SPATRNAGLU.02"
FT                   /product="tRNA Glutamic acid"
FT   3'UTR           complement(957367..957645)
FT                   /locus_tag="SPAC222.08c"
FT   CDS_pept        complement(957646..958350)
FT                   /transl_table=1
FT                   /locus_tag="SPAC222.08c"
FT                   /product="glutamine aminotransferease subunit (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.08c.1"
FT                   /db_xref="GOA:Q9UTE4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PomBase:SPAC222.08c"
FT                   /db_xref="PomBase:SPAC222.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE4"
FT                   /protein_id="CAB60700.1"
FT                   /translation="MSSASMFGSLKTNAVDESQLKARIGVLALQGAFIEHINIMNSIDG
FT                   VISFPVKTAKDCENIDGLIIPGGESTTIGKLINIDEKLRDRLEHLVDQGLPIWGTCAGM
FT                   ILLSKKSRGGKFPDPYLLRAMDIEVTRNYFGPQTMSFTTDITVTESMQFEATEPLHSFS
FT                   ATFIRAPVASTILSDDINVLATIVHEGNKEIVAVEQGPFLGTSFHPELTADNRWHEWWV
FT                   KERVLPLKEKKD"
FT   5'UTR           complement(958351..958774)
FT                   /locus_tag="SPAC222.08c"
FT   5'UTR           959867..960060
FT                   /gene="seb1"
FT                   /locus_tag="SPAC222.09"
FT   CDS_pept        join(960061..960417,960608..962113)
FT                   /transl_table=1
FT                   /gene="seb1"
FT                   /locus_tag="SPAC222.09"
FT                   /product="RNA-binding protein Seb1"
FT                   /db_xref="GOA:Q9UTE3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034894"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PDB:5MDT"
FT                   /db_xref="PDB:5MDU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE3"
FT                   /protein_id="CAB60701.1"
FT                   /translation="MSGIAEFDGILDSLEHSKTGISGSKILKLTNLSMENVSENAQFVA
FT                   SVYKYAKRAPVTHKLGALYILDSIVRSFQDGAKKNNESFENPVDASFSGGWCKAAEITD
FT                   SLVADAIQHAPSAHLPKILKLCDIWEKASTFPPEKLESLRSKLKDAMASTEPVSVDSAA
FT                   APSQSTNPEGNGGSVGSQAAAPTSRPVENDAASILEALAAFAQKAPVPSAAEESVSTPP
FT                   QPAVAPSVSAVVPNLPVHPATAINAQSQSGNPLSNPLFQPSNVPQSIPSGPMGMKTGSV
FT                   NDTQSQQITLMNVLASQNVPPAQIDSIMKAAFPNYNAPFQPAGVGSVPLPAPTSSQSLR
FT                   LGSLHRSRSPSPRSGRPRRSPSPSHLSIPSTLPPADGVPKPTPDGFPRRFERDPTIPPD
FT                   SIKVYSRTLFLGGITRSVREPVLRSMFERFGSVQSLILNHNYRHGFLKMFRRDAAEKAQ
FT                   VAMENVPFADTTIRTKWGVGFGPRECSDFSTGISVIPIRLLTDADRTWLVTAEYGGTGG
FT                   LPITPGIALDEPDIEIGLGISSKAISKRGKDFAMRRDERFRGRKPYRGGPPIHHGERHF
FT                   DSGNDWHGNPSTVPPPTNPYNPGYPYMDPNYSSGYVSQPPWQPQ"
FT   3'UTR           962114..962227
FT                   /gene="seb1"
FT                   /locus_tag="SPAC222.09"
FT   3'UTR           complement(962314..962436)
FT                   /gene="byr4"
FT                   /locus_tag="SPAC222.10c"
FT   CDS_pept        complement(962437..964434)
FT                   /transl_table=1
FT                   /gene="byr4"
FT                   /locus_tag="SPAC222.10c"
FT                   /product="two-component GAP Byr4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.10c.1"
FT                   /db_xref="GOA:Q10951"
FT                   /db_xref="InterPro:IPR034586"
FT                   /db_xref="PomBase:SPAC222.10c"
FT                   /db_xref="PomBase:SPAC222.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10951"
FT                   /protein_id="CAB60702.1"
FT                   /translation="MTEVECWDDDPDFASDVDNASLFTQSIATTSASTSVDDGFSFDDS
FT                   ISRLNSLSISDVPSAHSRVEQWNQQVHNLNHELSSNKNRISSNVEGYEDDFSFDEEGEE
FT                   GNNEFNTLRPNKYQDADVDEFNTIRASETASQRPPIPFSSDTLKKTYLSSENDARYPSV
FT                   SDSPYCESEGFSSFEDDFEIDPDTDLNSILHRKQNRMDPKASFSSVEQSSLRTPSSAHN
FT                   DDGFWDDFDIDFNNETESIFRKKIRSPNTINQKHPYISSTISYQPNVHQDAKYYPLCKD
FT                   IFPSLANENPHSDNPNLKYSSKTLSKRDTSSHYPETLKASSKHSSPVKGNSSISSTWTP
FT                   SNLKIYHSKNSMGLMDLDALKTVASNSKYRTKPKNCKTYGDGTELDTLDELPVDYEFEL
FT                   KLRKKQTTKVSGTPKSKHAGSTQEWHSHTTPRSTSKHENNLNNITNSAKNEHIRSQRQH
FT                   KTHAAPSKELTKESLSNDQLSVKEKRRHHKKAPTLIQNLNSPRTPKIVGKMRYNPTKHC
FT                   WEGNDYAIRDFDTPISPSRPALISNISTKKGIQVVGNMVYDPTRLRWIDNSISGQEAED
FT                   PFSGFDDLEDTDSTSQYLNENSGSFNGSINSIINFPDMSEIYDVGPEFEKKQFSEDIQW
FT                   RKRIDGWFFSFKNDDRSRLWELYNILNAEQ"
FT   5'UTR           complement(964435..964867)
FT                   /gene="byr4"
FT                   /locus_tag="SPAC222.10c"
FT   5'UTR           966164..966429
FT                   /gene="hem13"
FT                   /locus_tag="SPAC222.11"
FT   CDS_pept        966430..967368
FT                   /transl_table=1
FT                   /gene="hem13"
FT                   /locus_tag="SPAC222.11"
FT                   /product="coproporphyrinogen III oxidase (predicted)"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.11.1"
FT                   /db_xref="GOA:Q9UTE2"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="PomBase:SPAC222.11"
FT                   /db_xref="PomBase:SPAC222.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE2"
FT                   /protein_id="CAB60703.1"
FT                   /translation="MSDITVEPIGKQMEKLILDVQQEIVAGLEAVDGQKFFQDKWTKGE
FT                   GGYGISCVIQDGNVFEKGGVNTSIVQGKLNQDAVQRMRANHEGIDRTAKELPFFAAGIS
FT                   MVIHPRNPMAPTTHLNYRYFELVNSDGKKIWWFGGGADLTPSILFEEDGKHFHKLHKEA
FT                   CDRHDPTFYPRFKKWADEYFLIKHRKETRGIGGIFFDDLSEKDPQELFAFVKDCAHTFL
FT                   PAYVPIMEKRKNMEFTEDDKEFQLIRRGYYAEFNVMYDRGTWFGLQAPEPRVESILMTL
FT                   PLHASWRYKYEPKQERHKALLKVTHTPIEWC"
FT   3'UTR           967369..967591
FT                   /gene="hem13"
FT                   /locus_tag="SPAC222.11"
FT   3'UTR           complement(967583..967864)
FT                   /locus_tag="SPAC222.17"
FT   CDS_pept        complement(join(967865..967958,968030..968205))
FT                   /transl_table=1
FT                   /locus_tag="SPAC222.17"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.17"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.17.1"
FT                   /db_xref="GOA:C6Y4B9"
FT                   /db_xref="PomBase:SPAC222.17"
FT                   /db_xref="PomBase:SPAC222.17.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6Y4B9"
FT                   /protein_id="CBA11492.1"
FT                   /translation="MEEKVQEFLKDSTKEQKVFFESLNNQTERVCQQTESGDISCIELA
FT                   AAETKLFATMQSLGFICTLSADPNRPTVFECKRELDTNERKERL"
FT   5'UTR           complement(968206..968302)
FT                   /locus_tag="SPAC222.17"
FT   3'UTR           complement(968507..968782)
FT                   /gene="atp2"
FT                   /locus_tag="SPAC222.12c"
FT   CDS_pept        complement(968783..970360)
FT                   /transl_table=1
FT                   /gene="atp2"
FT                   /locus_tag="SPAC222.12c"
FT                   /product="F1-ATPase beta subunit Atp2"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.12c.1"
FT                   /db_xref="GOA:P22068"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="PomBase:SPAC222.12c"
FT                   /db_xref="PomBase:SPAC222.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22068"
FT                   /protein_id="CAB60704.1"
FT                   /translation="MLKKQALSGIRRFSLATKQSFVKTSYKLPRKSWLNTAKFNTIRYA
FT                   STEAAKHNKGSIKQVIGAVVDCQFEDADSLPSILNALEVKLPDNKRLVLEVAQHVGENT
FT                   VRTIAMDGTEGLVRGTAVIDTGSPISIPVGPGTLGRIMNVIGEPVDERGPIKAVKYSPI
FT                   HADAPSFEEQSTTPEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAK
FT                   AHGGYSVFTGVGERTREGNDLYREMQETGVIKLEGESKAALVFGQMNEPPGARARVALT
FT                   GLTVAEYFRDIEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGAMQE
FT                   RITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDS
FT                   KSRMMDPRILGEEHYNLAGSVQQMLQEYKSLQDIIAILGMDELSEADKLTVERARKVQR
FT                   FLSQPFAVAEVFTGIEGRLVSLKDTIRSFKEILEGKHDSLPESAFYMVGSIDDAVKKAE
FT                   KIAQELAA"
FT   5'UTR           complement(970361..970412)
FT                   /gene="atp2"
FT                   /locus_tag="SPAC222.12c"
FT   3'UTR           complement(970875..971257)
FT                   /locus_tag="SPAC222.13c"
FT   CDS_pept        complement(join(971258..971404,971447..972268,
FT                   972320..972644,972757..973241))
FT                   /transl_table=1
FT                   /locus_tag="SPAC222.13c"
FT                   /product="6-phosphofructo-2-kinase (predicted)"
FT                   /EC_number="2.7.1.105"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.13c.1"
FT                   /db_xref="GOA:Q9UTE1"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PomBase:SPAC222.13c"
FT                   /db_xref="PomBase:SPAC222.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE1"
FT                   /protein_id="CAB60705.1"
FT                   /translation="MSNTGSARTEEFTKGTGYEATKPNNDTDDDAKQNYPSKEPHMKLG
FT                   DYTEETSFVDDSIFKREELTPDRNSPANDVEKMEVPKPTPQWMKLKDEGKLGKHRKNRL
FT                   RRPGRFPVRQESTIDIPGLTVSKRTENDSNNASYGIREKLIIILVGIPATGKSYIGSKL
FT                   SRYYNWLKYNCRFFSVGDKRREEGASTYSMSADFFDIKNEETFKFRENVALETLEDLLH
FT                   WMIHENGVIGILDATNSTHERRKHLYDRISKEADIGIMFLESLCTDDILFEENIKLKIK
FT                   GPDYEGYDTESALKDLRERVDLYKKYYEPLDERDEQLPFLQYVKVINVGIKVVTHNIEG
FT                   FLAGQAVYFMLNLNIQKRQIWLTRPGESLDTVAGRIGGDASLTPIGKQYAQDLANFMDR
FT                   QRVLWQLRYTNDLASTNKRFSLSEASSFNVWSSVRKRAIETIEFFNPDSYNVKKIRLLN
FT                   DLNLGSREGLTLREFSEKYPDEFDVIKRKDYAYRFSGQGGESYLDVIHRLQPLIVEIER
FT                   SSGNILVVSHRIVSNILMTYFLNYHPEDIIDVGLPLHTLFCIESDRYGTTCMAYRYDAA
FT                   NRQFIKDPMFDLRKRT"
FT   misc_RNA        972677..973994
FT                   /locus_tag="SPNCRNA.701"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(973242..973548)
FT                   /locus_tag="SPAC222.13c"
FT   3'UTR           complement(973843..974166)
FT                   /locus_tag="SPAC222.14c"
FT   CDS_pept        complement(join(974167..976137,976245..976330,
FT                   976389..976463,976577..976733))
FT                   /transl_table=1
FT                   /locus_tag="SPAC222.14c"
FT                   /product="GTP binding protein Sey1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.14c.1"
FT                   /db_xref="GOA:Q9UTE0"
FT                   /db_xref="InterPro:IPR008803"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030386"
FT                   /db_xref="PomBase:SPAC222.14c"
FT                   /db_xref="PomBase:SPAC222.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTE0"
FT                   /protein_id="CAB60706.1"
FT                   /translation="MSTASNRVSTQIVDEHKQFNNELPKFMQSVGLLDAGFNYHVVAVL
FT                   GSQSTGKSTLLNNLFGTSFSVMDASKRQQTTKGIWLSKANNSPILVMDVEGTDGRERGE
FT                   DQDFERKSALFSISTSEVIIVNMWENQVGLYQGSNMALLKTVLEVNLQLFHNKKERCLL
FT                   QFVIRDFLGNTSMENLADTIMTDLNNIWASLSKPEGFENSVINDFFDVGFTGLPHKILC
FT                   SDAFSEAVDSLRERFVDNNNSDYIFNVSYHKKIPADGFSLYTREIWDTIENNKDLDLPT
FT                   QQQLLAQYRCDEIITEVMEPFSTACTILQKEFLPGNLCKDLPTKLLNMFETVIEAYDRQ
FT                   ASRYNVHIYQKKKQELIASVDSHLYVFFQAQLNALHKELIKSFFDASNEFPSDTPFKES
FT                   SSIKINELVNKMREEGESLSLPHVHWDVDPFILKLSEELTQNSETLCKEKLKEKLEELF
FT                   TGFEFEVSEAVEVAFQKLSHNVWDTLLNEFLAAQNTTIEKIKNIVPFYVDIDDTKTTEE
FT                   YIINFKKNSWLFFRKKIDSEMSEVLLQQRLRVYFEELFRYDSDGMPKLWKKSGTIDRDY
FT                   RESLTKTLDLINVLASIKVSDGNYPDLNVDIKTLEPEYTSPASFFTILNRRRVSDISVN
FT                   FKRSADLIFMDCKRSVINTTTRIPPYFWVLLIVLGWNEFMAILRNPFVFMILMFGGTVV
FT                   YGLYISGLIWPAKMVLERATNNLVDLATDRFSNTYQEQVQQRAMQRTEKSGSPVASADD
FT                   AEAEKTALS"
FT   5'UTR           complement(976734..976782)
FT                   /locus_tag="SPAC222.14c"
FT   misc_RNA        complement(977075..977568)
FT                   /gene="prl50"
FT                   /locus_tag="SPNCRNA.50"
FT                   /product="non-coding RNA poly(A)-bearing (predicted)"
FT   CDS_pept        join(977709..977757,977804..977857,977905..978006,
FT                   978049..978189,978333..978637)
FT                   /transl_table=1
FT                   /gene="meu13"
FT                   /gene_synonym="SPAC821.01"
FT                   /locus_tag="SPAC222.15"
FT                   /product="Tat binding protein 1(TBP-1)-interacting protein
FT                   (TBPIP) homolog (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.15.1"
FT                   /db_xref="GOA:Q9HGK2"
FT                   /db_xref="InterPro:IPR010776"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040461"
FT                   /db_xref="PomBase:SPAC222.15"
FT                   /db_xref="PomBase:SPAC222.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGK2"
FT                   /protein_id="CAD33796.1"
FT                   /translation="MAKAKEVKAKPIKGEEAEKLVYEYLRKTNRPYSATDVSANLKNVV
FT                   SKQVAQKALEQLRDTGLIHGKLYGKQSVFVCLQDDLAAATPEELAEMEKQIQELKDEVS
FT                   VVKTLYKEKCIELQALNNSLSPAEIREKIQSIDKEIEETSSKLESLRNGTVKQISKEAM
FT                   QKTDKNYDFAKKGFSNRKKMFYDLWHLITDSLENPKQLWEKLGFETEGPIDLN"
FT   5'UTR           978722..978902
FT                   /locus_tag="SPAC222.18"
FT   CDS_pept        join(978903..979021,979120..979176,979215..979374)
FT                   /transl_table=1
FT                   /locus_tag="SPAC222.18"
FT                   /product="Srp1 family splicing factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.18"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.18.1"
FT                   /db_xref="GOA:C6Y4C0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PomBase:SPAC222.18"
FT                   /db_xref="PomBase:SPAC222.18.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6Y4C0"
FT                   /protein_id="CBA11493.1"
FT                   /translation="MSNAPSNTPTGFNYKPGHTLYIRNFGTDMRARTLGQAFEKWGRIV
FT                   RCDIPISSNPQAHRYAFVEFEEREKAELAHEKMRNAKIGNDIIFVEWAKSRERYHRDDK
FT                   RRLSNYA"
FT   3'UTR           979375..979643
FT                   /locus_tag="SPAC222.18"
FT   3'UTR           complement(979482..979678)
FT                   /gene="csn3"
FT                   /gene_synonym="SPAC821.02c"
FT                   /locus_tag="SPAC222.16c"
FT   CDS_pept        complement(join(979679..980026,980093..980239,
FT                   980289..980378,980434..980532,980628..980774,
FT                   980846..980898,980944..981076))
FT                   /transl_table=1
FT                   /gene="csn3"
FT                   /gene_synonym="SPAC821.02c"
FT                   /locus_tag="SPAC222.16c"
FT                   /product="COP9/signalosome complex subunit Csn3
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC222.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC222.16c.1"
FT                   /db_xref="GOA:Q9UT51"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR037753"
FT                   /db_xref="PomBase:SPAC222.16c"
FT                   /db_xref="PomBase:SPAC222.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT51"
FT                   /protein_id="CAB60708.3"
FT                   /translation="MVANMEFQGTLPFHPLEDPETLLLKFTDFVHQHSVEQCNQLSMYI
FT                   IASVNSLAEAFYGSHPEKYNIVFQSVEYAAHSPAISVMHVCYLKELLRQGQYATSLKSF
FT                   NDLEVSKHIPGSILLQYCMYAAYHCLGNNDLDSAKVWYFSILYIPTTTLTSFHEEAYYS
FT                   FLLLYIITTGKKFQLDSATSSNVLPLKRHMVPYEEFLDAYLKDVNTLRTVIKEHWSRFL
FT                   KDNSTAFILFALEVYPMHRLKKWRKTFSSLKLEYIAKQLAISQDVAKEIIQKFDNKTNF
FT                   TVANGEIFLTFNALDDVSPEMHSDLCQQLIEASKNFEASIRLKSVIYSKIMAKKLNA"
FT   5'UTR           complement(981077..981161)
FT                   /gene="csn3"
FT                   /gene_synonym="SPAC821.02c"
FT                   /locus_tag="SPAC222.16c"
FT   3'UTR           complement(981473..981797)
FT                   /locus_tag="SPAC821.03c"
FT   CDS_pept        complement(981798..983255)
FT                   /transl_table=1
FT                   /locus_tag="SPAC821.03c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.03c.1"
FT                   /db_xref="GOA:Q9UT50"
FT                   /db_xref="PomBase:SPAC821.03c"
FT                   /db_xref="PomBase:SPAC821.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT50"
FT                   /protein_id="CAB57437.1"
FT                   /translation="MSSIIQNPIESSYFVEDLSAVGNSQLHSGRSLTYGDRKANIDTRS
FT                   GGGRRFWSNLNDSGNSFGAVPASSMNLSYGPTKSATISSKDGAMSRSSRYYVSSELKAT
FT                   LPSLDGRRLSKRNAANHASHHRMPDESASYRTRGEYESSSPRVPQKSLRRYYSTRTAQR
FT                   LDVRRPASRSSRYSKTSDLPPSDPGRFVDDSDLTPHTDFTNRFVDSDFDPDSGVGRSSS
FT                   PDQMMSRNNNLNINARMTSTSSKPYAKENQQLISSMAPVEQKNSFSTAREQYVAPALSF
FT                   AEPVETQHNHMPKTTPLRGTSTVMNGSPIGPYSSSSNATGMYGVSKGHSSSTRRPFFSD
FT                   VGSSQPAEEFVGSSSSHGRQQDSYIADDSDSERSYRRVRDQYLSKPRLSDKNRYSTFSE
FT                   FPGQGTPSASQSNLRRSNTVRPTSFYYEKLHIKNDNPSFQALPYETTTQERKPVVKPDS
FT                   IKTVKPEKKKSKGFFKKLMHKISHIFD"
FT   5'UTR           complement(983256..983481)
FT                   /locus_tag="SPAC821.03c"
FT   3'UTR           complement(983567..985010)
FT                   /gene="cid13"
FT                   /locus_tag="SPAC821.04c"
FT   CDS_pept        complement(985011..986747)
FT                   /transl_table=1
FT                   /gene="cid13"
FT                   /locus_tag="SPAC821.04c"
FT                   /product="poly(A) polymerase Cid13"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.04c.1"
FT                   /db_xref="GOA:Q9UT49"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="PomBase:SPAC821.04c"
FT                   /db_xref="PomBase:SPAC821.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT49"
FT                   /protein_id="CAB57438.1"
FT                   /translation="MDNANCVGGCKFETRSFQYRRRIPYSLGADPLPPVHPLSLKNLVD
FT                   IDTDLISSQLYELYDSIILNDSGLERRYAFVQKLEQILKKEFPYKNIKTSLFGSTQSLL
FT                   ASNASDIDLCIITDPPQCAPTTCEVSAAFARNGLKKVVCISTAKVPIVKVWDSELQLSC
FT                   DCNINKTISTLNTRLMRSYVLCDPRVRPLIVMIKYWAKRRCLNDAAEGGTLTSYTISCM
FT                   VINFLQKRDPPILPSLQMLPHLQDSSTMTDGLDVSFFDDPDLVHGFGDKNEESLGILFV
FT                   EFFRFFGYLFDYEHFVLSIRHGTFLSKRAKGWQFQLNNFLCVEEPFHTSRNLANTADEI
FT                   TMKGIQLEFRRVFRLLAYNCNVDDACSQFTFPSLTDTSFMDDYVNELQLEIVPGFSHGR
FT                   DSSDTSCTESPPEPSHFAWAFDPYNATASPYYNQNINSSIDYSSIYSNDVPAIPPNVPY
FT                   TFVDPYTYACYINNNSYLPPSYMDFYTWYNSPYPKSSHHFDERHGGDRHEKNLSNSRRY
FT                   SRNKFHKKKQSSGPFQYYPDAFSFTPTDNNSPPSNSSSSEVVSPVSLHSEPVLSTVQAF
FT                   KS"
FT   5'UTR           complement(986748..987084)
FT                   /gene="cid13"
FT                   /locus_tag="SPAC821.04c"
FT   5'UTR           988076..988396
FT                   /locus_tag="SPAC821.05"
FT   CDS_pept        join(988397..988422,988462..988568,988748..989688)
FT                   /transl_table=1
FT                   /locus_tag="SPAC821.05"
FT                   /product="translation initiation factor eIF3h (p40)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.05.1"
FT                   /db_xref="GOA:Q9UT48"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR027524"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="PomBase:SPAC821.05"
FT                   /db_xref="PomBase:SPAC821.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT48"
FT                   /protein_id="CAB57439.1"
FT                   /translation="MSDTTSLNVPELESPPIERVELESLLVMNIIKHCRDSFPNMGTIG
FT                   QLVGIDIDGVLQVSSSFESPSVLENEESAVNKSVSGKARQAHTEAMLNRLQYIGAVTGH
FT                   VGWYLGAYVSSFLSSPFFVETQYAYQKANPNSIAFLYDLSQSSNGTLYMRAYQLTPEFM
FT                   AAHEEKTWTASSLNSHNLTPSNVIRELPIVIHNSHLATCLLHSLSEPPTPASTLTAEAA
FT                   LEDCESNLPLTETFSNFEVSLGTRYRKNIELLLESTDEFHYEQGNLGFHQRQLAREQAK
FT                   IQQWIAKRKAENANRAAENLQPLPLDDWKRIFKLPAEPRLLDSLLISSQIMKSTQIDEQ
FT                   SSAFLSKLAGVRNAYAS"
FT   3'UTR           989689..989866
FT                   /locus_tag="SPAC821.05"
FT   misc_RNA        complement(990025..991617)
FT                   /locus_tag="SPNCRNA.702"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           990192..990249
FT                   /gene="spn2"
FT                   /locus_tag="SPAC821.06"
FT   CDS_pept        join(990250..990289,990339..990413,990472..990600,
FT                   990712..990793,990856..991525)
FT                   /transl_table=1
FT                   /gene="spn2"
FT                   /locus_tag="SPAC821.06"
FT                   /product="septin Spn2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.06.1"
FT                   /db_xref="GOA:Q09116"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="PomBase:SPAC821.06"
FT                   /db_xref="PomBase:SPAC821.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09116"
FT                   /protein_id="CAB57440.1"
FT                   /translation="MEVPSAVTLNNYVGFDSITSQINRKLIRRGFQFNVMVVGPSGSGK
FT                   STLINTLFSAHLMDSKGRLDYQAPYRQTTEIHVTSQVVRENRVQLQLNLIDTPGYGDQI
FT                   NNDKCWEPIIKYIRDQHSSYLRRELNSHREKRLQDTRVHCCLFFIRPTGHSLRPIDIAV
FT                   LKRLTEVVNVVPVIAKSDSLTLEERAAFKQQIREEFVKHDINLYPYDSDDADEEEINLN
FT                   AAVRNLIPFAVVGSEKAIIVDGRPIRGRQNRWGVVNVDDENHCEFVFLRNFLMRTHLQD
FT                   LIETTSYYHYEKFRFKQLSSLKEQSSLATRMGSPAPVYPSEPHLHTATAQ"
FT   intron          990290..990338
FT                   /gene="spn2"
FT                   /locus_tag="SPAC821.06"
FT   intron          990414..990471
FT                   /gene="spn2"
FT                   /locus_tag="SPAC821.06"
FT   intron          990601..990711
FT                   /gene="spn2"
FT                   /locus_tag="SPAC821.06"
FT   intron          990794..990855
FT                   /gene="spn2"
FT                   /locus_tag="SPAC821.06"
FT   3'UTR           991526..991889
FT                   /gene="spn2"
FT                   /locus_tag="SPAC821.06"
FT   3'UTR           complement(991632..991751)
FT                   /gene="moc3"
FT                   /locus_tag="SPAC821.07c"
FT   CDS_pept        complement(991752..993278)
FT                   /transl_table=1
FT                   /gene="moc3"
FT                   /locus_tag="SPAC821.07c"
FT                   /product="transcription factor Moc3"
FT                   /db_xref="GOA:Q9UT46"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT46"
FT                   /protein_id="CAB57441.2"
FT                   /translation="MNPYVSYPEIHMKRNRTGSINSNPLYIPNPNVEPTPKPTKRRTKT
FT                   GCLTCRRRRIKCDETKPFCLNCTKTNRECEGYPNSAAQMQAMGSVSPPELSVHSAQQPL
FT                   IPTSIASSSAQTGDTFSGSSQSNFNTNDLNQMTSSSNLSTVTPIKQDHQKPMNLQGFPS
FT                   AYQQHQYLQSNHNVPTNNSSSATSSTKPSVQSVGQASYPFLSSVSNFPSNFNSELFPFY
FT                   FHDVVPSICAFEFDNNIALHFWSVTVPQFAQSMPCIANSLMAFASIKKLDVFGAYSHLT
FT                   RALRCPMPGPNSFEYLLVSAFLTLTQLNLPAYDLNFCNNFIRKLSWSSSTKSNYVSLLI
FT                   AMVVRELVFAILPRGCIWGFNGKPLSEVSVSRSHAPVSDSLFTIGLDILSQPTLSDDLH
FT                   RERMVAWRDEYHVHLYSASRSPLTKVIDCVGHAVTKNNNDVLSGLQQLMQEECTDIAVL
FT                   RTSYLCVLSLQNVFASNSKEFKLRAQIESHFGRLMLEHFMDCNVLNRPVL"
FT   5'UTR           complement(993279..994230)
FT                   /gene="moc3"
FT                   /locus_tag="SPAC821.07c"
FT   misc_RNA        993887..995063
FT                   /locus_tag="SPNCRNA.703"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(994941..995475)
FT                   /gene="slp1"
FT                   /gene_synonym="cdc20"
FT                   /locus_tag="SPAC821.08c"
FT   CDS_pept        complement(995476..996942)
FT                   /transl_table=1
FT                   /gene="slp1"
FT                   /gene_synonym="cdc20"
FT                   /locus_tag="SPAC821.08c"
FT                   /product="sleepy homolog Slp1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.08c.1"
FT                   /db_xref="GOA:P78972"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PDB:4AEZ"
FT                   /db_xref="PomBase:SPAC821.08c"
FT                   /db_xref="PomBase:SPAC821.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78972"
FT                   /protein_id="CAB57442.1"
FT                   /translation="MEIAGNSSTISPTFSTPTKKRNLVFPNSPITPLHQQALLGRNGRS
FT                   SKRCSPKSSFIRNSPKIDVVNTDWSIPLCGSPRNKSRPASRSDRFIPSRPNTANAFVNS
FT                   ISSDVPFDYSESVAEACGFDLNTRVLAFKLDAPEAKKPVDLRTQHNRPQRPVVTPAKRR
FT                   FNTTPERVLDAPGIIDDYYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAETDEST
FT                   YVASVKWSHDGSFLSVGLGNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSR
FT                   SGAIHHHDVRIANHQIGTLQGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKF
FT                   TKTNHNAAVKAVAWCPWQSNLLATGGGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWS
FT                   PHSKEIMSTHGFPDNNLSIWSYSSSGLTKQVDIPAHDTRVLYSALSPDGRILSTAASDE
FT                   NLKFWRVYDGDHVKRPIPITKTPSSSITIR"
FT   5'UTR           complement(996943..997625)
FT                   /gene="slp1"
FT                   /gene_synonym="cdc20"
FT                   /locus_tag="SPAC821.08c"
FT   misc_RNA        998045..998413
FT                   /gene_synonym="SPNG167"
FT                   /locus_tag="SPNCRNA.163"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           998686..998952
FT                   /gene="eng1"
FT                   /locus_tag="SPAC821.09"
FT   CDS_pept        998953..1002003
FT                   /transl_table=1
FT                   /gene="eng1"
FT                   /locus_tag="SPAC821.09"
FT                   /product="endo-1,3-beta-glucanase Eng1"
FT                   /EC_number="3.2.1.39"
FT                   /db_xref="GOA:Q9UT45"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR018909"
FT                   /db_xref="InterPro:IPR040451"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT45"
FT                   /protein_id="CAB57443.1"
FT                   /translation="MSSYLRSFIFGLLTISLAQCSPILKDTKDTKFSTGSNISLKKRDT
FT                   NVFDSVVDTINPASYFGTVSHPVTPAGVSTDSLSSPIETNKFFDNNLLGSRTNFMYADP
FT                   FRYWWQSSDTMGGICIAHTDDNQRVMDTDDTIPSYYYEPIGICSLGFGASGITSNTDPI
FT                   VDEIDQMSARFTFSWDSSSMQLTLTEGMAVTTAVYTNAIPQIFSSTLYINDFVEVPGTS
FT                   AVQKYRVTMSDNHVWLIYIYGDSLTLTESTSQMLVGSNTFNGYIQIAKIPLGDGTAEAL
FT                   YDTYAGVYITGISISGYVEDAVGYYSFDFTTAGDTSVEPLFFLLPHQVDTAVSGTKVTS
FT                   IVLASLVSGDMNAAAGNSITFAEAIPQDIGFLPWSPTGGQIGYSEEALEIIAEVAGTEL
FT                   GEDFSANSNLNSMYYSGKVLAKYAMLCVTINDILGDETSSEQCIQKLEAAFARFVDNQQ
FT                   IYPLTYDNTWKGVVSVAGLSGDSLADFGNSYYNDHHFHYGYFVFTAAVIGHIDPDWINT
FT                   GNNKEWVNFLVRDVANPSSNDPYFPKHRMIDIYHGHGWASGLFESNDGKDEESTSEDYN
FT                   FFFGMKLWGQVIGDSDMEDRANIILGIERNALNKYMLYADGNVQPTSMQPNYVAGITFM
FT                   NKITHTTYFGTNIEYIQGIHMLPITPISAFIRGPSFVLAEWNALLASVIDYVDSGWRSL
FT                   LYANLAIAEPEESYEYFSSSDFNTDYLDDGASRAWYLAYAAGLWANDAVYYPVSSSSTT
FT                   TTSTSTGSVTTTSTTATASCTLPISYTSTPTTTSISGTCNGATFDASLYVCDGTVLCPI
FT                   VNGVSYQNCNGACYNPSQYGCDNGALGPVQSSSTTSSITPTPTTTSSITPTPTTTSTTT
FT                   TAQSTGMQLCGSNYYDASSYYCDNDQLCPIIDGVDYLSCNGACYNPSQYVCSDGSLSPN
FT                   TVTTTKATTTFTPTPTTTTTPTPTTTSATSTNVIAQCGSAWYDSQSYICYGNILCPIIN
FT                   GSPLLACGNACYDSSIYGCSNGALVAA"
FT   3'UTR           1002004..1002361
FT                   /gene="eng1"
FT                   /locus_tag="SPAC821.09"
FT   3'UTR           complement(1002838..1002998)
FT                   /gene="sod1"
FT                   /locus_tag="SPAC821.10c"
FT   CDS_pept        complement(1002999..1003463)
FT                   /transl_table=1
FT                   /gene="sod1"
FT                   /locus_tag="SPAC821.10c"
FT                   /product="superoxide dismutase Sod1"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="GOA:P28758"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28758"
FT                   /protein_id="CAB57444.1"
FT                   /translation="MVRAVAVLRGDSKVSGVVTFEQVDQNSQVSVIVDLVGNDANAKRG
FT                   FHIHQFGDNTNGCTSAGPHFNPEGKTHGDRTAAVRHVGDLGNLESDAQGNIKTTFSDSV
FT                   ISLFGANSIIGRTIVIHAGEDDLGKGTSEESLKTGNAGARNACGVIGIAV"
FT   5'UTR           complement(1003464..1004804)
FT                   /gene="sod1"
FT                   /locus_tag="SPAC821.10c"
FT   repeat_region   1004892..1005249
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        1005499..1005710
FT                   /gene_synonym="SPNG168"
FT                   /locus_tag="SPNCRNA.164"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           1006259..1006393
FT                   /gene="pro1"
FT                   /locus_tag="SPAC821.11"
FT   CDS_pept        1006394..1007749
FT                   /transl_table=1
FT                   /gene="pro1"
FT                   /locus_tag="SPAC821.11"
FT                   /product="gamma-glutamyl phosphate reductase Pro1
FT                   (predicted)"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.11.1"
FT                   /db_xref="GOA:Q9UT44"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="PomBase:SPAC821.11"
FT                   /db_xref="PomBase:SPAC821.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT44"
FT                   /protein_id="CAB57445.1"
FT                   /translation="MSLEENVKEAKNAFNILQTLSVEDRDDALDKIVEELRIKKSEVLA
FT                   ANAEDMKAAKLLAESGKLSSSMVKRLDLSSSDKYDSMVQGVLDVKSLPDPLGRVTYARS
FT                   LDDGLDLYKVSCPVGLLLVIFEARPEVIINITSLAIKSGNAVVLKGGTESAKSFAALSN
FT                   VVRSALGKSKVPQAAVQLVQSREEVSQLLKLDEYIDLVIPRGSTNLVRHIKDNTKIPVL
FT                   GHAAGLCSMYVHEDADMELASKLVLDGKTDYPAACNAIETLLINEAVLSSHLPKIAETL
FT                   TEAKVTLKCDPASLKVLKDMPKVSALVEPSVDQDYNTEFSDLILAIKTVPSLQSAMQHI
FT                   NTHGSKHTDCIITSSEAAANRFMAGIDASGVYWNASTRFADGFRYGYGTEVGISTNKIH
FT                   ARGPMGLDGLTIYKYQLRGNGQVASSYGVGPGKRAFKHTPINIDNISQVSKK"
FT   3'UTR           1007750..1008003
FT                   /gene="pro1"
FT                   /locus_tag="SPAC821.11"
FT   5'UTR           1008215..1008438
FT                   /gene="orb6"
FT                   /locus_tag="SPAC821.12"
FT   CDS_pept        join(1008439..1008581,1008849..1009023,1009069..1010160)
FT                   /transl_table=1
FT                   /gene="orb6"
FT                   /locus_tag="SPAC821.12"
FT                   /product="serine/threonine protein kinase Orb6"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.12.1"
FT                   /db_xref="GOA:O13310"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPAC821.12"
FT                   /db_xref="PomBase:SPAC821.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13310"
FT                   /protein_id="CAB57446.1"
FT                   /translation="MDKNDYLHFERNPSLFPKSTLDKVQKTKKYIEHYYKVAVDHAVER
FT                   NQRRINLEQRLATERGSEERKNRQLRASGEKESQFLRFRRTRLSLEDFSTIKVIGKGAF
FT                   GEVRLVQKLDTGKIYAMKSLLKTEMFKRDQLAHVKAERDLLVESDSPWVVSLYYAFQDS
FT                   LYLYLIMEFLPGGDLMTMLINYDTFSEDVTRFYMAECVLAIADVHRMGYIHRDIKPDNI
FT                   LIDRDGHIKLSDFGLSTGFYKQDQSASYMKPRTGNTVKRGQMVDAIWLTMSSKDKMATW
FT                   KKNRRVMAYSTVGTPDYIAPEIFLQQGYGQDCDWWSLGAIMFECLIGWPPFCSENSHET
FT                   YRKIINWRETLTFPNDIHLSIEARDLMDRLMTDSEHRLGRGGAIEIMQHPFFTGIDWDH
FT                   IRETAAPFIPNLKSITDTHYFPVDELEQVPEQPVTQQPASVDPQTLEQTNLAFLGYTYK
FT                   KFNYLTMKGAL"
FT   3'UTR           1010161..1010318
FT                   /gene="orb6"
FT                   /locus_tag="SPAC821.12"
FT   3'UTR           complement(1010343..1010639)
FT                   /gene_synonym="SPAC955.01c"
FT                   /locus_tag="SPAC821.13c"
FT   CDS_pept        complement(1010640..1015328)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC955.01c"
FT                   /locus_tag="SPAC821.13c"
FT                   /product="P-type ATPase (predicted)"
FT                   /EC_number="3.6.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC821.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC821.13c.1"
FT                   /db_xref="GOA:Q9UT43"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PomBase:SPAC821.13c"
FT                   /db_xref="PomBase:SPAC821.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UT43"
FT                   /protein_id="CAB57447.2"
FT                   /translation="MKSSGIAGDSNGFETNFLNETTNREEDGAFNWNAADDGTNERRED
FT                   IHVRFQDSALPLGIDENELDEIDINGDSKKLDSVEVDESHDVNSPSDSRLKSSFKSVLE
FT                   LTANSMVSVLTPSTKTEQTSKGKGKKKKAHVSFLEGPVEEIPLDDIEPTSPREASPVFN
FT                   GRPPIPPEFLKSRHKEFTIPNPLQFISNFLSNLFSRDTRYLKSSHGRIIIINPYDDSSQ
FT                   IDERTGKPYMQNSIVSSRYNKYNFVPLQIIAQFSKTANCYFLLIAIMQMIPGWSTTGTY
FT                   TTIIPLLIFISIAILREGFDNYRRYRQDRVENRIQTQVLRHVDVDPPIVEEHSSFFRRR
FT                   RWRRSRSQESASRSTIRSTDEREPERTSEDPPQLPPSPSSPSSPALSVKPNIDPQPPLY
FT                   NSTLTTTRSIPANKPTFFWASCDRKDVRVGDIIRLTSDQTLPADVIALSSPNPNGAIYI
FT                   ETAALDGETSLKTRLVNSTLRSLCKDINDLIRLSGTCTVEDPNGDLYNFNGSMKLDSIQ
FT                   GEIPLSNNDVLYRGSNLRNTSELFALVIFTGEESKIRMNAVRNVSVKAPSMQKVTNRIV
FT                   IFIFALVVSMAIYCTAAYFVWQKKVERKLWYLTNSKLSFVPILVSFIILYNTMVPISLY
FT                   VSMEIIRVFQTFLVQSDIDLYYPENDTRCEVRSSSILEELGQVTHVFSDKTGTLTDNIM
FT                   LFRNLSVGGFAWQHVGAENPKLVSTSQKSDDLDGEAKPPQLENIQGTTIQLLQYVHDNP
FT                   HTTFSKRVRIFLLNLAICHTCLPSFDEENQIYKYQSISPDELALVHAAQQLGYIVIDRD
FT                   IDSLTIRLHYPLDPHSHPIAKTYRILNIIEFTSKRKCMSVIVRMPNGRICLFCKGADSA
FT                   IIKRLRLSNLAKRKDKSVTKAEQARKSIEIDKAIIRNSQSTSRPSLTASRPSLSRRRND
FT                   YINNVTSWLDERREKMGVVRPRASTSILETRRRPAVGRHSLAGGERLMEDKKYLSKQEE
FT                   AEGSIYESLNHNDAKLFENTFEHVHAFATDGLRTLMYAHRFIDESEYQSWKLVNDAALN
FT                   SLSNRQQLLDEAADLIEKDLEFAGATAIEDKLQVGVPESINSLFRAGIKFWMLTGDKKE
FT                   TAINIGHSCGVIKEYSTVVVMGSLDGVEGSDETVSGGQRLSLDRPPTNDPASLMIHQLI
FT                   SCMNAIHSNSLAHLVIVIDGSTLADIENDPELFLLFINTAVEADSVICCRSSPMQKALM
FT                   VQKVRNTLEKAVTLAIGDGANDIAMIQEAHVGIGIAGREGLQAARSSDFSIGRFKFLIK
FT                   LLFCHGRWSYVRLSKYILGTFYKEQFFFLMQAIMQPFVGYTGQSLYESWGLTCFNTLFS
FT                   SLCVIGLGIFEKDLSASTVIAVPELYQKGINNEAFNWRVYFGWCSIAFIQAFLVFYVTY
FT                   SLFGMKELNDNNIFAYGQLIFTAAIFIMNFKLVFIEMQYINIISIIVLVLTSLAWFLFN
FT                   IFISEHYPDKNLYLARSQFLHHFGKNPSWWLTMLFVMVCALTIDIVAQMLRRTLRPTDT
FT                   DIFVEMENDAFVRSRFEQESGEFLQANAPSVDEIEQYLKSRD"
FT   5'UTR           complement(1015329..1015415)
FT                   /gene_synonym="SPAC955.01c"
FT                   /locus_tag="SPAC821.13c"
FT   misc_RNA        1015475..1015830
FT                   /gene_synonym="SPNG169"
FT                   /locus_tag="SPNCRNA.220"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(1016103..1016365)
FT                   /gene_synonym="SPAC955.02c"
FT                   /locus_tag="SPAC139.01c"
FT   CDS_pept        complement(join(1016366..1016669,1016730..1018827,
FT                   1018869..1018875))
FT                   /transl_table=1
FT                   /gene_synonym="SPAC955.02c"
FT                   /locus_tag="SPAC139.01c"
FT                   /product="nuclease, XP-G family (predicted)"
FT                   /db_xref="GOA:Q9UTN2"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR022039"
FT                   /db_xref="InterPro:IPR022040"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTN2"
FT                   /protein_id="CAB88876.3"
FT                   /translation="MTIRSLNLFIIDKKHQHKSSLSSFQNCKLGIDASFYLTQIIHSFT
FT                   PQELQSLAVNGESEYLQHRISEFLEQLRTENITPIFVFNGIPLTFEASSQLEVPGKQKS
FT                   HSALTDFEAFDPYDANIQRNMYRMDASGPANYGESKPTLLYTNQRDHLDRLCDQVKFYL
FT                   DQCNVEYFVAPYLAMAQLAYFLNGTSSPYIDAIYGSTDLLLFGVKKFITSMNTSSNVKI
FT                   SSDPSSPSTQTTINSAAKSSFTWLDGNALLQDTNGLSWQQFIDSCLLCGTAISPTFPQI
FT                   EGTFLIKSAMELVRMFGSAYRAVLHFAEIFPQPIFQDYLQQYKRAVCFSKFGIVMDTKG
FT                   LTLPPVPTESVPNDINIYFGTRLPNEIYFYISRGLIPCKMIGALVSGCFSDPVSILEQH
FT                   IGDKASQGTFSGANSGLNPGRDNAAAVAAVDQRRFVDDLEEIWSQGLNLLTQPLNRFYQ
FT                   ARDIVSLHGHNQQASLKVMHSYDPPLYNDTRAWMIYEENLPSYLSSNFLKEEPVVLFDL
FT                   LRALNDPVFVKKSFCTEGNIGIKNPPKHPLSSTAEIVLSSCYRFLQIRSFVLTSHQLTS
FT                   WGCPLLKALENCHLQNQTSVVVLFELLRLRQLKEPSLLSSSSASIADLSITSATEFLAK
FT                   VATFLPIKQRPEVSKISIVDENLLQFYQLQTSFGSNLKELMAMILASVILNRNVDKSKI
FT                   DPKLIRKTLPFQNINGSLVSGFVVKRFFEIISKEQEASSQQENIQKAYEIIEKEFPTIG
FT                   SAENHIAQFLEFWKTFMEGVKEAENTSAIGKLVLSKLFLTNQWIFSLGL"
FT   intron          complement(1016670..1016729)
FT                   /gene_synonym="SPAC955.02c"
FT                   /locus_tag="SPAC139.01c"
FT   misc_RNA        1018733..1021093
FT                   /locus_tag="SPNCRNA.704"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(1018876..1019031)
FT                   /gene_synonym="SPAC955.02c"
FT                   /locus_tag="SPAC139.01c"
FT   3'UTR           complement(1019248..1019611)
FT                   /gene="oac1"
FT                   /locus_tag="SPAC139.02c"
FT   CDS_pept        complement(1019612..1020574)
FT                   /transl_table=1
FT                   /gene="oac1"
FT                   /locus_tag="SPAC139.02c"
FT                   /product="mitochondrial anion transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC139.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC139.02c.1"
FT                   /db_xref="GOA:Q9UTN1"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="PomBase:SPAC139.02c"
FT                   /db_xref="PomBase:SPAC139.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTN1"
FT                   /protein_id="CAB59616.1"
FT                   /translation="MSEKQTIKALPAHNPTQVKKLGPVSGFLSGGLAACGAVTLTNPFE
FT                   VIKTRFQLQGQLTKLDPSKRIYKSVGQAFSLIARHEGIRGLQRGLGTAYVYQICLNGCR
FT                   LGFYEPIRRTLNTWFLDDPKGNKLAINVASGAGSGLCGALFGSPFFLVKTRMQSYSPKF
FT                   PVGQQYGYKHIFNAFSRIIKENGVKGLFVGADAAILRTVSGSSVQLPIYNWAKRMIEHY
FT                   NLLEEGMIKHLTASAVSGFGVCCTMQIFDTVMTRMYNQKNKELYKNPIDCILKTIRSEG
FT                   FFALYKGFGAHLARIAPHTIFCLTFVEQTNKLFLKFQKD"
FT   5'UTR           complement(1020575..1020838)
FT                   /gene="oac1"
FT                   /locus_tag="SPAC139.02c"
FT   5'UTR           1021695..1021916
FT                   /locus_tag="SPAC139.03"
FT   CDS_pept        join(1021917..1022807,1022847..1023794,1023836..1023874)
FT                   /transl_table=1
FT                   /locus_tag="SPAC139.03"
FT                   /product="transcription factor, zf-fungal binuclear cluster
FT                   type (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC139.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC139.03.1"
FT                   /db_xref="GOA:Q9UTN0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPAC139.03"
FT                   /db_xref="PomBase:SPAC139.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTN0"
FT                   /protein_id="CAB59617.1"
FT                   /translation="MSETTKSGSKKSGQTSRRAIHSCLACRRKKLKCDHGRPCSNCLKR
FT                   STIQSCIYIDPGKTNYDKRFERGSEADELIDQLLSRVSMLEKRLNEVGTKSQSDYENQQ
FT                   SHNLPSTPSADAETQRNIGSLSVLDDTKSQYANYSSSSHVLWHLRNYHYLNLDQDIQEE
FT                   NDSLISPFFFRISPNESAYDYLPPKKVSDILIEQFFFRCHMLINVLHRPTFYVRYNDFW
FT                   EKPHLRKPAFTSLLYAIYASALLATPVEVQKTWALGEDERYLQVDYHQAFRYALASSNF
FT                   LFEPDLNALQALVLCQVVFDSDRIRAPPSLVGLILHVALCMGLHRDGSLYGLNPVISEI
FT                   RRRVWANIVLSDLRTSETIGYPPQIVEGNYDTRLPSALPDEIHNVDSSVIISEATFVNI
FT                   ITKVSRAYSKCLKVLLGIIAPNYTRLLELDRELSNFFKELIEVNIPTSNTMHERHIRLL
FT                   VSYLSNRFPILLHFPFLLKKNSAQFAYSHSRALESATLALNQLYELGSNPEYSKYSWYL
FT                   WRYPPFHPCIVLLLDLLNSQKIIYLDDERVVLLNKIFSLFPRSSGKEHYQKAWALLQTS
FT                   RAKVWEKLGLSTVDVSTTDVRLTNFEFFDANNLDINWDDWDAIFQHCPF"
FT   3'UTR           1023875..1024135
FT                   /locus_tag="SPAC139.03"
FT   3'UTR           complement(1024002..1024175)
FT                   /gene="fap2"
FT                   /locus_tag="SPAC139.04c"
FT   CDS_pept        complement(1024176..1025477)
FT                   /transl_table=1
FT                   /gene="fap2"
FT                   /locus_tag="SPAC139.04c"
FT                   /product="L-saccharopine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC139.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC139.04c.1"
FT                   /db_xref="GOA:Q9UTM9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PomBase:SPAC139.04c"
FT                   /db_xref="PomBase:SPAC139.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTM9"
FT                   /protein_id="CAB59618.1"
FT                   /translation="MSRTIVIVGCGVFGLSTAVELAKNHSFDNIIAIDAEPVPSSMSAA
FT                   NDINKIVRPEYADLKYMKLALEAMEKWRNDPELSSVYFECGRLSTISKDPYRARFDEVA
FT                   QRNLRKLLGDSALINLSSSEEIRKKYPSLFSNSPLRSDMQAVVNEHAGYANSAASLKLL
FT                   ELKARELGVEFVFGKAGKFKKFVVNHSETDIDKNDNHVSVQTEDGTIYHADTILLAVGA
FT                   YLNAYLNTSHRVCAKGLPVAHIQLTDEEFKTYKNMPIIFDPDCAYAFPPYPVTKLIKLA
FT                   STGYEYVCNVETDYDENSKVVSIPHSGPSKSSLPKYAIIQMRRFLDTFLPDLADRSLIN
FT                   TKMCWISDTEDANFLIDKVPQFDNVFVANGDSGHAFKFLPNIGRYIAQRILGDLSEEWK
FT                   DAWRWREDDKASELKWRCVRSLIDYKDAEFTYDK"
FT   misc_RNA        1025199..1025635
FT                   /locus_tag="SPNCRNA.705"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(1025478..1025903)
FT                   /gene="fap2"
FT                   /locus_tag="SPAC139.04c"
FT   5'UTR           1027811..1028315
FT                   /locus_tag="SPAC139.05"
FT   misc_RNA        complement(1028239..1030659)
FT                   /locus_tag="SPNCRNA.706"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        1028316..1029797
FT                   /transl_table=1
FT                   /locus_tag="SPAC139.05"
FT                   /product="succinate-semialdehyde dehydrogenase (predicted)"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC139.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC139.05.1"
FT                   /db_xref="GOA:Q9UTM8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="PomBase:SPAC139.05"
FT                   /db_xref="PomBase:SPAC139.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTM8"
FT                   /protein_id="CAB59619.1"
FT                   /translation="MAPQFKRPELFGFDKSHAQSFVQGKWISSPNNKTFEVDNPATGEI
FT                   IGKVADVSVEETKKAISAANEAFKTYKNFTHVQRSQLLERWAELIMENKDDLVKMLTLE
FT                   NGKPLSQAEMEVTTCSGYLKWYAAEAVRTFGDVAPSSLQSQNFLISIKQPVGVSALITP
FT                   WNFPAAMIARKGGAALAAGCTAIFLPAFRTPYVCLGLVRLAQEAGFPDGVLNVITSSDA
FT                   SAHGKELTTNPIVRKVSFTGSTNVGKILMGQSASTIKKVSMELGGNAPFIVFPDFPIDQ
FT                   AVESFCTIKFNSCGQVCVCPNRVYVHKNVYDEFVSKLTEKVKTIKVGDGFDSSSAVGPL
FT                   ISQDGCKKVSKHIEDAVSKGAKITVGGKEISSSKGYFFEPTVLSGVTQDMLVASEETFG
FT                   PLASVFKFDDTEEVIEWANDSDVGLAGYVFTNNLSTMIHVAKELEVGLVGANIEMVDEP
FT                   FISFGGIKQSGFGKEAGRLGVQEFMVVKEINLKTL"
FT   3'UTR           1029798..1029993
FT                   /locus_tag="SPAC139.05"
FT   5'UTR           1030125..1030229
FT                   /gene="hat1"
FT                   /gene_synonym="SPAC23C4.01"
FT                   /gene_synonym="kat1"
FT                   /locus_tag="SPAC139.06"
FT   CDS_pept        join(1030230..1030287,1030338..1030441,1030503..1030721,
FT                   1030811..1030926,1030998..1031361,1031418..1031693)
FT                   /transl_table=1
FT                   /gene="hat1"
FT                   /gene_synonym="SPAC23C4.01"
FT                   /gene_synonym="kat1"
FT                   /locus_tag="SPAC139.06"
FT                   /product="histone acetyltransferase Hat1"
FT                   /EC_number="2.3.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC139.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC139.06.1"
FT                   /db_xref="GOA:Q9UTM7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="InterPro:IPR037113"
FT                   /db_xref="PomBase:SPAC139.06"
FT                   /db_xref="PomBase:SPAC139.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTM7"
FT                   /protein_id="CAB59620.2"
FT                   /translation="MSAVDEWVHNANECIEIVQVNEKHEKDCQYHPSNTYAIFGDAEVI
FT                   YGYKDLNVTITYECPLMVPKLEISYSERLAPDSGVEPTDIEGTLNTYLKDRSIKVEGNS
FT                   FDVHSANSIHNYSFNGKTFKILQATVLEASEIMQHLQIFSLFFIEGGSFIDLNDPRWMV
FT                   YLLYETTEDDYCLRGYCTVYKYYKWDKLIHDGIRARISQFVILPPFQHQGHGSQLYNAI
FT                   VSTFLKNPKILDFTVEDASEAFDSLRDHCDYKRLLSMGIFSEPDFHPSLSRQWINSKIA
FT                   ETKLTQRQFSRCCELAFTTKLKKLSLLERKSVRLGIKERIFRQNLDVLLQLDKSERIEK
FT                   IHNAYENQFDEYKQIVKKLPKLKEDSPRKRQKLAQSSS"
FT   3'UTR           1031694..1031941
FT                   /gene="hat1"
FT                   /gene_synonym="SPAC23C4.01"
FT                   /gene_synonym="kat1"
FT                   /locus_tag="SPAC139.06"
FT   misc_RNA        complement(1031904..1033018)
FT                   /locus_tag="SPNCRNA.707"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           1032085..1032181
FT                   /gene="crn1"
FT                   /locus_tag="SPAC23C4.02"
FT   CDS_pept        join(1032182..1032215,1032258..1032310,1032359..1032586,
FT                   1032628..1032716,1032766..1034167)
FT                   /transl_table=1
FT                   /gene="crn1"
FT                   /locus_tag="SPAC23C4.02"
FT                   /product="actin binding protein, coronin Crn1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.02.1"
FT                   /db_xref="GOA:O13923"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPAC23C4.02"
FT                   /db_xref="PomBase:SPAC23C4.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13923"
FT                   /protein_id="CAB16873.1"
FT                   /translation="MSGRFVRASKYRHIFGQTCKKELCYDNIKLSNNAWDSNLLSVNPF
FT                   YLSVNWNAGAGGALAVIPLNERGKLPDQVNLFRGHTAAVLDTDWNPFHDQVLASGGDDS
FT                   KIMIWKVPEDYTVMEPYEDVHPIAELKGHSRKVGLVQYHPTAANVLASSSADNTIKLWD
FT                   CEKGVAHVSLKMDVMCQSMSFNADGTRLVTTSRDKKVRVWDPRTDKPVSVGNGHAGAKN
FT                   PRVVWLGSLDRFATTGFSKMSDRQIALWDPTNLSEPIGGFTTLDTGSGILMPFWDDGTK
FT                   VIYLAGKGDGNIRYYEYENDVFHYLSEFKSVDPQRGIAFLPKRGVNVSENEVMRAYKSV
FT                   NDSIIEPISFIVPRRSESFQSDIYPPAPSGKPSLTAEEWASGKDAQPDLLDMSTLYESK
FT                   GTVEKAVSATVPSAGAQVQKHNEEKVETPKPEAQPVSKPKESAEEQKPSKEPEVKPTTP
FT                   SASKVEEPSKKRDEDNHQKEETVTQPKREKTPVEKSFPKPASSPVTFSEDVKKEPSEEK
FT                   KLEVSDEAPKAAPLAESKKVEEKEPFYVSKDKKDISAVNLADLNKRFEGFEKRYEEELA
FT                   IRDWKIAQLEDKLAKLTEAIKEKCN"
FT   CDS_pept        1034296..1035762
FT                   /transl_table=1
FT                   /gene="hrk1"
FT                   /locus_tag="SPAC23C4.03"
FT                   /product="haspin related kinase Hrk1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.03.1"
FT                   /db_xref="GOA:O13924"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PomBase:SPAC23C4.03"
FT                   /db_xref="PomBase:SPAC23C4.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13924"
FT                   /protein_id="CAB16874.1"
FT                   /translation="MESRSKVKTYGKNRRYINKDIEIWASLDERPCALKPRNIENFNNQ
FT                   ERSDLEHIHSKPKKDSLLSWNILLKKGSYKENELLAKRNQNLVPTVIIPASPRDNASKS
FT                   VVSKKEVVNLSSSVALSGKPANNSKLDPLHRLLQIVAQEDALPFSQFVKSQTFEIQKIG
FT                   EASYSEVYQASNADDVPVVWKVIPFGEDGQAQYADVLNEVQISQWIKVDGFANLHQVVV
FT                   VKGTYPSLLLEEWDRYLMQNGSENDRPDSYSSTQLYCVLCLDHSGTDLEHFELRSWREC
FT                   WSVFYETLKILSLVETRYEFEHRDLHWGNILIRKADRSEEEVSFLLNEISLDDIESVDF
FT                   PGSQDKADDFDNILQVTLIDFTLARASYSQGIISYNEFNDPDLFNGVDDYQFDIYRLMS
FT                   RVTKGRWAQFFPITNVLWLHYLIHQLLHKKNLSSPLTETETLMRSRLKQIFRLIDPVKT
FT                   MQFQQAEDSIRSKSTVTSATSLLNWVRQKY"
FT   3'UTR           1035763..1035992
FT                   /gene="hrk1"
FT                   /locus_tag="SPAC23C4.03"
FT   CDS_pept        join(1036033..1036343,1036397..1036508)
FT                   /transl_table=1
FT                   /locus_tag="SPAC23C4.04c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.04c.1"
FT                   /db_xref="GOA:A6X970"
FT                   /db_xref="PomBase:SPAC23C4.04c"
FT                   /db_xref="PomBase:SPAC23C4.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6X970"
FT                   /protein_id="CAO77637.2"
FT                   /translation="MFCYFLSKSYDDCSRYYIISNMAFYFPVYDSDSPTTVHHDERKES
FT                   WRSHGFIVCLHIRCCICCKYNSKIKKPSLNIALRIQSLKIIKILIFQFYSTKPLWDKNS
FT                   PEYKQLRSEIEATKRDEEVKNGELIDPNVTTEDEKL"
FT   3'UTR           complement(1036639..1036832)
FT                   /locus_tag="SPAC23C4.05c"
FT   CDS_pept        complement(join(1036833..1038061,1038116..1038182))
FT                   /transl_table=1
FT                   /locus_tag="SPAC23C4.05c"
FT                   /product="LEA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.05c.1"
FT                   /db_xref="GOA:O94559"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="PomBase:SPAC23C4.05c"
FT                   /db_xref="PomBase:SPAC23C4.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94559"
FT                   /protein_id="CAB16876.1"
FT                   /translation="MQPRFLLHGALLALGIQLCLSIGKITGHISSIEATAADIHDAPST
FT                   TTKYVQRTVYAGREKGKIGGPADSWPQRKLDDFLQNHGVKSLDVPPIETPSQFWRKPLQ
FT                   YVSKVTDKCKSFYEKEKNHASHNAQKLDVWIFNSWTNSELSRWLIKNKYEVPEPGTREQ
FT                   LLETVFQASMGDAISTNDELESWSNNLLLSMLDQKNITVPIGASHDDLIVLARRYYDIE
FT                   ERKSQDKVTNITDSQPAPYMKEIIHLWSDGRLIDFLRERNIPISVLSPRETLLKEAYAN
FT                   RFTPRVMIASNVLDGWSSEDLLDWIWKYNKRGSIFSHVAYNSRHELIHAAKLFYMDVAS
FT                   EWSSSDMASLNDSLYSHPSVSKQSTWTEEELKEELESFGELVPVPFSSTKAFERLLPHL
FT                   YYYLRGPAFLNRIHYWQTFLGNSLKRAFVLSQ"
FT   5'UTR           complement(1038183..1038267)
FT                   /locus_tag="SPAC23C4.05c"
FT   5'UTR           1038379..1040240
FT                   /gene="tht2"
FT                   /gene_synonym="mug22"
FT                   /locus_tag="SPAC23C4.07"
FT   3'UTR           complement(1038515..1038665)
FT                   /locus_tag="SPAC23C4.06c"
FT   CDS_pept        complement(1038666..1039649)
FT                   /transl_table=1
FT                   /locus_tag="SPAC23C4.06c"
FT                   /product="methyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.06c.1"
FT                   /db_xref="GOA:O13926"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PomBase:SPAC23C4.06c"
FT                   /db_xref="PomBase:SPAC23C4.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13926"
FT                   /protein_id="CAB16877.1"
FT                   /translation="MTFYYIRILRLQEKLEESFKYALRVVFTITSDLGEVSYPQDATVR
FT                   VEALDRQQSHSRITISKQCVSWIGNGHAAETTLYFPASHQQIQLTLHLENQNSIVDSIH
FT                   INADTVLPVWSEAFSPKSTLPNMVWRYIQGPEKKSPNDGLWFLEQMGNSIAKHLWDAGV
FT                   VFSKKILSDDWHYSFSNRKDINVLELGSGCGIVGISIASKYPRALVSMTDTEDAIEFME
FT                   KNVEKNKSAMSNNITSDILVWGHDIPRKFRRHWDYIVMSDVMYNESSFSDLEASLQELM
FT                   DKNTKLYIAYKKRHDNEKTFMSNILGWLDLVYEERGPITIYILQKK"
FT   5'UTR           complement(1039650..1042027)
FT                   /locus_tag="SPAC23C4.06c"
FT   CDS_pept        1040241..1040846
FT                   /transl_table=1
FT                   /gene="tht2"
FT                   /gene_synonym="mug22"
FT                   /locus_tag="SPAC23C4.07"
FT                   /product="meiotically upregulated gene Mug22"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.07.1"
FT                   /db_xref="GOA:O13927"
FT                   /db_xref="PomBase:SPAC23C4.07"
FT                   /db_xref="PomBase:SPAC23C4.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13927"
FT                   /protein_id="CAB16878.1"
FT                   /translation="MENQVSSFLIDSPMEWKTYMKSLSDDNPSFGDVTVNLTKISVSSK
FT                   NAKSYAEEMYNYVTQEMVFISERSRLLLRAKRRLYKNQSLMKKTSVSTSNTVKMVFMSL
FT                   AKQIEQMLKFCMMVYSKLCEAFETTLKVAKEFQICDSSQEWFFQFQLGYHRKQMELQML
FT                   SFVAEWLVLTQHYTDALNDSAKTLYDIMESSHKAAQKV"
FT   3'UTR           1040847..1041195
FT                   /gene="tht2"
FT                   /gene_synonym="mug22"
FT                   /locus_tag="SPAC23C4.07"
FT   5'UTR           1041414..1041534
FT                   /gene="rho3"
FT                   /locus_tag="SPAC23C4.08"
FT   CDS_pept        join(1041535..1041598,1041673..1041745,1042070..1042550)
FT                   /transl_table=1
FT                   /gene="rho3"
FT                   /locus_tag="SPAC23C4.08"
FT                   /product="Rho family GTPase Rho3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.08.1"
FT                   /db_xref="GOA:O13928"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPAC23C4.08"
FT                   /db_xref="PomBase:SPAC23C4.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13928"
FT                   /protein_id="CAD86888.1"
FT                   /translation="MSSCFGSKKKPIYRKIVILGDGAAGKTSLLNVFTKGYFPQVYEPT
FT                   IFENYIHDIFVDGNSIELSLWDTAGQEEYDQLRSLSYSDTHVIMICFAVDSRDSLENVI
FT                   TKWLPEVSSNCPGVKLVLVALKCDLRGADEEQVDHSKIIDYEEGLAAAKKINAVRYLEC
FT                   SAKLNRGVNEAFTEAARVALAAQPRGTKDGADESHGTGCIIA"
FT   intron          1041599..1041672
FT                   /gene="rho3"
FT                   /locus_tag="SPAC23C4.08"
FT   intron          1041746..1042069
FT                   /gene="rho3"
FT                   /locus_tag="SPAC23C4.08"
FT   3'UTR           complement(1041980..1043219)
FT                   /locus_tag="SPAC23C4.09c"
FT   3'UTR           1042551..1043083
FT                   /gene="rho3"
FT                   /locus_tag="SPAC23C4.08"
FT   CDS_pept        complement(join(1043220..1043264,1043382..1043512,
FT                   1043596..1043671,1043720..1043789,1044001..1044074))
FT                   /transl_table=1
FT                   /locus_tag="SPAC23C4.09c"
FT                   /product="DNA-binding TFAR19-related protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.09c.1"
FT                   /db_xref="GOA:O13929"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="PomBase:SPAC23C4.09c"
FT                   /db_xref="PomBase:SPAC23C4.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13929"
FT                   /protein_id="CAB16880.1"
FT                   /translation="MDEELQAIRQARLAQLQAEHGSAPSNIASGPSSNQQQQEVQDEMR
FT                   QNLLSQILEHPARDRLRRIALVRKDRAEAVEELLLRMAKTGQISHKISEPELIELLEKI
FT                   SGEVSKRNETKIVINRRVQDDEDDWDL"
FT   5'UTR           complement(1044075..1044240)
FT                   /locus_tag="SPAC23C4.09c"
FT   repeat_region   1044522..1044860
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           1044844..1044994
FT                   /gene="sec2"
FT                   /locus_tag="SPAC23C4.10"
FT   CDS_pept        1044995..1046578
FT                   /transl_table=1
FT                   /gene="sec2"
FT                   /locus_tag="SPAC23C4.10"
FT                   /product="guanyl-nucleotide exchange factor Sec2
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.10.1"
FT                   /db_xref="GOA:O13930"
FT                   /db_xref="InterPro:IPR009449"
FT                   /db_xref="InterPro:IPR040351"
FT                   /db_xref="PomBase:SPAC23C4.10"
FT                   /db_xref="PomBase:SPAC23C4.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13930"
FT                   /protein_id="CAB16881.1"
FT                   /translation="MPDVSNVRVKPNQHPYEKEVNGKLMSQEEILSQKLVAAIERQAAL
FT                   DDKYATEVHRNEALSERIRELEAKLSAKKSFDEELVKFHNLEEKLQLTETKCRNAESEK
FT                   SRVENELEDLTSSLFEEANRMVANARKETVASEKRVNQLKKQLVDAETLLSSTQHQLTE
FT                   LKDVMHSMSDSHEQNNALHPPLSRTTSFVADNVSVGSFASSTSGLDILTGTSARESLDA
FT                   KEISSDKHLNISGERPATFPNPTFIEGSDERRSASSLGHRTNNNQNQLIRFSTQIRSSS
FT                   TSPPRSPLIISDSPSSSIIHNPHPTHPSASAMNYMNPCFLEFHAFFNYPMKFARSRSAY
FT                   STSANYSNTPPRNTVTPSTARSSTLSQNPSSSSNSIPLISRNLRDFSFFKRCLEEDIEP
FT                   TLRLDHASGLSWLTRRSVFTAILESSLIINPLHSTSLLSSQPCSLCGFNRTQPLRQFEF
FT                   RSRPDSTSHASCTYCVARLRSVCNFVAFLHQICKGVWSSCSLEKAWDECLKKREAMFLS
FT                   RVGLAKELEG"
FT   3'UTR           1046579..1046788
FT                   /gene="sec2"
FT                   /locus_tag="SPAC23C4.10"
FT   misc_RNA        complement(1046859..1048934)
FT                   /locus_tag="SPNCRNA.708"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           1047065..1047315
FT                   /gene="atp18"
FT                   /locus_tag="SPAC23C4.11"
FT   CDS_pept        join(1047316..1047385,1047435..1047485,1047530..1047591)
FT                   /transl_table=1
FT                   /gene="atp18"
FT                   /locus_tag="SPAC23C4.11"
FT                   /product="F0-ATPase subunit J (predicted)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SPAC23C4.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPAC23C4.11.1"
FT                   /db_xref="GOA:O13931"
FT                   /db_xref="InterPro:IPR006995"
FT                   /db_xref="PomBase:SPAC23C4.11"
FT                   /db_xref="PomBase:SPAC23C4.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13931"
FT                   /protein_id="CAB16882.1"
FT                   /translation="MSFFGLKRYSTPILKPMLPFFLGGAIVFYGTVKLRDAMMDSAEYR
FT                   NDPRNPKAGKYGSDH"
FT   intron          1047386..1047434
FT                   /gene="atp18"
FT                   /locus_tag="SPAC23C4.11"
FT   intron          1047486..104752