(data stored in ACNUC22857 zone)

EMBL: CU329671

ID   CU329671; SV 1; linear; genomic DNA; STD; FUN; 4539804 BP.
XX
AC   CU329671; AL021730; AL021746-AL021748; AL021766-AL021767; AL021815;
AC   AL021837-AL021839; AL022019; AL022070-AL022072; AL022103-AL022105;
AC   AL022117; AL022172; AL022244; AL022299; AL022304-AL022305;
AC   AL022599-AL022600; AL023286-AL023288; AL023290; AL023533-AL023534;
AC   AL023554; AL023587; AL023589; AL023594; AL023634; AL023706;
AC   AL023779-AL023780; AL023796; AL023859; AL031154; AL031158; AL031174;
AC   AL031261-AL031263; AL031322; AL031349; AL031517; AL031528; AL031534;
AC   AL031536; AL031739; AL031741; AL031743; AL031786; AL031788;
AC   AL031852-AL031854; AL031856; AL032684; AL033385; AL033388-AL033389;
AC   AL033534; AL034352-AL034353; AL034382; AL034433; AL034463; AL034563;
AC   AL035065; AL035077; AL035085; AL035216; AL035226; AL035263;
AC   AL035536-AL035537; AL035548; AL035570; AL035581; AL035583-AL035584;
AC   AL035637; AL035655; AL035675; AL049190; AL049474; AL049489; AL049495;
AC   AL049558; AL049769; AL050301; AL078627; AL080287; AL096788;
AC   AL096796-AL096797; AL096809; AL096846; AL096851; AL096874; AL096876;
AC   AL109652; AL109731; AL109822; AL109834; AL109846; AL110295; AL110506;
AC   AL121794-AL121795; AL121815; AL121863; AL122033; AL132717; AL132720;
AC   AL132869; AL133303; AL133306; AL133362; AL135748; AL136498;
AC   AL136535-AL136536; AL137099; AL139314; AL157874; AL157918; AL162532;
AC   AL162692; AL163525; AL163702; AL353012; AL353866; AL354632;
AC   AL355920-AL355921; AL356012; AL356712; AL358273; AL358912; AL390355;
AC   AL391016; AL391034; AL391174; AL391603-AL391604; AL391715; AL391743;
AC   AL392143; AL441603; AL512495; AL512522; AL512563; AL512943; AL590604;
AC   AL590606; AL590882-AL590883; AL590971-AL590972; AL591302;
AC   AL596270-AL596271; AL672257; AL691490; AL732457; BX545922; Z54140; Z95397;
AC   Z95620; Z97204; Z97211; Z97992; Z98270; Z99759;
XX
PR   Project:PRJNA13836;
XX
DT   09-JUL-2007 (Rel. 92, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 13)
XX
DE   Schizosaccharomyces pombe chromosome II, complete sequence
XX
KW   complete genome.
XX
OS   Schizosaccharomyces pombe (fission yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
OC   Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae;
OC   Schizosaccharomyces.
XX
RN   [1]
RP   1-4539804
RG   The Schizosaccharomyces pombe Genome Sequencing Consortium
RA   Wood V.;
RT   ;
RL   Submitted (29-JUN-2007) to the INSDC.
RL   European Schizosaccharomyces genome sequencing project, Sanger Institute,
RL   The Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA
XX
RN   [2]
RP   1-4539804
RX   DOI; 10.1038/nature724.
RX   PUBMED; 11859360.
RA   Wood V., Gwilliam R., Rajandream M.A., Lyne M., Lyne R., Stewart A.,
RA   Sgouros J., Peat N., Hayles J., Baker S., Basham D., Bowman S., Brooks K.,
RA   Brown D., Brown S., Chillingworth T., Churcher C., Collins M., Connor R.,
RA   Cronin A., Davis P., Feltwell T., Fraser A., Gentles S., Goble A.,
RA   Hamlin N., Harris D., Hidalgo J., Hodgson G., Holroyd S., Hornsby T.,
RA   Howarth S., Huckle E.J., Hunt S., Jagels K., James K., Jones L., Jones M.,
RA   Leather S., McDonald S., McLean J., Mooney P., Moule S., Mungall K.,
RA   Murphy L., Niblett D., Odell C., Oliver K., O'Neil S., Pearson D.,
RA   Quail M.A., Rabbinowitsch E., Rutherford K., Rutter S., Saunders D.,
RA   Seeger K., Sharp S., Skelton J., Simmonds M., Squares R., Squares S.,
RA   Stevens K., Taylor K., Taylor R.G., Tivey A., Walsh S., Warren T.,
RA   Whitehead S., Woodward J., Volckaert G., Aert R., Robben J., Grymonprez B.,
RA   Weltjens I., Vanstreels E., Rieger M., Schafer M., Muller-Auer S.,
RA   Gabel C., Fuchs M., Dusterhoft A., Fritzc C., Holzer E., Moestl D.,
RA   Hilbert H., Borzym K., Langer I., Beck A., Lehrach H., Reinhardt R.,
RA   Pohl T.M., Eger P., Zimmermann W., Wedler H., Wambutt R., Purnelle B.,
RA   Goffeau A., Cadieu E., Dreano S., Gloux S., Lelaure V., Mottier S.,
RA   Galibert F., Aves S.J., Xiang Z., Hunt C., Moore K., Hurst S.M., Lucas M.,
RA   Rochet M., Gaillardin C., Tallada V.A., Garzon A., Thode G., Daga R.R.,
RA   Cruzado L., Jimenez J., Sanchez M., del Rey F., Benito J., Dominguez A.,
RA   Revuelta J.L., Moreno S., Armstrong J., Forsburg S.L., Cerutti L., Lowe T.,
RA   McCombie W.R., Paulsen I., Potashkin J., Shpakovski G.V., Ussery D.,
RA   Barrell B.G., Nurse P.;
RT   "The genome sequence of Schizosaccharomyces pombe";
RL   Nature 415(6874):871-880(2002).
XX
DR   MD5; 93f3aad824cfaa147c5f3488a3b8d454.
DR   BioSample; SAMEA3138176.
DR   EnsemblGenomes-Gn; ENSRNA049626499.
DR   EnsemblGenomes-Gn; ENSRNA049626555.
DR   EnsemblGenomes-Gn; ENSRNA049626597.
DR   EnsemblGenomes-Gn; ENSRNA049626680.
DR   EnsemblGenomes-Gn; ENSRNA049626722.
DR   EnsemblGenomes-Gn; ENSRNA049626802.
DR   EnsemblGenomes-Gn; ENSRNA049626864.
DR   EnsemblGenomes-Gn; ENSRNA049626918.
DR   EnsemblGenomes-Gn; ENSRNA049626982.
DR   EnsemblGenomes-Gn; ENSRNA049627029.
DR   EnsemblGenomes-Gn; ENSRNA049627123.
DR   EnsemblGenomes-Gn; ENSRNA049627179.
DR   EnsemblGenomes-Gn; ENSRNA049627223.
DR   EnsemblGenomes-Gn; ENSRNA049627265.
DR   EnsemblGenomes-Gn; ENSRNA049627340.
DR   EnsemblGenomes-Gn; ENSRNA049627433.
DR   EnsemblGenomes-Gn; ENSRNA049627494.
DR   EnsemblGenomes-Gn; ENSRNA049627588.
DR   EnsemblGenomes-Gn; ENSRNA049627646.
DR   EnsemblGenomes-Gn; ENSRNA049627707.
DR   EnsemblGenomes-Gn; ENSRNA049627745.
DR   EnsemblGenomes-Gn; ENSRNA049627819.
DR   EnsemblGenomes-Gn; ENSRNA049627905.
DR   EnsemblGenomes-Gn; ENSRNA049627956.
DR   EnsemblGenomes-Gn; ENSRNA049628005.
DR   EnsemblGenomes-Gn; ENSRNA049628088.
DR   EnsemblGenomes-Gn; ENSRNA049628168.
DR   EnsemblGenomes-Gn; ENSRNA049628231.
DR   EnsemblGenomes-Gn; ENSRNA049628307.
DR   EnsemblGenomes-Gn; ENSRNA049628356.
DR   EnsemblGenomes-Gn; ENSRNA049628402.
DR   EnsemblGenomes-Gn; ENSRNA049628446.
DR   EnsemblGenomes-Gn; ENSRNA049628471.
DR   EnsemblGenomes-Gn; ENSRNA049628543.
DR   EnsemblGenomes-Gn; ENSRNA049628658.
DR   EnsemblGenomes-Gn; ENSRNA049628693.
DR   EnsemblGenomes-Gn; ENSRNA049628756.
DR   EnsemblGenomes-Gn; ENSRNA049628837.
DR   EnsemblGenomes-Gn; ENSRNA049628875.
DR   EnsemblGenomes-Gn; ENSRNA049628927.
DR   EnsemblGenomes-Gn; ENSRNA049628987.
DR   EnsemblGenomes-Gn; ENSRNA049629048.
DR   EnsemblGenomes-Gn; ENSRNA049629109.
DR   EnsemblGenomes-Gn; ENSRNA049629155.
DR   EnsemblGenomes-Gn; ENSRNA049629225.
DR   EnsemblGenomes-Gn; ENSRNA049629286.
DR   EnsemblGenomes-Gn; ENSRNA049629355.
DR   EnsemblGenomes-Gn; ENSRNA049629443.
DR   EnsemblGenomes-Gn; ENSRNA049629509.
DR   EnsemblGenomes-Gn; ENSRNA049629570.
DR   EnsemblGenomes-Gn; ENSRNA049629631.
DR   EnsemblGenomes-Gn; ENSRNA049629679.
DR   EnsemblGenomes-Gn; ENSRNA049629724.
DR   EnsemblGenomes-Gn; ENSRNA049629766.
DR   EnsemblGenomes-Gn; ENSRNA049629840.
DR   EnsemblGenomes-Gn; ENSRNA049629926.
DR   EnsemblGenomes-Gn; ENSRNA049629978.
DR   EnsemblGenomes-Gn; ENSRNA049630059.
DR   EnsemblGenomes-Gn; ENSRNA049630111.
DR   EnsemblGenomes-Gn; ENSRNA049630184.
DR   EnsemblGenomes-Gn; ENSRNA049630202.
DR   EnsemblGenomes-Gn; ENSRNA049630249.
DR   EnsemblGenomes-Gn; ENSRNA049630298.
DR   EnsemblGenomes-Gn; ENSRNA049630358.
DR   EnsemblGenomes-Gn; ENSRNA049630430.
DR   EnsemblGenomes-Gn; ENSRNA049630497.
DR   EnsemblGenomes-Gn; ENSRNA049630555.
DR   EnsemblGenomes-Gn; ENSRNA049630597.
DR   EnsemblGenomes-Gn; ENSRNA049677528.
DR   EnsemblGenomes-Gn; ENSRNA049677556.
DR   EnsemblGenomes-Gn; ENSRNA049677584.
DR   EnsemblGenomes-Gn; ENSRNA049677621.
DR   EnsemblGenomes-Gn; ENSRNA049677681.
DR   EnsemblGenomes-Gn; ENSRNA049677710.
DR   EnsemblGenomes-Gn; ENSRNA049677729.
DR   EnsemblGenomes-Gn; ENSRNA049677755.
DR   EnsemblGenomes-Gn; ENSRNA049677768.
DR   EnsemblGenomes-Gn; ENSRNA049677832.
DR   EnsemblGenomes-Gn; ENSRNA049677866.
DR   EnsemblGenomes-Gn; ENSRNA049677891.
DR   EnsemblGenomes-Gn; ENSRNA049677927.
DR   EnsemblGenomes-Gn; ENSRNA049677943.
DR   EnsemblGenomes-Gn; ENSRNA049677971.
DR   EnsemblGenomes-Gn; ENSRNA049678002.
DR   EnsemblGenomes-Gn; ENSRNA049678019.
DR   EnsemblGenomes-Gn; ENSRNA049678043.
DR   EnsemblGenomes-Gn; ENSRNA049678068.
DR   EnsemblGenomes-Gn; ENSRNA049678095.
DR   EnsemblGenomes-Gn; ENSRNA049678113.
DR   EnsemblGenomes-Gn; ENSRNA049678136.
DR   EnsemblGenomes-Gn; ENSRNA049678159.
DR   EnsemblGenomes-Gn; ENSRNA049678178.
DR   EnsemblGenomes-Gn; ENSRNA049678201.
DR   EnsemblGenomes-Gn; ENSRNA049678217.
DR   EnsemblGenomes-Gn; ENSRNA049678253.
DR   EnsemblGenomes-Gn; ENSRNA049678266.
DR   EnsemblGenomes-Gn; ENSRNA049678299.
DR   EnsemblGenomes-Gn; ENSRNA049678320.
DR   EnsemblGenomes-Gn; SPBC119.17.
DR   EnsemblGenomes-Gn; SPBC1348.11.
DR   EnsemblGenomes-Gn; SPBC13E7.05.
DR   EnsemblGenomes-Gn; SPBC1706.02c.
DR   EnsemblGenomes-Gn; SPBC18E5.15.
DR   EnsemblGenomes-Gn; SPBC1E8.04.
DR   EnsemblGenomes-Gn; SPBC27B12.10c.
DR   EnsemblGenomes-Gn; SPBC29A3.08.
DR   EnsemblGenomes-Gn; SPBC31A8.02.
DR   EnsemblGenomes-Gn; SPBC32F12.08c.
DR   EnsemblGenomes-Gn; SPBC713.14c.
DR   EnsemblGenomes-Gn; SPBCPT2R1.05c.
DR   EnsemblGenomes-Gn; SPBCPT2R1.06c.
DR   EnsemblGenomes-Gn; SPBCPT2R1.07c.
DR   EnsemblGenomes-Gn; SPBCPT2R1.10.
DR   EnsemblGenomes-Gn; SPBPB10D8.03.
DR   EnsemblGenomes-Gn; SPBPB21E7.06.
DR   EnsemblGenomes-Gn; SPBPB21E7.08.
DR   EnsemblGenomes-Gn; SPBTRNAALA.07.
DR   EnsemblGenomes-Gn; SPBTRNAALA.08.
DR   EnsemblGenomes-Gn; SPBTRNAALA.09.
DR   EnsemblGenomes-Gn; SPBTRNAALA.10.
DR   EnsemblGenomes-Gn; SPBTRNAALA.11.
DR   EnsemblGenomes-Gn; SPBTRNAARG.04.
DR   EnsemblGenomes-Gn; SPBTRNAARG.05.
DR   EnsemblGenomes-Gn; SPBTRNAARG.06.
DR   EnsemblGenomes-Gn; SPBTRNAARG.07.
DR   EnsemblGenomes-Gn; SPBTRNAASN.01.
DR   EnsemblGenomes-Gn; SPBTRNAASN.02.
DR   EnsemblGenomes-Gn; SPBTRNAASN.03.
DR   EnsemblGenomes-Gn; SPBTRNAASN.04.
DR   EnsemblGenomes-Gn; SPBTRNAASP.04.
DR   EnsemblGenomes-Gn; SPBTRNAASP.05.
DR   EnsemblGenomes-Gn; SPBTRNAGLN.01.
DR   EnsemblGenomes-Gn; SPBTRNAGLN.02.
DR   EnsemblGenomes-Gn; SPBTRNAGLN.03.
DR   EnsemblGenomes-Gn; SPBTRNAGLN.04.
DR   EnsemblGenomes-Gn; SPBTRNAGLU.05.
DR   EnsemblGenomes-Gn; SPBTRNAGLU.06.
DR   EnsemblGenomes-Gn; SPBTRNAGLU.07.
DR   EnsemblGenomes-Gn; SPBTRNAGLU.08.
DR   EnsemblGenomes-Gn; SPBTRNAGLY.03.
DR   EnsemblGenomes-Gn; SPBTRNAGLY.04.
DR   EnsemblGenomes-Gn; SPBTRNAGLY.05.
DR   EnsemblGenomes-Gn; SPBTRNAGLY.06.
DR   EnsemblGenomes-Gn; SPBTRNAGLY.07.
DR   EnsemblGenomes-Gn; SPBTRNAGLY.08.
DR   EnsemblGenomes-Gn; SPBTRNAGLY.09.
DR   EnsemblGenomes-Gn; SPBTRNAHIS.01.
DR   EnsemblGenomes-Gn; SPBTRNAHIS.02.
DR   EnsemblGenomes-Gn; SPBTRNAILE.05.
DR   EnsemblGenomes-Gn; SPBTRNAILE.06.
DR   EnsemblGenomes-Gn; SPBTRNAILE.07.
DR   EnsemblGenomes-Gn; SPBTRNAILE.08.
DR   EnsemblGenomes-Gn; SPBTRNALEU.05.
DR   EnsemblGenomes-Gn; SPBTRNALEU.06.
DR   EnsemblGenomes-Gn; SPBTRNALEU.07.
DR   EnsemblGenomes-Gn; SPBTRNALEU.08.
DR   EnsemblGenomes-Gn; SPBTRNALEU.09.
DR   EnsemblGenomes-Gn; SPBTRNALEU.10.
DR   EnsemblGenomes-Gn; SPBTRNALYS.06.
DR   EnsemblGenomes-Gn; SPBTRNALYS.07.
DR   EnsemblGenomes-Gn; SPBTRNALYS.08.
DR   EnsemblGenomes-Gn; SPBTRNALYS.09.
DR   EnsemblGenomes-Gn; SPBTRNAMET.04.
DR   EnsemblGenomes-Gn; SPBTRNAMET.05.
DR   EnsemblGenomes-Gn; SPBTRNAMET.06.
DR   EnsemblGenomes-Gn; SPBTRNAPHE.03.
DR   EnsemblGenomes-Gn; SPBTRNAPRO.04.
DR   EnsemblGenomes-Gn; SPBTRNAPRO.05.
DR   EnsemblGenomes-Gn; SPBTRNAPRO.06.
DR   EnsemblGenomes-Gn; SPBTRNAPRO.07.
DR   EnsemblGenomes-Gn; SPBTRNAPRO.08.
DR   EnsemblGenomes-Gn; SPBTRNASER.05.
DR   EnsemblGenomes-Gn; SPBTRNASER.06.
DR   EnsemblGenomes-Gn; SPBTRNATHR.06.
DR   EnsemblGenomes-Gn; SPBTRNATHR.07.
DR   EnsemblGenomes-Gn; SPBTRNATRP.02.
DR   EnsemblGenomes-Gn; SPBTRNATRP.03.
DR   EnsemblGenomes-Gn; SPBTRNATYR.02.
DR   EnsemblGenomes-Gn; SPBTRNATYR.03.
DR   EnsemblGenomes-Gn; SPBTRNATYR.04.
DR   EnsemblGenomes-Gn; SPBTRNAVAL.05.
DR   EnsemblGenomes-Gn; SPBTRNAVAL.06.
DR   EnsemblGenomes-Gn; SPBTRNAVAL.07.
DR   EnsemblGenomes-Gn; SPBTRNAVAL.08.
DR   EnsemblGenomes-Gn; SPNCRNA.04.
DR   EnsemblGenomes-Gn; SPNCRNA.08.
DR   EnsemblGenomes-Gn; SPNCRNA.09.
DR   EnsemblGenomes-Gn; SPNCRNA.100.
DR   EnsemblGenomes-Gn; SPNCRNA.102.
DR   EnsemblGenomes-Gn; SPNCRNA.103.
DR   EnsemblGenomes-Gn; SPNCRNA.105.
DR   EnsemblGenomes-Gn; SPNCRNA.107.
DR   EnsemblGenomes-Gn; SPNCRNA.108.
DR   EnsemblGenomes-Gn; SPNCRNA.11.
DR   EnsemblGenomes-Gn; SPNCRNA.110.
DR   EnsemblGenomes-Gn; SPNCRNA.111.
DR   EnsemblGenomes-Gn; SPNCRNA.112.
DR   EnsemblGenomes-Gn; SPNCRNA.113.
DR   EnsemblGenomes-Gn; SPNCRNA.114.
DR   EnsemblGenomes-Gn; SPNCRNA.115.
DR   EnsemblGenomes-Gn; SPNCRNA.116.
DR   EnsemblGenomes-Gn; SPNCRNA.117.
DR   EnsemblGenomes-Gn; SPNCRNA.118.
DR   EnsemblGenomes-Gn; SPNCRNA.1301.
DR   EnsemblGenomes-Gn; SPNCRNA.1302.
DR   EnsemblGenomes-Gn; SPNCRNA.1303.
DR   EnsemblGenomes-Gn; SPNCRNA.1304.
DR   EnsemblGenomes-Gn; SPNCRNA.1305.
DR   EnsemblGenomes-Gn; SPNCRNA.1306.
DR   EnsemblGenomes-Gn; SPNCRNA.1307.
DR   EnsemblGenomes-Gn; SPNCRNA.1309.
DR   EnsemblGenomes-Gn; SPNCRNA.1310.
DR   EnsemblGenomes-Gn; SPNCRNA.1312.
DR   EnsemblGenomes-Gn; SPNCRNA.1313.
DR   EnsemblGenomes-Gn; SPNCRNA.1314.
DR   EnsemblGenomes-Gn; SPNCRNA.1315.
DR   EnsemblGenomes-Gn; SPNCRNA.1316.
DR   EnsemblGenomes-Gn; SPNCRNA.1317.
DR   EnsemblGenomes-Gn; SPNCRNA.1318.
DR   EnsemblGenomes-Gn; SPNCRNA.1319.
DR   EnsemblGenomes-Gn; SPNCRNA.1320.
DR   EnsemblGenomes-Gn; SPNCRNA.1321.
DR   EnsemblGenomes-Gn; SPNCRNA.1322.
DR   EnsemblGenomes-Gn; SPNCRNA.1323.
DR   EnsemblGenomes-Gn; SPNCRNA.1324.
DR   EnsemblGenomes-Gn; SPNCRNA.1325.
DR   EnsemblGenomes-Gn; SPNCRNA.1326.
DR   EnsemblGenomes-Gn; SPNCRNA.1327.
DR   EnsemblGenomes-Gn; SPNCRNA.1328.
DR   EnsemblGenomes-Gn; SPNCRNA.1329.
DR   EnsemblGenomes-Gn; SPNCRNA.133.
DR   EnsemblGenomes-Gn; SPNCRNA.1330.
DR   EnsemblGenomes-Gn; SPNCRNA.1331.
DR   EnsemblGenomes-Gn; SPNCRNA.1332.
DR   EnsemblGenomes-Gn; SPNCRNA.1333.
DR   EnsemblGenomes-Gn; SPNCRNA.1334.
DR   EnsemblGenomes-Gn; SPNCRNA.1335.
DR   EnsemblGenomes-Gn; SPNCRNA.1336.
DR   EnsemblGenomes-Gn; SPNCRNA.1337.
DR   EnsemblGenomes-Gn; SPNCRNA.1338.
DR   EnsemblGenomes-Gn; SPNCRNA.1339.
DR   EnsemblGenomes-Gn; SPNCRNA.134.
DR   EnsemblGenomes-Gn; SPNCRNA.1340.
DR   EnsemblGenomes-Gn; SPNCRNA.1342.
DR   EnsemblGenomes-Gn; SPNCRNA.1343.
DR   EnsemblGenomes-Gn; SPNCRNA.1344.
DR   EnsemblGenomes-Gn; SPNCRNA.1345.
DR   EnsemblGenomes-Gn; SPNCRNA.1346.
DR   EnsemblGenomes-Gn; SPNCRNA.1348.
DR   EnsemblGenomes-Gn; SPNCRNA.1349.
DR   EnsemblGenomes-Gn; SPNCRNA.135.
DR   EnsemblGenomes-Gn; SPNCRNA.1350.
DR   EnsemblGenomes-Gn; SPNCRNA.1351.
DR   EnsemblGenomes-Gn; SPNCRNA.1352.
DR   EnsemblGenomes-Gn; SPNCRNA.1353.
DR   EnsemblGenomes-Gn; SPNCRNA.1354.
DR   EnsemblGenomes-Gn; SPNCRNA.1355.
DR   EnsemblGenomes-Gn; SPNCRNA.1356.
DR   EnsemblGenomes-Gn; SPNCRNA.1357.
DR   EnsemblGenomes-Gn; SPNCRNA.1358.
DR   EnsemblGenomes-Gn; SPNCRNA.1359.
DR   EnsemblGenomes-Gn; SPNCRNA.1360.
DR   EnsemblGenomes-Gn; SPNCRNA.1361.
DR   EnsemblGenomes-Gn; SPNCRNA.1362.
DR   EnsemblGenomes-Gn; SPNCRNA.1363.
DR   EnsemblGenomes-Gn; SPNCRNA.1364.
DR   EnsemblGenomes-Gn; SPNCRNA.1365.
DR   EnsemblGenomes-Gn; SPNCRNA.1366.
DR   EnsemblGenomes-Gn; SPNCRNA.1367.
DR   EnsemblGenomes-Gn; SPNCRNA.1368.
DR   EnsemblGenomes-Gn; SPNCRNA.1369.
DR   EnsemblGenomes-Gn; SPNCRNA.1370.
DR   EnsemblGenomes-Gn; SPNCRNA.1371.
DR   EnsemblGenomes-Gn; SPNCRNA.1373.
DR   EnsemblGenomes-Gn; SPNCRNA.1374.
DR   EnsemblGenomes-Gn; SPNCRNA.1375.
DR   EnsemblGenomes-Gn; SPNCRNA.1376.
DR   EnsemblGenomes-Gn; SPNCRNA.1377.
DR   EnsemblGenomes-Gn; SPNCRNA.1378.
DR   EnsemblGenomes-Gn; SPNCRNA.1379.
DR   EnsemblGenomes-Gn; SPNCRNA.1381.
DR   EnsemblGenomes-Gn; SPNCRNA.1382.
DR   EnsemblGenomes-Gn; SPNCRNA.1383.
DR   EnsemblGenomes-Gn; SPNCRNA.1384.
DR   EnsemblGenomes-Gn; SPNCRNA.1385.
DR   EnsemblGenomes-Gn; SPNCRNA.1386.
DR   EnsemblGenomes-Gn; SPNCRNA.1387.
DR   EnsemblGenomes-Gn; SPNCRNA.1389.
DR   EnsemblGenomes-Gn; SPNCRNA.1390.
DR   EnsemblGenomes-Gn; SPNCRNA.1391.
DR   EnsemblGenomes-Gn; SPNCRNA.1392.
DR   EnsemblGenomes-Gn; SPNCRNA.1393.
DR   EnsemblGenomes-Gn; SPNCRNA.1394.
DR   EnsemblGenomes-Gn; SPNCRNA.1395.
DR   EnsemblGenomes-Gn; SPNCRNA.1396.
DR   EnsemblGenomes-Gn; SPNCRNA.1397.
DR   EnsemblGenomes-Gn; SPNCRNA.1398.
DR   EnsemblGenomes-Gn; SPNCRNA.1399.
DR   EnsemblGenomes-Gn; SPNCRNA.1400.
DR   EnsemblGenomes-Gn; SPNCRNA.1401.
DR   EnsemblGenomes-Gn; SPNCRNA.1402.
DR   EnsemblGenomes-Gn; SPNCRNA.1403.
DR   EnsemblGenomes-Gn; SPNCRNA.1404.
DR   EnsemblGenomes-Gn; SPNCRNA.1405.
DR   EnsemblGenomes-Gn; SPNCRNA.1406.
DR   EnsemblGenomes-Gn; SPNCRNA.1407.
DR   EnsemblGenomes-Gn; SPNCRNA.1408.
DR   EnsemblGenomes-Gn; SPNCRNA.1409.
DR   EnsemblGenomes-Gn; SPNCRNA.1410.
DR   EnsemblGenomes-Gn; SPNCRNA.1411.
DR   EnsemblGenomes-Gn; SPNCRNA.1412.
DR   EnsemblGenomes-Gn; SPNCRNA.1413.
DR   EnsemblGenomes-Gn; SPNCRNA.1414.
DR   EnsemblGenomes-Gn; SPNCRNA.1415.
DR   EnsemblGenomes-Gn; SPNCRNA.1416.
DR   EnsemblGenomes-Gn; SPNCRNA.1417.
DR   EnsemblGenomes-Gn; SPNCRNA.1418.
DR   EnsemblGenomes-Gn; SPNCRNA.1419.
DR   EnsemblGenomes-Gn; SPNCRNA.1420.
DR   EnsemblGenomes-Gn; SPNCRNA.1421.
DR   EnsemblGenomes-Gn; SPNCRNA.1422.
DR   EnsemblGenomes-Gn; SPNCRNA.1423.
DR   EnsemblGenomes-Gn; SPNCRNA.1424.
DR   EnsemblGenomes-Gn; SPNCRNA.1425.
DR   EnsemblGenomes-Gn; SPNCRNA.1426.
DR   EnsemblGenomes-Gn; SPNCRNA.1427.
DR   EnsemblGenomes-Gn; SPNCRNA.1428.
DR   EnsemblGenomes-Gn; SPNCRNA.1429.
DR   EnsemblGenomes-Gn; SPNCRNA.1430.
DR   EnsemblGenomes-Gn; SPNCRNA.1431.
DR   EnsemblGenomes-Gn; SPNCRNA.1432.
DR   EnsemblGenomes-Gn; SPNCRNA.1433.
DR   EnsemblGenomes-Gn; SPNCRNA.1434.
DR   EnsemblGenomes-Gn; SPNCRNA.1435.
DR   EnsemblGenomes-Gn; SPNCRNA.1436.
DR   EnsemblGenomes-Gn; SPNCRNA.1437.
DR   EnsemblGenomes-Gn; SPNCRNA.1438.
DR   EnsemblGenomes-Gn; SPNCRNA.1439.
DR   EnsemblGenomes-Gn; SPNCRNA.1440.
DR   EnsemblGenomes-Gn; SPNCRNA.1441.
DR   EnsemblGenomes-Gn; SPNCRNA.1442.
DR   EnsemblGenomes-Gn; SPNCRNA.1443.
DR   EnsemblGenomes-Gn; SPNCRNA.1444.
DR   EnsemblGenomes-Gn; SPNCRNA.1445.
DR   EnsemblGenomes-Gn; SPNCRNA.1446.
DR   EnsemblGenomes-Gn; SPNCRNA.1447.
DR   EnsemblGenomes-Gn; SPNCRNA.1448.
DR   EnsemblGenomes-Gn; SPNCRNA.1449.
DR   EnsemblGenomes-Gn; SPNCRNA.1450.
DR   EnsemblGenomes-Gn; SPNCRNA.1451.
DR   EnsemblGenomes-Gn; SPNCRNA.1452.
DR   EnsemblGenomes-Gn; SPNCRNA.1453.
DR   EnsemblGenomes-Gn; SPNCRNA.1454.
DR   EnsemblGenomes-Gn; SPNCRNA.1455.
DR   EnsemblGenomes-Gn; SPNCRNA.1456.
DR   EnsemblGenomes-Gn; SPNCRNA.1457.
DR   EnsemblGenomes-Gn; SPNCRNA.1458.
DR   EnsemblGenomes-Gn; SPNCRNA.1459.
DR   EnsemblGenomes-Gn; SPNCRNA.1460.
DR   EnsemblGenomes-Gn; SPNCRNA.1461.
DR   EnsemblGenomes-Gn; SPNCRNA.1462.
DR   EnsemblGenomes-Gn; SPNCRNA.1463.
DR   EnsemblGenomes-Gn; SPNCRNA.1464.
DR   EnsemblGenomes-Gn; SPNCRNA.1465.
DR   EnsemblGenomes-Gn; SPNCRNA.1466.
DR   EnsemblGenomes-Gn; SPNCRNA.1467.
DR   EnsemblGenomes-Gn; SPNCRNA.1468.
DR   EnsemblGenomes-Gn; SPNCRNA.1469.
DR   EnsemblGenomes-Gn; SPNCRNA.1470.
DR   EnsemblGenomes-Gn; SPNCRNA.1471.
DR   EnsemblGenomes-Gn; SPNCRNA.1472.
DR   EnsemblGenomes-Gn; SPNCRNA.1473.
DR   EnsemblGenomes-Gn; SPNCRNA.1474.
DR   EnsemblGenomes-Gn; SPNCRNA.1475.
DR   EnsemblGenomes-Gn; SPNCRNA.1476.
DR   EnsemblGenomes-Gn; SPNCRNA.1477.
DR   EnsemblGenomes-Gn; SPNCRNA.1478.
DR   EnsemblGenomes-Gn; SPNCRNA.1479.
DR   EnsemblGenomes-Gn; SPNCRNA.1480.
DR   EnsemblGenomes-Gn; SPNCRNA.1481.
DR   EnsemblGenomes-Gn; SPNCRNA.1482.
DR   EnsemblGenomes-Gn; SPNCRNA.1483.
DR   EnsemblGenomes-Gn; SPNCRNA.1484.
DR   EnsemblGenomes-Gn; SPNCRNA.1485.
DR   EnsemblGenomes-Gn; SPNCRNA.1487.
DR   EnsemblGenomes-Gn; SPNCRNA.1488.
DR   EnsemblGenomes-Gn; SPNCRNA.1489.
DR   EnsemblGenomes-Gn; SPNCRNA.1490.
DR   EnsemblGenomes-Gn; SPNCRNA.1491.
DR   EnsemblGenomes-Gn; SPNCRNA.1492.
DR   EnsemblGenomes-Gn; SPNCRNA.1493.
DR   EnsemblGenomes-Gn; SPNCRNA.1494.
DR   EnsemblGenomes-Gn; SPNCRNA.1495.
DR   EnsemblGenomes-Gn; SPNCRNA.1496.
DR   EnsemblGenomes-Gn; SPNCRNA.1497.
DR   EnsemblGenomes-Gn; SPNCRNA.1498.
DR   EnsemblGenomes-Gn; SPNCRNA.1499.
DR   EnsemblGenomes-Gn; SPNCRNA.15.
DR   EnsemblGenomes-Gn; SPNCRNA.1500.
DR   EnsemblGenomes-Gn; SPNCRNA.1501.
DR   EnsemblGenomes-Gn; SPNCRNA.1502.
DR   EnsemblGenomes-Gn; SPNCRNA.1503.
DR   EnsemblGenomes-Gn; SPNCRNA.1504.
DR   EnsemblGenomes-Gn; SPNCRNA.1505.
DR   EnsemblGenomes-Gn; SPNCRNA.1506.
DR   EnsemblGenomes-Gn; SPNCRNA.1507.
DR   EnsemblGenomes-Gn; SPNCRNA.1508.
DR   EnsemblGenomes-Gn; SPNCRNA.1509.
DR   EnsemblGenomes-Gn; SPNCRNA.1510.
DR   EnsemblGenomes-Gn; SPNCRNA.1511.
DR   EnsemblGenomes-Gn; SPNCRNA.1512.
DR   EnsemblGenomes-Gn; SPNCRNA.1513.
DR   EnsemblGenomes-Gn; SPNCRNA.1514.
DR   EnsemblGenomes-Gn; SPNCRNA.1515.
DR   EnsemblGenomes-Gn; SPNCRNA.1516.
DR   EnsemblGenomes-Gn; SPNCRNA.1517.
DR   EnsemblGenomes-Gn; SPNCRNA.1518.
DR   EnsemblGenomes-Gn; SPNCRNA.1519.
DR   EnsemblGenomes-Gn; SPNCRNA.1520.
DR   EnsemblGenomes-Gn; SPNCRNA.1521.
DR   EnsemblGenomes-Gn; SPNCRNA.1522.
DR   EnsemblGenomes-Gn; SPNCRNA.1523.
DR   EnsemblGenomes-Gn; SPNCRNA.1524.
DR   EnsemblGenomes-Gn; SPNCRNA.1525.
DR   EnsemblGenomes-Gn; SPNCRNA.1526.
DR   EnsemblGenomes-Gn; SPNCRNA.1527.
DR   EnsemblGenomes-Gn; SPNCRNA.1528.
DR   EnsemblGenomes-Gn; SPNCRNA.1529.
DR   EnsemblGenomes-Gn; SPNCRNA.1530.
DR   EnsemblGenomes-Gn; SPNCRNA.1531.
DR   EnsemblGenomes-Gn; SPNCRNA.1532.
DR   EnsemblGenomes-Gn; SPNCRNA.1533.
DR   EnsemblGenomes-Gn; SPNCRNA.1534.
DR   EnsemblGenomes-Gn; SPNCRNA.1535.
DR   EnsemblGenomes-Gn; SPNCRNA.1536.
DR   EnsemblGenomes-Gn; SPNCRNA.1537.
DR   EnsemblGenomes-Gn; SPNCRNA.1538.
DR   EnsemblGenomes-Gn; SPNCRNA.1539.
DR   EnsemblGenomes-Gn; SPNCRNA.1540.
DR   EnsemblGenomes-Gn; SPNCRNA.1541.
DR   EnsemblGenomes-Gn; SPNCRNA.1542.
DR   EnsemblGenomes-Gn; SPNCRNA.1543.
DR   EnsemblGenomes-Gn; SPNCRNA.1544.
DR   EnsemblGenomes-Gn; SPNCRNA.1545.
DR   EnsemblGenomes-Gn; SPNCRNA.1546.
DR   EnsemblGenomes-Gn; SPNCRNA.1547.
DR   EnsemblGenomes-Gn; SPNCRNA.1548.
DR   EnsemblGenomes-Gn; SPNCRNA.1549.
DR   EnsemblGenomes-Gn; SPNCRNA.1550.
DR   EnsemblGenomes-Gn; SPNCRNA.1551.
DR   EnsemblGenomes-Gn; SPNCRNA.1552.
DR   EnsemblGenomes-Gn; SPNCRNA.1553.
DR   EnsemblGenomes-Gn; SPNCRNA.1554.
DR   EnsemblGenomes-Gn; SPNCRNA.1555.
DR   EnsemblGenomes-Gn; SPNCRNA.1556.
DR   EnsemblGenomes-Gn; SPNCRNA.1557.
DR   EnsemblGenomes-Gn; SPNCRNA.1558.
DR   EnsemblGenomes-Gn; SPNCRNA.1559.
DR   EnsemblGenomes-Gn; SPNCRNA.1560.
DR   EnsemblGenomes-Gn; SPNCRNA.1561.
DR   EnsemblGenomes-Gn; SPNCRNA.1562.
DR   EnsemblGenomes-Gn; SPNCRNA.1563.
DR   EnsemblGenomes-Gn; SPNCRNA.1564.
DR   EnsemblGenomes-Gn; SPNCRNA.1565.
DR   EnsemblGenomes-Gn; SPNCRNA.1566.
DR   EnsemblGenomes-Gn; SPNCRNA.1567.
DR   EnsemblGenomes-Gn; SPNCRNA.1568.
DR   EnsemblGenomes-Gn; SPNCRNA.1569.
DR   EnsemblGenomes-Gn; SPNCRNA.1570.
DR   EnsemblGenomes-Gn; SPNCRNA.1571.
DR   EnsemblGenomes-Gn; SPNCRNA.1572.
DR   EnsemblGenomes-Gn; SPNCRNA.1573.
DR   EnsemblGenomes-Gn; SPNCRNA.1574.
DR   EnsemblGenomes-Gn; SPNCRNA.1575.
DR   EnsemblGenomes-Gn; SPNCRNA.1576.
DR   EnsemblGenomes-Gn; SPNCRNA.1577.
DR   EnsemblGenomes-Gn; SPNCRNA.1578.
DR   EnsemblGenomes-Gn; SPNCRNA.1579.
DR   EnsemblGenomes-Gn; SPNCRNA.1580.
DR   EnsemblGenomes-Gn; SPNCRNA.1581.
DR   EnsemblGenomes-Gn; SPNCRNA.1582.
DR   EnsemblGenomes-Gn; SPNCRNA.1583.
DR   EnsemblGenomes-Gn; SPNCRNA.1584.
DR   EnsemblGenomes-Gn; SPNCRNA.1585.
DR   EnsemblGenomes-Gn; SPNCRNA.1586.
DR   EnsemblGenomes-Gn; SPNCRNA.1587.
DR   EnsemblGenomes-Gn; SPNCRNA.1588.
DR   EnsemblGenomes-Gn; SPNCRNA.1589.
DR   EnsemblGenomes-Gn; SPNCRNA.1590.
DR   EnsemblGenomes-Gn; SPNCRNA.1591.
DR   EnsemblGenomes-Gn; SPNCRNA.1592.
DR   EnsemblGenomes-Gn; SPNCRNA.1593.
DR   EnsemblGenomes-Gn; SPNCRNA.1594.
DR   EnsemblGenomes-Gn; SPNCRNA.1595.
DR   EnsemblGenomes-Gn; SPNCRNA.1596.
DR   EnsemblGenomes-Gn; SPNCRNA.1597.
DR   EnsemblGenomes-Gn; SPNCRNA.1598.
DR   EnsemblGenomes-Gn; SPNCRNA.1599.
DR   EnsemblGenomes-Gn; SPNCRNA.1600.
DR   EnsemblGenomes-Gn; SPNCRNA.1601.
DR   EnsemblGenomes-Gn; SPNCRNA.1602.
DR   EnsemblGenomes-Gn; SPNCRNA.1603.
DR   EnsemblGenomes-Gn; SPNCRNA.1604.
DR   EnsemblGenomes-Gn; SPNCRNA.1605.
DR   EnsemblGenomes-Gn; SPNCRNA.1606.
DR   EnsemblGenomes-Gn; SPNCRNA.1607.
DR   EnsemblGenomes-Gn; SPNCRNA.1608.
DR   EnsemblGenomes-Gn; SPNCRNA.1609.
DR   EnsemblGenomes-Gn; SPNCRNA.1610.
DR   EnsemblGenomes-Gn; SPNCRNA.1611.
DR   EnsemblGenomes-Gn; SPNCRNA.1613.
DR   EnsemblGenomes-Gn; SPNCRNA.1614.
DR   EnsemblGenomes-Gn; SPNCRNA.1615.
DR   EnsemblGenomes-Gn; SPNCRNA.1616.
DR   EnsemblGenomes-Gn; SPNCRNA.1617.
DR   EnsemblGenomes-Gn; SPNCRNA.1618.
DR   EnsemblGenomes-Gn; SPNCRNA.1619.
DR   EnsemblGenomes-Gn; SPNCRNA.1620.
DR   EnsemblGenomes-Gn; SPNCRNA.1621.
DR   EnsemblGenomes-Gn; SPNCRNA.1622.
DR   EnsemblGenomes-Gn; SPNCRNA.1623.
DR   EnsemblGenomes-Gn; SPNCRNA.1624.
DR   EnsemblGenomes-Gn; SPNCRNA.1625.
DR   EnsemblGenomes-Gn; SPNCRNA.1626.
DR   EnsemblGenomes-Gn; SPNCRNA.1627.
DR   EnsemblGenomes-Gn; SPNCRNA.1628.
DR   EnsemblGenomes-Gn; SPNCRNA.1629.
DR   EnsemblGenomes-Gn; SPNCRNA.1630.
DR   EnsemblGenomes-Gn; SPNCRNA.1631.
DR   EnsemblGenomes-Gn; SPNCRNA.1632.
DR   EnsemblGenomes-Gn; SPNCRNA.1633.
DR   EnsemblGenomes-Gn; SPNCRNA.1634.
DR   EnsemblGenomes-Gn; SPNCRNA.1635.
DR   EnsemblGenomes-Gn; SPNCRNA.1636.
DR   EnsemblGenomes-Gn; SPNCRNA.1637.
DR   EnsemblGenomes-Gn; SPNCRNA.1638.
DR   EnsemblGenomes-Gn; SPNCRNA.1639.
DR   EnsemblGenomes-Gn; SPNCRNA.1640.
DR   EnsemblGenomes-Gn; SPNCRNA.1641.
DR   EnsemblGenomes-Gn; SPNCRNA.1642.
DR   EnsemblGenomes-Gn; SPNCRNA.1643.
DR   EnsemblGenomes-Gn; SPNCRNA.1644.
DR   EnsemblGenomes-Gn; SPNCRNA.1645.
DR   EnsemblGenomes-Gn; SPNCRNA.1646.
DR   EnsemblGenomes-Gn; SPNCRNA.1647.
DR   EnsemblGenomes-Gn; SPNCRNA.1648.
DR   EnsemblGenomes-Gn; SPNCRNA.1649.
DR   EnsemblGenomes-Gn; SPNCRNA.1650.
DR   EnsemblGenomes-Gn; SPNCRNA.1651.
DR   EnsemblGenomes-Gn; SPNCRNA.1653.
DR   EnsemblGenomes-Gn; SPNCRNA.1654.
DR   EnsemblGenomes-Gn; SPNCRNA.1655.
DR   EnsemblGenomes-Gn; SPNCRNA.1656.
DR   EnsemblGenomes-Gn; SPNCRNA.1657.
DR   EnsemblGenomes-Gn; SPNCRNA.1658.
DR   EnsemblGenomes-Gn; SPNCRNA.1659.
DR   EnsemblGenomes-Gn; SPNCRNA.1660.
DR   EnsemblGenomes-Gn; SPNCRNA.1661.
DR   EnsemblGenomes-Gn; SPNCRNA.1662.
DR   EnsemblGenomes-Gn; SPNCRNA.1663.
DR   EnsemblGenomes-Gn; SPNCRNA.1664.
DR   EnsemblGenomes-Gn; SPNCRNA.1665.
DR   EnsemblGenomes-Gn; SPNCRNA.1666.
DR   EnsemblGenomes-Gn; SPNCRNA.1667.
DR   EnsemblGenomes-Gn; SPNCRNA.1668.
DR   EnsemblGenomes-Gn; SPNCRNA.1669.
DR   EnsemblGenomes-Gn; SPNCRNA.1670.
DR   EnsemblGenomes-Gn; SPNCRNA.1671.
DR   EnsemblGenomes-Gn; SPNCRNA.1672.
DR   EnsemblGenomes-Gn; SPNCRNA.1673.
DR   EnsemblGenomes-Gn; SPNCRNA.1674.
DR   EnsemblGenomes-Gn; SPNCRNA.1675.
DR   EnsemblGenomes-Gn; SPNCRNA.1676.
DR   EnsemblGenomes-Gn; SPNCRNA.1677.
DR   EnsemblGenomes-Gn; SPNCRNA.1678.
DR   EnsemblGenomes-Gn; SPNCRNA.1680.
DR   EnsemblGenomes-Gn; SPNCRNA.1681.
DR   EnsemblGenomes-Gn; SPNCRNA.1682.
DR   EnsemblGenomes-Gn; SPNCRNA.1683.
DR   EnsemblGenomes-Gn; SPNCRNA.1684.
DR   EnsemblGenomes-Gn; SPNCRNA.1685.
DR   EnsemblGenomes-Gn; SPNCRNA.1686.
DR   EnsemblGenomes-Gn; SPNCRNA.1687.
DR   EnsemblGenomes-Gn; SPNCRNA.1688.
DR   EnsemblGenomes-Gn; SPNCRNA.1689.
DR   EnsemblGenomes-Gn; SPNCRNA.1690.
DR   EnsemblGenomes-Gn; SPNCRNA.1691.
DR   EnsemblGenomes-Gn; SPNCRNA.1692.
DR   EnsemblGenomes-Gn; SPNCRNA.1693.
DR   EnsemblGenomes-Gn; SPNCRNA.1694.
DR   EnsemblGenomes-Gn; SPNCRNA.1695.
DR   EnsemblGenomes-Gn; SPNCRNA.1696.
DR   EnsemblGenomes-Gn; SPNCRNA.1697.
DR   EnsemblGenomes-Gn; SPNCRNA.17.
DR   EnsemblGenomes-Gn; SPNCRNA.20.
DR   EnsemblGenomes-Gn; SPNCRNA.23.
DR   EnsemblGenomes-Gn; SPNCRNA.24.
DR   EnsemblGenomes-Gn; SPNCRNA.25.
DR   EnsemblGenomes-Gn; SPNCRNA.26.
DR   EnsemblGenomes-Gn; SPNCRNA.287.
DR   EnsemblGenomes-Gn; SPNCRNA.289.
DR   EnsemblGenomes-Gn; SPNCRNA.290.
DR   EnsemblGenomes-Gn; SPNCRNA.291.
DR   EnsemblGenomes-Gn; SPNCRNA.292.
DR   EnsemblGenomes-Gn; SPNCRNA.293.
DR   EnsemblGenomes-Gn; SPNCRNA.294.
DR   EnsemblGenomes-Gn; SPNCRNA.296.
DR   EnsemblGenomes-Gn; SPNCRNA.297.
DR   EnsemblGenomes-Gn; SPNCRNA.298.
DR   EnsemblGenomes-Gn; SPNCRNA.299.
DR   EnsemblGenomes-Gn; SPNCRNA.300.
DR   EnsemblGenomes-Gn; SPNCRNA.301.
DR   EnsemblGenomes-Gn; SPNCRNA.304.
DR   EnsemblGenomes-Gn; SPNCRNA.305.
DR   EnsemblGenomes-Gn; SPNCRNA.307.
DR   EnsemblGenomes-Gn; SPNCRNA.312.
DR   EnsemblGenomes-Gn; SPNCRNA.313.
DR   EnsemblGenomes-Gn; SPNCRNA.315.
DR   EnsemblGenomes-Gn; SPNCRNA.316.
DR   EnsemblGenomes-Gn; SPNCRNA.317.
DR   EnsemblGenomes-Gn; SPNCRNA.318.
DR   EnsemblGenomes-Gn; SPNCRNA.319.
DR   EnsemblGenomes-Gn; SPNCRNA.321.
DR   EnsemblGenomes-Gn; SPNCRNA.322.
DR   EnsemblGenomes-Gn; SPNCRNA.323.
DR   EnsemblGenomes-Gn; SPNCRNA.324.
DR   EnsemblGenomes-Gn; SPNCRNA.325.
DR   EnsemblGenomes-Gn; SPNCRNA.327.
DR   EnsemblGenomes-Gn; SPNCRNA.328.
DR   EnsemblGenomes-Gn; SPNCRNA.329.
DR   EnsemblGenomes-Gn; SPNCRNA.332.
DR   EnsemblGenomes-Gn; SPNCRNA.334.
DR   EnsemblGenomes-Gn; SPNCRNA.335.
DR   EnsemblGenomes-Gn; SPNCRNA.337.
DR   EnsemblGenomes-Gn; SPNCRNA.338.
DR   EnsemblGenomes-Gn; SPNCRNA.34.
DR   EnsemblGenomes-Gn; SPNCRNA.342.
DR   EnsemblGenomes-Gn; SPNCRNA.346.
DR   EnsemblGenomes-Gn; SPNCRNA.348.
DR   EnsemblGenomes-Gn; SPNCRNA.351.
DR   EnsemblGenomes-Gn; SPNCRNA.352.
DR   EnsemblGenomes-Gn; SPNCRNA.358.
DR   EnsemblGenomes-Gn; SPNCRNA.359.
DR   EnsemblGenomes-Gn; SPNCRNA.36.
DR   EnsemblGenomes-Gn; SPNCRNA.360.
DR   EnsemblGenomes-Gn; SPNCRNA.361.
DR   EnsemblGenomes-Gn; SPNCRNA.362.
DR   EnsemblGenomes-Gn; SPNCRNA.363.
DR   EnsemblGenomes-Gn; SPNCRNA.364.
DR   EnsemblGenomes-Gn; SPNCRNA.365.
DR   EnsemblGenomes-Gn; SPNCRNA.366.
DR   EnsemblGenomes-Gn; SPNCRNA.367.
DR   EnsemblGenomes-Gn; SPNCRNA.368.
DR   EnsemblGenomes-Gn; SPNCRNA.369.
DR   EnsemblGenomes-Gn; SPNCRNA.370.
DR   EnsemblGenomes-Gn; SPNCRNA.371.
DR   EnsemblGenomes-Gn; SPNCRNA.372.
DR   EnsemblGenomes-Gn; SPNCRNA.373.
DR   EnsemblGenomes-Gn; SPNCRNA.374.
DR   EnsemblGenomes-Gn; SPNCRNA.376.
DR   EnsemblGenomes-Gn; SPNCRNA.377.
DR   EnsemblGenomes-Gn; SPNCRNA.379.
DR   EnsemblGenomes-Gn; SPNCRNA.38.
DR   EnsemblGenomes-Gn; SPNCRNA.380.
DR   EnsemblGenomes-Gn; SPNCRNA.382.
DR   EnsemblGenomes-Gn; SPNCRNA.383.
DR   EnsemblGenomes-Gn; SPNCRNA.384.
DR   EnsemblGenomes-Gn; SPNCRNA.385.
DR   EnsemblGenomes-Gn; SPNCRNA.386.
DR   EnsemblGenomes-Gn; SPNCRNA.387.
DR   EnsemblGenomes-Gn; SPNCRNA.388.
DR   EnsemblGenomes-Gn; SPNCRNA.389.
DR   EnsemblGenomes-Gn; SPNCRNA.39.
DR   EnsemblGenomes-Gn; SPNCRNA.390.
DR   EnsemblGenomes-Gn; SPNCRNA.391.
DR   EnsemblGenomes-Gn; SPNCRNA.392.
DR   EnsemblGenomes-Gn; SPNCRNA.393.
DR   EnsemblGenomes-Gn; SPNCRNA.394.
DR   EnsemblGenomes-Gn; SPNCRNA.397.
DR   EnsemblGenomes-Gn; SPNCRNA.398.
DR   EnsemblGenomes-Gn; SPNCRNA.399.
DR   EnsemblGenomes-Gn; SPNCRNA.400.
DR   EnsemblGenomes-Gn; SPNCRNA.401.
DR   EnsemblGenomes-Gn; SPNCRNA.402.
DR   EnsemblGenomes-Gn; SPNCRNA.403.
DR   EnsemblGenomes-Gn; SPNCRNA.405.
DR   EnsemblGenomes-Gn; SPNCRNA.406.
DR   EnsemblGenomes-Gn; SPNCRNA.408.
DR   EnsemblGenomes-Gn; SPNCRNA.410.
DR   EnsemblGenomes-Gn; SPNCRNA.411.
DR   EnsemblGenomes-Gn; SPNCRNA.412.
DR   EnsemblGenomes-Gn; SPNCRNA.413.
DR   EnsemblGenomes-Gn; SPNCRNA.414.
DR   EnsemblGenomes-Gn; SPNCRNA.415.
DR   EnsemblGenomes-Gn; SPNCRNA.417.
DR   EnsemblGenomes-Gn; SPNCRNA.419.
DR   EnsemblGenomes-Gn; SPNCRNA.42.
DR   EnsemblGenomes-Gn; SPNCRNA.421.
DR   EnsemblGenomes-Gn; SPNCRNA.423.
DR   EnsemblGenomes-Gn; SPNCRNA.424.
DR   EnsemblGenomes-Gn; SPNCRNA.425.
DR   EnsemblGenomes-Gn; SPNCRNA.426.
DR   EnsemblGenomes-Gn; SPNCRNA.427.
DR   EnsemblGenomes-Gn; SPNCRNA.428.
DR   EnsemblGenomes-Gn; SPNCRNA.431.
DR   EnsemblGenomes-Gn; SPNCRNA.435.
DR   EnsemblGenomes-Gn; SPNCRNA.436.
DR   EnsemblGenomes-Gn; SPNCRNA.437.
DR   EnsemblGenomes-Gn; SPNCRNA.438.
DR   EnsemblGenomes-Gn; SPNCRNA.439.
DR   EnsemblGenomes-Gn; SPNCRNA.440.
DR   EnsemblGenomes-Gn; SPNCRNA.441.
DR   EnsemblGenomes-Gn; SPNCRNA.442.
DR   EnsemblGenomes-Gn; SPNCRNA.443.
DR   EnsemblGenomes-Gn; SPNCRNA.444.
DR   EnsemblGenomes-Gn; SPNCRNA.445.
DR   EnsemblGenomes-Gn; SPNCRNA.446.
DR   EnsemblGenomes-Gn; SPNCRNA.448.
DR   EnsemblGenomes-Gn; SPNCRNA.497.
DR   EnsemblGenomes-Gn; SPNCRNA.498.
DR   EnsemblGenomes-Gn; SPNCRNA.514.
DR   EnsemblGenomes-Gn; SPNCRNA.515.
DR   EnsemblGenomes-Gn; SPNCRNA.532.
DR   EnsemblGenomes-Gn; SPNCRNA.534.
DR   EnsemblGenomes-Gn; SPNCRNA.536.
DR   EnsemblGenomes-Gn; SPNCRNA.538.
DR   EnsemblGenomes-Gn; SPNCRNA.539.
DR   EnsemblGenomes-Gn; SPNCRNA.540.
DR   EnsemblGenomes-Gn; SPNCRNA.541.
DR   EnsemblGenomes-Gn; SPNCRNA.543.
DR   EnsemblGenomes-Gn; SPNCRNA.545.
DR   EnsemblGenomes-Gn; SPNCRNA.565.
DR   EnsemblGenomes-Gn; SPNCRNA.566.
DR   EnsemblGenomes-Gn; SPNCRNA.567.
DR   EnsemblGenomes-Gn; SPNCRNA.568.
DR   EnsemblGenomes-Gn; SPNCRNA.569.
DR   EnsemblGenomes-Gn; SPNCRNA.570.
DR   EnsemblGenomes-Gn; SPNCRNA.571.
DR   EnsemblGenomes-Gn; SPNCRNA.572.
DR   EnsemblGenomes-Gn; SPNCRNA.573.
DR   EnsemblGenomes-Gn; SPNCRNA.574.
DR   EnsemblGenomes-Gn; SPNCRNA.575.
DR   EnsemblGenomes-Gn; SPNCRNA.576.
DR   EnsemblGenomes-Gn; SPNCRNA.577.
DR   EnsemblGenomes-Gn; SPNCRNA.62.
DR   EnsemblGenomes-Gn; SPNCRNA.66.
DR   EnsemblGenomes-Gn; SPNCRNA.68.
DR   EnsemblGenomes-Gn; SPNCRNA.89.
DR   EnsemblGenomes-Gn; SPRRNA.27.
DR   EnsemblGenomes-Gn; SPRRNA.28.
DR   EnsemblGenomes-Gn; SPRRNA.29.
DR   EnsemblGenomes-Gn; SPRRNA.30.
DR   EnsemblGenomes-Gn; SPRRNA.31.
DR   EnsemblGenomes-Gn; SPRRNA.32.
DR   EnsemblGenomes-Gn; SPRRNA.33.
DR   EnsemblGenomes-Gn; SPRRNA.34.
DR   EnsemblGenomes-Gn; SPRRNA.35.
DR   EnsemblGenomes-Gn; SPRRNA.36.
DR   EnsemblGenomes-Gn; SPRRNA.37.
DR   EnsemblGenomes-Gn; SPRRNA.38.
DR   EnsemblGenomes-Gn; SPRRNA.39.
DR   EnsemblGenomes-Gn; SPRRNA.40.
DR   EnsemblGenomes-Gn; SPRRNA.41.
DR   EnsemblGenomes-Gn; SPRRNA.54.
DR   EnsemblGenomes-Gn; SPSNORNA.21.
DR   EnsemblGenomes-Gn; SPSNORNA.22.
DR   EnsemblGenomes-Gn; SPSNORNA.23.
DR   EnsemblGenomes-Gn; SPSNORNA.24.
DR   EnsemblGenomes-Gn; SPSNORNA.25.
DR   EnsemblGenomes-Gn; SPSNORNA.26.
DR   EnsemblGenomes-Gn; SPSNORNA.27.
DR   EnsemblGenomes-Gn; SPSNORNA.28.
DR   EnsemblGenomes-Gn; SPSNORNA.33.
DR   EnsemblGenomes-Gn; SPSNORNA.34.
DR   EnsemblGenomes-Gn; SPSNORNA.35.
DR   EnsemblGenomes-Gn; SPSNORNA.36.
DR   EnsemblGenomes-Gn; SPSNORNA.38.
DR   EnsemblGenomes-Gn; SPSNORNA.39.
DR   EnsemblGenomes-Gn; SPSNORNA.40.
DR   EnsemblGenomes-Gn; SPSNORNA.44.
DR   EnsemblGenomes-Gn; SPSNORNA.45.
DR   EnsemblGenomes-Gn; SPSNORNA.47.
DR   EnsemblGenomes-Gn; SPSNRNA.01.
DR   EnsemblGenomes-Gn; SPSNRNA.04.
DR   EnsemblGenomes-Gn; SPSNRNA.05.
DR   EnsemblGenomes-Gn; SPSNRNA.07.
DR   EnsemblGenomes-Tr; SPBC119.17.1.
DR   EnsemblGenomes-Tr; SPBC1348.11.1.
DR   EnsemblGenomes-Tr; SPBC13E7.05.1.
DR   EnsemblGenomes-Tr; SPBC1706.02c.1.
DR   EnsemblGenomes-Tr; SPBC18E5.15.1.
DR   EnsemblGenomes-Tr; SPBC1E8.04.1.
DR   EnsemblGenomes-Tr; SPBC27B12.10c.1.
DR   EnsemblGenomes-Tr; SPBC29A3.08.1.
DR   EnsemblGenomes-Tr; SPBC31A8.02.1.
DR   EnsemblGenomes-Tr; SPBC32F12.08c.1.
DR   EnsemblGenomes-Tr; SPBC713.14c.1.
DR   EnsemblGenomes-Tr; SPBCPT2R1.05c.1.
DR   EnsemblGenomes-Tr; SPBCPT2R1.06c.1.
DR   EnsemblGenomes-Tr; SPBCPT2R1.07c.1.
DR   EnsemblGenomes-Tr; SPBCPT2R1.10.1.
DR   EnsemblGenomes-Tr; SPBPB10D8.03.1.
DR   EnsemblGenomes-Tr; SPBPB21E7.06.1.
DR   EnsemblGenomes-Tr; SPBPB21E7.08.1.
DR   EnsemblGenomes-Tr; SPBTRNAALA.07.1.
DR   EnsemblGenomes-Tr; SPBTRNAALA.08.1.
DR   EnsemblGenomes-Tr; SPBTRNAALA.09.1.
DR   EnsemblGenomes-Tr; SPBTRNAALA.10.1.
DR   EnsemblGenomes-Tr; SPBTRNAALA.11.1.
DR   EnsemblGenomes-Tr; SPBTRNAARG.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAARG.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAARG.06.1.
DR   EnsemblGenomes-Tr; SPBTRNAARG.07.1.
DR   EnsemblGenomes-Tr; SPBTRNAASN.01.1.
DR   EnsemblGenomes-Tr; SPBTRNAASN.02.1.
DR   EnsemblGenomes-Tr; SPBTRNAASN.03.1.
DR   EnsemblGenomes-Tr; SPBTRNAASN.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAASP.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAASP.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLN.01.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLN.02.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLN.03.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLN.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLU.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLU.06.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLU.07.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLU.08.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLY.03.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLY.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLY.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLY.06.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLY.07.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLY.08.1.
DR   EnsemblGenomes-Tr; SPBTRNAGLY.09.1.
DR   EnsemblGenomes-Tr; SPBTRNAHIS.01.1.
DR   EnsemblGenomes-Tr; SPBTRNAHIS.02.1.
DR   EnsemblGenomes-Tr; SPBTRNAILE.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAILE.06.1.
DR   EnsemblGenomes-Tr; SPBTRNAILE.07.1.
DR   EnsemblGenomes-Tr; SPBTRNAILE.08.1.
DR   EnsemblGenomes-Tr; SPBTRNALEU.05.1.
DR   EnsemblGenomes-Tr; SPBTRNALEU.06.1.
DR   EnsemblGenomes-Tr; SPBTRNALEU.07.1.
DR   EnsemblGenomes-Tr; SPBTRNALEU.08.1.
DR   EnsemblGenomes-Tr; SPBTRNALEU.09.1.
DR   EnsemblGenomes-Tr; SPBTRNALEU.10.1.
DR   EnsemblGenomes-Tr; SPBTRNALYS.06.1.
DR   EnsemblGenomes-Tr; SPBTRNALYS.07.1.
DR   EnsemblGenomes-Tr; SPBTRNALYS.08.1.
DR   EnsemblGenomes-Tr; SPBTRNALYS.09.1.
DR   EnsemblGenomes-Tr; SPBTRNAMET.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAMET.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAMET.06.1.
DR   EnsemblGenomes-Tr; SPBTRNAPHE.03.1.
DR   EnsemblGenomes-Tr; SPBTRNAPRO.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAPRO.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAPRO.06.1.
DR   EnsemblGenomes-Tr; SPBTRNAPRO.07.1.
DR   EnsemblGenomes-Tr; SPBTRNAPRO.08.1.
DR   EnsemblGenomes-Tr; SPBTRNASER.05.1.
DR   EnsemblGenomes-Tr; SPBTRNASER.06.1.
DR   EnsemblGenomes-Tr; SPBTRNATHR.06.1.
DR   EnsemblGenomes-Tr; SPBTRNATHR.07.1.
DR   EnsemblGenomes-Tr; SPBTRNATRP.02.1.
DR   EnsemblGenomes-Tr; SPBTRNATRP.03.1.
DR   EnsemblGenomes-Tr; SPBTRNATYR.02.1.
DR   EnsemblGenomes-Tr; SPBTRNATYR.03.1.
DR   EnsemblGenomes-Tr; SPBTRNATYR.04.1.
DR   EnsemblGenomes-Tr; SPBTRNAVAL.05.1.
DR   EnsemblGenomes-Tr; SPBTRNAVAL.06.1.
DR   EnsemblGenomes-Tr; SPBTRNAVAL.07.1.
DR   EnsemblGenomes-Tr; SPBTRNAVAL.08.1.
DR   EnsemblGenomes-Tr; SPNCRNA.04.1.
DR   EnsemblGenomes-Tr; SPNCRNA.08.1.
DR   EnsemblGenomes-Tr; SPNCRNA.09.1.
DR   EnsemblGenomes-Tr; SPNCRNA.100.1.
DR   EnsemblGenomes-Tr; SPNCRNA.102.1.
DR   EnsemblGenomes-Tr; SPNCRNA.103.1.
DR   EnsemblGenomes-Tr; SPNCRNA.105.1.
DR   EnsemblGenomes-Tr; SPNCRNA.107.1.
DR   EnsemblGenomes-Tr; SPNCRNA.108.1.
DR   EnsemblGenomes-Tr; SPNCRNA.11.1.
DR   EnsemblGenomes-Tr; SPNCRNA.110.1.
DR   EnsemblGenomes-Tr; SPNCRNA.111.1.
DR   EnsemblGenomes-Tr; SPNCRNA.112.1.
DR   EnsemblGenomes-Tr; SPNCRNA.113.1.
DR   EnsemblGenomes-Tr; SPNCRNA.114.1.
DR   EnsemblGenomes-Tr; SPNCRNA.115.1.
DR   EnsemblGenomes-Tr; SPNCRNA.116.1.
DR   EnsemblGenomes-Tr; SPNCRNA.117.1.
DR   EnsemblGenomes-Tr; SPNCRNA.118.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1301.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1302.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1303.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1304.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1305.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1306.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1307.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1309.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1310.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1312.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1313.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1314.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1315.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1316.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1317.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1318.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1319.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1320.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1321.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1322.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1323.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1324.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1325.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1326.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1327.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1328.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1329.1.
DR   EnsemblGenomes-Tr; SPNCRNA.133.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1330.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1331.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1332.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1333.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1334.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1335.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1336.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1337.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1338.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1339.1.
DR   EnsemblGenomes-Tr; SPNCRNA.134.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1340.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1342.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1343.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1344.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1345.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1346.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1348.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1349.1.
DR   EnsemblGenomes-Tr; SPNCRNA.135.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1350.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1351.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1352.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1353.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1354.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1355.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1356.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1357.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1358.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1359.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1360.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1361.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1362.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1363.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1364.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1365.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1366.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1367.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1368.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1369.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1370.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1371.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1373.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1374.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1375.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1376.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1377.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1378.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1379.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1381.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1382.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1383.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1384.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1385.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1386.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1387.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1389.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1390.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1391.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1392.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1393.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1394.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1395.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1396.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1397.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1398.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1399.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1400.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1401.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1402.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1403.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1404.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1405.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1406.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1407.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1408.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1409.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1410.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1411.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1412.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1413.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1414.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1415.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1416.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1417.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1418.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1419.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1420.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1421.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1422.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1423.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1424.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1425.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1426.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1427.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1428.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1429.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1430.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1431.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1432.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1433.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1434.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1435.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1436.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1437.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1438.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1439.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1440.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1441.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1442.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1443.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1444.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1445.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1446.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1447.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1448.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1449.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1450.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1451.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1452.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1453.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1454.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1455.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1456.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1457.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1458.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1459.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1460.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1461.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1462.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1463.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1464.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1465.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1466.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1467.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1468.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1469.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1470.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1471.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1472.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1473.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1474.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1475.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1476.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1477.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1478.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1479.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1480.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1481.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1482.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1483.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1484.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1485.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1487.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1488.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1489.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1490.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1491.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1492.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1493.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1494.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1495.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1496.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1497.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1498.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1499.1.
DR   EnsemblGenomes-Tr; SPNCRNA.15.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1500.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1501.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1502.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1503.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1504.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1505.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1506.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1507.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1508.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1509.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1510.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1511.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1512.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1513.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1514.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1515.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1516.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1517.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1518.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1519.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1520.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1521.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1522.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1523.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1524.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1525.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1526.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1527.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1528.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1529.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1530.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1531.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1532.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1533.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1534.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1535.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1536.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1537.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1538.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1539.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1540.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1541.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1542.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1543.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1544.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1545.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1546.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1547.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1548.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1549.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1550.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1551.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1552.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1553.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1554.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1555.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1556.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1557.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1558.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1559.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1560.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1561.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1562.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1563.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1564.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1565.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1566.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1567.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1568.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1569.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1570.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1571.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1572.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1573.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1574.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1575.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1576.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1577.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1578.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1579.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1580.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1581.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1582.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1583.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1584.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1585.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1586.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1587.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1588.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1589.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1590.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1591.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1592.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1593.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1594.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1595.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1596.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1597.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1598.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1599.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1600.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1601.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1602.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1603.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1604.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1605.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1606.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1607.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1608.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1609.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1610.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1611.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1613.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1614.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1615.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1616.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1617.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1618.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1619.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1620.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1621.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1622.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1623.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1624.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1625.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1626.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1627.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1628.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1629.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1630.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1631.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1632.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1633.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1634.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1635.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1636.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1637.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1638.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1639.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1640.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1641.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1642.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1643.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1644.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1645.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1646.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1647.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1648.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1649.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1650.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1651.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1653.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1654.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1655.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1656.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1657.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1658.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1659.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1660.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1661.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1662.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1663.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1664.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1665.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1666.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1667.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1668.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1669.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1670.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1671.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1672.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1673.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1674.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1675.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1676.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1677.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1678.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1680.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1681.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1682.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1683.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1684.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1685.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1686.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1687.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1688.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1689.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1690.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1691.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1692.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1693.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1694.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1695.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1696.1.
DR   EnsemblGenomes-Tr; SPNCRNA.1697.1.
DR   EnsemblGenomes-Tr; SPNCRNA.17.1.
DR   EnsemblGenomes-Tr; SPNCRNA.20.1.
DR   EnsemblGenomes-Tr; SPNCRNA.23.1.
DR   EnsemblGenomes-Tr; SPNCRNA.24.1.
DR   EnsemblGenomes-Tr; SPNCRNA.25.1.
DR   EnsemblGenomes-Tr; SPNCRNA.26.1.
DR   EnsemblGenomes-Tr; SPNCRNA.287.1.
DR   EnsemblGenomes-Tr; SPNCRNA.289.1.
DR   EnsemblGenomes-Tr; SPNCRNA.290.1.
DR   EnsemblGenomes-Tr; SPNCRNA.291.1.
DR   EnsemblGenomes-Tr; SPNCRNA.292.1.
DR   EnsemblGenomes-Tr; SPNCRNA.293.1.
DR   EnsemblGenomes-Tr; SPNCRNA.294.1.
DR   EnsemblGenomes-Tr; SPNCRNA.296.1.
DR   EnsemblGenomes-Tr; SPNCRNA.297.1.
DR   EnsemblGenomes-Tr; SPNCRNA.298.1.
DR   EnsemblGenomes-Tr; SPNCRNA.299.1.
DR   EnsemblGenomes-Tr; SPNCRNA.300.1.
DR   EnsemblGenomes-Tr; SPNCRNA.301.1.
DR   EnsemblGenomes-Tr; SPNCRNA.304.1.
DR   EnsemblGenomes-Tr; SPNCRNA.305.1.
DR   EnsemblGenomes-Tr; SPNCRNA.307.1.
DR   EnsemblGenomes-Tr; SPNCRNA.312.1.
DR   EnsemblGenomes-Tr; SPNCRNA.313.1.
DR   EnsemblGenomes-Tr; SPNCRNA.315.1.
DR   EnsemblGenomes-Tr; SPNCRNA.316.1.
DR   EnsemblGenomes-Tr; SPNCRNA.317.1.
DR   EnsemblGenomes-Tr; SPNCRNA.318.1.
DR   EnsemblGenomes-Tr; SPNCRNA.319.1.
DR   EnsemblGenomes-Tr; SPNCRNA.321.1.
DR   EnsemblGenomes-Tr; SPNCRNA.322.1.
DR   EnsemblGenomes-Tr; SPNCRNA.323.1.
DR   EnsemblGenomes-Tr; SPNCRNA.324.1.
DR   EnsemblGenomes-Tr; SPNCRNA.325.1.
DR   EnsemblGenomes-Tr; SPNCRNA.327.1.
DR   EnsemblGenomes-Tr; SPNCRNA.328.1.
DR   EnsemblGenomes-Tr; SPNCRNA.329.1.
DR   EnsemblGenomes-Tr; SPNCRNA.332.1.
DR   EnsemblGenomes-Tr; SPNCRNA.334.1.
DR   EnsemblGenomes-Tr; SPNCRNA.335.1.
DR   EnsemblGenomes-Tr; SPNCRNA.337.1.
DR   EnsemblGenomes-Tr; SPNCRNA.338.1.
DR   EnsemblGenomes-Tr; SPNCRNA.34.1.
DR   EnsemblGenomes-Tr; SPNCRNA.342.1.
DR   EnsemblGenomes-Tr; SPNCRNA.346.1.
DR   EnsemblGenomes-Tr; SPNCRNA.348.1.
DR   EnsemblGenomes-Tr; SPNCRNA.351.1.
DR   EnsemblGenomes-Tr; SPNCRNA.352.1.
DR   EnsemblGenomes-Tr; SPNCRNA.358.1.
DR   EnsemblGenomes-Tr; SPNCRNA.359.1.
DR   EnsemblGenomes-Tr; SPNCRNA.36.1.
DR   EnsemblGenomes-Tr; SPNCRNA.360.1.
DR   EnsemblGenomes-Tr; SPNCRNA.361.1.
DR   EnsemblGenomes-Tr; SPNCRNA.362.1.
DR   EnsemblGenomes-Tr; SPNCRNA.363.1.
DR   EnsemblGenomes-Tr; SPNCRNA.364.1.
DR   EnsemblGenomes-Tr; SPNCRNA.365.1.
DR   EnsemblGenomes-Tr; SPNCRNA.366.1.
DR   EnsemblGenomes-Tr; SPNCRNA.367.1.
DR   EnsemblGenomes-Tr; SPNCRNA.368.1.
DR   EnsemblGenomes-Tr; SPNCRNA.369.1.
DR   EnsemblGenomes-Tr; SPNCRNA.370.1.
DR   EnsemblGenomes-Tr; SPNCRNA.371.1.
DR   EnsemblGenomes-Tr; SPNCRNA.372.1.
DR   EnsemblGenomes-Tr; SPNCRNA.373.1.
DR   EnsemblGenomes-Tr; SPNCRNA.374.1.
DR   EnsemblGenomes-Tr; SPNCRNA.376.1.
DR   EnsemblGenomes-Tr; SPNCRNA.377.1.
DR   EnsemblGenomes-Tr; SPNCRNA.379.1.
DR   EnsemblGenomes-Tr; SPNCRNA.38.1.
DR   EnsemblGenomes-Tr; SPNCRNA.380.1.
DR   EnsemblGenomes-Tr; SPNCRNA.382.1.
DR   EnsemblGenomes-Tr; SPNCRNA.383.1.
DR   EnsemblGenomes-Tr; SPNCRNA.384.1.
DR   EnsemblGenomes-Tr; SPNCRNA.385.1.
DR   EnsemblGenomes-Tr; SPNCRNA.386.1.
DR   EnsemblGenomes-Tr; SPNCRNA.387.1.
DR   EnsemblGenomes-Tr; SPNCRNA.388.1.
DR   EnsemblGenomes-Tr; SPNCRNA.389.1.
DR   EnsemblGenomes-Tr; SPNCRNA.39.1.
DR   EnsemblGenomes-Tr; SPNCRNA.390.1.
DR   EnsemblGenomes-Tr; SPNCRNA.391.1.
DR   EnsemblGenomes-Tr; SPNCRNA.392.1.
DR   EnsemblGenomes-Tr; SPNCRNA.393.1.
DR   EnsemblGenomes-Tr; SPNCRNA.394.1.
DR   EnsemblGenomes-Tr; SPNCRNA.397.1.
DR   EnsemblGenomes-Tr; SPNCRNA.398.1.
DR   EnsemblGenomes-Tr; SPNCRNA.399.1.
DR   EnsemblGenomes-Tr; SPNCRNA.400.1.
DR   EnsemblGenomes-Tr; SPNCRNA.401.1.
DR   EnsemblGenomes-Tr; SPNCRNA.402.1.
DR   EnsemblGenomes-Tr; SPNCRNA.403.1.
DR   EnsemblGenomes-Tr; SPNCRNA.405.1.
DR   EnsemblGenomes-Tr; SPNCRNA.406.1.
DR   EnsemblGenomes-Tr; SPNCRNA.408.1.
DR   EnsemblGenomes-Tr; SPNCRNA.410.1.
DR   EnsemblGenomes-Tr; SPNCRNA.411.1.
DR   EnsemblGenomes-Tr; SPNCRNA.412.1.
DR   EnsemblGenomes-Tr; SPNCRNA.413.1.
DR   EnsemblGenomes-Tr; SPNCRNA.414.1.
DR   EnsemblGenomes-Tr; SPNCRNA.415.1.
DR   EnsemblGenomes-Tr; SPNCRNA.417.1.
DR   EnsemblGenomes-Tr; SPNCRNA.419.1.
DR   EnsemblGenomes-Tr; SPNCRNA.42.1.
DR   EnsemblGenomes-Tr; SPNCRNA.421.1.
DR   EnsemblGenomes-Tr; SPNCRNA.423.1.
DR   EnsemblGenomes-Tr; SPNCRNA.424.1.
DR   EnsemblGenomes-Tr; SPNCRNA.425.1.
DR   EnsemblGenomes-Tr; SPNCRNA.426.1.
DR   EnsemblGenomes-Tr; SPNCRNA.427.1.
DR   EnsemblGenomes-Tr; SPNCRNA.428.1.
DR   EnsemblGenomes-Tr; SPNCRNA.431.1.
DR   EnsemblGenomes-Tr; SPNCRNA.435.1.
DR   EnsemblGenomes-Tr; SPNCRNA.436.1.
DR   EnsemblGenomes-Tr; SPNCRNA.437.1.
DR   EnsemblGenomes-Tr; SPNCRNA.438.1.
DR   EnsemblGenomes-Tr; SPNCRNA.439.1.
DR   EnsemblGenomes-Tr; SPNCRNA.440.1.
DR   EnsemblGenomes-Tr; SPNCRNA.441.1.
DR   EnsemblGenomes-Tr; SPNCRNA.442.1.
DR   EnsemblGenomes-Tr; SPNCRNA.443.1.
DR   EnsemblGenomes-Tr; SPNCRNA.444.1.
DR   EnsemblGenomes-Tr; SPNCRNA.445.1.
DR   EnsemblGenomes-Tr; SPNCRNA.446.1.
DR   EnsemblGenomes-Tr; SPNCRNA.448.1.
DR   EnsemblGenomes-Tr; SPNCRNA.497.1.
DR   EnsemblGenomes-Tr; SPNCRNA.498.1.
DR   EnsemblGenomes-Tr; SPNCRNA.514.1.
DR   EnsemblGenomes-Tr; SPNCRNA.515.1.
DR   EnsemblGenomes-Tr; SPNCRNA.532.1.
DR   EnsemblGenomes-Tr; SPNCRNA.534.1.
DR   EnsemblGenomes-Tr; SPNCRNA.536.1.
DR   EnsemblGenomes-Tr; SPNCRNA.538.1.
DR   EnsemblGenomes-Tr; SPNCRNA.539.1.
DR   EnsemblGenomes-Tr; SPNCRNA.540.1.
DR   EnsemblGenomes-Tr; SPNCRNA.541.1.
DR   EnsemblGenomes-Tr; SPNCRNA.543.1.
DR   EnsemblGenomes-Tr; SPNCRNA.545.1.
DR   EnsemblGenomes-Tr; SPNCRNA.565.1.
DR   EnsemblGenomes-Tr; SPNCRNA.566.1.
DR   EnsemblGenomes-Tr; SPNCRNA.567.1.
DR   EnsemblGenomes-Tr; SPNCRNA.568.1.
DR   EnsemblGenomes-Tr; SPNCRNA.569.1.
DR   EnsemblGenomes-Tr; SPNCRNA.570.1.
DR   EnsemblGenomes-Tr; SPNCRNA.571.1.
DR   EnsemblGenomes-Tr; SPNCRNA.572.1.
DR   EnsemblGenomes-Tr; SPNCRNA.573.1.
DR   EnsemblGenomes-Tr; SPNCRNA.574.1.
DR   EnsemblGenomes-Tr; SPNCRNA.575.1.
DR   EnsemblGenomes-Tr; SPNCRNA.576.1.
DR   EnsemblGenomes-Tr; SPNCRNA.577.1.
DR   EnsemblGenomes-Tr; SPNCRNA.62.1.
DR   EnsemblGenomes-Tr; SPNCRNA.66.1.
DR   EnsemblGenomes-Tr; SPNCRNA.68.1.
DR   EnsemblGenomes-Tr; SPNCRNA.89.1.
DR   EnsemblGenomes-Tr; SPRRNA.27.1.
DR   EnsemblGenomes-Tr; SPRRNA.28.1.
DR   EnsemblGenomes-Tr; SPRRNA.29.1.
DR   EnsemblGenomes-Tr; SPRRNA.30.1.
DR   EnsemblGenomes-Tr; SPRRNA.31.1.
DR   EnsemblGenomes-Tr; SPRRNA.32.1.
DR   EnsemblGenomes-Tr; SPRRNA.33.1.
DR   EnsemblGenomes-Tr; SPRRNA.34.1.
DR   EnsemblGenomes-Tr; SPRRNA.35.1.
DR   EnsemblGenomes-Tr; SPRRNA.36.1.
DR   EnsemblGenomes-Tr; SPRRNA.37.1.
DR   EnsemblGenomes-Tr; SPRRNA.38.1.
DR   EnsemblGenomes-Tr; SPRRNA.39.1.
DR   EnsemblGenomes-Tr; SPRRNA.40.1.
DR   EnsemblGenomes-Tr; SPRRNA.41.1.
DR   EnsemblGenomes-Tr; SPRRNA.54.1.
DR   EnsemblGenomes-Tr; SPSNORNA.21.1.
DR   EnsemblGenomes-Tr; SPSNORNA.22.1.
DR   EnsemblGenomes-Tr; SPSNORNA.23.1.
DR   EnsemblGenomes-Tr; SPSNORNA.24.1.
DR   EnsemblGenomes-Tr; SPSNORNA.25.1.
DR   EnsemblGenomes-Tr; SPSNORNA.26.1.
DR   EnsemblGenomes-Tr; SPSNORNA.27.1.
DR   EnsemblGenomes-Tr; SPSNORNA.28.1.
DR   EnsemblGenomes-Tr; SPSNORNA.33.1.
DR   EnsemblGenomes-Tr; SPSNORNA.34.1.
DR   EnsemblGenomes-Tr; SPSNORNA.35.1.
DR   EnsemblGenomes-Tr; SPSNORNA.36.1.
DR   EnsemblGenomes-Tr; SPSNORNA.38.1.
DR   EnsemblGenomes-Tr; SPSNORNA.39.1.
DR   EnsemblGenomes-Tr; SPSNORNA.40.1.
DR   EnsemblGenomes-Tr; SPSNORNA.44.1.
DR   EnsemblGenomes-Tr; SPSNORNA.45.1.
DR   EnsemblGenomes-Tr; SPSNORNA.47.1.
DR   EnsemblGenomes-Tr; SPSNRNA.01.1.
DR   EnsemblGenomes-Tr; SPSNRNA.04.1.
DR   EnsemblGenomes-Tr; SPSNRNA.05.1.
DR   EnsemblGenomes-Tr; SPSNRNA.07.1.
DR   EuropePMC; PMC5063382; 27736907.
DR   EuropePMC; PMC6168568; 30279451.
DR   EuropePMC; PMC6275460; 30192951.
DR   GOA; P0CU21.
DR   GOA; P0CU26.
DR   PomBase; ENSRNA049626499; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626499-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626555; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626555-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626597; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626597-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626680; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626680-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626722; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626722-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626802; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626802-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626864; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626864-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626918; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626918-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626982; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049626982-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627029; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627029-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627123; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627123-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627179; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627179-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627223; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627223-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627265; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627265-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627340; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627340-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627433; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627433-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627494; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627494-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627588; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627588-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627646; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627646-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627707; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627707-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627745; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627745-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627819; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627819-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627905; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627905-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627956; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049627956-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628005; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628005-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628088; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628088-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628168; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628168-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628231; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628231-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628307; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628307-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628356; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628356-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628402; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628402-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628446; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628446-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628471; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628471-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628543; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628543-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628658; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628658-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628693; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628693-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628756; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628756-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628837; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628837-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628875; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628875-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628927; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628927-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628987; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049628987-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629048; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629048-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629109; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629109-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629155; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629155-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629225; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629225-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629286; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629286-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629355; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629355-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629443; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629443-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629509; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629509-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629570; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629570-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629631; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629631-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629679; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629679-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629724; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629724-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629766; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629766-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629840; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629840-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629926; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629926-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629978; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049629978-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630059; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630059-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630111; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630111-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630184; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630184-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630202; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630202-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630249; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630249-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630298; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630298-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630358; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630358-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630430; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630430-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630497; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630497-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630555; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630555-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630597; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049630597-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677528; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677528-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677556; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677556-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677584; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677584-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677621; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677621-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677681; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677681-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677710; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677710-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677729; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677729-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677755; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677755-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677768; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677768-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677832; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677832-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677866; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677866-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677891; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677891-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677927; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677927-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677943; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677943-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677971; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049677971-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678002; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678002-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678019; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678019-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678043; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678043-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678068; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678068-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678095; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678095-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678113; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678113-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678136; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678136-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678159; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678159-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678178; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678178-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678201; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678201-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678217; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678217-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678253; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678253-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678266; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678266-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678299; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678299-T1; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678320; Schizosaccharomyces_pombe.
DR   PomBase; ENSRNA049678320-T1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC119.17; Schizosaccharomyces_pombe.
DR   PomBase; SPBC119.17.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC1348.11; Schizosaccharomyces_pombe.
DR   PomBase; SPBC1348.11.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC13E7.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBC13E7.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC1706.02c; Schizosaccharomyces_pombe.
DR   PomBase; SPBC1706.02c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC18E5.15; Schizosaccharomyces_pombe.
DR   PomBase; SPBC18E5.15.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC1E8.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBC1E8.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC27B12.10c; Schizosaccharomyces_pombe.
DR   PomBase; SPBC27B12.10c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC29A3.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBC29A3.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC31A8.02; Schizosaccharomyces_pombe.
DR   PomBase; SPBC31A8.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC32F12.08c; Schizosaccharomyces_pombe.
DR   PomBase; SPBC32F12.08c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBC713.14c; Schizosaccharomyces_pombe.
DR   PomBase; SPBC713.14c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.05c; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.05c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.06c; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.06c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.07c; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.07c.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.10; Schizosaccharomyces_pombe.
DR   PomBase; SPBCPT2R1.10.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBPB10D8.03; Schizosaccharomyces_pombe.
DR   PomBase; SPBPB10D8.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBPB21E7.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBPB21E7.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBPB21E7.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBPB21E7.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.09; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.09.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.10; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.10.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.11; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAALA.11.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAARG.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.01; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.02; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.03; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASN.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASP.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASP.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASP.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAASP.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.01; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.02; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.03; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLN.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLU.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.03; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.09; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAGLY.09.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAHIS.01; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAHIS.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAHIS.02; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAHIS.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAILE.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.09; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.09.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.10; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALEU.10.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.09; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNALYS.09.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAMET.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAMET.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAMET.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAMET.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAMET.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAMET.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPHE.03; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPHE.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAPRO.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNASER.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNASER.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNASER.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNASER.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATHR.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATHR.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATHR.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATHR.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATRP.02; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATRP.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATRP.03; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATRP.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATYR.02; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATYR.02.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATYR.03; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATYR.03.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATYR.04; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNATYR.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.05; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.06; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.06.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.07; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.07.1; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.08; Schizosaccharomyces_pombe.
DR   PomBase; SPBTRNAVAL.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.04; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.08; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.08.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.09; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.09.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.100; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.100.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.102; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.102.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.103; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.103.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.105; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.105.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.107; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.107.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.108; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.108.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.11; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.11.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.110; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.110.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.111; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.111.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.112; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.112.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.113; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.113.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.114; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.114.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.115; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.115.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.116; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.116.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.117; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.117.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.118; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.118.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1301; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1301.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1302; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1302.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1303; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1303.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1304; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1304.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1305; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1305.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1306; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1306.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1307; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1307.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1309; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1309.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1310; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1310.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1312; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1312.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1313; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1313.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1314; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1314.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1315; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1315.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1316; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1316.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1317; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1317.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1318; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1318.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1319; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1319.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1320; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1320.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1321; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1321.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1322; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1322.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1323; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1323.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1324; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1324.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1325; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1325.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1326; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1326.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1327; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1327.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1328; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1328.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1329; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1329.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.133; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.133.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1330; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1330.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1331; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1331.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1332; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1332.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1333; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1333.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1334; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1334.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1335; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1335.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1336; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1336.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1337; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1337.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1338; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1338.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1339; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1339.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.134; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.134.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1340; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1340.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1342; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1342.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1343; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1343.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1344; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1344.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1345; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1345.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1346; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1346.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1348; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1348.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1349; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1349.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.135; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.135.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1350; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1350.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1351; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1351.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1352; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1352.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1353; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1353.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1354; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1354.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1355; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1355.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1356; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1356.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1357; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1357.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1358; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1358.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1359; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1359.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1360; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1360.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1361; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1361.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1362; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1362.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1363; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1363.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1364; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1364.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1365; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1365.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1366; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1366.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1367; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1367.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1368; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1368.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1369; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1369.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1370; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1370.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1371; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1371.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1373; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1373.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1374; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1374.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1375; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1375.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1376; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1376.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1377; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1377.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1378; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1378.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1379; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1379.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1381; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1381.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1382; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1382.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1383; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1383.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1384; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1384.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1385; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1385.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1386; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1386.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1387; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1387.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1389; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1389.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1390; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1390.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1391; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1391.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1392; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1392.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1393; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1393.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1394; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1394.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1395; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1395.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1396; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1396.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1397; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1397.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1398; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1398.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1399; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1399.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1400; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1400.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1401; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1401.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1402; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1402.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1403; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1403.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1404; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1404.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1405; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1405.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1406; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1406.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1407; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1407.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1408; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1408.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1409; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1409.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1410; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1410.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1411; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1411.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1412; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1412.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1413; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1413.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1414; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1414.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1415; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1415.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1416; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1416.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1417; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1417.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1418; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1418.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1419; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1419.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1420; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1420.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1421; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1421.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1422; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1422.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1423; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1423.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1424; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1424.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1425; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1425.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1426; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1426.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1427; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1427.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1428; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1428.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1429; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1429.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1430; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1430.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1431; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1431.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1432; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1432.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1433; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1433.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1434; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1434.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1435; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1435.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1436; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1436.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1437; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1437.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1438; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1438.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1439; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1439.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1440; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1440.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1441; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1441.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1442; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1442.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1443; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1443.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1444; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1444.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1445; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1445.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1446; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1446.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1447; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1447.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1448; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1448.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1449; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1449.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1450; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1450.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1451; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1451.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1452; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1452.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1453; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1453.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1454; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1454.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1455; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1455.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1456; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1456.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1457; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1457.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1458; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1458.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1459; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1459.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1460; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1460.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1461; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1461.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1462; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1462.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1463; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1463.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1464; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1464.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1465; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1465.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1466; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1466.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1467; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1467.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1468; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1468.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1469; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1469.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1470; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1470.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1471; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1471.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1472; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1472.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1473; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1473.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1474; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1474.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1475; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1475.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1476; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1476.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1477; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1477.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1478; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1478.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1479; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1479.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1480; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1480.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1481; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1481.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1482; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1482.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1483; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1483.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1484; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1484.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1485; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1485.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1487; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1487.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1488; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1488.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1489; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1489.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1490; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1490.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1491; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1491.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1492; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1492.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1493; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1493.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1494; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1494.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1495; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1495.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1496; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1496.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1497; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1497.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1498; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1498.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1499; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1499.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.15; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.15.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1500; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1500.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1501; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1501.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1502; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1502.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1503; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1503.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1504; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1504.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1505; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1505.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1506; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1506.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1507; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1507.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1508; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1508.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1509; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1509.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1510; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1510.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1511; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1511.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1512; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1512.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1513; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1513.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1514; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1514.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1515; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1515.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1516; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1516.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1517; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1517.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1518; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1518.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1519; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1519.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1520; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1520.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1521; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1521.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1522; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1522.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1523; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1523.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1524; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1524.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1525; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1525.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1526; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1526.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1527; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1527.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1528; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1528.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1529; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1529.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1530; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1530.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1531; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1531.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1532; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1532.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1533; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1533.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1534; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1534.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1535; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1535.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1536; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1536.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1537; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1537.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1538; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1538.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1539; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1539.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1540; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1540.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1541; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1541.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1542; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1542.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1543; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1543.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1544; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1544.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1545; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1545.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1546; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1546.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1547; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1547.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1548; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1548.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1549; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1549.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1550; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1550.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1551; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1551.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1552; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1552.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1553; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1553.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1554; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1554.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1555; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1555.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1556; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1556.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1557; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1557.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1558; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1558.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1559; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1559.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1560; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1560.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1561; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1561.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1562; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1562.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1563; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1563.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1564; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1564.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1565; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1565.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1566; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1566.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1567; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1567.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1568; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1568.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1569; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1569.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1570; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1570.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1571; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1571.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1572; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1572.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1573; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1573.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1574; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1574.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1575; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1575.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1576; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1576.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1577; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1577.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1578; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1578.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1579; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1579.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1580; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1580.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1581; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1581.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1582; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1582.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1583; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1583.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1584; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1584.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1585; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1585.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1586; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1586.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1587; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1587.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1588; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1588.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1589; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1589.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1590; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1590.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1591; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1591.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1592; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1592.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1593; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1593.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1594; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1594.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1595; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1595.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1596; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1596.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1597; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1597.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1598; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1598.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1599; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1599.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1600; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1600.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1601; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1601.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1602; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1602.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1603; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1603.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1604; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1604.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1605; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1605.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1606; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1606.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1607; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1607.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1608; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1608.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1609; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1609.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1610; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1610.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1611; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1611.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1613; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1613.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1614; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1614.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1615; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1615.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1616; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1616.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1617; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1617.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1618; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1618.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1619; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1619.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1620; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1620.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1621; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1621.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1622; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1622.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1623; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1623.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1624; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1624.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1625; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1625.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1626; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1626.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1627; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1627.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1628; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1628.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1629; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1629.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1630; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1630.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1631; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1631.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1632; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1632.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1633; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1633.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1634; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1634.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1635; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1635.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1636; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1636.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1637; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1637.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1638; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1638.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1639; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1639.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1640; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1640.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1641; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1641.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1642; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1642.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1643; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1643.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1644; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1644.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1645; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1645.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1646; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1646.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1647; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1647.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1648; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1648.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1649; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1649.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1650; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1650.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1651; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1651.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1653; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1653.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1654; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1654.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1655; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1655.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1656; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1656.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1657; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1657.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1658; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1658.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1659; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1659.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1660; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1660.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1661; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1661.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1662; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1662.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1663; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1663.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1664; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1664.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1665; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1665.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1666; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1666.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1667; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1667.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1668; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1668.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1669; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1669.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1670; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1670.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1671; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1671.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1672; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1672.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1673; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1673.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1674; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1674.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1675; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1675.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1676; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1676.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1677; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1677.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1678; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1678.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1680; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1680.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1681; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1681.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1682; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1682.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1683; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1683.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1684; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1684.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1685; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1685.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1686; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1686.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1687; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1687.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1688; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1688.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1689; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1689.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1690; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1690.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1691; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1691.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1692; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1692.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1693; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1693.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1694; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1694.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1695; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1695.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1696; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1696.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1697; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.1697.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.17; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.17.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.20; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.20.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.23; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.23.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.24; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.24.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.25; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.25.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.26; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.26.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.287; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.287.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.289; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.289.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.290; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.290.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.291; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.291.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.292; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.292.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.293; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.293.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.294; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.294.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.296; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.296.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.297; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.297.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.298; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.298.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.299; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.299.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.300; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.300.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.301; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.301.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.304; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.304.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.305; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.305.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.307; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.307.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.312; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.312.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.313; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.313.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.315; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.315.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.316; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.316.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.317; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.317.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.318; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.318.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.319; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.319.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.321; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.321.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.322; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.322.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.323; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.323.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.324; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.324.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.325; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.325.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.327; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.327.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.328; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.328.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.329; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.329.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.332; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.332.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.334; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.334.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.335; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.335.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.337; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.337.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.338; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.338.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.34; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.34.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.342; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.342.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.346; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.346.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.348; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.348.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.351; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.351.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.352; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.352.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.358; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.358.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.359; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.359.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.36; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.36.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.360; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.360.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.361; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.361.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.362; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.362.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.363; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.363.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.364; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.364.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.365; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.365.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.366; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.366.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.367; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.367.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.368; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.368.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.369; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.369.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.370; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.370.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.371; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.371.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.372; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.372.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.373; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.373.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.374; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.374.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.376; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.376.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.377; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.377.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.379; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.379.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.38; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.38.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.380; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.380.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.382; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.382.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.383; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.383.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.384; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.384.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.385; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.385.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.386; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.386.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.387; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.387.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.388; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.388.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.389; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.389.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.39; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.39.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.390; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.390.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.391; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.391.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.392; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.392.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.393; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.393.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.394; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.394.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.397; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.397.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.398; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.398.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.399; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.399.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.400; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.400.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.401; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.401.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.402; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.402.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.403; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.403.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.405; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.405.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.406; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.406.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.408; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.408.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.410; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.410.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.411; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.411.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.412; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.412.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.413; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.413.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.414; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.414.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.415; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.415.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.417; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.417.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.419; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.419.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.42; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.42.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.421; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.421.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.423; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.423.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.424; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.424.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.425; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.425.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.426; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.426.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.427; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.427.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.428; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.428.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.431; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.431.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.435; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.435.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.436; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.436.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.437; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.437.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.438; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.438.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.439; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.439.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.440; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.440.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.441; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.441.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.442; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.442.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.443; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.443.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.444; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.444.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.445; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.445.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.446; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.446.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.448; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.448.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.497; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.497.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.498; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.498.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.514; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.514.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.515; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.515.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.532; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.532.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.534; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.534.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.536; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.536.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.538; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.538.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.539; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.539.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.540; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.540.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.541; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.541.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.543; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.543.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.545; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.545.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.565; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.565.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.566; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.566.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.567; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.567.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.568; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.568.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.569; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.569.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.570; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.570.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.571; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.571.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.572; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.572.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.573; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.573.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.574; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.574.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.575; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.575.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.576; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.576.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.577; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.577.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.62; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.62.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.66; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.66.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.68; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.68.1; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.89; Schizosaccharomyces_pombe.
DR   PomBase; SPNCRNA.89.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.27; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.27.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.28; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.28.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.29; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.29.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.30; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.30.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.31; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.31.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.32; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.32.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.33; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.33.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.34; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.34.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.35; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.35.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.36; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.36.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.37; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.37.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.38; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.38.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.39; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.39.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.40; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.40.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.41; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.41.1; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.54; Schizosaccharomyces_pombe.
DR   PomBase; SPRRNA.54.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.21; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.21.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.22; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.22.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.23; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.23.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.24; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.24.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.25; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.25.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.26; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.26.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.27; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.27.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.28; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.28.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.33; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.33.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.34; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.34.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.35; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.35.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.36; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.36.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.38; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.38.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.39; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.39.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.40; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.40.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.44; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.44.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.45; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.45.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.47; Schizosaccharomyces_pombe.
DR   PomBase; SPSNORNA.47.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.01; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.01.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.04; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.04.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.05; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.05.1; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.07; Schizosaccharomyces_pombe.
DR   PomBase; SPSNRNA.07.1; Schizosaccharomyces_pombe.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00003; U1.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00015; U4.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF00020; U5.
DR   RFAM; RF00093; SNORD18.
DR   RFAM; RF00309; snosnR60_Z15.
DR   RFAM; RF00476; snosnR61.
DR   RFAM; RF01434; S_pombe_snR3.
DR   RFAM; RF01435; S_pombe_snR5.
DR   RFAM; RF01436; S_pombe_snR33.
DR   RFAM; RF01438; S_pombe_snR35.
DR   RFAM; RF01439; S_pombe_snR36.
DR   RFAM; RF01440; S_pombe_snR42.
DR   RFAM; RF01444; S_pombe_snR92.
DR   RFAM; RF01446; S_pombe_snR95.
DR   RFAM; RF01448; S_pombe_snR93.
DR   RFAM; RF01449; S_pombe_snR100.
DR   RFAM; RF01846; Fungi_U3.
DR   StrainInfo; 579442; 0.
DR   UniProtKB/Swiss-Prot; P0CU21; YN5E_SCHPO.
DR   UniProtKB/Swiss-Prot; P0CU26; INA17_SCHPO.
XX
CC   Notes:
CC
CC   S. pombe (fission yeast) sequence and annotation are available from:
CC   (URL, http://www.genedb.org/genedb/pombe/index.jsp)
CC   (URL, http://www.sanger.ac.uk/Projects/S_pombe/)
CC
CC   CDS are numbered using the following system eg SPAC5H10.01c.
CC   SP (S. pombe), A (chromosome 1), c5H10 (cosmid name),
CC   .01 (first CDS), c (complementary strand). However, clones may have
CC   been reorientated since the original submission, therefore the
CC   complementary strand notation may be invalid for strand inference.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4539804
FT                   /organism="Schizosaccharomyces pombe"
FT                   /chromosome="II"
FT                   /strain="972h-"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4896"
FT   repeat_region   1..6535
FT   CDS_pept        complement(304..693)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.15"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:P0CS84"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS84"
FT                   /protein_id="CAO77672.1"
FT                   /translation="MSIEFDDSSRHNMNMTQLMQLGAFDRRSGDDFMVQDFKNGIRDCS
FT                   GIPVNNRNLAFKAYDAVKQKYDSSIKVFNIQDITIKGATWQHHNCQSTGKWYSQLYDYQ
FT                   NTFIGKQEYNILFDCYSYLKYNLNG"
FT   repeat_region   complement(997..1215)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(1296..1591)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(2756..3054)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   4835..5191
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           5224..5450
FT                   /locus_tag="SPBC1348.01"
FT   CDS_pept        join(5451..5940,5999..6318)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.01"
FT                   /product="S. pombe specific DUF999 protein family 5"
FT                   /db_xref="GOA:P0CS86"
FT                   /db_xref="InterPro:IPR009340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS86"
FT                   /protein_id="CAB94268.1"
FT                   /translation="MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQ
FT                   SQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRISTRSN
FT                   FRWPLLIIWSIIIVFAVDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLMLLSLI
FT                   FFAEFAVLALRVTGVIIAVLGMIIAVLGMIIAALGATITGLLYFGHWALYKLVILSLGF
FT                   KIVTPGDVCVSNTLPTHNGETALHSETTVGSDIEQIELQNMPTPVKK"
FT   3'UTR           6319..6829
FT                   /locus_tag="SPBC1348.01"
FT   5'UTR           7633..7979
FT                   /locus_tag="SPBC1348.02"
FT   CDS_pept        7980..9014
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.02"
FT                   /product="S. pombe specific 5Tm protein family"
FT                   /db_xref="GOA:P0CU14"
FT                   /db_xref="InterPro:IPR018291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU14"
FT                   /protein_id="CAB94269.1"
FT                   /translation="MIDFVKSRDTVIQKSFFEEFNSQNREMGSFAYSGNSESVWTGENI
FT                   TSIWKTILINETGSYCVAARPMTMDGAEFNLDLMGYSVSEDQINNDEIGIWNYISVAEM
FT                   GGVLLFLSYWIWTCLHFSKIIFPAQKVICLYIFLFALNQTLQECIEEYVFSSECIKYRQ
FT                   FYSVYEIIDFLRTNFYRLFVIYCALGFGITRTVPKYLMIKGISIVIALCSVYWISLYKD
FT                   VYVVSEIFDMIQYEVSPAIWVYSICHLLKQCTSVTTYENASKARFFRRMLNAFIFIFCA
FT                   SPMLHYLSNIIFGNFDYRLSVIIGDLFTFMEKIAFPCYIMFPTHNEALAYNRNVAEEAQ
FT                   EKMI"
FT   repeat_region   8062..12662
FT   3'UTR           9015..9457
FT                   /locus_tag="SPBC1348.02"
FT   CDS_pept        10569..11009
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.03"
FT                   /product="S. pombe specific 5Tm protein family"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.03.1"
FT                   /db_xref="GOA:Q9P3V7"
FT                   /db_xref="InterPro:IPR018291"
FT                   /db_xref="PomBase:SPBC1348.03"
FT                   /db_xref="PomBase:SPBC1348.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P3V7"
FT                   /protein_id="CAB94270.1"
FT                   /translation="MALLKKINTQVNRIMKNSSLVQNICFDRVPLFIPRLSLTVKYCLA
FT                   VKLLIYLLYCWYIYSEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTHSINSIRTFSKFQ
FT                   VIILFSIEKVTRSESKNHSYSKTDISDLHQGYNNPPSRFISQ"
FT   3'UTR           11010..11351
FT                   /locus_tag="SPBC1348.03"
FT   CDS_pept        12176..12613
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.04"
FT                   /product="methyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.04.1"
FT                   /db_xref="GOA:Q9P3V6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="PomBase:SPBC1348.04"
FT                   /db_xref="PomBase:SPBC1348.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P3V6"
FT                   /protein_id="CAB94271.1"
FT                   /translation="MNLVQLGKLHENVLDAGCEPNRNARYLASLGYKVVGIDISERAIS
FT                   KAIDKTSSEKSNVNFNQRDFSRLNEFKGHFDTVIDIGCFHSILNSDHEPYTASLSHICH
FT                   SDSSVFLRAFSETNKSRYRRWQGHKRYSLALKRNNVKKLSL"
FT   3'UTR           12614..12750
FT                   /locus_tag="SPBC1348.04"
FT   CDS_pept        13572..15029
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.05"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.05.1"
FT                   /db_xref="GOA:Q9P3V5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1348.05"
FT                   /db_xref="PomBase:SPBC1348.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P3V5"
FT                   /protein_id="CAB94272.1"
FT                   /translation="MKEESILKKCDSSSIKHVPSTPLETNCPDKYNPKTWPIRLKVRNV
FT                   IVISSMTFLNQYGDSVFAPSISNIAEQFHASRTLVTLGATLYTLGILFGNLIFAPLSEQ
FT                   FGRRPIYLIGYSVFALLQIPIALSVNLAMFLVFRFFSGLFGSVGLSNGSGSLADLFEKK
FT                   DRGKYMVIYFTVLSIGPGIAPIISGFISQSSIGWQWEFWILLILSGFNLFWAFLLLKET
FT                   YPPVLNRKKFEKYGEIGENEPVALRLTGKQLLIKLLILLSMKKPISILLSQPILICVAC
FT                   TIGSIYGMINLVLIAFSEVWKSSYDFSPGISGLMYISITLGLFSAVFIAMPINQKFYSY
FT                   LVKRNGGEGEPEFRLPMGFIGITLFEIGILLFGWTARYKIFWFVPTIGSAIMGGGYIMT
FT                   SNPLNMYVVDSYGIYSASASAGVKIFQLLFGAIFPLFAESLFRRLNYGWGCTLLAFILL
FT                   ACGCSLPILFKYGKQIRNLRPFDPSKY"
FT   repeat_region   14527..29514
FT   3'UTR           15030..15378
FT                   /locus_tag="SPBC1348.05"
FT   CDS_pept        complement(15981..16592)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.06c"
FT                   /product="conserved fungal family"
FT                   /db_xref="GOA:P0CU13"
FT                   /db_xref="InterPro:IPR019435"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU13"
FT                   /protein_id="CAB94273.1"
FT                   /translation="MFKNLIFLFFIGLATAIRFNLTDLECSRLRGPHCGTYLLKVVGTN
FT                   ATYVGEKSFIGLDALTESKGEFFQRMLEQEPRLIPRLFTIAENDTANFTPLTFTTYLKT
FT                   CNPQSIENAMIPFVNTVTSEISFDAWAYTAQNSSRITGLSNQLMNSTLYNVQVATCTPG
FT                   FSALLLDSPTINVFNNEEGMPSWCQPIELTPVCPLDEGFN"
FT   5'UTR           19395..19640
FT                   /locus_tag="SPBC1348.07"
FT   CDS_pept        join(19641..20058,20109..20383)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.07"
FT                   /product="S. pombe specific DUF999 protein family 6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.07.1"
FT                   /db_xref="GOA:Q9P3V3"
FT                   /db_xref="InterPro:IPR009340"
FT                   /db_xref="PomBase:SPBC1348.07"
FT                   /db_xref="PomBase:SPBC1348.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P3V3"
FT                   /protein_id="CAB94274.1"
FT                   /translation="MVRDTRNVDLERGLELCKPEKVNKQNLFTNIVKPQKDKINIKTDK
FT                   IKFFLNNLFTEFSKFHDSCYPDGRISTRSKLRWPLLIIWCILIVFAIDKNFEVKDFLSI
FT                   WINESFINENRFYSEIWGPIAIYICLFILLLLGLIYCSKIVVKAIPLISIVIAAVVVII
FT                   AVAMVKILYICHWLIYKILILAFGIKVKPLGDTLPTHNGETGSHSKATVGSDIEQIEFQ
FT                   NMPTPVKK"
FT   3'UTR           20384..20606
FT                   /locus_tag="SPBC1348.07"
FT   misc_RNA        21025..21701
FT                   /gene_synonym="SPNG1093"
FT                   /locus_tag="SPNCRNA.287"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(21060..21754)
FT                   /locus_tag="SPNCRNA.1300"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(22111..22278)
FT                   /locus_tag="SPBC1348.08c"
FT   CDS_pept        complement(22279..23529)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.08c"
FT                   /product="cell surface glycoprotein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.08c.1"
FT                   /db_xref="GOA:P0CU04"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="PomBase:SPBC1348.08c"
FT                   /db_xref="PomBase:SPBC1348.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU04"
FT                   /protein_id="CAB94275.1"
FT                   /translation="MNFFLYFRTIFLIQLYFFNYSTFGCSASSTSVQSDTTNQVSVSCP
FT                   KYTTIYTSGTSPDTKTIYPESTSTKSITTSTQSHSSPVIVVSTVGTVTETTISGSTEYT
FT                   TTIPAEGITSGTVEIVEPTAGTVTETITSGTLPFTTTLAQASGTVSGTVEIVSPKNNPT
FT                   TVYSGTVATTETFSSSTVVVIPTAICDGVRGLEYAVYDYTISSSMNEFCYPKNGQTDVF
FT                   AFNEPAYFGSSDLDQSSPLFTGVFSSTDDIPEWASSWYLPPYPPQASDMASTYCACKVI
FT                   VYQFFLRIPETDTYTLVVNNVDDVFFGWFGDKAISGWSNNNFDAYSYWHESPNMGLGTV
FT                   GMGNFTVGNYPEGYFLPVRFVVANGAYIGGFDFYFTSDSTGPLATTSYSYTKTCTQQFL
FT                   PFGQGNGGVNGPTEKLS"
FT   CDS_pept        24916..25626
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.09"
FT                   /product="short chain dehydrogenase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.09.1"
FT                   /db_xref="GOA:P0CU01"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC1348.09"
FT                   /db_xref="PomBase:SPBC1348.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU01"
FT                   /protein_id="CAB94276.1"
FT                   /translation="MREPKNAKVLSRLENVLVTQLDVNNFSSIKKSVEKAISHFGRIDV
FT                   LLNNAGYSVYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFRSQHNGMIINVSSIGG
FT                   KMTFPLGCLYYGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATEFRVEEGAGKHYAE
FT                   YDNLKQKLYEDLLPKLKTATPPQKIAEVILQAATDESDELRYPTGDYVVEWMALRSKVD
FT                   DATFLATHRKQMGL"
FT   3'UTR           complement(26155..26286)
FT                   /locus_tag="SPBC1348.10c"
FT   CDS_pept        complement(join(26287..26355,26420..28372))
FT                   /transl_table=1
FT                   /locus_tag="SPBC1348.10c"
FT                   /product="phospholipase (predicted)"
FT                   /db_xref="GOA:P0CU03"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU03"
FT                   /protein_id="CAB94277.1"
FT                   /translation="MYVNYIGLFAFVQISLTLAYPPGRVEISEIYDFEESSSYKGQDID
FT                   TSVLYTLSKRKPALVKRSTDASYAPFNVTCSNDNLLRPASEGLNEGEQSYINKRISKVN
FT                   SELRSFISKTGLNVDLDKVVNSSDGPRLGIAFSGGGLRAMVNGGGAFNAFDSRFESDSP
FT                   LSGLLQSAMYISGLSGGSWLVGSVAINNFTNITYLRDNVWNLEHSVFAPHGDNVIENLN
FT                   YYNDLRKEIDQKKHAGFDCSLTDLWGRALSRKLVDAERGGPGITYSSMRNQSWFQNADY
FT                   PYPIIVADSRLEEETAIPANTSIFEFTAYEFGTWDNGIKAFIPMEYVGTHLLDGVPPDK
FT                   SCIHNYDNAGFVMGTSATLFNSFLLDWNENVKKNDTYYDILHAILEDLSKHQDDIAPYP
FT                   NPYQNYTTSNTSVVNAFEPYDTIDLVDGGEDRENIPLWPLLHPQRFVDVVFAIDSTYND
FT                   PYGWPLGSSIVATYERVVTFNANKSVDVRGFPYIPDENTIISLGLNTRPTFFGCDGKNT
FT                   TAGNHDVDNNTPPLLVYFPNYPWTYYSNISTFTMSMDDKMANGILENAFMSTTQNNNES
FT                   FAVCLACAIIQRSLERKKLSTPTQCSSCFQEYCWDGTLATSTASVYDPTVMSAATTSRA
FT                   PSGTTSGTASSTTSSSVASATPTHKHWWDSIFEAKENP"
FT   intron          complement(26356..26419)
FT                   /locus_tag="SPBC1348.10c"
FT   5'UTR           complement(28373..28576)
FT                   /locus_tag="SPBC1348.10c"
FT   misc_RNA        28624..28796
FT                   /gene="prl11"
FT                   /locus_tag="SPNCRNA.11"
FT                   /product="non-coding RNA, poly(A)-bearing (predicted)"
FT   CDS_pept        join(33231..33602,33608..34291,34295..34780)
FT                   /pseudo
FT                   /transl_table=1
FT                   /gene_synonym="SPAC1348.11"
FT                   /locus_tag="SPBC1348.11"
FT                   /product="membrane transporter, pseudogene"
FT                   /db_xref="PSEUDO:CAO77653.2"
FT   CDS_pept        join(35112..35171,35211..35612,35748..35883,35928..36125,
FT                   36234..36589)
FT                   /transl_table=1
FT                   /gene_synonym="SPAC1348.12"
FT                   /locus_tag="SPBC1348.12"
FT                   /product="zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.12.1"
FT                   /db_xref="GOA:G2TRT1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="InterPro:IPR040331"
FT                   /db_xref="PomBase:SPBC1348.12"
FT                   /db_xref="PomBase:SPBC1348.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRT1"
FT                   /protein_id="CAO77654.2"
FT                   /translation="MHLSKASFLFDCSRFILNFHERCLKNGVRTKKACVICRSKKQKCD
FT                   GQLPCLYCKKYEYQCAYEGQATSTCNSEASLFNDANFKIGSDYRSKRIKVVSDTNNNKE
FT                   DGDGKLSFTQCNPRMDIHHEAENFTAMVPYYEPKKFRFFYENSAIVFPRIYVFIYFEEV
FT                   HPIFSMFDQKAMEKKIQFLWDNKSTDSCSEYVVISVKGKLVEHITQVLESSLSTTILSS
FT                   IQLTVCWVLRTIYLHATTRPHLSWIASSVSMHYAEIVGLHQEITAEYGTRGIELTNITT
FT                   QMVEEDGPAYQLVLLFKIIMEYQIISEDSRFVYLQAFQRLDQLCDIHSPALVLLKATVC
FT                   FHLYRNLFLARIKPFCVIVSILFSVIDRALESCKQLVSQRKAW"
FT   CDS_pept        36892..37188
FT                   /transl_table=1
FT                   /gene_synonym="SPAC1348.13"
FT                   /locus_tag="SPBC1348.13"
FT                   /product="similar to fragment of cox1 intron protein"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS8"
FT                   /protein_id="CAO77655.2"
FT                   /translation="MFDFGIVRKIKDKNAILFIIANSKGIERVITLINNKFRTTSKYNQ
FT                   IINNIFAQPRFKEFSKTINLSLNTFQLSVLNNHWLAGFSDADASFQIKILNRD"
FT   3'UTR           complement(38514..38586)
FT                   /gene="ght7"
FT                   /gene_synonym="SPBPB8B6.01c"
FT                   /locus_tag="SPBC1348.14c"
FT   CDS_pept        complement(38587..40143)
FT                   /transl_table=1
FT                   /gene="ght7"
FT                   /gene_synonym="SPBPB8B6.01c"
FT                   /locus_tag="SPBC1348.14c"
FT                   /product="hexose transporter Ght7 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1348.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1348.14c.1"
FT                   /db_xref="GOA:Q8TFG1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1348.14c"
FT                   /db_xref="PomBase:SPBC1348.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TFG1"
FT                   /protein_id="CAD27907.1"
FT                   /translation="MRDFQSRFADRYNQITNSYSYSSSRQGLITGMVNVGSFFGCLLSS
FT                   PVADKIGKRLSIIVWTTVYLIGIIIQVTTVPSWVQILVAKIWTGLSIGALSVITPGYQS
FT                   EVAPAIMRGAIVTTYQLFITLGIFIAACINMGTHKYSHGTTAQWRISIGINLLWGIITL
FT                   VGIIFLPESPRYLIAIGKDDEALKIMCYNNDLPLEHEIIQTEYHTIKSDCDAELAGGPA
FT                   RWPEIFNANIRYRTFLGMAVMMFQQLTGANYYFYYGTQVFRGTGMDSPYLAALIPDAVN
FT                   CGCTFGAIFVLEFFGRRSPLIVGGIWQYICFFIYAAVGDRALYHKNGTSNHRAGAVMIV
FT                   FSCLFIFSFSQTWAPAAYVIVGESYPVRYRSKCAAVATSANWFWNFLISFFTPFITNSI
FT                   GFKYGYIFASCNLTGAAIIFLFVHETKGRTLEEINTMYASNLKPWMPHPEGYREFGREQ
FT                   NNATLKSHIGLNGETTELIENTDNQGDSGSFQTSTPDDSRPEQNQASATYIRPDKREPR
FT                   L"
FT   5'UTR           complement(40144..40277)
FT                   /gene="ght7"
FT                   /gene_synonym="SPBPB8B6.01c"
FT                   /locus_tag="SPBC1348.14c"
FT   3'UTR           complement(44694..44809)
FT                   /locus_tag="SPBPB8B6.02c"
FT   CDS_pept        complement(44810..46831)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB8B6.02c"
FT                   /product="urea transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB8B6.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB8B6.02c.1"
FT                   /db_xref="GOA:Q8TFG0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR031155"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="PomBase:SPBPB8B6.02c"
FT                   /db_xref="PomBase:SPBPB8B6.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TFG0"
FT                   /protein_id="CAD27908.1"
FT                   /translation="MEPILNQGYGYGFALGLGAAFALLMAIITKVLTACMGQTQNSERF
FT                   STASRSVKSGLISSSTVSAWTWPATLLSSGAWSYTYGIMGGFMYGVGGTIQITLFLFLA
FT                   IQIKKKAPAAHTVSECFFIRFGKLGHCVYLFYCISTNVLVSSLLLLGGSQGFSSTTGMN
FT                   TVAACFLLPLGVMVYTTLGGLKATFISDWIHTVMIYIILIVTCYTVYCSSSLIGSPAKM
FT                   YDMLKEVQEVYPATGGQSYLSFKNSEMMYLTWSVMIGGLSSVFGDPGYSQRAIASDAKS
FT                   VFQGYLMGGLCWWIIPMALGSSAGLACRALLLNPASVTYPNVLSSVEISSGLPVIYGMA
FT                   SIFGKSGAAAGLVMLFMSITSATSAELIAFSSVTTYDIFRAYINPAANGKQLVRTAHLS
FT                   VIGFSLFIGALSVGFNYAGVTAGWLLTFLGIILTPEVSAVTLCLFWNKMTRFSLVVGAP
FT                   FGTITGVVCWLASTYSFCDGIVNKDTVMTSKACFVGNIVSMASSPLYIVLLSYIWPDKE
FT                   TFDLNQFRNITVGDDIDTTELNAIVSQLKDERILKLQTYWSIGINLFILIGCYVIIPTA
FT                   LLGSNHDLSKSSFSGLIIVCLIWILVAAIYIILFPLWQGRKSLANVISHIIRLKAPENI
FT                   LLDGLTPKQSSEDVGDATSFHMDKLDKEKEKSSELKTA"
FT   5'UTR           complement(46832..46836)
FT                   /locus_tag="SPBPB8B6.02c"
FT   5'UTR           47056..47427
FT                   /locus_tag="SPBPB8B6.03"
FT   3'UTR           complement(47369..49142)
FT                   /gene="grt1"
FT                   /gene_synonym="SPAPB8B6.04c"
FT                   /locus_tag="SPBPB8B6.04c"
FT   CDS_pept        47428..49071
FT                   /transl_table=1
FT                   /locus_tag="SPBPB8B6.03"
FT                   /product="acetamidase (predicted)"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB8B6.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB8B6.03.1"
FT                   /db_xref="GOA:Q8TFF9"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="PomBase:SPBPB8B6.03"
FT                   /db_xref="PomBase:SPBPB8B6.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TFF9"
FT                   /protein_id="CAD27909.1"
FT                   /translation="MDTPTWEVVAALKRNQVLNSIPKEWRKPNIRKEMISSGYVNTYEY
FT                   LNLILPPEENAITNLSMLELATNIAKGNYTSYNVTKAFCHRAALAHQILNCCIEIFFDE
FT                   ALKKAKELDDVFQKTSKVVGPFHGIPISLKDQVDLPGKDSSIGYVSLVGKPKTEIALLA
FT                   KILQDKGAIFYVKTTVPMAMMAPQTVSNLHGYTYNALNINLSSGGSSGGEGALLGSGAS
FT                   CCGIGTDIGGSIRIPSCFQGLYALKPSTGRISYLNVTNSYSGQELIPSVIGPMARSLKD
FT                   IEFFTETVIASEAWKIDSKLLPIPWKNQSHLKSKKLIFGVLKTDGIVKPHPPIIRALNE
FT                   VVAVLEKSGYEVIEISIPFQKDMLDTVVKVFSADARFEINNESQKTGEPVVSVVKRFVS
FT                   DKIFKKPITVNEWWDLGNQVYKIRQMFLELWNNTAIQTLSGNSIDAIIAPIWASTSFLP
FT                   ESKADHLYTSLFNICDCPCVVFPFTKVDANIDLSDVSYKPLNEEDKENNDMYDPVLFDN
FT                   MPVCLQVVTKKLEEEKCLAAASSIMDCLTN"
FT   CDS_pept        complement(join(49143..50910,50953..51062,51113..51181))
FT                   /transl_table=1
FT                   /gene="grt1"
FT                   /gene_synonym="SPAPB8B6.04c"
FT                   /locus_tag="SPBPB8B6.04c"
FT                   /product="transcription factor Grt1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB8B6.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB8B6.04c.1"
FT                   /db_xref="GOA:Q9C469"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPBPB8B6.04c"
FT                   /db_xref="PomBase:SPBPB8B6.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C469"
FT                   /protein_id="CAD27910.1"
FT                   /translation="MVLSKRPVRISKACENCRKRKVKCSGGDVCFECQKYNENCVYRQF
FT                   YRKIKRLKYNNDNSKIDNFSNEQMNIPEFISVRNLNDDSSSIEFFGPASNISFVNQLNH
FT                   YLRKAERNGYDFLSEGQNDITPEEERKGLEKFGMKLMVLKDNANNFDFSLSNITTEKMN
FT                   GLLIAYLETWHIPCPIFKAEDLFNLSVRTWKNPSASVHDKALLYLILSIGSAASYFDLQ
FT                   SNSSTLPLARGFFNLALRTVPHIFTELSLDAIRIVFFMSVSAGNLGDTALSYLYSGTAV
FT                   RMSLAIGLHKCKNFSNDLSDKYQNIRLWVSVWQWEGYWSFCVGRPSCSRQDIPIPAVPN
FT                   EAFSFSGYGEHGRFLINHEHMRLRVFFSSCCSKIQSEIYSTNRNLLSVLQTVEQISKEV
FT                   DKEYFSSTNHQLIRSEIGEYCKTLDINSCREWFWIRIYYLYLKLMIFRPFLIFLAYVNI
FT                   SKTSAPDDIIEGLKRGSDQCVQEAIDISKFIVQLNRKVRMLQPIFFICTYLESACTVLL
FT                   FYIASNSAKIQGQLATEIWAVLRDTCSFLQGSSGPYVGSVSTIAKDALESLNNILVSKK
FT                   YQDNSVNNTYFDKVMQHVLVHSPAFDDSSDPKFETNRSETPTQYTLDDSANDELMIPDL
FT                   QGFWEQTLDWINN"
FT   misc_RNA        50110..52193
FT                   /locus_tag="SPNCRNA.1301"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(51182..51220)
FT                   /gene="grt1"
FT                   /gene_synonym="SPAPB8B6.04c"
FT                   /locus_tag="SPBPB8B6.04c"
FT   repeat_region   complement(54135..56795)
FT   3'UTR           complement(54322..54496)
FT                   /locus_tag="SPBPB8B6.05c"
FT   CDS_pept        complement(54497..55567)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB8B6.05c"
FT                   /product="L-asparaginase (predicted)"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB8B6.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB8B6.05c.1"
FT                   /db_xref="GOA:Q8TFF8"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="PomBase:SPBPB8B6.05c"
FT                   /db_xref="PomBase:SPBPB8B6.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TFF8"
FT                   /protein_id="CAD27911.1"
FT                   /translation="MWGFIVTCGIFLVLLCQLRLLSKRKSKSTPYNALLPNVTVFAMGG
FT                   TIAGCANSSLEIVNYIPGSVGIEKLIEAVPAIKAIANINGVQVTNMGSENLTPADVLKL
FT                   AKLILAEVAKPNVHGIVITHGTDSLEETAMFLDLTISTAKPIVVVGAMRPSTAIGADGP
FT                   MNLLNAVAVASSNQSMGRGTLVLLNDRIGSAFYTTKTNGNTLDTFKSYEAGSLGIVLNQ
FT                   KPFYFFSPAVPTGKVFFDIYNIKQLPRVDILYGYQGLNPKLAESAVHLGAKGLVLAAMG
FT                   ATSWTDDGNEVISSLIREHNIPVVYSHRTAEGYSSNSCLGIPSYFLNPQKARYMLMLAI
FT                   SSGYSIRDIEGLFSIK"
FT   5'UTR           complement(55568..55582)
FT                   /locus_tag="SPBPB8B6.05c"
FT   3'UTR           complement(55751..55849)
FT                   /locus_tag="SPBPB8B6.06c"
FT   CDS_pept        complement(55850..56785)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB8B6.06c"
FT                   /product="CRCB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB8B6.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB8B6.06c.1"
FT                   /db_xref="GOA:P0CU20"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="PomBase:SPBPB8B6.06c"
FT                   /db_xref="PomBase:SPBPB8B6.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CU20"
FT                   /protein_id="CAD27912.1"
FT                   /translation="MLLTQSYFCIMSMLGTLARLGLTALNTYPGAPFSGLLWVQFVGCV
FT                   IMGFCQTESVFFPRPKHNATFLLAITTGFCGSLTTFSSWMLQMFTGMANLDPFERRGRG
FT                   YSFLSVVSDFMVTMCIAMSSLIWGKQIGKTTGQWRIGKVAFAWPIPAHTHIVVRVLLLL
FT                   LSICFFVGAAFYTAYTTNVTHRGIGFSLIFSPFAALTRLYLARFLNSPQYFIPYGTLCA
FT                   NVFATLLLSIMYMIPQITHCTPVSRSVMYGIQNGFCAVLSTLSTFSNELHTMPIKRAYI
FT                   YCIISVAISFSICVIVDGATAWGHGYTEKY"
FT   5'UTR           complement(56786..57113)
FT                   /locus_tag="SPBPB8B6.06c"
FT   repeat_region   complement(56925..57077)
FT   repeat_region   complement(57151..57483)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(57604..57821)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   3'UTR           complement(58136..58323)
FT                   /gene="eno102"
FT                   /gene_synonym="eno1"
FT                   /gene_synonym="SPBPB8B6.07c"
FT                   /locus_tag="SPBPB21E7.01c"
FT   CDS_pept        complement(58324..59646)
FT                   /transl_table=1
FT                   /gene="eno102"
FT                   /gene_synonym="eno1"
FT                   /gene_synonym="SPBPB8B6.07c"
FT                   /locus_tag="SPBPB21E7.01c"
FT                   /product="enolase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.01c.1"
FT                   /db_xref="GOA:Q8NKC2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PomBase:SPBPB21E7.01c"
FT                   /db_xref="PomBase:SPBPB21E7.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NKC2"
FT                   /protein_id="CAD27913.2"
FT                   /translation="MTTIQKIYSRSIYDSRGNPTVEVELTTELGTFRSMVPSGASTGEW
FT                   EAKELRDNDKNKWGGKGVTIAVHNVNNIIGPALVKSDIKITDQRGIDEFMIKLDGTNDK
FT                   SKLGANSIVGVSMAVARAAAAFLKIPLYEYIGKLAGSKTTECIPVPSFNVLNGGRHAGG
FT                   DLAFQEFMIMPIKAPTFSEGLRWGSEVYHTLKALAKKKYGASAGNVGDEGGIAPDLTTA
FT                   EEALDLVNEAIKEAGYDGKVKIGFDVAASELYNGKLYDLDFKSEHPKPENKLDYKKLYE
FT                   KYSALIEKYPIVFIEDPFSEEDWGAFSYMSSKTKVEVIADDLTVTNVKRLSKAIELKCA
FT                   NALLVKINQIGSLSETIDAANMAKKAGWGLMVSHRSGETDDSFIAHLAVGLEAGQMKSG
FT                   APCRSERLAKYNELLRIEDNLGDSAIYAGTRAADYIKSNTL"
FT   misc_RNA        58453..59684
FT                   /locus_tag="SPNCRNA.1302"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(59647..59704)
FT                   /gene="eno102"
FT                   /gene_synonym="eno1"
FT                   /gene_synonym="SPBPB8B6.07c"
FT                   /locus_tag="SPBPB21E7.01c"
FT   CDS_pept        complement(join(60553..61107,61119..61205))
FT                   /transl_table=1
FT                   /gene_synonym="SPAPB21E7.02c"
FT                   /locus_tag="SPBPB21E7.02c"
FT                   /product="phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.02c.1"
FT                   /db_xref="GOA:U3H041"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PomBase:SPBPB21E7.02c"
FT                   /db_xref="PomBase:SPBPB21E7.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:U3H041"
FT                   /protein_id="CAO77656.1"
FT                   /translation="MDKNLEEKVIWLVRHAQAEHNVGPPGNHRRINQVGIKQWEALHNW
FT                   LVDNPIPIDVIVCSPLRRTLQTMEISFKSYIHKELPVPIKISPLFEESGNWPCDCAMDL
FT                   SSTEKLFPDYDFSSCYDDIYPLRRGLYGTTYDENYCRAQKPLKHLASLHEKNIVVVTHS
FT                   VYLRFLLREQRPEDNMNFMPPEKVFRNCEIRKYNLCHTGFQWELIPLIDN"
FT   5'UTR           61362..61495
FT                   /locus_tag="SPBPB21E7.10"
FT   CDS_pept        join(61496..61526,61632..61855)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB21E7.10"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.10.1"
FT                   /db_xref="GOA:G2TRR8"
FT                   /db_xref="PomBase:SPBPB21E7.10"
FT                   /db_xref="PomBase:SPBPB21E7.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRR8"
FT                   /protein_id="CCD31349.1"
FT                   /translation="MQKLNKSSSKGKNNIETEEAEDSAGRGSTYGFGPYGGGGFSSKSS
FT                   GEEATTGDTKKLKGEVEEGTGKLLHSKKLVDKGERKESE"
FT   3'UTR           complement(61526..62255)
FT                   /locus_tag="SPBPB21E7.11"
FT   3'UTR           61856..62126
FT                   /locus_tag="SPBPB21E7.10"
FT   CDS_pept        complement(join(62256..62449,62598..62885,62944..62956))
FT                   /transl_table=1
FT                   /locus_tag="SPBPB21E7.11"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.11.1"
FT                   /db_xref="GOA:G2TRR9"
FT                   /db_xref="PomBase:SPBPB21E7.11"
FT                   /db_xref="PomBase:SPBPB21E7.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRR9"
FT                   /protein_id="CCD31350.1"
FT                   /translation="MLCVRSSSSNLESDTYLSRYSTRASAGTGSTYGFGLAGDRGYSSD
FT                   SSSSSSESKPSNNKNIDFIYNNNAESNLSEYLGKDIPEDLSGFRDTASAPDTQSDVRNC
FT                   DSIRKYQSLSSAGSGSTYGYGAGGNRGFMDESNESPKEDYINQKKHSKLFLLLYRIFHL
FT                   I"
FT   5'UTR           complement(62957..63086)
FT                   /locus_tag="SPBPB21E7.11"
FT   repeat_region   63206..63538
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        63602..64286
FT                   /locus_tag="SPNCRNA.1303"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        63695..64021
FT                   /gene_synonym="SPNG1100"
FT                   /locus_tag="SPNCRNA.289"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(64487..64668)
FT                   /locus_tag="SPBPB21E7.04c"
FT   CDS_pept        complement(64669..65514)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB21E7.04c"
FT                   /product="human COMT ortholog 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.04c.1"
FT                   /db_xref="GOA:Q8NKC1"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PomBase:SPBPB21E7.04c"
FT                   /db_xref="PomBase:SPBPB21E7.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NKC1"
FT                   /protein_id="CAD31744.1"
FT                   /translation="MFAQALHWLTTSKLRYALALPFLFFILYTKTKKSKEQELENYIFS
FT                   LPREKLDQIRGKPDEVINVIDEYVEQGHFLMNIGKLKGKIISEKIQQVKPKVMIELGGY
FT                   VGYSAILFGKQLTDPSAHYYSLEVNPKFAKIASKIIDLAGLSNKVTIIVGKATDSLVEL
FT                   RRSLPNVIPSFEYLDFVFIDHWKDLYVPDLRVMETLDLIGQGSIIAADNILRPGVPEYV
FT                   KYVQGSLDYRKEYDSTVSNVNGPQFIGKWNIIYKSKTIKVDDGKREKDAVEITEYIEAK
FT                   "
FT   misc_RNA        65390..66274
FT                   /locus_tag="SPNCRNA.1304"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           complement(65515..65620)
FT                   /locus_tag="SPBPB21E7.04c"
FT   CDS_pept        66842..67225
FT                   /transl_table=1
FT                   /locus_tag="SPBPB21E7.05"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.05.1"
FT                   /db_xref="GOA:Q8NIL4"
FT                   /db_xref="PomBase:SPBPB21E7.05"
FT                   /db_xref="PomBase:SPBPB21E7.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NIL4"
FT                   /protein_id="CAD31745.1"
FT                   /translation="MVKKFQSKLINLQFNIILTFFVYEWNHDITCLNFKVKKRRGDFYV
FT                   INERFFIKYIIKKNKNPQNLTKSICNSKTSINSMRQYLATINKKLRAFVQTFLAIGGYY
FT                   SITTQIVKIILITHPVLLCQCSS"
FT   CDS_pept        68355..68852
FT                   /pseudo
FT                   /transl_table=1
FT                   /gene_synonym="SPAPB21E7.06"
FT                   /locus_tag="SPBPB21E7.06"
FT                   /product="pseudogene"
FT   5'UTR           70156..70203
FT                   /gene="aes1"
FT                   /gene_synonym="SPAPB21E7.07"
FT                   /locus_tag="SPBPB21E7.07"
FT   CDS_pept        70204..71094
FT                   /transl_table=1
FT                   /gene="aes1"
FT                   /gene_synonym="SPAPB21E7.07"
FT                   /locus_tag="SPBPB21E7.07"
FT                   /product="enhancer of RNA-mediated gene silencing"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.07.1"
FT                   /db_xref="GOA:Q8NIL3"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="PomBase:SPBPB21E7.07"
FT                   /db_xref="PomBase:SPBPB21E7.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NIL3"
FT                   /protein_id="CAD31747.1"
FT                   /translation="MTEHSFKQIDVFSNKGFRGNPVAVFFDADNLSQKEMQQIAKWTNL
FT                   SETTFVQKPTIDKADYRLRIFTPECELSFAGHPTIGSCFAVVESGYCTPKNCKIIQECL
FT                   AGLVELTIDGEKDEDTWISFKLPYYKILQTSETAISEVENALGIPLNYSSQVSPPVLID
FT                   DGPKWLVIQLPNATDVLNLVPKFQSLSQVCKNNDWIGVTVFGELGKDSFESRSFAPLIH
FT                   VNEDPACGSGAGAVGVYIGSSQKTPTSLSFTISQGTKLSRQAISKVSVDVSSNKSIAVF
FT                   VGGQAKTCISGKSFI"
FT   3'UTR           71095..71310
FT                   /gene="aes1"
FT                   /gene_synonym="SPAPB21E7.07"
FT                   /locus_tag="SPBPB21E7.07"
FT   misc_RNA        complement(71485..73328)
FT                   /locus_tag="SPNCRNA.1305"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           72081..72344
FT                   /gene_synonym="SPAPB21E7.08"
FT                   /locus_tag="SPBPB21E7.08"
FT   CDS_pept        join(72345..72612,72615..73117,73136..73390)
FT                   /pseudo
FT                   /transl_table=1
FT                   /gene_synonym="SPAPB21E7.08"
FT                   /locus_tag="SPBPB21E7.08"
FT                   /product="pseudogene"
FT   5'UTR           75073..76317
FT                   /gene_synonym="SPAPB21E7.09"
FT                   /locus_tag="SPBPB21E7.09"
FT   CDS_pept        76318..77400
FT                   /transl_table=1
FT                   /gene_synonym="SPAPB21E7.09"
FT                   /locus_tag="SPBPB21E7.09"
FT                   /product="L-asparaginase (predicted)"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB21E7.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB21E7.09.1"
FT                   /db_xref="GOA:Q8NKC0"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="PomBase:SPBPB21E7.09"
FT                   /db_xref="PomBase:SPBPB21E7.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NKC0"
FT                   /protein_id="CAD31749.1"
FT                   /translation="MWSSIISFLFFSVALCQPLLFQKRSSNVSDFISFNASLPNVTIFA
FT                   MGGTIAGYASSSTETVDYAAGSVGIATLVDAVPAIKNFSNIRGVQVTNVGSEELTPANV
FT                   LNLTQLILAEVAKPDVHGIVVTHGTDSLEETAIFLDMTVNTTKPIVVVGAMRPSTAISA
FT                   DGPMNLLNAVVVAASNRSIGRGTMILLNDRIGSAFYTTKTNGNMLDTFKSYEAGFLGMI
FT                   LDQRPHFFYSPATPTGKVHFDVSNTTELPAVEILYGYQGLNPNLAKAAVDLGAKGLVLA
FT                   GMGAASWTDPGNEVIDGLISNQSIPVVYSHRTMDGFSDYYYNGIPAYFQNPQKARYMLM
FT                   LSINAGYSIQNITDIFSLEY"
FT   3'UTR           77401..77625
FT                   /gene_synonym="SPAPB21E7.09"
FT                   /locus_tag="SPBPB21E7.09"
FT   misc_RNA        complement(78958..80201)
FT                   /locus_tag="SPNCRNA.1306"
FT                   /product="intergenic RNA (predicted)"
FT   gap             80202..80301
FT                   /estimated_length=unknown
FT   5'UTR           80899..81294
FT                   /locus_tag="SPBPB10D8.01"
FT   CDS_pept        81295..82953
FT                   /transl_table=1
FT                   /locus_tag="SPBPB10D8.01"
FT                   /product="cysteine transporter (predicted)"
FT                   /db_xref="GOA:Q9C0V8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0V8"
FT                   /protein_id="CAC36910.1"
FT                   /translation="MPQPSYADQINVEDSSDYEKDPKEYVDKEKGYFPHVITSHISKSS
FT                   SQSHPDVSNAVLDETFSFMQEAKDLEPLTPKQDKRLRWKLYFTVLVMLMILDMMLYIDK
FT                   ATLSYSSILGLFEDTHINSNQYNDINTLFYVGFVIGQIPGHMLLQRFPVSKFVAASTAL
FT                   WTIIIFLHCAAYNFSGLMALRFFLGLVESSLLPTMEATIGMFFPHSEQALLQPFFYISC
FT                   YGCNIPAGFIAYGVQYAKNTISPWKLFMIIVGGITFFLTIGLFFYYPDNTSTARFLTKK
FT                   ERLYTVDRVRRSNHSGIESKTFKKYQVIEALKDPVTWLFTFHVFCNQLSNNLAYQQNLL
FT                   FTSLNVSDLNSTLVGVASAGYNCVSAIIATYMMSVIKNQSAFHGAIWYIPSIAGGIACV
FT                   AMSWDHKIGELAAIIIASNFGIPFIISLGWTTASCAGYTKKLTRGVMFMIGYAIANIIG
FT                   PQMWQSRDAPRYYPAWIVQIVIAWSVSPFVLLIIRWILVRRNKKRLALLEQNKEQYEKT
FT                   WIETIDSSGNHVSGFYENSMLDLTDQENLSFIYPL"
FT   3'UTR           82954..83357
FT                   /locus_tag="SPBPB10D8.01"
FT   3'UTR           complement(83229..83766)
FT                   /locus_tag="SPBPB10D8.02c"
FT   CDS_pept        complement(83767..85431)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB10D8.02c"
FT                   /product="arylsulfatase (predicted)"
FT                   /EC_number="3.1.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB10D8.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB10D8.02c.1"
FT                   /db_xref="GOA:Q9C0V7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="PomBase:SPBPB10D8.02c"
FT                   /db_xref="PomBase:SPBPB10D8.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0V7"
FT                   /protein_id="CAC36911.1"
FT                   /translation="MAFNKQAESKKPNFLVIVADDLGWSDVSPFGSEIHTPNIERLAKE
FT                   GVRLTNFHTASACSPTRSMLLSGTDNHIAGLGQMAETVRRFSKVWGGKPGYEGYLNDRV
FT                   AALPEILQEAGYYTTMSGKWHLGLTPDRYPSKRGFKESFALLPGGGNHFAYEPGTRENP
FT                   AVPFLPPLYTHNHDPVDHKSLKNFYSSNYFAEKLIDQLKNREKSQSFFAYLPFTAPHWP
FT                   LQSPKEYINKYRGRYSEGPDVLRKNRLQAQKDLGLIPENVIPAPVDGMGTKSWDELTTE
FT                   EKEFSARTMEVYAAMVELLDLNIGRVIDYLKTIGELDNTFVIFMSDNGAEGSVLEAIPV
FT                   LSTKPPVKYFDNSLENLGNYNSFIWYGPRWAQAATAPSRLSKGFITEGGIRCPAIIRYP
FT                   PLIKPDIISDEFVTVMDILPTILELAEVPHPGHKFQGRDVVIPRGKPWIDHFVHGKPVH
FT                   KDTDFSGWELFGQRAIRKGNYKAIYVPKEGIKTEWELYDLSQDKGELENLAKVHPDILN
FT                   ELIEYWLVYEAETGVVTAPDDFVAENVGLFKPAKHNL"
FT   misc_RNA        83799..85528
FT                   /locus_tag="SPNCRNA.1307"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(85432..85631)
FT                   /locus_tag="SPBPB10D8.02c"
FT   CDS_pept        join(87727..88101,88103..89029)
FT                   /pseudo
FT                   /transl_table=1
FT                   /locus_tag="SPBPB10D8.03"
FT                   /product="pseudogene transporter"
FT   3'UTR           complement(91376..91723)
FT                   /locus_tag="SPBPB10D8.04c"
FT   CDS_pept        complement(91724..92863)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB10D8.04c"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="GOA:P0CT94"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT94"
FT                   /protein_id="CAC36913.1"
FT                   /translation="MSWFYRFFIRDYQNCWMVSIMGTGLSANVLHNFPFAARWLRICSY
FT                   IMFGFALVCLFTNTIVFFFKHTIYRGTLIQKEEFIDVPNTLFLGCYTMGFQSCINMLCF
FT                   LSSQSSPQGWINFLYILWIFSVAMSFFTAWVIFSTILTKRAKIEFSTFLPTILLPIVPL
FT                   TVAASTGSVVIETFSTRLNKKIILNTIVTSFICWSNAIALGFCIIACILWRMIFFKVPA
FT                   RALIFTQFVPIGVLGQGAFGIIMQAINAKTFALSYYQQIPMIEFYSNCVLVQSLILSLF
FT                   LISFGYFFTFFAVFSVINYGFRHKFTVAWWAMTFPLGTMSISNTQLSKVTNIIFFRVIG
FT                   AIYGTALILITIVCIVGNTIMAIQKLKSETSSKNLVGII"
FT   repeat_region   complement(93517..93860)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   CDS_pept        complement(94483..95622)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB10D8.05c"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="GOA:P0CT95"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT95"
FT                   /protein_id="CAC36914.1"
FT                   /translation="MSWFYRFFIRDYQNCWMVSIMGTGLSANVLHNFPFAARWLRICSY
FT                   IMFGFALVCLFTNTIVFFFKHTIYRGTLIQKEEFIDVPNTLFLGCYTMGFQSCINMLCF
FT                   LSSQSSPQGWINFLYILWIFSVAMSFFTAWVIFSTILTKRAKIEFSTFLPTILLPIVPL
FT                   TVAASTGSVVIETFSTRLNKKIILNTIVTSFICWSNAIALGFCIIACILWRMIFFKVPA
FT                   RALIFTQFVPIGVLGQGAFGIIMQAINAKTFALSYYQQIPMIEFYSNCVLVQSLILSLF
FT                   LISFGYFFTFFAVFSVINYGFRHKFTVAWWAMTFPLGTMSISNTQLSKVTNIIFFRVIG
FT                   AIYGTALILITIVCIVGNTIMAIQKLKSETSSKNLVGII"
FT   5'UTR           complement(95623..95739)
FT                   /locus_tag="SPBPB10D8.05c"
FT   repeat_region   complement(96276..96619)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   CDS_pept        complement(97242..98381)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB10D8.06c"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="GOA:P0CT96"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT96"
FT                   /protein_id="CAC36915.1"
FT                   /translation="MSWFYRFFIRDYQNCWMVSIMGTGLSANVLHNFPFAARWLRICSY
FT                   IMFGFALVCLFTNTIVFFFKHTIYRGTLIQKEEFIDVPNTLFLGCYTMGFQSCINMLCF
FT                   LSSQSSPQGWINFLYILWIFSVAMSFFTAWVIFSTILTKRAKIEFSTFLPTILLPIVPL
FT                   TVAASTGSVVIETFSTRLNKKIILNTIVTSFICWSNAIALGFCIIACILWRMIFFKVPA
FT                   RALIFTQFVPIGVLGQGAFGIIMQAINAKTFALSYYQQIPMIEFYSNCVLVQSLILSLF
FT                   LISFGYFFTFFAVFSVINYGFRHKFTVAWWAMTFPLGTMSISNTQLSKVTNIIFFRVIG
FT                   AIYGTALILITIVCIVGNTIMAIQKLKSETSSKNLVGII"
FT   5'UTR           complement(98382..98534)
FT                   /locus_tag="SPBPB10D8.06c"
FT   repeat_region   complement(99035..99378)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   3'UTR           complement(99860..100000)
FT                   /locus_tag="SPBPB10D8.07c"
FT   CDS_pept        complement(100001..101140)
FT                   /transl_table=1
FT                   /locus_tag="SPBPB10D8.07c"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB10D8.04c"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB10D8.05c"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB10D8.06c"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPB10D8.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB10D8.04c.1"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB10D8.05c.1"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB10D8.06c.1"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPB10D8.07c.1"
FT                   /db_xref="GOA:P0CT97"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="PomBase:SPBPB10D8.04c"
FT                   /db_xref="PomBase:SPBPB10D8.04c.1"
FT                   /db_xref="PomBase:SPBPB10D8.05c"
FT                   /db_xref="PomBase:SPBPB10D8.05c.1"
FT                   /db_xref="PomBase:SPBPB10D8.06c"
FT                   /db_xref="PomBase:SPBPB10D8.06c.1"
FT                   /db_xref="PomBase:SPBPB10D8.07c"
FT                   /db_xref="PomBase:SPBPB10D8.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT97"
FT                   /protein_id="CAC36916.1"
FT                   /translation="MSWFYRFFIRDYQNCWMVSIMGTGLSANVLHNFPFAARWLRICSY
FT                   IMFGFALVCLFTNTIVFFFKHTIYRGTLIQKEEFIDVPNTLFLGCYTMGFQSCINMLCF
FT                   LSSQSSPQGWINFLYILWIFSVAMSFFTAWVIFSTILTKRAKIEFSTFLPTILLPIVPL
FT                   TVAASTGSVVIETFSTRLNKKIILNTIVTSFICWSNAIALGFCIIACILWRMIFFKVPA
FT                   RALIFTQFVPIGVLGQGAFGIIMQAINAKTFALSYYQQIPMIEFYSNCVLVQSLILSLF
FT                   LISFGYFFTFFAVFSVINYGFRHKFTVAWWAMTFPLGTMSISNTQLSKVTNIIFFRVIG
FT                   AIYGTALILITIVCIVGNTIMAIQKLKSETSSKNLVGII"
FT   5'UTR           complement(101141..101411)
FT                   /locus_tag="SPBPB10D8.07c"
FT   repeat_region   complement(101794..102137)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        102509..102673
FT                   /gene_synonym="SPNG1114"
FT                   /locus_tag="SPNCRNA.290"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(103165..104528)
FT                   /locus_tag="SPNCRNA.1308"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        103208..104381
FT                   /gene_synonym="SPNG1116"
FT                   /locus_tag="SPNCRNA.291"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           104609..105127
FT                   /gene_synonym="SPBPB10D8.08"
FT                   /locus_tag="SPBC359.01"
FT   CDS_pept        105128..106873
FT                   /transl_table=1
FT                   /gene_synonym="SPBPB10D8.08"
FT                   /locus_tag="SPBC359.01"
FT                   /product="amino acid permease (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC359.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC359.01.1"
FT                   /db_xref="GOA:Q9P5N4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="PomBase:SPBC359.01"
FT                   /db_xref="PomBase:SPBC359.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P5N4"
FT                   /protein_id="CAC36917.2"
FT                   /translation="MSHSDYNFDIEQNAFEKEAPKVSIERKGDVVEEEVIATGEVENYA
FT                   EPKSRNFLQRFFDDFKPALTTRGDGVALKRKLTSRHMQMISVGGAIGSGLYVGSGSAFA
FT                   DGGPASVIINYILIGIMMIFVIYALGELAIAYPVAGSFNTYATRFIDPAWGFAVSWNYF
FT                   LNYFVTCPLELTTCAITFKFWTEINSAAWISIFLAVVIVINLFGVRAYGEVEFILSTIK
FT                   VIATVGFIILAIIINCGGVPTDHRGYIGGSIIKQKPFRHGFKGFCSVFTTAAFSFSGTE
FT                   IIGLAAAEVGNPRKSVPSAVKQVFWRIAIFYVVSLILIGLLVSPDDPRLMGNGDVSVSP
FT                   FVLAIQEANIKGLPSVFNAVIIISVVSVTNSTTYTAARTLQGMATLKQAPKFFSYTDRV
FT                   GRPLIAMVVVLLFGFFAYINEADKNGSDISDTVFDWLLAISGLSSFFTWGSICLSHIMF
FT                   RLAFKKQGHSLKELGFVSPMGIWGSVIGLGFNILCLMAEFYVSLFLIGGSPNANDFFQG
FT                   YLAACIALAFFIGYKIYDRSHIPSLDKLDIDTGLKTYDNQDEEKEEYSSKGPLNILKKA
FT                   WNAVC"
FT   3'UTR           106874..107221
FT                   /gene_synonym="SPBPB10D8.08"
FT                   /locus_tag="SPBC359.01"
FT   misc_RNA        complement(107514..108774)
FT                   /locus_tag="SPNCRNA.1309"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           107583..107758
FT                   /gene="alr2"
FT                   /locus_tag="SPBC359.02"
FT   CDS_pept        107759..108871
FT                   /transl_table=1
FT                   /gene="alr2"
FT                   /locus_tag="SPBC359.02"
FT                   /product="alanine racemase Alr2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC359.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC359.02.1"
FT                   /db_xref="GOA:Q9P5N3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="PomBase:SPBC359.02"
FT                   /db_xref="PomBase:SPBC359.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P5N3"
FT                   /protein_id="CAB91571.1"
FT                   /translation="MRGARAVIDLRAIGYNYNLIRELLDEKNPDAHILCILKANAYGHG
FT                   AVEVAQFLAKYCSAEGFGVASIEEALELRLSGIQNRILLLEGFFTDEDELSLIDKYNFS
FT                   ITIHCEEQLKSFMNYPFKKPVEVHLKLDSGMNRLGFTPAEYADKYRLLKNHKNVSGIVK
FT                   ATHFAFADIPEKSEYTLKQWRIFEKAAGCLPDPLSAGGGVIVVGWLNTIHMDWLRTGSM
FT                   LYGLDPYDLDAKAPELPKPLIPAMKLMSTIVCVKHVEKDQPIGYGGAYVTTRDSLIGVV
FT                   AIGYGDGFPQVRNGCPVIINGKRVPTVGKVCMDMLAIDVTDVPDVKRGDDVVLWGNPEL
FT                   TIEEVSTFSNENPFEIITGLTRRVPLQYTF"
FT   3'UTR           108872..109353
FT                   /gene="alr2"
FT                   /locus_tag="SPBC359.02"
FT   misc_RNA        complement(109405..109905)
FT                   /locus_tag="SPNCRNA.1310"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(111007..111308)
FT                   /gene="aat1"
FT                   /locus_tag="SPBC359.03c"
FT   CDS_pept        complement(111309..113048)
FT                   /transl_table=1
FT                   /gene="aat1"
FT                   /locus_tag="SPBC359.03c"
FT                   /product="amino acid transporter Aat1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC359.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC359.03c.1"
FT                   /db_xref="GOA:Q9P5N2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="PomBase:SPBC359.03c"
FT                   /db_xref="PomBase:SPBC359.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P5N2"
FT                   /protein_id="CAB91572.1"
FT                   /translation="MSAKDYDFDIESVLPEEKAPQVSEAKKDYISQESTVLSGQVDFVE
FT                   PEHKGFFQNLIDGFKPAREADGNGGPALKRGLSTRHMQLMSIGGAIGSGLYVGSGSALA
FT                   DGGPASVIINYILIGIMMFFVIYALGEMAVAYPVAGSFNTYATRFIDPAWGFAVSWNYF
FT                   FNYFVTFPFELTTCAITFTFWTDVNCAVWISIFLVVVIGINLFGVRVFGEVEFVLALIK
FT                   VVATVGFIILAIIINCGGVPTDHRGYIGGSIIKQKPFRHGFKGFCSVYTTAAFSFSGTE
FT                   IVGLAAAEVGDPRKTLPGAVKQVFWRVAIFYIVSLILIGLLISPDDPKLMGNGSASVSP
FT                   FVLAIQEANIKGLPSVFNAVIIISVISVTNSSTYTAGRTLHGMANLKQAPAFFKYTDRL
FT                   GRPLIAMIVVLSFGFFAYINEANNNGNDISDTVFDWLLAISGLSNFFTWGSICLSHIMF
FT                   RLAFKKQGHSLKELGFVSPMGIWGSVIGLGFNILCLMAEFYVSLFPIGGSPNANDFFQG
FT                   YLAACITLVFFIGYKIYDRSHIPSLDKLDITTGLKTYEYEETKDSSDTGRFRFFKKIIN
FT                   TVC"
FT   5'UTR           complement(113049..113472)
FT                   /gene="aat1"
FT                   /locus_tag="SPBC359.03c"
FT   misc_RNA        114092..114583
FT                   /gene_synonym="SPNG1122"
FT                   /locus_tag="SPNCRNA.292"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(117892..118251)
FT                   /locus_tag="SPBC359.04c"
FT   CDS_pept        complement(118252..119328)
FT                   /transl_table=1
FT                   /locus_tag="SPBC359.04c"
FT                   /product="cell surface glycoprotein (predicted), DIPSY
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC359.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC359.04c.1"
FT                   /db_xref="GOA:Q9P5N1"
FT                   /db_xref="InterPro:IPR021746"
FT                   /db_xref="PomBase:SPBC359.04c"
FT                   /db_xref="PomBase:SPBC359.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P5N1"
FT                   /protein_id="CAB91573.1"
FT                   /translation="MNSLKSLCLKCIVTLCLLVNAFAFDYASLQEQDENLLAACPQYIT
FT                   IYTNGPVPGTTTIYPTSNVASNTSENYPYTGSKSLSSSSILSNSTISTSSSTPITASVP
FT                   TSSSILSNSTIPTTSPVPTTSSTPTSSSILSNSTIPSSSSISASTITTTIISGSTQFTT
FT                   TFVDQSIDTVEVVIPTAGYITTTLTSGSSYPVSTTTLQTVSGTQSGLVEVITPSCGCNP
FT                   ENSFHLRLVGDSINPSYVYKNTNVSDPDEGNMYTSTEGNTEAVNVFYYDPTVERILTCD
FT                   CVRPVYTIYTDDPDSSFDIIKNNNGTFTFVESSSGEIQTLHVSQYGALWITSPEYDGET
FT                   GGMDDVGFRADDVILVAY"
FT   5'UTR           complement(join(119329..120017,120074..120469,
FT                   120511..121286))
FT                   /locus_tag="SPBC359.04c"
FT   misc_RNA        120577..121643
FT                   /locus_tag="SPNCRNA.1311"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        120652..121497
FT                   /gene_synonym="SPNG1125"
FT                   /locus_tag="SPNCRNA.293"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           122657..122746
FT                   /gene="abc3"
FT                   /locus_tag="SPBC359.05"
FT   CDS_pept        122747..127144
FT                   /transl_table=1
FT                   /gene="abc3"
FT                   /locus_tag="SPBC359.05"
FT                   /product="ABC transporter Abc3, unknown specificity"
FT                   /db_xref="GOA:Q9P5N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P5N0"
FT                   /protein_id="CAB91574.1"
FT                   /translation="MITANKGLSLVLLIPNLFALVSGGLQYVFDVRRRIFRPHFSQFWT
FT                   IWMKFFSIALVIITQIYVGYKTKNIGWNFFSVVTYCFVLFLQFAEQSTLRVPMASLLIF
FT                   WLLKVVTSLLILLFSPYIAITSMARLLTLITLFCSLVCFISEVYVPPCNRVWYSDDTNE
FT                   VEEKGIRPSEVRYANIFSKLSFSWISSFIKFGYTNYLKESDVWLLPPDERSGNLIIGFE
FT                   DWWIYHSKNKRRSLFLWKLLFFNHWKLVALITITKLIQDVLAFVQPTLIQKTILFISSY
FT                   TSPNPESPSRGFIIAILVLVANFLQTLLLQQYNQLIMLLGMRWKTELLASIYRKSLLLS
FT                   SSARQNRSIGDIINYMAVDTQKISDLPIYLFIIVSGPFQIALALSNLYHLMGYSAFTGV
FT                   AASVILFPCNIIVANVYKKFQSILMKNKDSRSKLMTEIINNIRSIKLYAWETPFLQKLL
FT                   HIRNTKELSMLKKIGFITAIGDFAWIFTTIIVTTVAFGAFIIFHGKTQALTADIVFPAV
FT                   SLFNLLQFPLAMLPTVISSLLEASVSVSRIYEFLIAQELDYNGVQRFPATEIPHEICLE
FT                   IKSGTFSWSKKTLKQQVTPTLRQINFVAKNGELTCIFGKVGAGKSSLLEACMGNMYKNS
FT                   GSVFQCGSLAYAAQQPWIFDATIRENILFGSEFDPELYEKTIHACCLKRDFEIFTEGDQ
FT                   TEVGQKGASLSGGQKSRISLARAIYSQADIYLLDDVLSSVDQHVSRDLIKNLFGPEGFL
FT                   RTHCVVLTTNSLNVLKEADSIYILSNGKIVEKGNYEHLFVSTNSELKQQLSEFNDEKDT
FT                   QPLPEHTTSYPSTQISLAPSIHVEGLETYSSSERKDSSNKYKSRKRNPIRQKVTEDDKG
FT                   KCVAQTDELVQRGKVKWHVYWMYFKSCSIGLILLYFFFIISGIMMNVATNVWLKHWSEE
FT                   NGKSSSELNPSPYFYLGIYLFFGFLSCAFISSSSLTMTVLCGIRSGRYLHDSMLKTILR
FT                   APMGFFETTSSGRILNRFSNDVYKVDEVVSLTFMFFFRNSIQVLFILGVICYSAPLSLL
FT                   LIVPLFFLYLYNRAYYVRTSRELKRLDNVTRSPLYAHVQESLSGLSTIRAYGMQETFVE
FT                   ENDLRIDTNHRVWFMFFSSSRWQAIRVECIGDLIIFCTAFYGILSAIKGSPNPGLVGFS
FT                   LSYAIQITQGLSFIVQQSVDAENNTVSVERILEYINVKSEAPEIIPENRPPCEWPTDGA
FT                   VSFNHYSAKYREDLSFALNNINIEISPREKIGIVGRTGAGKSTLAMALFRIIEPTEGKI
FT                   EIDNEDITKFGLYDLRSRLSIIPQESQIFEGNIRENLDPNHRLTDKKIWEVLEIASLKN
FT                   CISQLEDGLYSRVAEGGANFSSGQRQLICLARVLLTSTRILLLDEATASVHAETDAIVQ
FT                   QTIRKRFKDRTILTVAHRINTVMDSDRILVLDHGKVVEFDATKKLLENKDSMFYSLAKE
FT                   SGLI"
FT   misc_RNA        complement(123704..126325)
FT                   /locus_tag="SPNCRNA.1312"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           127145..127461
FT                   /gene="abc3"
FT                   /locus_tag="SPBC359.05"
FT   misc_RNA        127311..127803
FT                   /gene_synonym="SPNG1126"
FT                   /locus_tag="SPNCRNA.294"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(127382..128570)
FT                   /locus_tag="SPNCRNA.1313"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        127937..128726
FT                   /locus_tag="SPNCRNA.1314"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           128660..128824
FT                   /gene="mug14"
FT                   /locus_tag="SPBC359.06"
FT   CDS_pept        128825..129598
FT                   /transl_table=1
FT                   /gene="mug14"
FT                   /locus_tag="SPBC359.06"
FT                   /product="adducin"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC359.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC359.06.1"
FT                   /db_xref="GOA:Q9P5M9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="PomBase:SPBC359.06"
FT                   /db_xref="PomBase:SPBC359.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P5M9"
FT                   /protein_id="CAB91575.1"
FT                   /translation="MAKVTGLPEFEDLHTKRKWMLNHMAAAFRMFGRNGYNEGTAGHVT
FT                   VRDPIDENTFWINPLEVPFSLMKPSDLVHINSDGEIIGGSKMKYNTSGFAIHYEMHKVR
FT                   PEVICVCHVHSIYGKAFSALGKPLDMLNTDCCVFYNNHGIYFDMDDVISMPEEGRRTAK
FT                   GLADYKAVLVQNHGIMTVGTTVDEAAYLLSLMERSCQIQLLIDSATKVGERKHVHPTRA
FT                   KAIRENADNPVGLYTAQQPNFLYEVACSNGELEII"
FT   3'UTR           129599..129742
FT                   /gene="mug14"
FT                   /locus_tag="SPBC359.06"
FT   5'UTR           132353..134302
FT                   /locus_tag="SPBC1683.01"
FT   CDS_pept        134303..136024
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.01"
FT                   /product="inorganic phosphate transporter (predicted)"
FT                   /db_xref="GOA:Q9P6J9"
FT                   /db_xref="InterPro:IPR004738"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J9"
FT                   /protein_id="CAB91163.1"
FT                   /translation="MKLNIFKSHGDSNTAEERPVPLEQVEAEDQQHENRFWLGLTAKEF
FT                   RLMMLAGVGFFLDSYDLFIINLVTPIFEYLYWGGIEKGPNGKGHYPSGIRGLVNAASNI
FT                   GNIFGQLMFGFMGDFFGRKFVYGKEMIIVIIATILLIAMPKSIHSPLSKMMWVFCWRWL
FT                   LGVGIGGDYPMSAAITSERSKLNRRGTLISLIFAFQGFGTLAGAIVTIILLGCFEHPLN
FT                   REGHYRKLEGVWRLQFGLALVPAIGVLIPRLMMEETQKFKNSQQLNSGDNRDPKTSLNF
FT                   EDDELVKNPSVTKGHPEIHESSENYLSRSNTVENEPENIEKQFESVSAPANRSGFIQYF
FT                   RQWHHFKHLLGTSVCWFLLDIAFYGVNLNQSVILKNIGFSSGTNEYRTLMKNAIGNLII
FT                   AVAGYVPGYWFNVFLVEILGRKWIQLQGFVITGLMFAILAGRWNEISTGGRFACFVIAQ
FT                   LFSNFGPNSTTFIYPAEVFPARVRGTAHGISAALGKCGAILASLLFNFLTSIIGYGNVM
FT                   WIFCGCMWGGILFTLLLPETKGRDADEIDRVELFYGGDGKVECNSKWKSWYVNGIF"
FT   3'UTR           136025..136275
FT                   /locus_tag="SPBC1683.01"
FT   repeat_region   complement(136385..136555)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           join(136622..136693,136744..137043)
FT                   /locus_tag="SPBC1683.02"
FT   CDS_pept        137044..138063
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.02"
FT                   /product="adenine/adenosine deaminase family (predicted)"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.02.1"
FT                   /db_xref="GOA:Q9P6J8"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PomBase:SPBC1683.02"
FT                   /db_xref="PomBase:SPBC1683.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J8"
FT                   /protein_id="CAB91164.1"
FT                   /translation="MTDIERFIEKLPKAELHLHLEGTLEAELKLKLSHRNKIPLKQSSI
FT                   EEIKESYNFHDLASFLEVYYEGVELLLHEQDFYDLCYQYLRKAASQNVVYAEMFFDPQL
FT                   HTRRGISFETVIKGLIRARDDAMRDFHIYSQLIMCFIREMSFENAEETLNASLPYKSEI
FT                   IGIGLDSNEENNPPIKFLKVFQRARQLGYRLTCHCDLHQKNTTTHIRQALEDIGVERID
FT                   HGINILDDPELIKLALERNIPFTVCPFSNEIVYPGKAQPEIRIMLDTGLKVTINSDDPA
FT                   YMHCFYITENFNLAQKGASLTKKELVQICRNSFEAAWISEEKRNHYLEALNSFASAYD"
FT   3'UTR           138064..138470
FT                   /locus_tag="SPBC1683.02"
FT   3'UTR           complement(138298..138524)
FT                   /locus_tag="SPBC1683.03c"
FT   CDS_pept        complement(138525..140084)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.03c"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.03c.1"
FT                   /db_xref="GOA:Q9P6J7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1683.03c"
FT                   /db_xref="PomBase:SPBC1683.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J7"
FT                   /protein_id="CAB91165.1"
FT                   /translation="MMNYVKSLGTYNTRNMEKESSKDLVQNEDTPLPVQKISMSLFHEI
FT                   VFVFIACTAQLMTQAGLGQSIAPNNIIGKSLGTTNPGQLSWFPASYSLTVGTFILIAGR
FT                   LGDIYGHKKMFVLGYIWFCIWSLISGFSYYAKSVIMFDVCRALTGIAPAFLLPNALALL
FT                   GRVYPPGKKKNLIFALFGATAPNGFLLGSVFSGIFAQLSWWPWTYWTTAIVCIVFAIIG
FT                   YFAIPHIEADEVEEKQKFDYLGAFFGVSGLVLINFSWNQGPVVGWQVPYVYILLIIGFL
FT                   SLVVFVLVEKRVVQPILAPSMMNSEMGCVLICVAAGWACFGIWMYYLWQFLENLRFATP
FT                   LLVTAQLTPVGISGCAAALTTGYLLKRLKPTKIMVVSMIAFTVGTILIATAPIHQTYWA
FT                   QTFVSIIVTPWGMDMSFPAATLMLSDFVPKQHQGIAASLVSTVVNYSISIGLGIAGTVE
FT                   THLNHKGVDLIRGYRSAWYMGTGFGGLGVCVAILTVFASYLKVGQQKSPKFPLIMKNTK
FT                   AV"
FT   5'UTR           complement(140085..140377)
FT                   /locus_tag="SPBC1683.03c"
FT   misc_RNA        140474..141087
FT                   /gene_synonym="SPNG1135"
FT                   /locus_tag="SPNCRNA.296"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(141285..142180)
FT                   /locus_tag="SPNCRNA.1315"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        141435..141927
FT                   /gene_synonym="SPNG1136"
FT                   /locus_tag="SPNCRNA.297"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           142262..142411
FT                   /locus_tag="SPBC1683.04"
FT   CDS_pept        142412..144910
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.04"
FT                   /product="glycosyl hydrolase family 3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.04.1"
FT                   /db_xref="GOA:Q9P6J6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="PomBase:SPBC1683.04"
FT                   /db_xref="PomBase:SPBC1683.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J6"
FT                   /protein_id="CAB91166.1"
FT                   /translation="MMEHDVEDLINQLDISEKAMLLSGTDLWHTAAIPRLNIPSIRLSD
FT                   GPNGIRGTSFFNSSPSACFPCGTALGATFDKKLLFEVGEYLAEEAKAKGVSVVLGPTVN
FT                   IHRGPLNGRGFESFSEDSTLSGLAASYVILGLQSKNVQACIKHFVCNDMEDERNSVSID
FT                   VSQRALREVYLMPFQLACKYSNFKSLMTSYNKVNGEHVSQSRILLDNILRKEWEWKGTI
FT                   ISDWFGTYSLKKAIDAGLDLEMPGKPRFRNVNTIQHLVGSKELSESILDERAKNVLKLV
FT                   KHSWQNTEAENHCELNNDSSCLREALKKFASQSIVLLKNKKKLLPLSRKGTFAVIGPNA
FT                   KVCNYSGGGSANLKPYYTVSMYDGIAAKIDGVPEYALGCHNYLNLPNIANLLVNPRTGK
FT                   HGYVAKFYLEPATSENRTLIDDYDLEDGVVRFYDYCNDKMKDGYFYIDIEGYLIPDEDA
FT                   VYEFGISVFGTALLFIDDVLLIDNKTKQTPTNHTFEFGTIEERNSIYLKKGRKYNVRVE
FT                   YGSAATYTLSTNLSPSTGGRYSIGCVKVIDPETEIDYAVRVAKSVDCVILCVGLTAEWE
FT                   TEGEDRKTMTLPSLSDKLVYSILQSNPNTVVVTQSGTPIEMPWISEAHTLLHIWYNGNE
FT                   LGNALANIIFGEQNPCGKLPITFPKKLKDNPAYLSFRSSRGHCVYGEDVFVGYKYYEAV
FT                   EREVLFPFGYGLSYTTFELSNLYLKNCGERLRIDLEISNTGPMSGAEIIQVYISQIVRS
FT                   VNRPVKELKEFSKVVLCPKETKLIRIELDIKYATSFYDELNEKWCSEEGEYNVLVGTSS
FT                   KDIALTGKFTLPKTIHWTGL"
FT   3'UTR           144911..145393
FT                   /locus_tag="SPBC1683.04"
FT   misc_RNA        complement(145701..148807)
FT                   /locus_tag="SPNCRNA.1316"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           147915..148749
FT                   /locus_tag="SPBC1683.05"
FT   CDS_pept        148750..150429
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.05"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.05.1"
FT                   /db_xref="GOA:Q9P6J5"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="PomBase:SPBC1683.05"
FT                   /db_xref="PomBase:SPBC1683.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J5"
FT                   /protein_id="CAB91167.1"
FT                   /translation="MEDPKSDEKFDIGISEKNLDVGFGESSSVDVPVKGRFASFLKKLE
FT                   LSSGPEKENIDLRPTPPDRRHYSALDIIYLWSCNGISASAFRTGTSYMEMGLSPKQALA
FT                   ALIAGNVFIAMPMTLNGLFGSHYHIPFAVQSRASFGYYFNTLIILLRFIAGLFYYGTNV
FT                   YTGAECVQTILYAIFKSFRSYKNRLPADAGITSDFLISYFVYWVISFPFHLIRPEYLQR
FT                   FFLIKSISTYIACFAMLIFLLCNVGSHVVWDQPATVSGRSWSWVFMCALNSSVAGFSTL
FT                   AVNVNDFTRYVKHPKTPYVQMLILPLVAAVSAPIGIVSGVASKIMYGTAMWDPLQIANN
FT                   WTSRGGRAAAFFMGLTYLVSMIAQNISDNTVAAANDLLYFFPRYLDIRRAQVIVIIIGA
FT                   WAIVPWKILQNGTAFLAFLGSLSIFLGPAAGIFVADKFKNHHKYDIDEFYNPSGIYRYN
FT                   KLGLNWRALIAFLCACVPLIPGMAMSINPSITMPDGVIHLYYIGYFYSFMTAFLIYWGL
FT                   NLVFPAKETLLEEAVYPPKSNAELVDPSTLSGKDKFWYYIDY"
FT   3'UTR           150430..150574
FT                   /locus_tag="SPBC1683.05"
FT   5'UTR           151490..153561
FT                   /gene="mal1"
FT                   /locus_tag="SPBC1683.07"
FT   3'UTR           complement(151789..151813)
FT                   /locus_tag="SPBC1683.06c"
FT   CDS_pept        complement(151814..152746)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.06c"
FT                   /product="uridine ribohydrolase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.06c.1"
FT                   /db_xref="GOA:Q9P6J4"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="PomBase:SPBC1683.06c"
FT                   /db_xref="PomBase:SPBC1683.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J4"
FT                   /protein_id="CAB91168.1"
FT                   /translation="MKIIIDTDPGQDDAITALLAIASPEIELLGVTTVAGNVPVSMTTR
FT                   NALQMLDLAGRPDIPVYAGSNKPLLRAPITATHVHGASGFEGAVLPPPSRKENEGHAVD
FT                   FIIDTLRNNEPGTITICTIGPLTNIALALNKAPEVIQRAKQIVMMAGAFSEVGNITPAA
FT                   EFNIYVDPHAAQMVLSSGIPIVMMPLDITHQLHTSAKRIARMEALPNRVGPVVAAWLRM
FT                   EKAYEAKKYGTDGGPLHDPNTVMWLLRPDIYSGRKVNVQIETQSELTMGMSVVDWWQVG
FT                   LLPANVTFLRTVDDDEFYEVLIERLGRLP"
FT   5'UTR           complement(152747..153659)
FT                   /locus_tag="SPBC1683.06c"
FT   CDS_pept        153562..155301
FT                   /transl_table=1
FT                   /gene="mal1"
FT                   /locus_tag="SPBC1683.07"
FT                   /product="maltase alpha-glucosidase Mal1"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.07.1"
FT                   /db_xref="GOA:Q9P6J3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="PomBase:SPBC1683.07"
FT                   /db_xref="PomBase:SPBC1683.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J3"
FT                   /protein_id="CAB91169.1"
FT                   /translation="MKVVPSEKIKPNWWRETSVYQIYPASFKDSNGDGFGDLEGIISKV
FT                   DYLKALNVESIWLCPIYPSPLKDMGYDVSDYKQIDSRYGTLEDLDRLMKALHERDMKLV
FT                   MDLVLNHTSDQHEWFKESRSSKTNPKRDWYFWKPARYNEKGERLPPNNWRSYFDTSAWE
FT                   WDEATQEYYLHLWSVGQPDLNWETPKVREAVHDILRFWLDRGVDGFRLDAINMISKDQR
FT                   FLDAPITDDRYEYQLAYQYYANGPRIHEYLNGIGNILTEYDAFSVGEMPYVLDTNEILH
FT                   VVGADRRELTMIFQFDFVDLDLDPNQHKYIEGSWELSDLKKSLKKWQSALLSGGGWNAS
FT                   FIENHDQTRTVSRYLSDSPKYRAYSSKLMALFIIFQSGTPFVFQGQELALANIPRDWPI
FT                   DEYLDVETQNFWKLFMSGNPSQEEIEKTMDIVNKRARDNGRTPMHWDSSPNGGFTKAGV
FT                   KPWMRVTNDYKEWNAANQVNDPESPYTFWSKALELRKELKDAVVYGSFELISEEDPSIV
FT                   AFVRESSTYKLIILLNFTGNKVSYDCPLNLTSYEILLDNYKDFICMTSPVTLNPYQAVL
FT                   LKL"
FT   misc_RNA        complement(154152..154516)
FT                   /locus_tag="SPNCRNA.1317"
FT                   /product="antisense RNA (predicted)"
FT   misc_RNA        complement(154521..156642)
FT                   /locus_tag="SPNCRNA.1318"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           155302..155630
FT                   /gene="mal1"
FT                   /locus_tag="SPBC1683.07"
FT   5'UTR           155751..157554
FT                   /gene="ght4"
FT                   /locus_tag="SPBC1683.08"
FT   misc_RNA        156254..157003
FT                   /gene_synonym="SPNG1143"
FT                   /locus_tag="SPNCRNA.298"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(157362..158316)
FT                   /locus_tag="SPNCRNA.1319"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        157555..159228
FT                   /transl_table=1
FT                   /gene="ght4"
FT                   /locus_tag="SPBC1683.08"
FT                   /product="hexose transporter Ght4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.08.1"
FT                   /db_xref="GOA:O59932"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1683.08"
FT                   /db_xref="PomBase:SPBC1683.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59932"
FT                   /protein_id="CAB91170.1"
FT                   /translation="MGRTLTSVLVVFISMAGWLGGADTGSISGILGMRDFQSRFADRYN
FT                   PITNSYSYSAWRQALLTGTVNAGCLFGAMLSSPFTEAIGKKYSIAFFSGCYIIGQILLV
FT                   TAVPSWVQIMVGKLFTGLTIGALSVLSPGYQSEVAPPQIRGAVVSTYQLFQTCGTLIAA
FT                   CINMGTHKLRKTASWRTSFGINILWGIFLMVGVLFLPESPRYLIYKGRDEEALRIMCQT
FT                   AELDPESEIIQTNFNTIKSDIEMEMAGGKARWPEVFGKEVRYRTVLGFLTMLLRELIGN
FT                   NYYFYYATQVFKGTGMTDIFLPAVILGAINFGTTFGALYTIDNLGRRNPLIFGAAFQSI
FT                   CFFIYAAVGDRKLIYKNGTSDHRAGAVMIVFSCLFLFSYCCSWGPMGWVIVGETFPIRY
FT                   RSKCAAVATSGNWLGNFMVSFFTPFISNSIGFKLGYIYACINMTSAFQIFLMAKETKGL
FT                   TLEEVNELYESDIKPWDSYKYVRQIESRRIHFSKEEEKREREKSKGYRGQEERFIENAD
FT                   GADNDDSSASSESFASAGAHSRSVFPRRSNVSEESHPTWV"
FT   3'UTR           159229..159570
FT                   /gene="ght4"
FT                   /locus_tag="SPBC1683.08"
FT   3'UTR           complement(160357..160460)
FT                   /gene="frp1"
FT                   /locus_tag="SPBC1683.09c"
FT   CDS_pept        complement(160461..162155)
FT                   /transl_table=1
FT                   /gene="frp1"
FT                   /locus_tag="SPBC1683.09c"
FT                   /product="ferric-chelate reductase Frp1"
FT                   /EC_number="1.16.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.09c.1"
FT                   /db_xref="GOA:Q04800"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="PomBase:SPBC1683.09c"
FT                   /db_xref="PomBase:SPBC1683.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04800"
FT                   /protein_id="CAB91171.1"
FT                   /translation="MAINSSDKWTVIAICLILGILLAFILMFWLERFRVIIKSNAHKHD
FT                   PSDKRQIWLEKYYLFVRQIYTYLVTHKVILTLIAVPVVFAISIPFIGMQTPASSHGKQT
FT                   TQVSTGNWSKNAVAARLGFLACGLYVTSYFFSIKNNPFALLLISSHEKMNYVHRRLSQY
FT                   AIMIGAIHGFAYIGLAAQGKRALLTARVTIIGYVILGLMVIMIVSSLPFFRRRFYEWFF
FT                   VLHHMCSIGFLITIWLHHRRCVVYMKVCVAVYVFDRGCRMLRSFLNRSKFDVVLVEDDL
FT                   IYMKGPRPKKSFFGLPWGAGNHMYINIPSLSYWQIHPFTIASVPSDDFIELFVAVRAGF
FT                   TKRLAKKVSSKSLSDVSDINISDEKIEKNGDVGIEVMERHSLSQEDLVFESSAAKVSVL
FT                   MDGPYGPVSNPYKDYSYLFLFAGGVGVSYILPIILDTIKKQSRTVHITFVWSARSSALL
FT                   NIVHKSLCEAVRYTEMNINIFCHLTNSYPVEEVSSLNSQSARNYSLQYLNGRPDVNDYF
FT                   KDFLHATGTQTAALASCGSDKLLRHLKSCVNTHSPSTVDLYQHYEEI"
FT   5'UTR           complement(162156..162497)
FT                   /gene="frp1"
FT                   /locus_tag="SPBC1683.09c"
FT   3'UTR           complement(163534..164429)
FT                   /gene="pcl1"
FT                   /locus_tag="SPBC1683.10c"
FT   misc_RNA        163689..163891
FT                   /locus_tag="SPNCRNA.100"
FT                   /product="non-coding RNA (predicted)"
FT   CDS_pept        complement(164430..165158)
FT                   /transl_table=1
FT                   /gene="pcl1"
FT                   /locus_tag="SPBC1683.10c"
FT                   /product="ferrous iron transporter Pcl1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.10c.1"
FT                   /db_xref="GOA:Q9P6J2"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="PomBase:SPBC1683.10c"
FT                   /db_xref="PomBase:SPBC1683.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J2"
FT                   /protein_id="CAB91172.1"
FT                   /translation="MWSIFEARPKEAHSVNKIGWLRASVLGANDGILSLSGLLVGVVAA
FT                   NADIKVILITGVAGLMSGALSMAVGEYVSVSSQADLEDADLQLERREMDADWDAEVDEL
FT                   AAIYRGRGLDEELSRTVAVQLMEYNALEAHARDELGINIHTTAKPTLAALSSAASFSVG
FT                   GIFPLLTSLITPLEYLSLVLPIATMFFLGMLGFVGAHIGGAKRVRAILRAVVLGLLAMA
FT                   ATALVGRLLEIHALSLQYAI"
FT   5'UTR           complement(165159..165317)
FT                   /gene="pcl1"
FT                   /locus_tag="SPBC1683.10c"
FT   3'UTR           complement(166550..166791)
FT                   /locus_tag="SPBC1683.11c"
FT   CDS_pept        complement(166792..168348)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.11c"
FT                   /product="isocitrate lyase (predicted)"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.11c.1"
FT                   /db_xref="GOA:Q9P6J1"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="PomBase:SPBC1683.11c"
FT                   /db_xref="PomBase:SPBC1683.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J1"
FT                   /protein_id="CAB91173.1"
FT                   /translation="MTTDMDLEQLEYEKEVEEIEKWWATPKQSQIKRPYTASTVAVLSE
FT                   VTKAYYPSSQQALKLYDLLREHRNKGTATLTYGVVDPVLASQASKAGLETIFVSGCLCG
FT                   LSSVDEPGMDHADYPWDTVPKAVDRIFRSQNWHARRQKQFHLMKPAEERKQLPKYDYLL
FT                   PIIADGDMGFGSVTSTMKMTKRFVESGVAMIHLDDLAIGLKRFTVGQGRTVVPTSEYLR
FT                   RLTAVRLQFDIMKAETMLLCRCDTDHAEFITSVVDPRDHAYVLGATTKIESLIKALKDA
FT                   ESTGVSMKKARENWIERAKLMTFDEAVKSTATPKEYENYISAISKKPFHSISERQELAE
FT                   KYLSNEVFFDWELPRSSDGQYFFKPTVQTVIERAIAAAPLGEMTWARMDYPKWQDIKAF
FT                   HEGVRAVYPDRMFAFGFTGNYDFKAAGFSEEQLRNLTSDMAKLGVCWQVQPYFTCQVLN
FT                   KASVDYSNIWKKDGIFGYVKTVQEPALKEDVDGFENEWCGTYFADKLLSAAGSSDKTIP
FT                   Y"
FT   5'UTR           166814..168670
FT                   /locus_tag="SPBC1683.12"
FT   5'UTR           complement(168349..168643)
FT                   /locus_tag="SPBC1683.11c"
FT   CDS_pept        168671..170119
FT                   /transl_table=1
FT                   /locus_tag="SPBC1683.12"
FT                   /product="nicotinic acid plasma membrane transporter
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1683.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1683.12.1"
FT                   /db_xref="GOA:Q9P6J0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1683.12"
FT                   /db_xref="PomBase:SPBC1683.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6J0"
FT                   /protein_id="CAB91174.1"
FT                   /translation="MSTMEEEKVISKSTSVDISEGTFDDITIEKKEEAKLVRKLDWYLM
FT                   PMFSVLYFLSFLDRANIGNAAVVGLKEDLKLQAYQYSAAVSVFYATYITAETPSVLLVK
FT                   KFGPHYYLSAMIIGWSLVTIFTCFVRHYWSLVLTRLLLGICEGGFFPCLSLYISMTYKR
FT                   EEQGKRLAYLYVCSCFSGAFGGLIATGLTKIPKSSGLPNWGWLYIIEGLISAISALWIL
FT                   FCLPDDPSTARFLNPREKELMKIRAEQRQKYMGSPNFDWTQFRKAFKDPKMYMSCVIQF
FT                   CQDLVLYGISTFLPSILKLELGYSSLAAQYMSVPVYALGGISVYVICLLSDRTNIRGWF
FT                   IIGMNFFGLAGFIILLATTNSAANYVATYLIALPLYPTVALNITWINNNMAPHYRRATA
FT                   LGCNQTIGNLAGVIAGQVYRSSPYKLGHGFALGCTVVGTLTATAMRFYLQRQNKIKQEI
FT                   LNGERVDEKKERDGCDALDFVYVL"
FT   3'UTR           170120..170140
FT                   /locus_tag="SPBC1683.12"
FT   CDS_pept        complement(join(170167..171862,171909..171991,
FT                   172040..172064,172105..172157))
FT                   /transl_table=1
FT                   /gene="cha4"
FT                   /locus_tag="SPBC1683.13c"
FT                   /product="transcription factor Cha4 (predicted)"
FT                   /db_xref="GOA:Q9P6I9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I9"
FT                   /protein_id="CAB91175.1"
FT                   /translation="MQMKPRQDKKNQEIFRISCQRCRQRKIKCDRLHPCFQCVKSNSQC
FT                   FYPEDPIRRRAPKEYVEALERQIAFFEAFVKKLAKVGSDEQSLMIQDMNNKIVNEGNEY
FT                   DQTPDISARKRRKHFRMLPQNNFRYFQFYGTTNVISASNLTTTSEIPTFKFPIFSKRKY
FT                   NDTENLYEQPFHLEFDTCQELLSLFFLKQYHNFMFVFRDYFIRDFELGGGPYYSQWLLF
FT                   AICSIGAMISPDDDLKNLSNTLANIAEKWVLDEGLNSPDITTLQTLLVLGIREIGRGLT
FT                   FKGWLFSGMAFRLVYDMGLHLDPDHWDHSEESRIDREVRRRCFWGCFTLDKLISLCYGR
FT                   PPGLYLKQTDVRNTTQLPYISELDEPFEIFNKKSELFAAVSAGEDRRGLVQFWLNQVEL
FT                   CKIIHRMLTEVFEDRTSSVLEASINNIHTELQKWIADIPMELQWNTRSQKETSSTVLLL
FT                   HMLYHSVIIILNRPSDDNYLKLDNTERYTFEICWKSAKTIVQLLKIYFKKYDADCLPMT
FT                   FIHIATSAARIILVKLNENIPEDGDVCNIYLEIITNALDVCANVWPLASQASRAILNAY
FT                   KSCATSPKENNEDSLPLQRSPSLDDVSRFDSLDYIFSPNVKY"
FT   5'UTR           complement(172158..172271)
FT                   /gene="cha4"
FT                   /locus_tag="SPBC1683.13c"
FT   5'UTR           172378..172990
FT                   /locus_tag="SPBC1198.01"
FT   misc_RNA        complement(172716..174355)
FT                   /locus_tag="SPNCRNA.1320"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        172991..174262
FT                   /transl_table=1
FT                   /locus_tag="SPBC1198.01"
FT                   /product="glutathione-dependent formaldehyde dehydrogenase
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.01.1"
FT                   /db_xref="GOA:Q9P6I8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC1198.01"
FT                   /db_xref="PomBase:SPBC1198.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I8"
FT                   /protein_id="CAB91176.1"
FT                   /translation="MEYLTNLKTNIMDKQLGHREVSEGSTQPKPDPSGATMKACVWDGP
FT                   LNVKIAEVPKPTITHPKDVIVKTTACTICSGSDSHIFSGEMPGIEKGAILGHESCGIVA
FT                   EKGDEVNNLEIGDRVVIAFDLACGQCSFCKRHEYAACDTTNDSKLMDVNYGSHHSAIFG
FT                   YTKLLGDVPGCQAEYIRVPFAEINCCKLPDDIPDSEGLFMSDVLCTSLHACTLGEVKKG
FT                   DTVAIWGMGPIGLYAGRWAQILGASKVIGIEVVPERIELARQKFGFTVIDRNEVSDVPK
FT                   KIMELVSNGVDCAIEASGFRFSTSILHKVERAVGLETDSPDMITECLNAVRKYGHVSII
FT                   ADYVGTSNQFPIGHVVMKHLTIRSGQCPCQNYFGYVIDNIRSGKIDPRWMVTNKIKFDD
FT                   LPDAYNKLFYKEDGYVKVYCDMTE"
FT   3'UTR           174263..174315
FT                   /locus_tag="SPBC1198.01"
FT   5'UTR           174822..174841
FT                   /gene="dea2"
FT                   /locus_tag="SPBC1198.02"
FT   CDS_pept        174842..175945
FT                   /transl_table=1
FT                   /gene="dea2"
FT                   /locus_tag="SPBC1198.02"
FT                   /product="adenine deaminase Dea2"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.02.1"
FT                   /db_xref="GOA:Q9P6I7"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PomBase:SPBC1198.02"
FT                   /db_xref="PomBase:SPBC1198.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I7"
FT                   /protein_id="CAB91177.1"
FT                   /translation="MSNLPIYNFIRKLPKCEHHVHLEGCLSPDLVFRLAKKNGITLPSD
FT                   DAAYTTPSTLLASYEHFGCLDDFLRYYYIAVSVLIEASDFEALAYEYFSIAHSQGVHHA
FT                   EVFFDPQTHTSRGISYDVVVSGFSAACERANRDFGMSTNLIMCFLRHLPSEAAHETFAE
FT                   ALKRNDFENGIVAGVGLDSSEVDFPPELFQEVYKLAAEKGIRRTGHAGEEGDPSYIRSG
FT                   LDNLSLQRIDHGIRLVEDKELMKRVAEENIMLTMCPLSNLKLRCVNSIAELPVREFLEA
FT                   GVPFSINCDDPAYFGGYTLENYFAIQKHFNLTVKEWVFIANAAINGSWISGKRKEELLS
FT                   SVQKCVKEYTAEIQQPKTLETAVEVQA"
FT   3'UTR           175946..176135
FT                   /gene="dea2"
FT                   /locus_tag="SPBC1198.02"
FT   3'UTR           complement(176082..176296)
FT                   /locus_tag="SPBC1198.03c"
FT   CDS_pept        complement(176297..177046)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1198.03c"
FT                   /product="Golgin subfamily A member"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.03c.1"
FT                   /db_xref="GOA:Q9P6I6"
FT                   /db_xref="InterPro:IPR028018"
FT                   /db_xref="PomBase:SPBC1198.03c"
FT                   /db_xref="PomBase:SPBC1198.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I6"
FT                   /protein_id="CAB91178.1"
FT                   /translation="MDIKDEKALTIEKACTINVFAPFVRNVTAEDEKAVTNKKHINSSA
FT                   TVHVFHGVVNRTFKTKGNTVGLPKSFSKAVIETLSYKPFAPICIHSRSDEVVNGFPLIY
FT                   FPEDLASHDISGKDWKSFIHDVNMACSFSDVALMGLDQILNLVSFGLSAYVISYYVEKY
FT                   VDKAKFPIIKGFIEMWNRKFFNPRKTHVYFINSDEVAEQRAVSIKAYQQGKGTKGLFSK
FT                   FNAQREWKKQHQDISSTQHSRLLLISL"
FT   5'UTR           complement(177047..177244)
FT                   /locus_tag="SPBC1198.03c"
FT   3'UTR           complement(177469..177555)
FT                   /gene="zas1"
FT                   /locus_tag="SPBC1198.04c"
FT   misc_RNA        177551..178869
FT                   /locus_tag="SPNCRNA.1321"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(join(177556..177608,177656..178291,
FT                   178344..178651,178690..178811,178857..178988,
FT                   179032..179283,179322..179387,179440..180416,
FT                   180461..180608))
FT                   /transl_table=1
FT                   /gene="zas1"
FT                   /locus_tag="SPBC1198.04c"
FT                   /product="zinc finger protein, transcription factor Zas1
FT                   (predicted)"
FT                   /db_xref="GOA:Q9UTS5"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTS5"
FT                   /protein_id="CAB91179.1"
FT                   /translation="MSNEESFTEKPLKKRSRAHRLGDPRFYCTYPDCPKSFTRKEHLRR
FT                   HERTHENVKAFSCSFCNRAFARSDVLNRHVQQMHLQKQNLSERRMLNASCFLGFCVLAH
FT                   DYVNLINARHFMIEHFLSLFAFCRTILFSLLTSFLLVPPPQFFHSEAGERPTPSVGAPS
FT                   SLASSMDSVRVAPSMLAASHQIVPQYSENNPRVSNEPPRVTIENASLKPFSGYIKSHMS
FT                   TSNFLNGEPDLNVNVDLSPFPNLPATVPITQAASTANAFQQPSNQFQTQKLPSGLDTRP
FT                   VSSYPDELTQLESNPDSFSRLDLQGDCTCIFKNRSSIASSRTMDDVVRWLFSSGKRRQK
FT                   YESSYPYQTQSNQIPSQDQYSDTDSNFLSYYFSASGPMYVPQKCPATVYNNLLNFLEGS
FT                   FHLQPNFLAMFTLESVSSWLNAYWSMFHVRWPILHRGTFQITQAPLDLLLSMITLGMHS
FT                   SNDLSIRSLAVEIHTTLRYNIYQKQEFGPPVSLWVYQALFLIQVFELFTSNLKQHRLAQ
FT                   MFHPVLIEAMRQAIPSDALTVRSETFGESNTPLTLQQWHKWITRESVKRIAFFVFALDS
FT                   TSTLVFGNQPLLYVTDVSMPLLAEEHHWEAENFEVWAAQKPTIEPPTILHMLKAFVQCE
FT                   QCESPLPKLSPWNMLLLLHGLLSVDISLKQKKFVPGMKLSKREIDGWCSLVFEAYQKWN
FT                   RCYYSIFLNNNILPFGHPFVKECRSLYNLACIYSKTRLTYLQAFAKAVTDPVDGSVTSK
FT                   TVAPLRYVKIWANTENARYSTSNALEILDMLLREKIESAPRYDTLIYHSWCYYVAALVL
FT                   WSIGFALDEENKKTEEVTNLHSQMSRYVTKVRQALEQGEPLFAVVEKSKNPIILHVVLQ
FT                   ALDVFPWDLLGEHKKIIQQLLSKGND"
FT   intron          complement(177609..177655)
FT                   /gene="zas1"
FT                   /locus_tag="SPBC1198.04c"
FT   intron          complement(180144..180299)
FT                   /gene="zas1"
FT                   /locus_tag="SPBC1198.04c"
FT   5'UTR           complement(180609..180735)
FT                   /gene="zas1"
FT                   /locus_tag="SPBC1198.04c"
FT   tRNA            complement(180994..181064)
FT                   /locus_tag="SPBTRNAGLY.03"
FT                   /product="tRNA Glycine"
FT   misc_RNA        complement(181431..182194)
FT                   /locus_tag="SPNCRNA.1322"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           181602..181694
FT                   /locus_tag="SPBC1198.05"
FT   CDS_pept        181695..182303
FT                   /transl_table=1
FT                   /locus_tag="SPBC1198.05"
FT                   /product="guanylate kinase (predicted)"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.05.1"
FT                   /db_xref="GOA:Q9P6I5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPBC1198.05"
FT                   /db_xref="PomBase:SPBC1198.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I5"
FT                   /protein_id="CAB91180.1"
FT                   /translation="MTPQLSSSVASKLVTLKLKPVVVFGPSGVGKSTLLKRLLKDHGDK
FT                   LGFSVSHTTRTPRAGEKDGIDYHFVTKEEFQKLVAEEKFVEWAVFSGNMYGTSIMAIQE
FT                   LEAVNKKAILDIDLQGVLQVKASPIDAQYVFLAPPSIEQLEVRLRGRGTENESAILQRL
FT                   ERARAEIEYSEKPGNFDALIVNDDVEKAYKQLEAICLSD"
FT   3'UTR           182304..182528
FT                   /locus_tag="SPBC1198.05"
FT   3'UTR           complement(182515..182824)
FT                   /locus_tag="SPBC1198.06c"
FT   CDS_pept        complement(182825..184225)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1198.06c"
FT                   /product="mannan endo-1,6-alpha-mannosidase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.06c.1"
FT                   /db_xref="GOA:Q9P6I4"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="PomBase:SPBC1198.06c"
FT                   /db_xref="PomBase:SPBC1198.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I4"
FT                   /protein_id="CAB91181.1"
FT                   /translation="MNIYSVGLFYFFLVFIGAQAMDLDITDYQSIDNTVNIMMKDLMNY
FT                   WNASSQAFVASYWWVTGATMGALLYNYELFNNDTYVDLISSSLLYNAGSGFDYQPSFEY
FT                   FNLGNDDQGMWAAAAMDAAEANFSPPNSTEHSWLELTQAAFNRMSGRWDSSTCGGGLRW
FT                   QAFAWLNGYSYKASVSNALLFQLSSRLARFTNESVYSDWANKIWDWTTDVGFVNTTTYA
FT                   VYDGADTSTNCTTLDPSQWSYNIGIFMVGAAYMYNYTGETVWRERLDGLISHATSYFFT
FT                   DDIAWDPQCEYFDDCNSDQTAFKGIFMQSFGNTIRLAPYTYDTLYPLIQTSAAAAAKQC
FT                   CGGYSGTSCGIYWFWNNGTWDDNYGVQEQFSALQAVQMLMIEYAPEIATLASSTDNRSN
FT                   STYASNVVINDTNTTTTIVVKEKDRGGAGFLTFLSAIFILGASIWALVEDEEGKIPSRG
FT                   KKGIAISS"
FT   5'UTR           complement(184226..184651)
FT                   /locus_tag="SPBC1198.06c"
FT   3'UTR           complement(184591..185288)
FT                   /locus_tag="SPBC1198.07c"
FT   misc_RNA        185042..186959
FT                   /locus_tag="SPNCRNA.1323"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(join(185289..186535,186594..186675))
FT                   /transl_table=1
FT                   /locus_tag="SPBC1198.07c"
FT                   /product="mannan endo-1,6-alpha-mannosidase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.07c.1"
FT                   /db_xref="GOA:Q9P6I3"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="PomBase:SPBC1198.07c"
FT                   /db_xref="PomBase:SPBC1198.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I3"
FT                   /protein_id="CAB91182.2"
FT                   /translation="MRYLSFFFEFFFLFSFAFAFDFDVTSDDSINSALTTVTDGMLNYY
FT                   QSTSHTFTAYWWMTGAGLNSMTDTYAATGNTTHLDMLISALVANKGDNNDYAPNSEKFD
FT                   LGNDDQGIWGLSAMSAAEVNMTTGDSSASFTELAQAVFNEIMSRWDTSSCGGGVRWQIY
FT                   SFNNGYSYKNSISNGILFQLAARLARYTNNDTYVDLAQKVWDWSTTVGFVDLDDYTVYD
FT                   GASVTSNCSSITNEQWSYNVGVYLAGTAFLYNYTNGSSVWQTHMEGLMNKALDYYFTSD
FT                   KIIYEPSCEPTESCNSDQTAFKGMLARFLGYTMQLAPYTVETILPYIQSSAEAAALACS
FT                   GGSDGVTCGYMWYWNNGTWDDHYGLGEQISAVETFQALLAQQSATILTLDTGASSESNP
FT                   DAGTDDGDTVTITPATKSDKGWAGFLTFAFSFVFLLFSIWLYF"
FT   5'UTR           complement(186676..186786)
FT                   /locus_tag="SPBC1198.07c"
FT   5'UTR           187366..187423
FT                   /locus_tag="SPBC1198.08"
FT   CDS_pept        join(187424..187455,187581..188979)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1198.08"
FT                   /product="dipeptidase Dug1 (predicted)"
FT                   /db_xref="GOA:Q9P6I2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I2"
FT                   /protein_id="CAB91183.2"
FT                   /translation="MKMSLDKLYEVIDKKKDEFVTRLSRAVSIPSVSADVTLRPKVVEM
FT                   ADFVVSEFTKLGAKMEKRDIGYHQMDGQDVPLPPIVLGQYGNDPSKKTVLIYNHFDVQP
FT                   ASLEDGWSTDPFTLTVDNKGRMFGRGATDDKGPLIGWISAIEAHKELGIDFPVNLLMCF
FT                   EGMEEYGSEGLEDLIRAEAEKYFAKADCVCISDTYWLGTKKPVLTYGLRGVCYFNITVE
FT                   GPSADLHSGVFGGTVHEPMTDLVAIMSTLVKPNGEILIPGIMDQVAELTPTEDSIYDGI
FT                   DYTMEDLKEAVGADISIYPDPKRTLQHRWRYPTLSLHGIEGAFSGSGAKTVIPAKVIGK
FT                   FSIRTVPNMESETVERLVKEHVTKVFNSLNSKNKLAFNNMHSGSWWISSPDHWHYDVGK
FT                   KATERVYGITPDFVREGGSIPVTVTFEQSLKKNVLLLPMGRGDDGAHSINEKLDLDNFL
FT                   KGIKLFCTYVHELASVSP"
FT   3'UTR           complement(188789..190206)
FT                   /gene="slm5"
FT                   /locus_tag="SPBC1198.10c"
FT   3'UTR           188980..189153
FT                   /locus_tag="SPBC1198.08"
FT   5'UTR           189392..189664
FT                   /gene="ubc16"
FT                   /locus_tag="SPBC1198.09"
FT   CDS_pept        join(189665..189919,189978..190205)
FT                   /transl_table=1
FT                   /gene="ubc16"
FT                   /locus_tag="SPBC1198.09"
FT                   /product="ubiquitin conjugating enzyme Ubc16 (predicted)"
FT                   /EC_number="6.3.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.09.1"
FT                   /db_xref="GOA:Q9P6I1"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="PomBase:SPBC1198.09"
FT                   /db_xref="PomBase:SPBC1198.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I1"
FT                   /protein_id="CAB91184.2"
FT                   /translation="MNSSIKRLHKEYASFQAGDISGLLLLKPVTDVDMFHWKAVIEGPT
FT                   ETPYEGGQWVLDIHVHEGYPISPPSVYFQTKIVHPNISWTNGEVCMDILKTHWSPAWSL
FT                   QSACLAIISLLSNYDASSPLNVDAAKLLRTGDKTAYNSLVRCTTYLYAKGKIEDLS"
FT   3'UTR           190206..191786
FT                   /gene="ubc16"
FT                   /locus_tag="SPBC1198.09"
FT   CDS_pept        complement(join(190207..191217,191288..191414,
FT                   191489..191676))
FT                   /transl_table=1
FT                   /gene="slm5"
FT                   /locus_tag="SPBC1198.10c"
FT                   /product="mitochondrial asparagine-tRNA ligase Slm5
FT                   (predicted)"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.10c.1"
FT                   /db_xref="GOA:Q9P6I0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PomBase:SPBC1198.10c"
FT                   /db_xref="PomBase:SPBC1198.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6I0"
FT                   /protein_id="CAB91185.1"
FT                   /translation="MNKFQLPKTLKSLWHHPHNGELISINGWVRSIRKLKNVCFAMVSD
FT                   GTCQQALQVVTSPEQSKKLSYGASVNIEGQLAVSKNAKLGLQQYELLAEKIKIYGQIND
FT                   DNYPIQKKHLTTEMLRQIPHLRLRTAKQGEIFRLRSDSLKALRQFFSSKDFTETNPPII
FT                   TSSDCEGAGEVFTLTPQETHKNKSFERDDQKHFFDRPAFLTVSTQLHLEALALGLSRVY
FT                   TISPAFRAEQSHTSRHLAEFWMLEAEVAFMTSLSQLTSLMEDMIKYTLNSLMEQNYHRD
FT                   HWDQLLKPWKCMTYSEAIEELSAVKKTWKYPPKWGNDLSSEHEKYLCEILHKTPVFVTD
FT                   YPQKIKPFYMKSSGPDTVAAVDLLVPQVGELAGGSLRKDHLDEYKTYPPELQWYLDLMK
FT                   YSNAPHGGFGLGIERLIAFLEGENTNVKETIPFPRSVGSIFA"
FT   5'UTR           complement(191677..191818)
FT                   /gene="slm5"
FT                   /locus_tag="SPBC1198.10c"
FT   3'UTR           complement(191752..191935)
FT                   /gene="reb1"
FT                   /gene_synonym="SPBC660.01c"
FT                   /locus_tag="SPBC1198.11c"
FT   CDS_pept        complement(join(191936..192146,192198..192524,
FT                   192566..193542))
FT                   /transl_table=1
FT                   /gene="reb1"
FT                   /gene_synonym="SPBC660.01c"
FT                   /locus_tag="SPBC1198.11c"
FT                   /product="RNA polymerase I transcription termination factor
FT                   Reb1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.11c.1"
FT                   /db_xref="GOA:Q9P6H9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="PDB:5EYB"
FT                   /db_xref="PomBase:SPBC1198.11c"
FT                   /db_xref="PomBase:SPBC1198.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P6H9"
FT                   /protein_id="CAB91186.1"
FT                   /translation="MDTSVLNPELQIHGFIGVDSLQSSRKRKNDFDDFPLNKGLKTNNN
FT                   DYSGSIEPKFSPALSIKEDGKNDRNFEALMSLQAQDSNLSEQNTSIHLDALASSSIALG
FT                   NDNVDSSAFLSKVNKGVNAMRNSTSNQTNDSILISPSEITNMDPFLKGSARWTAEHWDY
FT                   LERRMQNFCQTYSLDHTQVADSLHEKRLHGPLSSLVKLLVQEMPSFTRRTILRHLRALY
FT                   NIPGYEKYSRKNSSGRGDFGVQETAIISQEVHNFIMDQGWSEYQFCNQIWAGKCPKTIR
FT                   MFYSNLYKKLSHRDAKSIYHHVRRAYNPFEDRCVWSKEEDEELRKNVVEHGKCWTKIGR
FT                   KMARMPNDCRDRWRDVVRFGDKLKRNAWSLEEETQLLQIVAELRNREDLSSDINWTLVA
FT                   QMLGTRTRLQCRYKFQQLTKAASKFELQENVWLLERIYDSLLNNGGKIHWENIVKEANG
FT                   RWTRDQMLFQFINLKKMIPSYDNLPLLEATKSAIDDFKVVLSGFSN"
FT   5'UTR           complement(join(193543..193690,193810..193850))
FT                   /gene="reb1"
FT                   /gene_synonym="SPBC660.01c"
FT                   /locus_tag="SPBC1198.11c"
FT   3'UTR           complement(194038..195989)
FT                   /gene="tfg2"
FT                   /gene_synonym="SPBC660.03c"
FT                   /locus_tag="SPBC1198.13c"
FT   CDS_pept        join(194678..194798,194845..195989)
FT                   /transl_table=1
FT                   /gene="mfr1"
FT                   /gene_synonym="SPBC660.02"
FT                   /locus_tag="SPBC1198.12"
FT                   /product="fizzy-related protein Mfr1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.12.1"
FT                   /db_xref="GOA:O94423"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC1198.12"
FT                   /db_xref="PomBase:SPBC1198.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94423"
FT                   /protein_id="CAB91187.1"
FT                   /translation="MGDRFIPIRNVSNEFNFSFQSFKECVLSHGSNLRRKTSGTIQRQF
FT                   MELLSMELFGSQASRSRAFYYGEDKRKIEKKMLDTPDRKSYSLSPISPQSQDMLRQPQK
FT                   PKRAFPKTPYKILDAPYLKNDFYLNLLDWGQSNVLAVGLASSIYLWSAASGKVVQLHDF
FT                   GATNHVTSVLWTGKGTQLAVGTDSGVIYIWDIESTKSVRSLKGHSERVAALAWNDNTLT
FT                   SGGKDEVILHHDLRAPGCCAEMMKVHEQEICGLQWDRSLGQLASGGNDNNLFVWDYRSS
FT                   RPLHKFEEHTAAVKAIGWSPHQRGILASGGGTIDRCLTIHNTLTGRLQNKLDTGSQVCN
FT                   MAWSKTSNEIVTTHGFAKNQVSLWKYPSLKNIANLTAHTNRVLYLSMSPDGQSIVTGAG
FT                   DETLRFWKLFNKKPKEESTLIR"
FT   CDS_pept        complement(join(195990..196244,196348..196491,
FT                   196551..197075))
FT                   /transl_table=1
FT                   /gene="tfg2"
FT                   /gene_synonym="SPBC660.03c"
FT                   /locus_tag="SPBC1198.13c"
FT                   /product="transcription factor TFIIF complex beta subunit
FT                   Tfg2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.13c.1"
FT                   /db_xref="GOA:O94424"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040450"
FT                   /db_xref="InterPro:IPR040504"
FT                   /db_xref="PomBase:SPBC1198.13c"
FT                   /db_xref="PomBase:SPBC1198.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94424"
FT                   /protein_id="CAB91188.1"
FT                   /translation="MSEEKPTVRTEEDDRYEDDAGDLDLGQIGSRVWLVKIPKFLMDKW
FT                   NSIPEDDAANLGCVRVKNDEIQLLLQNSPENADVPKIYNLRVMNKFVRNSYVFRESETS
FT                   SSMKSTALVGTVAHECNVSPVINDDYRRVMQKRALAASAPKRKVQMIDDRGGSLLAPGT
FT                   LGSRSRSTTSFIRNVKPRTGEGLKNSRIPRNELLDILFKCFEDYEYWTLKGLREYVKQP
FT                   EVYLKEVLDSIAILNKRGPYALKYSLKPEYKGTMDAASVELRNQQASQSESSSIDHTGK
FT                   NTSPDNPGTNAEEDEDDDGVEMIDVV"
FT   5'UTR           complement(197163..197189)
FT                   /gene="tfg2"
FT                   /gene_synonym="SPBC660.03c"
FT                   /locus_tag="SPBC1198.13c"
FT   misc_RNA        197369..200995
FT                   /locus_tag="SPNCRNA.1324"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(197660..198098)
FT                   /gene="fbp1"
FT                   /gene_synonym="SPBC660.04c"
FT                   /locus_tag="SPBC1198.14c"
FT   CDS_pept        complement(198099..199142)
FT                   /transl_table=1
FT                   /gene="fbp1"
FT                   /gene_synonym="SPBC660.04c"
FT                   /locus_tag="SPBC1198.14c"
FT                   /product="fructose-1,6-bisphosphatase Fbp1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1198.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1198.14c.1"
FT                   /db_xref="GOA:P09202"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="PomBase:SPBC1198.14c"
FT                   /db_xref="PomBase:SPBC1198.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09202"
FT                   /protein_id="CAB91189.2"
FT                   /translation="MKKDLDEIDTDIVTLSSFILQEQRRYNQKHKNEEGKPCIIQEASG
FT                   ELSLLLNSLQFSFKFIANTIRKAELVNLIGLSGIVNSTGDEQKKLDKICNDIFITAMKS
FT                   NGCCKLIVSEEEEDLIVVDSNGSYAVTCDPIDGSSNIDAGVSVGTIFGIYKLRPGSQGD
FT                   ISDVLRPGKEMVAAGYTMYGASAHLLLTTGHRVNGFTLDTDIGEFILTHRNMKMPLQHS
FT                   IYSINEGYTAFWDEKIARFIAHLKESTPDKKPYSARYIGSMVADMHRTILYGGLFAYPC
FT                   SKGNNGKLRLLYECFPMAFLVEQAGGIAVNDKGDRILDLVPKTLHGKSSIWLGSKHEVE
FT                   EYINFIK"
FT   5'UTR           complement(199143..199474)
FT                   /gene="fbp1"
FT                   /gene_synonym="SPBC660.04c"
FT                   /locus_tag="SPBC1198.14c"
FT   misc_RNA        complement(199409..200559)
FT                   /locus_tag="SPNCRNA.1325"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        complement(201348..201812)
FT                   /locus_tag="SPNCRNA.1326"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           202257..202535
FT                   /locus_tag="SPBC660.05"
FT   CDS_pept        202536..202967
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.05"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.05.1"
FT                   /db_xref="GOA:O94425"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="PomBase:SPBC660.05"
FT                   /db_xref="PomBase:SPBC660.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94425"
FT                   /protein_id="CAA22525.1"
FT                   /translation="MSVYQTYKGLPAGWVAQWDPTYQAYFYINETFEGAQPQWEPPIPG
FT                   LHIPPPPGTTTVVYQKDVPRSSDGSRSMTAGLGGFMVGALAGSVLRGHRAYYAPPPPRG
FT                   PLFGPRIGGGHHGPLHGPHGGFGGRGGGRMGGRGGRGRR"
FT   3'UTR           202968..203623
FT                   /locus_tag="SPBC660.05"
FT   5'UTR           204405..204648
FT                   /locus_tag="SPBC660.06"
FT   CDS_pept        204649..205470
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.06"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.06.1"
FT                   /db_xref="GOA:O94426"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="PomBase:SPBC660.06"
FT                   /db_xref="PomBase:SPBC660.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94426"
FT                   /protein_id="CAA22526.1"
FT                   /translation="MSVYQTREGLPSGWVAQWDAEYGTYFYVNESAQNPQPQWEPPVEN
FT                   LKLAPPPGATSVNTAVYNNNNNTSAANTNAAYNANTAANANANTATTTNAAATTSAAYN
FT                   PNAPANTNAAYYPNAAATTTTNADGSDKGLFSGLTSSNGYTTGNSYSRPSYVAPVAAGL
FT                   GGLALGGLASHALGNLFHHRGHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGG
FT                   HGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGPGW"
FT   3'UTR           205471..205721
FT                   /locus_tag="SPBC660.06"
FT   misc_RNA        complement(205583..206910)
FT                   /locus_tag="SPNCRNA.1327"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           206580..207077
FT                   /gene="ntp1"
FT                   /locus_tag="SPBC660.07"
FT   CDS_pept        207078..209285
FT                   /transl_table=1
FT                   /gene="ntp1"
FT                   /locus_tag="SPBC660.07"
FT                   /product="alpha,alpha-trehalase Ntp1"
FT                   /EC_number="3.2.1.28"
FT                   /db_xref="GOA:O42893"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011120"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42893"
FT                   /protein_id="CAA22527.1"
FT                   /translation="MPSKFSSKYVDTEAISNDDDNPFATAKSYYSKDTDLSTRVSAGRP
FT                   RTLSTSMEASAAPTIPELKNLRRRGSLDEHKQPRKFLVDVDKTLNALLESEDTDRNMQI
FT                   TIEDTGPKVVSLGSASSGGYRLYELRGTYQLSNLLQELTLAKDYGRRYILLDERRLNEN
FT                   PVNRLSRLIKGTFWDALTRRIDASVLDVICRDTKDRSGSHVNRIYVPKAEQEMYEYYVR
FT                   AAKERPYLNLQVEYLPEEITPEWVRDVNDKPGLLALAMEKYQDDEGNTHLRGVPFVVPG
FT                   GRFNELYGWDSYFESLGLLVDDRVDLAKGMVENFIFEITYYGKILNANRTYYLLRSQPP
FT                   FLTDMALRVYERIKNEEGSLDFLHRAFSATIKEYHTVWTATPRLDPKTGLSRYRPGGLG
FT                   IPPETEASHFEHLLRPYMEKYHMTLEEFTHAYNYQQIHEPALDEYFVHDRAVRESGHDT
FT                   TYRLEKVCADLATVDLNSLLYKYETDISHVILEYFDDKFVLPNGTIETSAIWDRRARAR
FT                   RAAMEKYLWSEADSMWYDYNTKLETKSTYESATAFWALWAGVATPRQAAKFVDVSLPKF
FT                   EVAGGIVAGTKRSLGKVGLDNPSRQWDYPNGWSPQQILAWYGLIRYGYEEETRRLVYRW
FT                   LYTITKSFVDFNGIVVEKYDLTRPVDPHRVEAEYGNQGVNIKGVAREGFGWVNASYEVG
FT                   LTFCNSHMRRALGACTTPDVFFAGIKEESLPAFENLSIHKN"
FT   3'UTR           209286..209641
FT                   /gene="ntp1"
FT                   /locus_tag="SPBC660.07"
FT   5'UTR           209756..209801
FT                   /locus_tag="SPBC660.08"
FT   CDS_pept        join(209802..209825,209922..211172)
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.08"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.08.1"
FT                   /db_xref="GOA:O94427"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="PomBase:SPBC660.08"
FT                   /db_xref="PomBase:SPBC660.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94427"
FT                   /protein_id="CAA22528.2"
FT                   /translation="MVRYSLRKAHEYARDGENQEVLGEISQAIMYYGLAKSQFEKICQN
FT                   TAQPLIKRCANNQIEELMVRIRELRESLPNKQTPISMSMSTRLSPMYTSSLTPRFTSNS
FT                   MVLPGDHNTTVRLKPSFREALMEDSEDDLYQMYSKFEMQVKKLSTNYGLAVAFSIVPMD
FT                   DDQPSPSIFSSDESFLIVEGDDFSLGNSVEEDANATSKEDPAYQNTNEQIQPLSNFDIS
FT                   QQEYLNNTRIPYENEDLHLQHITQGTTDDNNVSKFLIPSYNDAKELSEEEMGRSHKREE
FT                   SFKRAFGHASSSESSIGEITDSREDIQSNRLVNGSWENNDFTKEINNNFPDRSETPTLQ
FT                   TIEAPTKLMKYTRRKSLFRFPFFRSISGKKKEEPMESGTDSLESSTAQITVDSQLKIKQ
FT                   LETQIATLQKQLEQFQTSTLDQDLH"
FT   misc_RNA        complement(210126..211344)
FT                   /locus_tag="SPNCRNA.1328"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        211511..211858
FT                   /transl_table=1
FT                   /gene="mug168"
FT                   /locus_tag="SPBC660.09"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.09.1"
FT                   /db_xref="GOA:O94428"
FT                   /db_xref="PomBase:SPBC660.09"
FT                   /db_xref="PomBase:SPBC660.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94428"
FT                   /protein_id="CAA22529.1"
FT                   /translation="MRMDGSDFEDRKVSKPSPVLPFDVSNIGDLSQGVHSPLGISHFDS
FT                   KNPTPFGRSTKNSVYEYETVTPYSRFKVDKKFGSATSVSPVHTKAEEPGLGLTPMNSAD
FT                   FSNKIASRYRS"
FT   3'UTR           211859..212091
FT                   /gene="mug168"
FT                   /locus_tag="SPBC660.09"
FT   CDS_pept        join(212375..212491,212575..214899)
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.10"
FT                   /product="mitochondrial translation elongation factor G
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.10.1"
FT                   /db_xref="GOA:O94429"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030851"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="PomBase:SPBC660.10"
FT                   /db_xref="PomBase:SPBC660.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94429"
FT                   /protein_id="CAA22530.1"
FT                   /translation="MLRIVWKPLKIRLPVWRRYQSNISINSIRNVGIIAHIDAGKTTLT
FT                   EKMLYYGGFTSHFGNVDTGDTVMDYLPAERQRGITINSAAISFTWRNQRINLIDTPGHA
FT                   DFTFEVERSVAVLDGAVAIIDGSAGVEAQTKVVWKQATKRGIPKVIFVNKMDRVGSSLG
FT                   STIRSIYTNLDCPYPLVLQLPVYSDGLQERKFLGILDILQQKMILWDTSDNKLGTDGTH
FT                   VQELPIPESHMERFIEARNALVMSLCDVDETLCDEYLENEDSLAFTNDRLFKIIKQKTI
FT                   SGNVVPVLCGSSLKNIAVQPIMDAIIDYLPSPVEFYEKNASKETSSDKIISLDKRPLLA
FT                   KIFKVIHHASRGILTYVRVNEGTLSRGMMMFNPRTKKSERAIRLYNVFADQTQEVDCIS
FT                   AGNIGVISGIKQFHTGDIIINKENSKNFHEYLSGNQSVISIPEPVCIASIEPYSLKDEP
FT                   ALLEALANMNREDPSFRYTQDLENGQLLIQGMGIMHLQVSYERLVSEFGARASLGKVQV
FT                   GYRETLIDVSFNSVTLSTENKENLIINVYLIPISDEGDETLKKYFSEGEIQKVRSKGQE
FT                   DGVLFYGWKPENSCTLPDHLSFQRIQENIYFGIVAGLSHGPLHGFPLTNLQSFCTISSF
FT                   LSNDFPLSLLTQASMKATKNAVFSLYKRSPKSFRILEPYMDVTITTPEEYVGIVSKDLV
FT                   GKRGATIKEITEIGKNAASKDSQIAIGILGERYLPADEPSSVKANNASSLLQSSSVIKC
FT                   IRAQVPLEQILDYNSVISSLTKGNAKFLMSHPMESQTPKLVNYGSSFHPMSMQRQKRIF
FT                   P"
FT   5'UTR           215127..215143
FT                   /gene="tcg1"
FT                   /gene_synonym="mug187"
FT                   /locus_tag="SPBC660.11"
FT   CDS_pept        join(215144..215355,215606..215807,215861..216496)
FT                   /transl_table=1
FT                   /gene="tcg1"
FT                   /gene_synonym="mug187"
FT                   /locus_tag="SPBC660.11"
FT                   /product="single-stranded telomeric binding protein Tgc1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.11.1"
FT                   /db_xref="GOA:Q9HEQ9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PomBase:SPBC660.11"
FT                   /db_xref="PomBase:SPBC660.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HEQ9"
FT                   /protein_id="CAA22531.2"
FT                   /translation="MMSAEETVTQNAPNTVQDQVEASVDAAVHASAEQSNTPAQQADDF
FT                   RVFVGRLSTSTKKSEIRSLFETVGTVRKVTIPFRRVRRGTRLVPSGIAFVTFNNQEDVD
FT                   KAIETLNGKTLDDREIVVQKARPVQEQPIKDRKKSKNKNGEEPETSTSVENAESAKGSS
FT                   DENEANTATAPSSNEANGVDKKQNEIKGKGGSGKNKAKPLPPNSIYVSGLSVTLTNEGL
FT                   KEMFDAYNPTRARIAVRSLPPYIIRRIKLRGEQRRGRGFGFVSFANAEDQSRAIEEMNG
FT                   KQVGDLTLVVKSAVFREDKQNDENEKNENEPIEASESAPTNVSDSTEPKASEVDSEEKS
FT                   GVTASAITA"
FT   intron          215356..215605
FT                   /gene="tcg1"
FT                   /gene_synonym="mug187"
FT                   /locus_tag="SPBC660.11"
FT   3'UTR           complement(215522..217000)
FT                   /locus_tag="SPBC660.12c"
FT   intron          215808..215860
FT                   /gene="tcg1"
FT                   /gene_synonym="mug187"
FT                   /locus_tag="SPBC660.11"
FT   3'UTR           216497..216901
FT                   /gene="tcg1"
FT                   /gene_synonym="mug187"
FT                   /locus_tag="SPBC660.11"
FT   CDS_pept        complement(217001..218179)
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.12c"
FT                   /product="aminotransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.12c.1"
FT                   /db_xref="GOA:O94431"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PomBase:SPBC660.12c"
FT                   /db_xref="PomBase:SPBC660.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94431"
FT                   /protein_id="CAA22532.1"
FT                   /translation="MAENNVYGHEMKKHFMLDPDYVNVNNGSCGTESLAVYNKHVQLLK
FT                   EAQSKPDFMCNAYMPMYMEATRNEVAKLIGADSSNIVFCNSATDGISTVLLTFPWEQND
FT                   EILMLNVAYPTCTYAADFAKNQHNLRLDVIDVGVEIDEDLFLKEVEQRFLQSKPRAFIC
FT                   DILSSMPVILFPWEKVVKLCKKYNIVSIIDGAHAIGHIPMNLANVDPDFLFTNAHKWLN
FT                   SPAACTVLYVSAKNHNLIEALPLSYGYGLREKESIAVDTLTNRFVNSFKQDLPKFIAVG
FT                   EAIKFRKSIGGEEKIQQYCHEIALKGAEIISKELGTSFIKPPYPVAMVNVEVPLRNIPS
FT                   IETQKVFWPKYNTFLRFMEFKGKFYTRLSGAVYLEESDFYYIAKVIKDFCSL"
FT   misc_RNA        217881..218882
FT                   /locus_tag="SPNCRNA.1329"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           complement(218180..218682)
FT                   /locus_tag="SPBC660.12c"
FT   3'UTR           complement(219182..219361)
FT                   /gene="ssb1"
FT                   /gene_synonym="rpa1"
FT                   /gene_synonym="rad11"
FT                   /locus_tag="SPBC660.13c"
FT   CDS_pept        complement(join(219362..221150,221220..221260))
FT                   /transl_table=1
FT                   /gene="ssb1"
FT                   /gene_synonym="rpa1"
FT                   /gene_synonym="rad11"
FT                   /locus_tag="SPBC660.13c"
FT                   /product="DNA replication factor A subunit Ssb1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.13c.1"
FT                   /db_xref="GOA:Q92372"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR007199"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="PomBase:SPBC660.13c"
FT                   /db_xref="PomBase:SPBC660.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92372"
FT                   /protein_id="CAA22533.1"
FT                   /translation="MAERLSVGALRIINTSDASSFPPNPILQVLTVKELNSNPTSGAPK
FT                   RYRVVLSDSINYAQSMLSTQLNHLVAENKLQKGAFVQLTQFTVNVMKERKILIVLGLNV
FT                   LTELGVMDKIGNPAGLETVDALRQQQNEQNNASAPRTGISTSTNSFYGNNAAATAPAPP
FT                   PMMKKPAAPNSLSTIIYPIEGLSPYQNKWTIRARVTNKSEVKHWHNQRGEGKLFSVNLL
FT                   DESGEIRATGFNDQVDAFYDILQEGSVYYISRCRVNIAKKQYTNVQNEYELMFERDTEI
FT                   RKAEDQTAVPVAKFSFVSLQEVGDVAKDAVIDVIGVLQNVGPVQQITSRATSRGFDKRD
FT                   ITIVDQTGYEMRVTLWGKTAIEFSVSEESILAFKGVKVNDFQGRSLSMLTSSTMSVDPD
FT                   IQESHLLKGWYDGQGRGQEFAKHSVISSTLSTTGRSAERKNIAEVQAEHLGMSETPDYF
FT                   SLKGTIVYIRKKNVSYPACPAADCNKKVFDQGGSWRCEKCNKEYDAPQYRYIITIAVGD
FT                   HTGQLWLNVFDDVGKLIMHKTADELNDLQENDENAFMNCMAEACYMPYIFQCRAKQDNF
FT                   KGEMRVRYTVMSINQMDWKEESKRLINFIESAQ"
FT   intron          complement(221151..221219)
FT                   /gene="ssb1"
FT                   /gene_synonym="rpa1"
FT                   /gene_synonym="rad11"
FT                   /locus_tag="SPBC660.13c"
FT   5'UTR           complement(221261..221326)
FT                   /gene="ssb1"
FT                   /gene_synonym="rpa1"
FT                   /gene_synonym="rad11"
FT                   /locus_tag="SPBC660.13c"
FT   5'UTR           221358..221698
FT                   /gene="mik1"
FT                   /locus_tag="SPBC660.14"
FT   CDS_pept        join(221699..222907,222976..223512)
FT                   /transl_table=1
FT                   /gene="mik1"
FT                   /locus_tag="SPBC660.14"
FT                   /product="mitotic inhibitor kinase Mik1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.14.1"
FT                   /db_xref="GOA:P30290"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PomBase:SPBC660.14"
FT                   /db_xref="PomBase:SPBC660.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30290"
FT                   /protein_id="CAA22534.1"
FT                   /translation="MDSSTTIPITPTRTPCFFNISSSFNEHSPLNFYDEPIYNFSSGHE
FT                   ENQSHKSSKLTFFKPSNTKRSPHTPMQNNAKAIRLSTTVRHGIFKNSDLDGCSKPFAFS
FT                   SGLKLSKKIVDASTPIDLKRKRAVTSLSTGLLSKREKWSLWEGNLTNPRSEQPHTPCKK
FT                   GTKIKLKPPQSPLSPTTSLLARKCKHIDLDTFSRLDHPNSDSSDETFEMEELPSLSYGS
FT                   EDLLEFCETPCKSQPIFLSSSHVNNWDEKDVPSSLSWTPTSPIFLNINSADDYEEEEDW
FT                   TSDLRIRFQQVKPIHESDFSFVYHVSSINPPTETVYVVKMLKKNAAKFTGKERHLQEVS
FT                   ILQRLQACPFVVNLVNVWSYNDNIFLQLDYCENGDLSLFLSELGLLQVMDPFRVWKMLF
FT                   QLTQALNFIHLLEFVHLDVKPSNVLITRDGNLKLGDFGLATSLPVSSMVDLEGDRVYIA
FT                   PEILASHNYGKPADVYSLGLSMIEAATNVVLPENGVEWQRLRSGDYSNLPNLKDLLLSK
FT                   EKVQINKVRCAESLQCLLQRMTHPYVDCRPTTQDLLAMPEMIFISEHSQKAAIIYEDHN
FT                   SWLET"
FT   3'UTR           223513..224117
FT                   /gene="mik1"
FT                   /locus_tag="SPBC660.14"
FT   5'UTR           224297..224328
FT                   /locus_tag="SPBC660.15"
FT   CDS_pept        join(224329..224375,224424..224864,224937..224977,
FT                   225299..225462,225508..226239)
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.15"
FT                   /product="mRNA cleavage factor complex subunit (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.15.1"
FT                   /db_xref="GOA:O94432"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034155"
FT                   /db_xref="InterPro:IPR034156"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR037366"
FT                   /db_xref="PomBase:SPBC660.15"
FT                   /db_xref="PomBase:SPBC660.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94432"
FT                   /protein_id="CAA22535.1"
FT                   /translation="MGGSDFEDDELFKDLYGEENEKKVESASGNQETSNVTPTKENEGY
FT                   EELEKSGEAGAERTKENPFREEPGADFDRSGSDQQYSAEAEANQEDDLNETSQQAPDPS
FT                   SYDIRGQALSSATWDNAEDGENSKNDNYNENQSALTGSGAMESNEDNAEETSPFNREDG
FT                   KMFIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVMS
FT                   KEHHLDGKIIDPKRAIPREEQEKTAKMFVGGVPGDCTEEEFRNFFNQFGRVLDATLMMD
FT                   KDTGRPRGFGFVTYENESAVEATMSQPYITIHGKPVEVKRATPKASLRDSHDRHQHGYH
FT                   GNANPYYAQNMNMYGGMTPAMMAQYYRQMQQYMEAMRNMPAAAGAVPYPQPVMPAGMAD
FT                   WQQQQQQGAAYFDPSKMNQGTGDGVPFSPSMPSGSSRGGYHGRNPGGPNRQRYRGRRDG
FT                   RGGNTGGGHSFHPYRR"
FT   3'UTR           226240..228689
FT                   /locus_tag="SPBC660.15"
FT   misc_RNA        complement(227193..227448)
FT                   /locus_tag="SPNCRNA.1330"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        227372..227760
FT                   /gene="prl62"
FT                   /locus_tag="SPNCRNA.62"
FT                   /product="non-coding RNA, poly(A)-bearing (predicted)"
FT   misc_RNA        227377..227756
FT                   /locus_tag="SPNCRNA.101"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        227847..228309
FT                   /locus_tag="SPNCRNA.102"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           230269..230367
FT                   /locus_tag="SPBC660.16"
FT   CDS_pept        join(230368..230384,230446..230450,230616..230679,
FT                   231497..231564,231737..233061)
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.16"
FT                   /product="phosphogluconate dehydrogenase, decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.16.1"
FT                   /db_xref="GOA:P78812"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC660.16"
FT                   /db_xref="PomBase:SPBC660.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78812"
FT                   /protein_id="CAA22536.1"
FT                   /translation="MSQKEVADFGLIGLAVMGQNLILNGADKGFTVCCYNRTTSRVDEF
FT                   LANEAKGKSIVGAHSLEEFVSKLKKPRVCILLVKAGKPVDYLIEGLAPLLEKGDIIVDG
FT                   GNSHYPDTTRRCEELAKKGILFVGSGVSGGEEGARYGPSLMPGGNPAAWPRIKPIFQTL
FT                   AAKAGNNEPCCDWVGEQGAGHYVKMVHNGIEYGDMQLICETYDIMKRGLGMSCDEIADV
FT                   FEKWNTGKLDSFLIEITRDVLRYKADDGKPLVEKILDAAGQKGTGKWTAQNALEMGTPV
FT                   SLITEAVFARCLSSLKSERVRASKKLTGPNTKFTGDKKQLIDDLEDALYASKIISYAQG
FT                   FMLMREAAKEYGWKLNNAGIALMWRGGCIIRSVFLKDITEAFREDPNLESILFHPFFTN
FT                   GVEKAQAGWRRVVAQAAMLGIPVPATSTGLSFYDGYRSAVLPANLLQAQRDYFGAHTFR
FT                   VLPEAADKSLPADKDIHINWTGHGGNISATTYDA"
FT   intron          230385..230445
FT                   /locus_tag="SPBC660.16"
FT   intron          230451..230615
FT                   /locus_tag="SPBC660.16"
FT   intron          230680..231496
FT                   /locus_tag="SPBC660.16"
FT   intron          231565..231736
FT                   /locus_tag="SPBC660.16"
FT   3'UTR           233062..233218
FT                   /locus_tag="SPBC660.16"
FT   3'UTR           complement(233267..233633)
FT                   /locus_tag="SPBC660.17c"
FT   CDS_pept        complement(join(233634..234070,234167..234248))
FT                   /transl_table=1
FT                   /locus_tag="SPBC660.17c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC660.17c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC660.17c.1"
FT                   /db_xref="GOA:O94433"
FT                   /db_xref="PomBase:SPBC660.17c"
FT                   /db_xref="PomBase:SPBC660.17c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94433"
FT                   /protein_id="CAA22537.1"
FT                   /translation="MEQLRKRVVRFTNNDDDDFEPVFLNEQDQDAFVEQLRLTNNRDNR
FT                   MFSIIFSFLYLLLIVPLFLYPEYWAFKLVELLSLFYCAYVMYFLPLEVGLFNPKTPNKW
FT                   KFLFILNIGVTALITVLGWSQHTSFFYAFLNIRTLVCGITIFTEIARYSMYHSTLSVEK
FT                   LDEMRFAHM"
FT   intron          complement(234071..234166)
FT                   /locus_tag="SPBC660.17c"
FT   5'UTR           complement(234249..234309)
FT                   /locus_tag="SPBC660.17c"
FT   3'UTR           complement(234477..234502)
FT                   /gene="atg2"
FT                   /gene_synonym="mug36"
FT                   /gene_synonym="SPBC660.18c"
FT                   /locus_tag="SPBC31E1.01c"
FT   CDS_pept        complement(join(234503..234523,234594..239513))
FT                   /transl_table=1
FT                   /gene="atg2"
FT                   /gene_synonym="mug36"
FT                   /gene_synonym="SPBC660.18c"
FT                   /locus_tag="SPBC31E1.01c"
FT                   /product="autophagy associated protein Atg2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC31E1.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC31E1.01c.1"
FT                   /db_xref="GOA:O94649"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="InterPro:IPR026849"
FT                   /db_xref="InterPro:IPR026854"
FT                   /db_xref="InterPro:IPR026885"
FT                   /db_xref="InterPro:IPR026886"
FT                   /db_xref="PDB:6A9E"
FT                   /db_xref="PDB:6A9J"
FT                   /db_xref="PomBase:SPBC31E1.01c"
FT                   /db_xref="PomBase:SPBC31E1.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94649"
FT                   /protein_id="CAA22538.2"
FT                   /translation="MRLPSWLKNSSSWLWTAALSRTVQRRLLAFALRKLIGSILLENVQ
FT                   PEDIDILFSKGVLMLSNLQLNCSFLNAVVSLPMINFTKGTLRRLILRLNVTDIVNLNVE
FT                   LEVNGLSLEIELVPPDESLSSTTYEDAPSQLDILDNVVEYMNKTASQDFEDEVINEGLE
FT                   SEIDGSSHNLLDSILQKCLASTSVLMQDALVYIGTANMSTRLEAKLDFMSFSSVKSNST
FT                   SRLLNINGITVSMVRPISKSNAGSSSPPRSEESFVSMDSSSSIVEGFENDLSPSQVTLN
FT                   ESSIISSNREEESFYSVHDSVTQKKTRTSWLIFQCSGEFRLVFSIESSNLLVIESHVPS
FT                   CVLNINSQVIAFLLYLYGYFLPAPSTPGFSSNKPPLTMLQLDIHISSVQILTHCKLPES
FT                   QDFSMHNDVDELLHTIPSNGAVFEMKINQIQIFNDNNDIDELTMTFSDLDIFMDSVTLV
FT                   SFGKSLQSPCSLIFKKLERIVSLFIHIPGGEISLPLGKALLLQESFVEFTNDISNLQNF
FT                   LSNSDPFKRSIQETFEAPKPFEVEMNQPSFEIIALFDELQLQILNELSTQSLYKLTLRV
FT                   SHLQFTRKSTGSLSSVLIFVKKIGCQSELFNCENSDWTKVSSSTAFHLSNSLFETHDTT
FT                   GTSNFAVSIQQEKHYYPVFQPAPTEFSYPEKHFYFAVDNFNVFISKEVVRLFKTLYETI
FT                   ASSLVTPVTPNKLVTSDYKNVLKIRTRTFSLSLLNDDGSSFALKCIRIKHYMCWAGAQL
FT                   ISLSLRLYNVSAEYLSESLEILPVVSFIRNLRNDEKYLLNADFSYALKRSSGSNDNTIF
FT                   VKITDLGYEHYPTCPWISDLLKTYFPQDPEVPFLAFPDFPFNIKLDLRESIIGLNPRTL
FT                   EAKLLLYLKSLDVEIDALVASNPLNIRIMAAETVVYIIDKLNQSVLEGKTSVLKREILN
FT                   SSLHFPGLSIKDTIEFVVKSLGYVEISQLKNLTLSLVVNAEEGVFSTLITVDNLDAQVQ
FT                   SCADSTELLIKVLSDLGSTEDEEISDCYLALPIEDYAKSLTEVDYNFFENRGIDYKSNP
FT                   TEQSTVLVSSDNDISSQEIKIVDDYYISSNEHSTHASDLASVSSEEFVIDDGSSSIIDI
FT                   SDELQDESSSRDSLKKGIELIEDYYLSQSTSKLESSVEGKNYLLKVKFKDINVNWDLHD
FT                   GYDWEATRATISSAIEKLCDSSSQNDKISPEAKTLLFQSIVIKSFSKVGRLNINHVSEP
FT                   IDSDEFADYLSKSISYHLRLGKSKSKKIGIEIKDLQGSFTVYADSNEPNAVLNDLDIGL
FT                   KDLIIYDHLSTSTWNKFFGRDSRSPSSKNRNQHMNAQIVTVRPLPELNNRELRLEFSVL
FT                   PCKMYIDQDTLDFLIRFLTFQTPSSSETLNTEPDLPFFQSICINATHVTIDFKFKSADK
FT                   VGLRSGKLPDLGSLIVMQGSEVFLRQLQIYGLSGAEEFLNALLNVWLQDIRNNQLSKVL
FT                   NGVVPIRTMFTVGRGIKDIFVSPVRGLQGNHSVGSFRHGIIKFTEKYVNDFLSLNAQGA
FT                   TGTHSLLRQAESYLERGSNASASASRARSYYAEQPETIEQGLRQGYSGLKQGLLGAKST
FT                   LMGLPRETRSHKSLGGVAQTVGRKVPLIVLQPMIGATEAVSKTLLGLSNSLQPQRRQDM
FT                   REKYKRPG"
FT   5'UTR           complement(239514..239592)
FT                   /gene="atg2"
FT                   /gene_synonym="mug36"
FT                   /gene_synonym="SPBC660.18c"
FT                   /locus_tag="SPBC31E1.01c"
FT   3'UTR           complement(239838..240369)
FT                   /gene="pmr1"
FT                   /locus_tag="SPBC31E1.02c"
FT   CDS_pept        complement(240370..243069)
FT                   /transl_table=1
FT                   /gene="pmr1"
FT                   /locus_tag="SPBC31E1.02c"
FT                   /product="P-type ATPase, calcium transporting Pmr1"
FT                   /EC_number="3.6.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC31E1.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC31E1.02c.1"
FT                   /db_xref="GOA:O59868"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PomBase:SPBC31E1.02c"
FT                   /db_xref="PomBase:SPBC31E1.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59868"
FT                   /protein_id="CAB39136.1"
FT                   /translation="MSVQYDAFSVEQTCADLETDMYNGLSSLQEITRRNKVHGDNDLKV
FT                   EDEENMVVQFLKQFVKDPLILLLFASSAISVTLGNIDDAISIALAIVIVVTVGFVQEYR
FT                   SEQSLKALNNLVPHYCNVIRSGKTEHIVASKLVPGDLVILQIGDRVPADLRIVEATELE
FT                   IDESNLTGENSPRKKSSEAISSNISLTERNNIAFMGTLVRHGHGRGIVVATGSDTEFGR
FT                   VFLTMQQTEKPKTPLQNSMDDLGKQLSLISLIGIAVIVLVGFFQGKNWLEMLTIGVSLA
FT                   VAAIPEGLPIIVTVTLALGVLRMSKKRAIIRRLPSVETLGSVNVICSDKTGTLTMNHMT
FT                   VTKIYTCGMLAAFSLPESEHIELSVRRTVGIEKALLAAALCNNSKVHNKADSILDTTCP
FT                   WAGFPVDVALIECSERFGLKDPRETYSRISEVSFSSERKYMSVAVQYNSSKMNFMKGAT
FT                   EQVLSSCAYFSDQDGVQHELTAEMKENIQRNEFEMAASGLRIIAVASGINTNKLVFHGL
FT                   FGINDPPRPQVRESVQYLMTGGVRVIMITGDSVVTAISIARSLGMAIPSNDEEAIRNYA
FT                   LTGAQLDDLDSSSLRDAVSRVVVFARTTPQHKMKIVEALQSLGDVVAMTGDGVNDAPAL
FT                   KLADIGIAMGRQGTDVAKEAADMILTDDSFATILSAVEEGKGIFNNIKNFITFQLSTSV
FT                   AALSLIAISSVFGFQNPLNAMQILWINILMDGPPAQSLGVESVDEDVMMKPPRPRNAPI
FT                   ISVQLLQRVLLSAFIIVTVTIVVFRVQMQDGNVTARDTTMTFTCFVFFDMFNALACRSE
FT                   TKSVFKLGIFSNRMFNIAVGGSLIGQALVVYASPFQRIFQTEAIGLKDVLILLACTSSV
FT                   LWVDEIRKWYRRRKGLVRTKSNYLLRNV"
FT   5'UTR           complement(243070..243731)
FT                   /gene="pmr1"
FT                   /locus_tag="SPBC31E1.02c"
FT   3'UTR           complement(243966..244610)
FT                   /gene="hub1"
FT                   /gene_synonym="ubl4"
FT                   /locus_tag="SPBC31E1.03"
FT   CDS_pept        complement(join(244611..244713,244763..244864,
FT                   244935..244951))
FT                   /transl_table=1
FT                   /gene="hub1"
FT                   /gene_synonym="ubl4"
FT                   /locus_tag="SPBC31E1.03"
FT                   /product="ubiquitin-like protein modifier Hub1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC31E1.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC31E1.03.1"
FT                   /db_xref="GOA:O94650"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR039732"
FT                   /db_xref="PomBase:SPBC31E1.03"
FT                   /db_xref="PomBase:SPBC31E1.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94650"
FT                   /protein_id="CAB39137.1"
FT                   /translation="MIEVLCNDRLGKKVRVKCMPDDTVGDFKKLVAAQTGTDPRRIVLK
FT                   KWHSVFKDNITLADYEIHDGMSLEMYYS"
FT   5'UTR           complement(244952..245183)
FT                   /gene="hub1"
FT                   /gene_synonym="ubl4"
FT                   /locus_tag="SPBC31E1.03"
FT   5'UTR           245469..245717
FT                   /gene="pep12"
FT                   /locus_tag="SPBC31E1.04"
FT   CDS_pept        join(245718..246297,246428..246639)
FT                   /transl_table=1
FT                   /gene="pep12"
FT                   /locus_tag="SPBC31E1.04"
FT                   /product="SNARE Pep12"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC31E1.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC31E1.04.1"
FT                   /db_xref="GOA:O94651"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="PomBase:SPBC31E1.04"
FT                   /db_xref="PomBase:SPBC31E1.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94651"
FT                   /protein_id="CAB39138.2"
FT                   /translation="MSFVDLEQGRHKIEQNGDFPALASSIAQEIHALRGNTAAIHRYLV
FT                   NNLTKNLHEVLEQSRELSQKVRSDLVRLANIKDTKYGEEASSFALSKLTRDFNTVLAEL
FT                   QRVQQKCAQQESDSVAAAQAALNQDVGQHFIEEEERNVSLSNNSSGQRQPLTESKISNS
FT                   QLEYQQRLINERQGEIENLTQGINELNEIFRDLSTIINEQGELVTNIEYNVGNTSTNTK
FT                   NASRQLQIANEHSRKARKRSFCFLVILVVILGVILTALIMG"
FT   3'UTR           246640..247128
FT                   /gene="pep12"
FT                   /locus_tag="SPBC31E1.04"
FT   5'UTR           247207..247260
FT                   /gene="gle1"
FT                   /locus_tag="SPBC31E1.05"
FT   CDS_pept        join(247261..247398,247449..248753)
FT                   /transl_table=1
FT                   /gene="gle1"
FT                   /locus_tag="SPBC31E1.05"
FT                   /product="RNA export factor, cytoplasmic nucleoporin Gle1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC31E1.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC31E1.05.1"
FT                   /db_xref="GOA:O94652"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="InterPro:IPR038506"
FT                   /db_xref="PomBase:SPBC31E1.05"
FT                   /db_xref="PomBase:SPBC31E1.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94652"
FT                   /protein_id="CAB39139.1"
FT                   /translation="MDTKTTPLIHAKLDEKIISSYNDANGLDIDDLWDIYNEKTRRMIH
FT                   IISQRYKPKKQSPFPVIADENVRIFPPLHKTIDWAKKRNVEEQNLIEQSITESQRIFSE
FT                   KQRLEQERFNRELLEKKRIEAERQRLKDEEERRKKELMEKEKKEKERIRLIEEQKHKEN
FT                   EQRRLKQEQIDAKRKEEEAREKRMKETFKDDPEEDSNMAWSIIHKIKTEVVAPISEKKE
FT                   LKNYCFTQKRKITPRLGQITKSNSQIMKITQLLQQTFQEARNTDPLVYKWVLNFFCKSV
FT                   VKQAEAEVAVNPISAYPLAKVCLLLQTQNADLKDLLFARLQKNCPWVIPFWYDHGTENG
FT                   KKKMGFKKLSDGHWEQNTTYNERQCGIFAVYAAILSLDDSLAPESWRTFSRLLNLPSPS
FT                   QLMKSDLELGQTLCSIVSTYLDIAGQSLLRIYGRQAKKLIVCSFSEAYLGANGGGSQYG
FT                   RLRIVGEDWMKGQGGLKFSFEP"
FT   3'UTR           248754..248977
FT                   /gene="gle1"
FT                   /locus_tag="SPBC31E1.05"
FT   5'UTR           249041..249086
FT                   /gene="bms1"
FT                   /gene_synonym="SPBC800.01"
FT                   /locus_tag="SPBC31E1.06"
FT   CDS_pept        join(249087..249188,249236..252499)
FT                   /transl_table=1
FT                   /gene="bms1"
FT                   /gene_synonym="SPBC800.01"
FT                   /locus_tag="SPBC31E1.06"
FT                   /product="GTP binding protein Bms1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC31E1.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC31E1.06.1"
FT                   /db_xref="GOA:O94653"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030387"
FT                   /db_xref="InterPro:IPR037875"
FT                   /db_xref="InterPro:IPR039761"
FT                   /db_xref="PomBase:SPBC31E1.06"
FT                   /db_xref="PomBase:SPBC31E1.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94653"
FT                   /protein_id="CAB39140.2"
FT                   /translation="MDEKKGHYAKHSGPKAEKKKLKKVSDGSASNNPKAFAVASAGRMA
FT                   RQAMRTADISQKKLHVPMVDRTPDEAPPPVIVAVMGPPGTGKSTLIKSLVRRYSKYTIS
FT                   QITGPITVVAGKKRRITFLECPNDLSSMIDVAKIADLVLLLIDANFGFEMETMEFLNIL
FT                   APHGMPRIMGVLTHLDLFKKTSTLREAKKRLKHRFWTELYQGAKLFYLSGVLNGRYPDR
FT                   EILNLSRFISVMKFRPLRWRNQHPYLLADRMEDLTLPVDIEQNPKVGRKITLYGYLHGT
FT                   NLPKHDASVHIPGVGDFVTSDVSSLEDPCPPPDADKVRRRRLSEKQKLIYGPMADIGGI
FT                   LFDKDRVYIEVPTSNFSKDENSEAGFGERMVMQLQEAQQPLGVDGNSGLQLFSNSDAID
FT                   TVDRESSEIDNVGRKTRRQPTGLINQELIKEDEGAFDDSDVNSADENEDVDFTGKIGAI
FT                   NNEDESDNEEVAFADSDSDLGGQFDDEDSNLRWKEGLASKAALAYSQSGKRRRNIQKIF
FT                   YDESLSPKDAYAEYKGESAKSSESDLVVSDDEEDFFKVSKVANESISSNHEKLMESESD
FT                   RLSKKWENPQLLAQLKSRFITGSLLDSIEGQEEVSQDDEEGDFEDLEDEENSSDNEMEE
FT                   SSGSSVTAENEESADEVDFQTEREENARKKEELRLRFEEEDRGDPEKKDVDWYTEEKEK
FT                   IARQLVINREAFEDMDPESRAEIEGYRAGTYVRIVINDVPFEFVEHFDSRYPVVVGGLL
FT                   PNEQRYGLVQVRIKRHRWHKKILKTNDPLIFSMGWRRFQSIPVYSISDSRTRNRMLKYT
FT                   PEHMHCFGTFYGPFVAPNSGFCAVQSVANSFAKAGSFRIAATGSVLNIDQSTDIVKKLK
FT                   LTGVPYKIFKNTAFIKKMFSSPLEVAKFEGANIRTVSGIRGQVKKAVDQEHGHFRATFE
FT                   DKILMSDIVFLRAWYPVQVRKFCTMVTNLLETDKTEWNGMRLTGEVRHELGLKTPLRPN
FT                   SQYQEIVRPSRHFNPLKVPASLQAQLPFNSRQKALRPRSKPTYMQKRTVLLNAEERKVR
FT                   DLLQKVMTLHTDKEAKRKAKKAAEHERYHKRMQKEEQAYIEKKREEKAEWFAQHGKRLR
FT                   QDGNSSGSGKRSKN"
FT   3'UTR           252500..252682
FT                   /gene="bms1"
FT                   /gene_synonym="SPBC800.01"
FT                   /locus_tag="SPBC31E1.06"
FT   CDS_pept        join(253148..253231,253310..253984)
FT                   /transl_table=1
FT                   /gene="whi5"
FT                   /gene_synonym="mug54"
FT                   /locus_tag="SPBC800.02"
FT                   /product="cell cycle transcriptional repressor Whi5
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.02.1"
FT                   /db_xref="GOA:Q9HGL9"
FT                   /db_xref="InterPro:IPR013734"
FT                   /db_xref="InterPro:IPR039198"
FT                   /db_xref="PomBase:SPBC800.02"
FT                   /db_xref="PomBase:SPBC800.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL9"
FT                   /protein_id="CAC01517.1"
FT                   /translation="MAGGHKKNEATRQTDEVIQQKYDESLSKHKNRCELSLTFEYKLSN
FT                   KLRARLKAAFFKVDHGWEDQTLDQVETLVRKENHVHRRSRSINDLDSSKLRRPHHPNSI
FT                   MGSNTGKLRASSFTRLVSPREGFAQLPYKKPVSPYSSSSAVSSTSSSFDRTSPPWLNYV
FT                   EPHTELPRLPFELSHASTASAKSPLFGMNYHISRPEETDESLRLGTANLSRIRKSTSLP
FT                   FPTAYPLSADDCKAAEVMLTLVNSMPSKKP"
FT   misc_RNA        complement(254617..257138)
FT                   /locus_tag="SPNCRNA.1331"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           254715..254821
FT                   /gene="clr3"
FT                   /locus_tag="SPBC800.03"
FT   CDS_pept        254822..256885
FT                   /transl_table=1
FT                   /gene="clr3"
FT                   /locus_tag="SPBC800.03"
FT                   /product="histone deacetylase (class II) Clr3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.03.1"
FT                   /db_xref="GOA:P56523"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR017321"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="PDB:5IKK"
FT                   /db_xref="PomBase:SPBC800.03"
FT                   /db_xref="PomBase:SPBC800.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56523"
FT                   /protein_id="CAC01518.1"
FT                   /translation="MLASNSDGASTSVKPSDDAVNTVTPWSILLTNNKPMSGSENTLNN
FT                   ESHEMSQILKKSGLCYDPRMRFHATLSEVDDHPEDPRRVLRVFEAIKKAGYVSNVPSPS
FT                   DVFLRIPAREATLEELLQVHSQEMYDRVTNTEKMSHEDLANLEKISDSLYYNNESAFCA
FT                   RLACGSAIETCTAVVTGQVKNAFAVVRPPGHHAEPHKPGGFCLFNNVSVTARSMLQRFP
FT                   DKIKRVLIVDWDIHHGNGTQMAFYDDPNVLYVSLHRYENGRFYPGTNYGCAENCGEGPG
FT                   LGRTVNIPWSCAGMGDGDYIYAFQRVVMPVAYEFDPDLVIVSCGFDAAAGDHIGQFLLT
FT                   PAAYAHMTQMLMGLADGKVFISLEGGYNLDSISTSALAVAQSLLGIPPGRLHTTYACPQ
FT                   AVATINHVTKIQSQYWRCMRPKHFDANPKDAHVDRLHDVIRTYQAKKLFEDWKITNMPI
FT                   LRDSVSNVFNNQVLCSSNFFQKDNLLVIVHESPRVLGNGTSETNVLNLNDSLLVDPVSL
FT                   YVEWAMQQDWGLIDINIPEVVTDGENAPVDILSEVKELCLYVWDNYVELSISKNIFFIG
FT                   GGKAVHGLVNLASSRNVSDRVKCMVNFLGTEPLVGLKTASEEDLPTWYYRHSLVFVSSS
FT                   NECWKKAKRAKRRYGRLMQSEHTETSDMMEQHYRAVTQYLLHLLQKARPTSQ"
FT   3'UTR           256886..257138
FT                   /gene="clr3"
FT                   /locus_tag="SPBC800.03"
FT   tRNA            257454..257525
FT                   /locus_tag="SPBTRNAGLN.01"
FT                   /product="tRNA Glutamine"
FT   tRNA            complement(257908..257979)
FT                   /locus_tag="SPBTRNAGLN.02"
FT                   /product="tRNA Glutamine"
FT   tRNA            complement(258848..258919)
FT                   /locus_tag="SPBTRNAGLN.03"
FT                   /product="tRNA Glutamine"
FT   3'UTR           complement(259506..259576)
FT                   /gene="rpl4301"
FT                   /gene_synonym="rpl43-1"
FT                   /gene_synonym="rpl43"
FT                   /gene_synonym="rpl37a-1"
FT                   /locus_tag="SPBC800.04c"
FT   CDS_pept        complement(join(259577..259704,259805..259961))
FT                   /transl_table=1
FT                   /gene="rpl4301"
FT                   /gene_synonym="rpl43-1"
FT                   /gene_synonym="rpl43"
FT                   /gene_synonym="rpl37a-1"
FT                   /locus_tag="SPBC800.04c"
FT                   /product="60S ribosomal protein L37a (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.04c.1"
FT                   /db_xref="GOA:Q9HGL8"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="PomBase:SPBC800.04c"
FT                   /db_xref="PomBase:SPBC800.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL8"
FT                   /protein_id="CAC01519.1"
FT                   /translation="MTKRTKKVGVTGKYGVRYGASLRRDVRKIEVQQHSRYQCPFCGRN
FT                   TVKRTAAGIWCCNGKGCKKVLAGGAWTVTTAAATSARSTIRRLREMVEV"
FT   intron          complement(259705..259804)
FT                   /gene="rpl4301"
FT                   /gene_synonym="rpl43-1"
FT                   /gene_synonym="rpl43"
FT                   /gene_synonym="rpl37a-1"
FT                   /locus_tag="SPBC800.04c"
FT   5'UTR           complement(259962..260025)
FT                   /gene="rpl4301"
FT                   /gene_synonym="rpl43-1"
FT                   /gene_synonym="rpl43"
FT                   /gene_synonym="rpl37a-1"
FT                   /locus_tag="SPBC800.04c"
FT   3'UTR           complement(260309..260724)
FT                   /gene="atb2"
FT                   /gene_synonym="tub1"
FT                   /gene_synonym="alp2"
FT                   /gene_synonym="ban5"
FT                   /locus_tag="SPBC800.05c"
FT   CDS_pept        complement(260725..262074)
FT                   /transl_table=1
FT                   /gene="atb2"
FT                   /gene_synonym="tub1"
FT                   /gene_synonym="alp2"
FT                   /gene_synonym="ban5"
FT                   /locus_tag="SPBC800.05c"
FT                   /product="tubulin alpha 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.05c.1"
FT                   /db_xref="GOA:P04689"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="PomBase:SPBC800.05c"
FT                   /db_xref="PomBase:SPBC800.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04689"
FT                   /protein_id="CAC01520.1"
FT                   /translation="MREIISIHVGQAGTQIGNACWELYCLEHGIQPNGYMNPETASQNS
FT                   DGGFSTFFSETGQGKYVPRSIYVDLEPNVIDQVRTGPYRDLFHPEQLITGKEDASNNYA
FT                   RGHYTVGKELVDEVTDKIRRIADNCSGLQGFLVFHSFGGGTGSGFGALLLERLAMEYTK
FT                   KSKLQFSVYPAPQVSTSVVEPYNSVLTTHATLDLADCTFMVDNESCYDICRRNLDIERP
FT                   SYENLNRLIAQVVSSITASLRFEGSLNVDLAEFQTNLVPYPRIHFPLVTYAPIVSAAKA
FT                   FHESNSVQEITNQCFEPYNQMVKCDPRAGRYMATCLLYRGDVIPRDVQAAVTTIKAKRT
FT                   IQFVDWCPTGFKIGICDRPPQHIEGSEIAKVDRAVCMLSNTTSIAEAWSRLDHKFDLMY
FT                   SKRAFVHWYVGEGMEEGEFSEAREDLAALERDYEEVGQDSMEVDYMEEEY"
FT   5'UTR           complement(262075..262185)
FT                   /gene="atb2"
FT                   /gene_synonym="tub1"
FT                   /gene_synonym="alp2"
FT                   /gene_synonym="ban5"
FT                   /locus_tag="SPBC800.05c"
FT   misc_RNA        complement(262125..263868)
FT                   /locus_tag="SPNCRNA.1332"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           262562..262762
FT                   /gene="brx1"
FT                   /locus_tag="SPBC800.06"
FT   CDS_pept        262763..263650
FT                   /transl_table=1
FT                   /gene="brx1"
FT                   /locus_tag="SPBC800.06"
FT                   /product="ribosome biogenesis protein Brx1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.06.1"
FT                   /db_xref="GOA:Q9HGL6"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR026532"
FT                   /db_xref="PomBase:SPBC800.06"
FT                   /db_xref="PomBase:SPBC800.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL6"
FT                   /protein_id="CAC01521.1"
FT                   /translation="MSTVYKLKTSERAPKNEDEDEEYVPVQNGQGNKHSAGFVPIKQKV
FT                   LVLSSRGVTYRQRHLLNDLVSMMPHSKKDSKLDSKDRLYQLNELAELYNCNNIFFFESR
FT                   RREDLYLHIARAPNGPTVKFHVENLHTMDELNMTGNALKGSRPILSFDKTFDTAPHLKV
FT                   VKELLQQTFGIPKGARRSKPFIDRVCTLTIADGKIWFRNYEIRENEDKSKDPVTLIEIG
FT                   PRFVMTIINILEGSFGGPVIYKNDTFVSSTMVRAAIRNQAAQRYVNRQESKLERQVRAQ
FT                   QNVIPEDPLDNVFA"
FT   3'UTR           263651..263669
FT                   /gene="brx1"
FT                   /locus_tag="SPBC800.06"
FT   3'UTR           complement(263802..263914)
FT                   /gene="tsf1"
FT                   /locus_tag="SPBC800.07c"
FT   CDS_pept        complement(263915..264814)
FT                   /transl_table=1
FT                   /gene="tsf1"
FT                   /locus_tag="SPBC800.07c"
FT                   /product="mitochondrial translation elongation factor EF-Ts
FT                   Tsf1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.07c.1"
FT                   /db_xref="GOA:Q9HGL5"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="PomBase:SPBC800.07c"
FT                   /db_xref="PomBase:SPBC800.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL5"
FT                   /protein_id="CAC01522.1"
FT                   /translation="MLFQRRLHFHQFFGKTRVTGSLSRQWYSKLPSKLADIKKLRSETN
FT                   ASMDLVKQSVEEAGVGNLELAREILKKKIVQRGGKLAEKSKNRTAKEGWIIQCISEDGR
FT                   KAVMAEINCESDFVAQTTPFQDLARRIASTFLHYLPTNHSSYSVEATLKNEILKHQAYV
FT                   SKNHEANEKDVSSNVSLEEEIVKMTSFTGEKVQVQRLHCMNARVPSTAIGIFSHGAKQS
FT                   SPLQQLGRIGSMVQINSDLSTRKGLSNQIAKEIVAQDPSSTSELLSFRSLVDSEKTIKD
FT                   VLGQSTILEWVRWERGGN"
FT   5'UTR           complement(264815..266793)
FT                   /gene="tsf1"
FT                   /locus_tag="SPBC800.07c"
FT   5'UTR           265305..265373
FT                   /gene="gcd10"
FT                   /locus_tag="SPBC800.08"
FT   CDS_pept        join(265374..265468,265605..266898)
FT                   /transl_table=1
FT                   /gene="gcd10"
FT                   /locus_tag="SPBC800.08"
FT                   /product="tRNA (m1A) methyltransferase, translation
FT                   initiation factor eIF-3 gamma subunit Gcd10 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.08.1"
FT                   /db_xref="GOA:Q9HGL4"
FT                   /db_xref="InterPro:IPR017423"
FT                   /db_xref="PomBase:SPBC800.08"
FT                   /db_xref="PomBase:SPBC800.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL4"
FT                   /protein_id="CAC01523.1"
FT                   /translation="MLRHASTISENSSVFIKLPSDNVRFVTLKPNNTIHLGKFGSFLAD
FT                   DLFGKHFDETFEIYQPKKIRVLKTREVQYIEEEKKTNQELNDCRGNQLMTQEEIDELRA
FT                   NIKAGGLRAEEAIKQLTNSSKTFEQKTLFAQEKYVTRKGEKYLQRFQVLRPCVEVVANY
FT                   MIEHDPYKILDLTAECISLMLTLGNVKPGGRYLVVDETGCMFLGSLIDRVAGDCKITLV
FT                   HPNEQPNSSCLEYWGQDFKEDSLVQKGILKTLNWYQVTNPTETLSEYSVEDIPESELNE
FT                   MKLRHRKRYETKKATFNRLKNTIDDFESGNYDALFILSIHTPMSVLQHLLPKLGISRPF
FT                   MVYSTYQQVLVETYHQLSKWDNLFVEKTAQSTENDEKVDQGDVAIDTQKEKVIMLDIHE
FT                   IRTRPYQVLPERTHPFMTVRGDMGFVLSGIKVLTSDSNLAAGRFPKRKGQKETSSVKKA
FT                   KLEN"
FT   3'UTR           266899..267229
FT                   /gene="gcd10"
FT                   /locus_tag="SPBC800.08"
FT   5'UTR           267459..267489
FT                   /gene="sum2"
FT                   /locus_tag="SPBC800.09"
FT   CDS_pept        join(267490..267542,267581..267639,267678..267859,
FT                   267968..268954)
FT                   /transl_table=1
FT                   /gene="sum2"
FT                   /locus_tag="SPBC800.09"
FT                   /product="G2/M transition checkpoint protein Sum2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.09.1"
FT                   /db_xref="GOA:Q9HGL3"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="InterPro:IPR025609"
FT                   /db_xref="InterPro:IPR025761"
FT                   /db_xref="InterPro:IPR025762"
FT                   /db_xref="InterPro:IPR025768"
FT                   /db_xref="PomBase:SPBC800.09"
FT                   /db_xref="PomBase:SPBC800.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL3"
FT                   /protein_id="CAC01524.1"
FT                   /translation="MTEFIGSRISLISKSDIRYVGILQDINSQDSTLALKHVRWCGTEG
FT                   RKQDPSQEIPPSDNVFDYIVFRGSDVKDLRIEEPATTPSAPPVQPPNDPAIIGSNSGQY
FT                   NWNQAQTAQPPQPVQPNPYGAPYQQAPPAGAPYYMYPNAPAQFVPPGGLPLGTPLDAST
FT                   PAVPYYGAPDQQQMGQRPEFAQNVSQGFAGQAPYNVRPGYGMPSNQKPPNFAPGMPAPG
FT                   PTAVSASPSLQSMPPTNGVIPGAQPSIEASIEKESTSIRNSTVTNDRVVNTTVDVSQSQ
FT                   TVETSGPSKEVPTTQPDASAAKPRTEFDFQTANQKFQSMKDDLLKGKNDEEAEEFYKPK
FT                   QSFFDNISCESKEKGMEAADRRALRDRERSLNMETFGVAGSGNRGRRGRGRGRGGRGRG
FT                   RGYARNQYNQYRNSNGSQPRAQPANDQ"
FT   intron          267543..267580
FT                   /gene="sum2"
FT                   /locus_tag="SPBC800.09"
FT   intron          267640..267677
FT                   /gene="sum2"
FT                   /locus_tag="SPBC800.09"
FT   intron          267860..267967
FT                   /gene="sum2"
FT                   /locus_tag="SPBC800.09"
FT   3'UTR           268955..269408
FT                   /gene="sum2"
FT                   /locus_tag="SPBC800.09"
FT   3'UTR           complement(269636..269706)
FT                   /locus_tag="SPBC800.14c"
FT   CDS_pept        complement(269707..270189)
FT                   /transl_table=1
FT                   /locus_tag="SPBC800.14c"
FT                   /product="DUF1772 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.14c.1"
FT                   /db_xref="GOA:Q9C0W5"
FT                   /db_xref="PomBase:SPBC800.14c"
FT                   /db_xref="PomBase:SPBC800.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0W5"
FT                   /protein_id="CAC35000.1"
FT                   /translation="MSLVYLFQSVGILTPCGSAGAIAYITSQVLPAILIGPADVALAQW
FT                   KYIYSMGKKSFPFLAIANALVQGYLSYSERKRSIFSSKLYAISALSGLCIIPFTLLFMK
FT                   KDINSLQTLNPDLILKDVKATQNFRSIIHRWGFKNLFRSAFMFFSGLASIAGSIYF"
FT   5'UTR           complement(270190..270292)
FT                   /locus_tag="SPBC800.14c"
FT   3'UTR           complement(270448..270986)
FT                   /locus_tag="SPBC800.10c"
FT   CDS_pept        complement(270987..274337)
FT                   /transl_table=1
FT                   /locus_tag="SPBC800.10c"
FT                   /product="EPS15 repeat family actin cortical patch
FT                   component (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.10c.1"
FT                   /db_xref="GOA:Q9HGL2"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="PomBase:SPBC800.10c"
FT                   /db_xref="PomBase:SPBC800.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL2"
FT                   /protein_id="CAC01525.1"
FT                   /translation="MSLNLSAEEQTAFDQLFKIADKQDIGVITGEEAVPFLEKSGLAPQ
FT                   VLGQIWQIADAENRGFLTFSGFVIAMRLVALAQEKLPFDYKKSGKIPYFADIHISGVDS
FT                   SKFVQLNRPNNVSSGDGSDGSFLPPISSDEMTRYQQMFTTVCPTDGLMDGDRASSIFGR
FT                   APLSTEILARVWNLVDTHKRGALDIREFNTGMHIINLLLNGSLKSPPVSISPSFIASAA
FT                   STSSVSAPSQYPGLSRSPPVQAPNIPVSDPWAIPSQDLTSFCQLFSNVDKAHKGYVSGS
FT                   EAYSFFLASKLPEDVLAQIWDLSDTNSNGKLNIGEFCISLYLIKLKLSGKELPKVLPSS
FT                   MLSSVAPLMQKSKSVPTSIPSVVPANISSPNPNPTLAPNPTGPSRVTSGTEDLLSLDAT
FT                   PFSPTLAPQHTSSNATKHSAPPVTKSAPFPVVSPLQLNHTPGFPTSPAAKPNSPTSTFF
FT                   PQSSFGQTIAKNTMDKPSAVRTSVPSQLAAPIPQVASAEQLKLAAEVPKLESQLSQVKK
FT                   SNDDLQKSSRDVAANLSDVKAKVSEIRKAYDEELAKAKQISLDIETNKAQTEQVNREYS
FT                   ILEATLNALQKQNKQKGEVLEQVVAESEAAKNMVESSNASIQQLKSEVADKEQTLAQLH
FT                   LQLDEMTQRLVSLDEESKAVSQRKLDLEYKINNSKTQLATATEEYHEHSKQLEAEKQEL
FT                   SKLEDGLKSVNLTEEAPKPEVDSTPRFPSFTSNGITTDKPTLPDTTSSVPTQHNSFDAM
FT                   HNTLRSPSLNSNNSSAHASTVSRNPFHNLKISGASSPVSNFWESEFASAVFPRSISKTT
FT                   SLSVNNSSVNPSLDSEPVQLSNMEEPQHQDSSVVDVSTSASQRGSPVLSDLSKLTGSAR
FT                   NTAEPVENTSAEPIENTSAPTPFEIANKQQATEPISAPFATETISTPAPVKPPVPPSRR
FT                   DRSAQDGVVQQATPHIQDEFPPIQFNEIDDDESSSDEEPPMSNLSPQISIGSVTNYTSA
FT                   VTELPDPNHQLEMSTTTHVQHPNSETIPSSTENQYFDTTSGAFEANSNTEVTVNSNEVS
FT                   QPFDFDTANESDNDDDELPVQQVVSGSLANDAFNVDDEFDNQFANLQAAEIKDDDNSST
FT                   DEEEHAGHH"
FT   5'UTR           complement(274338..274542)
FT                   /locus_tag="SPBC800.10c"
FT   misc_RNA        274712..275245
FT                   /locus_tag="SPNCRNA.1333"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        274745..275832
FT                   /gene_synonym="SPNG1162"
FT                   /locus_tag="SPNCRNA.299"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(275118..275866)
FT                   /locus_tag="SPNCRNA.1334"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           275388..275906
FT                   /locus_tag="SPBC800.11"
FT   CDS_pept        275907..277076
FT                   /transl_table=1
FT                   /locus_tag="SPBC800.11"
FT                   /product="inosine-uridine preferring nucleoside hydrolase
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.11.1"
FT                   /db_xref="GOA:Q9HGL1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="PomBase:SPBC800.11"
FT                   /db_xref="PomBase:SPBC800.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL1"
FT                   /protein_id="CAC01526.1"
FT                   /translation="MHFAKLGAIGLLGSIICAYAASAASKVIIDNDGLTDLQVLFALQA
FT                   KQQILGVTAIYGDYTLDDSLFLASDVLSTGNLTYCIPSFAGAAQPLLRTNNTFQIWQEL
FT                   YGSYVWQGYWQPEYETANTNNESYIYNTQISAAQFIIDMVKANPNEITIVAAGPMTNLA
FT                   IALSIWPDLAKNTKSLVIMGGYVDSQIAQVTGGDFLNDMYSDFNLFMEPEAAQTAITAD
FT                   WPELIIAGNITSQVYPSQSLYNGIIARAGGMANIESDSGLSYAKQFVGNGTLPSGSFPF
FT                   WDEVASAIAAWPEIVNSSYDAYVSVDTAYDSPFYGSLRMVPADLVPKKGVRTAKASMIT
FT                   GINVAMFYQKIYDSLTAEYSSYCMNGTIITPSNITISNTTNTTNTTGFY"
FT   3'UTR           277077..277238
FT                   /locus_tag="SPBC800.11"
FT   3'UTR           complement(277941..278246)
FT                   /locus_tag="SPBC800.12c"
FT   misc_RNA        278235..279160
FT                   /locus_tag="SPNCRNA.1335"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(join(278247..278488,278530..278593,
FT                   278651..278758))
FT                   /transl_table=1
FT                   /locus_tag="SPBC800.12c"
FT                   /product="ubiquitin family protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC800.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC800.12c.1"
FT                   /db_xref="GOA:Q9HGL0"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PomBase:SPBC800.12c"
FT                   /db_xref="PomBase:SPBC800.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGL0"
FT                   /protein_id="CAC01527.1"
FT                   /translation="MSEVQIVKSFLEELSKTPRNHPDSIPIEKIDETAISITIPAPLVE
FT                   FQGNLALFEEKKVHVVAKTVRPPIQQASTEINVQSTILELKEVLASQLSTQPSSIRLMY
FT                   KGKPLVNSRLLDDYVDADSVSEVNLQMFLMNIS"
FT   intron          complement(278594..278646)
FT                   /locus_tag="SPBC800.12c"
FT   5'UTR           complement(join(278759..279121,279166..279285))
FT                   /locus_tag="SPBC800.12c"
FT   5'UTR           279321..279663
FT                   /locus_tag="SPBC800.13"
FT   CDS_pept        279664..281103
FT                   /transl_table=1
FT                   /locus_tag="SPBC800.13"
FT                   /product="histone H4 variant, CENP-T ortholog (predicted)"
FT                   /db_xref="GOA:Q9HGK9"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR028255"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGK9"
FT                   /protein_id="CAC01528.1"
FT                   /translation="MASHNYETPLKSSSFQHLVGTLSQRRHFTPSRSRYTPRSAQRTVT
FT                   PHKRRALARRNSLARRRSNVFSATTPRDILRMLSRALAKNPVPSPAESESSERRHTPQT
FT                   NSQKSQKTPRLSSNKRRTLKNDAKQRNSQSPGTDTSDANLTIQSIEAPRRAPQRLSDFF
FT                   TPDGRRVSNIRDSLISEKRLENNIDQVQESALSTASSNRLIDLKNDEVPIFRIPLSDYE
FT                   TDDMDDGTPLQRHVATLNQYQSPIFNLGPDILEDEPSYSSRASRSRQSSLSSRLSELPS
FT                   KRASLEILRRENTFPADPIQEFGEKAYNERELMEEISNFEPLLDDNLLENANEAVNSPV
FT                   VDAPMDADSALEIPNDEDNGEILNKLKDSPFKKPKRRYSKSSTLVLPETNIRKLANSYS
FT                   QKKIAGSVIEELTTASELFFKQIANDLSAFADHAHRKTIDTQDVVLLMKRQRKISEKKS
FT                   LSSLMQQYLSREIAPPAIKRT"
FT   3'UTR           281104..281247
FT                   /locus_tag="SPBC800.13"
FT   5'UTR           281440..281628
FT                   /locus_tag="SPBC1773.01"
FT   CDS_pept        join(281629..281787,281825..282051,282096..283548)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.01"
FT                   /product="striatin homolog (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.01.1"
FT                   /db_xref="GOA:O94560"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC1773.01"
FT                   /db_xref="PomBase:SPBC1773.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94560"
FT                   /protein_id="CAA21906.1"
FT                   /translation="MKSNLSLKRQDEKRADKEPNLYTLQGVIQYLQYEAFKNERDHNLW
FT                   EIERAELKIRVAQLERERAKLEQSLSFQQRRAEMLEKSLRELRKDKNISVKDLDEFHLL
FT                   DKPAANNTKADAEACLLKSKNYIKKSLQEIVYLTNMQPNVSWNVLQEPTRGIKVPKESN
FT                   NTQQNNQFVMEPSQNKGNVNDANFFEVEYARNENMNKLSSSELISDDLLEDEIMKPLSS
FT                   GESLPKKEEEVTKSPSFTLDDSVASNEQTLAQLNIESPVDQKKSKAKKKKEQKWTLKFE
FT                   SDKGTSTQCITHQPLPGSTPSFASGTENGVINVWRLDEDSNDNSMGIIKPHLTFYGHEG
FT                   PVLCVCVPKATHHIFSGGHDGTIRCWSLPANQTSDSISKILTGSTIFQGHEDCVWELFC
FT                   HEVKDNNPILLSLSSDGTVRGWKYTGEQLFKIRCDSKQPLSMSVTDSRIAIAYNDGNVR
FT                   FYDLDTQILVSQMRIAGNSAIGNPAVKDRINKIVWKNGNPDRLYSLHENGMVRVFDVKS
FT                   EELLAEKSISKVSLTGIAFAVNRPEFAISASDGRVFFLRQDDKLSTLESLPSREAQEEI
FT                   TDLSDILWINSPVDKLEHLIVGCKERISVYDRKYLP"
FT   3'UTR           283549..283779
FT                   /locus_tag="SPBC1773.01"
FT   3'UTR           complement(283603..283937)
FT                   /locus_tag="SPBC1773.02c"
FT   CDS_pept        complement(283938..284525)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.02c"
FT                   /product="thioredoxin peroxidase (predicted)"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.02c.1"
FT                   /db_xref="GOA:O94561"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PomBase:SPBC1773.02c"
FT                   /db_xref="PomBase:SPBC1773.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94561"
FT                   /protein_id="CAA21907.1"
FT                   /translation="MDAPRRSSRLAAKIANVLDSKGTIIPEAAPVMLKKPAKDESVDST
FT                   IQVGDVIPDITLPDEDGTSIRLRDITANKGLVIFAYPKASTPGCTKQGCGFRDNYPKIQ
FT                   ASDYEVLGLSFDTSKAQKAFKDKQNFPYHLLSDPKGELIKKLGAEKPGGGKLFRSHWIF
FT                   EKGTGKCIVKEIDISPLVSVDKAFAVITDSEP"
FT   5'UTR           complement(284526..284901)
FT                   /locus_tag="SPBC1773.02c"
FT   tRNA            complement(285389..285459)
FT                   /locus_tag="SPBTRNAGLY.04"
FT                   /product="tRNA Glycine"
FT   tRNA            285676..285749
FT                   /locus_tag="SPBTRNAALA.07"
FT                   /product="tRNA Alanine"
FT   3'UTR           complement(285909..286038)
FT                   /locus_tag="SPBC1773.03c"
FT   CDS_pept        complement(286039..287418)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.03c"
FT                   /product="aminotransferase class-III, unknown specificty"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.03c.1"
FT                   /db_xref="GOA:O94562"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PomBase:SPBC1773.03c"
FT                   /db_xref="PomBase:SPBC1773.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94562"
FT                   /protein_id="CAA21908.1"
FT                   /translation="MTETVTTTSSDKSEKKNYLFYTSPNHRPPTVVRAEGVYLYLEDGT
FT                   RIMDATGGAAVACLGHGNKEVIDAMHKQSEKVCYIHSMGFSNEPADKLANLLVSEHPDV
FT                   FARAYFANSGSEAVETCLKLILQYWQLVGEKQRCHIIARKQGYHGNTLFALSVGGMKPR
FT                   KQPYEGVFSHTTSHVSPCFEYRYKENGETTEEYVARLAKELEDEILRVGPEKVAAFVAE
FT                   TVSGACTGCATPVPGYFKAMRKVCDKYGVIFYLDEVMSGIGRTGTMHAWEQEGVTPDIQ
FT                   SIAKCLGGGYQPISGALVGHRIMNVFEQKDAAMAGFFTYQAHPIACSAALAVQTILRRD
FT                   HLVERAAEMGKYLSEKLHETFDSHPNVGNIRGRGLFWGLEIVKDKATKECFPPEYKVGS
FT                   LANKIGCEHGVFVYPGMGTIDGTRGDHVLLAPPYIITREQIDELVEALSKTITSTVAAL
FT                   P"
FT   5'UTR           complement(287419..288246)
FT                   /locus_tag="SPBC1773.03c"
FT   misc_RNA        complement(287590..288017)
FT                   /gene_synonym="SPNG1164"
FT                   /locus_tag="SPNCRNA.300"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           288556..289624
FT                   /locus_tag="SPBC1773.04"
FT   CDS_pept        289625..290635
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.04"
FT                   /product="mythylglyoxyl reductase (NADPH-dependent)
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.04.1"
FT                   /db_xref="GOA:O94563"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC1773.04"
FT                   /db_xref="PomBase:SPBC1773.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94563"
FT                   /protein_id="CAA21909.1"
FT                   /translation="MSELVLITGITGFVASHSAEALLSQGYRVRGTYRFQEKLDGLLKN
FT                   RPEWEKKVEFVQVPDCRAPNAYVEAAKGVDYVIHAATEVHSNLEPPRKDPHELLHIAIQ
FT                   GCENALIAAAQEPKVKRFVYISSEAALKGPVNYFGDGHVFTEKDWNPKTLREAEESDDE
FT                   LLNYTVCKKLGERAMHAFVARNTPRFQAIALNPPLILGPVFHLQSVDNLNFSTWFFWQL
FT                   IKGRYEVAPESKFFNYVDVRDLAEAQVKALTAKTDKDRFVISGGAFKNDDIVNVALKYF
FT                   PQFKDKIAKPNGETSPCNYEVDASLSIKELGLTYRPAEETFKDATESLYKLAGLL"
FT   3'UTR           290636..290758
FT                   /locus_tag="SPBC1773.04"
FT   3'UTR           complement(290730..290875)
FT                   /gene="tms1"
FT                   /locus_tag="SPBC1773.05c"
FT   CDS_pept        complement(290876..291958)
FT                   /transl_table=1
FT                   /gene="tms1"
FT                   /locus_tag="SPBC1773.05c"
FT                   /product="hexitol dehydrogenase (predicted)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="GOA:P36624"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36624"
FT                   /protein_id="CAA21910.1"
FT                   /translation="MAPAEKAFVLRKKMDTAIEDRPGQTLTDDHQVKVAIKATGICGSD
FT                   VHYWKEGGIGDFILKKPMILGHESAGVVVEVGKGVSSLKPGDPVAVEPGCVCRLCDYCR
FT                   SGRYNLCPHMEFAATPPYDGTLRTYYITTEDFCTKLPKQISVEEGALFEPMSVAVHAMT
FT                   RGNLKCGSRVLVMGCGTVGLLMMAVAKAYGAIDIVAVDASPSRVEFAQKYVGAKPFTPI
FT                   AAKENESLPDYAQRYKQAIIEKYGEFDFAVDATGVGICIHTAVLALKRGGTFVQAGNGK
FT                   PVIDFPINHIINYEINVLGSFRYAHGCYKQSLFLVSNGLVDVKPLITHRFAFKDALKAY
FT                   ETVASGEEGVLKVIIGGPDA"
FT   5'UTR           complement(291959..292250)
FT                   /gene="tms1"
FT                   /locus_tag="SPBC1773.05c"
FT   3'UTR           complement(293225..293465)
FT                   /locus_tag="SPBC1773.06c"
FT   CDS_pept        complement(293466..294506)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.06c"
FT                   /product="alcohol dehydrogenase (predicted)"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.06c.1"
FT                   /db_xref="GOA:O94564"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC1773.06c"
FT                   /db_xref="PomBase:SPBC1773.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94564"
FT                   /protein_id="CAA21911.1"
FT                   /translation="MALRYVVHDEISGFDQLKPEEYEVPQKLNPGEVLVKLKAASLNYR
FT                   DLIITKGLYPLPLQLPVVPGSDGAGIIEKVGEDVEGFEKGDSVVCNFFTNYLDGTPTDF
FT                   ATHSALGGTRDGCFQKYAVLPAHALVHAPKNLSFEEIATLPCAAVTAWNGLFGSKEHQV
FT                   KPGNNVLVLGTGGVSTFALQFALAAGANVTVTSSSDEKLEFAKKLGATHTINYKKTPQW
FT                   ASPALKMTNGVGYHHVIEVGGEKTLPQSIACLAKDGMISMIGFVASEGTTPNLTSIIGQ
FT                   ILNRNANIRGIFVGSVSMFRDMVACIEAKDIHPVVDKVFPFDQLKEAYEYQWSQAHIGK
FT                   VVLKID"
FT   5'UTR           complement(294507..294725)
FT                   /locus_tag="SPBC1773.06c"
FT   misc_RNA        294730..296112
FT                   /locus_tag="SPNCRNA.1336"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(296047..296235)
FT                   /gene="sbp1"
FT                   /gene_synonym="yrb1"
FT                   /locus_tag="SPBC1773.07c"
FT   CDS_pept        complement(join(296236..296306,296405..296533,
FT                   296706..297153))
FT                   /transl_table=1
FT                   /gene="sbp1"
FT                   /gene_synonym="yrb1"
FT                   /locus_tag="SPBC1773.07c"
FT                   /product="Ran GTPase binding protein Sbp1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.07c.1"
FT                   /db_xref="GOA:Q09717"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="PomBase:SPBC1773.07c"
FT                   /db_xref="PomBase:SPBC1773.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09717"
FT                   /protein_id="CAA21912.1"
FT                   /translation="MSAEQEKKTQGTTKEEQKSSFASEDVASKQTEEAKAVFGDGVAKQ
FT                   ENKSGASTNDEKKPAEGDEDAEPASPEVHFEPIVKLSAVETKTNEEEETVEFKMRAKLF
FT                   RFDKAASEWKERGTGDARLLKHKETGKTRLVMRRDKTLKVCANHLLMPEMKLTPNVGSD
FT                   RSWVWTVAADVSEGEPTAETFAIRFANSENANLFKENFEKYQEENAKILKKN"
FT   intron          complement(296307..296404)
FT                   /gene="sbp1"
FT                   /gene_synonym="yrb1"
FT                   /locus_tag="SPBC1773.07c"
FT   intron          complement(296534..296705)
FT                   /gene="sbp1"
FT                   /gene_synonym="yrb1"
FT                   /locus_tag="SPBC1773.07c"
FT   5'UTR           complement(297154..297199)
FT                   /gene="sbp1"
FT                   /gene_synonym="yrb1"
FT                   /locus_tag="SPBC1773.07c"
FT   misc_RNA        297389..299135
FT                   /locus_tag="SPNCRNA.1337"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(297726..297770)
FT                   /gene="omh4"
FT                   /locus_tag="SPBC1773.08c"
FT   CDS_pept        complement(297771..299093)
FT                   /transl_table=1
FT                   /gene="omh4"
FT                   /locus_tag="SPBC1773.08c"
FT                   /product="alpha-1,2-mannosyltransferase Omh4 (predicted)"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.08c.1"
FT                   /db_xref="GOA:O94565"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="PomBase:SPBC1773.08c"
FT                   /db_xref="PomBase:SPBC1773.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94565"
FT                   /protein_id="CAA21913.2"
FT                   /translation="MLGWNKHVFFSESRINFRCLLRKKLKKRCPLSARFVLVLLLIVLI
FT                   FILKMGYKQLIYKLNHPPLRRIDERNDPLFSNGCKNVHLEAQLHPRMNATFVMLARNSD
FT                   LPGVVSSINSLEKHFNRHFNYPYTFLNDEPFDEKFKETILKLTSANVEFGTLEKDTFGF
FT                   PGNVDVDAAREAIASQGDRGIMYGDTESYHHMCRFFSGFFYKHPLLLKYQWYWRVEPDV
FT                   AFTCDISYDPFYYMEENGKIYGYVVALKELEDTVPNLFRYTSAYRRNNNLTSNMWKFFL
FT                   DAPKKENYDISRKDPTVGLSFSSHLNAMIDSSYSAETSSMEGESYNMCHFWSNFEIANF
FT                   KFFRNEQYENFFRTMDATGGFWTERWGDAPFHSLAAGLFLSKEQVHYFRDLGYRHSDIH
FT                   HCGQSLGCNCECIPELSEIESTSGGCVTQWVNLIGDGFLDE"
FT   CDS_pept        complement(join(299347..300074,300231..301108,
FT                   301165..301214))
FT                   /transl_table=1
FT                   /gene="mug184"
FT                   /locus_tag="SPBC1773.09c"
FT                   /product="meiotically upregulated gene Mug184"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.09c.1"
FT                   /db_xref="GOA:O94566"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="PomBase:SPBC1773.09c"
FT                   /db_xref="PomBase:SPBC1773.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94566"
FT                   /protein_id="CAA21914.2"
FT                   /translation="MLARPETDTSVDYYAILKLQKNATFQQIRKQYLFLALQYHPDRNP
FT                   GDEERAVKRFQRLQLAHEVLSDATKRLIYDQLFGLSTRTRSQYKPNSTSNPSKHTSAYA
FT                   SYNKGKNSKWSSPFASTTKKPQESSEKYSKKSSTRKKEHFNKKPSFPRDTEYSHIYNMK
FT                   YDPRSGIGIRVKRQEPESLKKENNNSDYLPKSAMKQKKGGPKDSSKHPSNDGKIPESKP
FT                   SVYKSRASNLFSSNEQSIHSSFGSKFHFDKSSNPFSFEFSPSSNAAKPSNSEECNIPKF
FT                   NSSFKTSNDFFTFTKTEESSPYSFSFKLEDSNTPKFKSSSKPVKSSFVFTKPEAESSNP
FT                   FSFDFGSSGPKSRSDTRNNIRTPLWTSSVFEKPESDLPNKTAFGFMRSNTSTFNQKCDD
FT                   FSSASFMKEKTEFEEQLQEDNDHSLGDLFSKINISTESPSVAMPSIPVIQPPSFPIFSS
FT                   IDFNVRNREYWNQLMVFQKLYSKYCTESQHFINSWINIKKELHIVPVNWEIFEKVEKSW
FT                   DQCEEFVAEFRQTEEKYFLFLKRLRELINKNQML"
FT   5'UTR           complement(301215..301356)
FT                   /gene="mug184"
FT                   /locus_tag="SPBC1773.09c"
FT   3'UTR           complement(301754..301981)
FT                   /gene="nrs1"
FT                   /gene_synonym="ded81"
FT                   /locus_tag="SPBC1773.10c"
FT   CDS_pept        complement(301982..303688)
FT                   /transl_table=1
FT                   /gene="nrs1"
FT                   /gene_synonym="ded81"
FT                   /locus_tag="SPBC1773.10c"
FT                   /product="cytoplasmic asparagine-tRNA ligase Nrs1
FT                   (predicted)"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.10c.1"
FT                   /db_xref="GOA:O94567"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PomBase:SPBC1773.10c"
FT                   /db_xref="PomBase:SPBC1773.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94567"
FT                   /protein_id="CAA21915.1"
FT                   /translation="MAGLESKVSDMKIKSDVVFYIDEASGNDETGNGSQTSPFKTAIHA
FT                   LETDANCTIFVKKNGSEEFEPITTNALKKAKKGVEQAAKKKAKAAEAEAAAAARAAAAK
FT                   EAEAKRLEAAKNIVLKEPKDAPAAKKIAIIDSTNFRDSRVRVNGWVHRMRTQKGIIFII
FT                   LRDGTGFLQCVLSGKVYDRASYDFINLGPESTVCLYGVIKELPEGKSAPGNHELVVDYY
FT                   QILHAAPTGEEAFTNRLNAEAEPSYLLDQRHLVIRGETASSVLKVRARALRAMRDTFEN
FT                   LKMTEVTPPCMVQTQVEGGATLFKFNYYGQDAYLTQSSQLYLEAALPALGSVYTIQESF
FT                   RAEKSLTRRHLSEFTHVEFELPFVNFGEFLEIIEEFICQTIDRLLDDPIATPLIKQLNP
FT                   DFVKPSRPFMRLSYEDAIKYLNEHNILTPEGEQHKFGDDIAEAAERKMTDQINRPIFLT
FT                   YFPLEIKSFYMKRVVDRPELTESVDCLMPNVGEIVGGSMRISDIQELLAAYKREGIDPA
FT                   PYYWFTEQRKYGTTEHGGCGLGLERFLAWLCDRYTVRECCLFPRFTERCTP"
FT   5'UTR           complement(303689..303734)
FT                   /gene="nrs1"
FT                   /gene_synonym="ded81"
FT                   /locus_tag="SPBC1773.10c"
FT   3'UTR           complement(303915..305300)
FT                   /gene="mug89"
FT                   /locus_tag="SPBC1773.11c"
FT   CDS_pept        complement(305301..306491)
FT                   /transl_table=1
FT                   /gene="mug89"
FT                   /locus_tag="SPBC1773.11c"
FT                   /product="CDC50 domain protein, implicated in signal
FT                   transduction (predicted)"
FT                   /db_xref="GOA:Q1MTQ5"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MTQ5"
FT                   /protein_id="CAA21916.1"
FT                   /translation="MPEALNENVSDTASNGPVAKTRAPPNTSFRQQRIKSWQPLLTPKI
FT                   VLPLFFVLGIIFGPLGGGLLYASSIVQELVVDYTDCETLASYDEFSAVPSKKYTASFDQ
FT                   SGTIGFDKESTYWKLEKILDKDLDMDVNYCIIRFTVPSVLKAPIFIYYRLTNFFQNHRR
FT                   YAKSVDEKQLQGVALTADEVKGGNCFPLEVNEDDKPYYPCGLIANSLFNDTFSSLRLLD
FT                   DNSVYTFSTKNIAWASDKRRFLKTNYSPDDVAPPPNWVLRYPDGYTESNMPDLSTMENL
FT                   QVWMRTAGLPTFSKLAMRNDNDDIFPGTYEIKIGLFFPVKSFDGTKSLVLTTRSVLGGK
FT                   NPFLGIAYIVVSAVCVVLGTVFTLRHFIRPRKLADHRYLNWDSEENNLAPHLSDRP"
FT   5'UTR           complement(306492..306704)
FT                   /gene="mug89"
FT                   /locus_tag="SPBC1773.11c"
FT   misc_RNA        complement(307042..309627)
FT                   /locus_tag="SPNCRNA.1338"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        308160..309944
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.12"
FT                   /product="transcription factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.12.1"
FT                   /db_xref="GOA:O94569"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPBC1773.12"
FT                   /db_xref="PomBase:SPBC1773.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94569"
FT                   /protein_id="CAA21917.1"
FT                   /translation="MVPIKKISTACDLCRQRKLRCNGELPKCQNCVVYSETCKYNKRKR
FT                   VKKPNVDKDDPHIVVGQPPVKKSTAGITREYTEMIELRNHIITLSKRSVNMESRIDDML
FT                   NLLNYDLSEKRETSNEIPSLVQQIQNCGFLIDEKMRRYPGIFQIHPKDYTMNDLFPQSF
FT                   PTWISVYRNVPEKAWANRCVEWYFRYINSCWPLFDLENFMDLFDNFYSDKEKTKGAWVV
FT                   SFYAIMALAVSRSKRKDKEKISKSLFSTSWFLVQKPGFFLTARLDKIQALTIMIQFCAH
FT                   LSLYNLCKVLCGQMCLMVKDLDLHKEATNPNVDIEVDELNRRVFWTCYIFETTTSLIFG
FT                   TPPELGDLEIDCQLPSMDVLPRFTESSQGGIVFCSEIQLTIIKNEIRKKIYKCLASASE
FT                   EVYKEAVLSIRGKLIVWERNLPDELKQYYDVIKLNGTIPKNVDFENQHIFTACVEIYLS
FT                   YCITQLYFYDPLTNYETCLEIARKAADAIRSYFMVIEPIFKKICYLWLFLYCPFTPFQI
FT                   LFSNILKMEKGTSDEKIEDLDRMYSLYRFFVEMKEINGEFADKLSRVALDCIDAAEHYL
FT                   ELKSSVGSNIFELESLLV"
FT   3'UTR           309945..310467
FT                   /locus_tag="SPBC1773.12"
FT   5'UTR           310402..310701
FT                   /locus_tag="SPBC1773.13"
FT   CDS_pept        310702..312147
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.13"
FT                   /product="aromatic aminotransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.13.1"
FT                   /db_xref="GOA:O94570"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PomBase:SPBC1773.13"
FT                   /db_xref="PomBase:SPBC1773.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94570"
FT                   /protein_id="CAA21918.1"
FT                   /translation="MIRNSEDFSHHLSRESKAREKGPFQMLGRIKSSTGIDAISFSSGL
FT                   PHPNKFAIRELSIKFPQLGCFKEENGTYAKEVNVTFNIKADPSEGLLNFSQSLQYGQCQ
FT                   GISELVGFIKEHIRRIHAPRYENWDIKMSNGNTSGLEYCLRLLVNYGDHVLTEKYTYPA
FT                   AITAMRALGVQFVSVDMDSEGMLPESLEEIMRDWDISLGPRPHVLYTVPTGQNPTGSTL
FT                   SLSRRKKLLALARKYDIIIVEDEPYYFLQMEDYNGSLNPAQQKCDGSTFLKSLVPSLLS
FT                   LDTEGRVLRLDSFSKLIAPGTRLGYITGNSMFIDHITRIAEVCTESPSGICQSVLYAML
FT                   HNWGQEGFCAWLQELQYSYTVRRNAFLNVANKYLPNSVCIYHVPRAGLFLWVELNLNHY
FT                   RFSDTKKSVSQIEMEIFLALVEKGVKTVCGQFFMANPERSTKIFFRFAYSIADFEDFEE
FT                   GIKRFTSVINEHFNVESRVRICP"
FT   3'UTR           312148..312518
FT                   /locus_tag="SPBC1773.13"
FT   5'UTR           312809..313296
FT                   /gene="arg7"
FT                   /locus_tag="SPBC1773.14"
FT   CDS_pept        313297..314682
FT                   /transl_table=1
FT                   /gene="arg7"
FT                   /locus_tag="SPBC1773.14"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.14.1"
FT                   /db_xref="GOA:P40369"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="PomBase:SPBC1773.14"
FT                   /db_xref="PomBase:SPBC1773.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40369"
FT                   /protein_id="CAA21919.1"
FT                   /translation="MAEKSSKKLWGGRFSGATDPLMAEFNKSIYSGKEMCEEDVIGSMA
FT                   YAKALCQKNVISEEELNSILKGLEQIQREWNSGQFVLEPSDEDVHTANERRLTEIIGDV
FT                   AGKLHTGRSRNDQVTTDLRLWLCRKIKEVEVYVINLLKVFTNRAEMEIDVIMSGYTHLQ
FT                   RAQPVRWSHFLMSHALPLLGDLGRLRQLYTRVSQLPLGAGALAGNPFNVDREFLRKELG
FT                   FEGIIMNSMNAVGDRDFVIEFMFWAGMVMLHISRFAEDLIIYSSSEFGFVTLSDAYSTG
FT                   SSIMPQKKNPDSLELLRGKSGRVLGDMIGLMITVKGTPTTYNKDLQEDKEPLFDAFKTV
FT                   SDSLQILTGVVSTLTINPTKIAESLTPDLLATDLAEYLVRKGLPFRQTHHISGSAVRMA
FT                   EERNTTLDKLSVSDLQSLHPLFDEDVSKVFNYEESVEKRCSIGGTAKHCVQEQIEHIRS
FT                   AIL"
FT   3'UTR           314683..314761
FT                   /gene="arg7"
FT                   /locus_tag="SPBC1773.14"
FT   5'UTR           315526..315961
FT                   /locus_tag="SPBC1773.15"
FT   CDS_pept        315962..317455
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.15"
FT                   /product="dipeptide transmembrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.15.1"
FT                   /db_xref="GOA:O94572"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1773.15"
FT                   /db_xref="PomBase:SPBC1773.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94572"
FT                   /protein_id="CAA21920.1"
FT                   /translation="MEKTEEENYSIKELGEKGSDSQEDVAVIFAEKHPIIDKSLNRKLK
FT                   LKTDLWVMPLLCLISAFQYMDKSTSNYSSIMGIRTDLNMVGNQYNWVGTSFYLGFMVFS
FT                   LPLSTLLQKFPLSKVTSAFIVAWGILMTLTCLVHSYASYIATRTLLGILESVITPAFVL
FT                   FIAQWYRKEEQFFRMAFLVAWNGLGGLIGGSMSYGLYKRELENNLTMSPWRILFIITGL
FT                   ITIINGVFIFIHIPDEPSKAWFLSEKEKDLVLKRLDTDHAGLGSKKFKKYQILEACRDV
FT                   RMYLYFFLQIAVAIPNGGLSNFSSIMLKNLGYVKGKALLMNMPTSSISFAALTLFGLIP
FT                   EFTNRRMDIALVGLAINLTSGSLIAFAKPTHAQLAGYWLFGISPIPYICILSCISSNSA
FT                   GHTKKVFMSAVSMIGYCVGNMVGPQTFRSTQAPKYQGAKVSFVVCYCVAIFIIIAIYAV
FT                   NVRENRRRDEKNEYLSNELSEEDKKDLTDFENPEFRYSI"
FT   3'UTR           317456..317629
FT                   /locus_tag="SPBC1773.15"
FT   3'UTR           complement(317694..318692)
FT                   /locus_tag="SPBC1773.16c"
FT   CDS_pept        complement(318693..320480)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1773.16c"
FT                   /product="transcription factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.16c.1"
FT                   /db_xref="GOA:O94573"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPBC1773.16c"
FT                   /db_xref="PomBase:SPBC1773.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94573"
FT                   /protein_id="CAA21921.2"
FT                   /translation="MKRIRNACELCRRKKLRCNGELTCQNCMVYGEECRYVKRVKHDNR
FT                   AAVQENERYPILYTPLSTSDHDNDEENEINELKNAVKALDKRFDNFELKLEALFSLLRS
FT                   QQDSERKVKPGGFPSLVSQILSAGALVDSKLQAYTMRTNFFSNGFSSNDLFPHSFPTWK
FT                   SAFRDVPDKDWAKTCLDWYFRFINCNWPIFYKKQYMESFEKLYIDKNLVKGAWIVSFYA
FT                   ILALAVSRDKRVDNSKLAESFFATSWFLIQRPGFFLTPQLEKIQALVIMIQFASHLSLY
FT                   NLCKKLCGQVCLMVKDLNLHKESTDKDLDQDMAELHRRIFWVCYIFETTTSLIFGTPPV
FT                   LGDLEIECKYPDINYAHCFAENVQGDLIFTCEISLTVLKHEIRTKLYNSNNVFLDKGQK
FT                   GVISNIQTKILNFERAIPSEMKHYFEILKAGNGLPEELDIIKQHFFTACVEIYLSYCNT
FT                   LIYLYLADDSIEGSKICLSTARAAIDVIKGFLVVLDPISKNICYLWLFLYCPFTPFLTV
FT                   FSHLLEDDDLDADICVKDVDRLYSIHAFFLKMKDISGEFAERLSVITENFIQSAEQYLA
FT                   LQNTSVFGTFDALSESFSI"
FT   5'UTR           complement(join(320481..320774,320818..320922))
FT                   /locus_tag="SPBC1773.16c"
FT   misc_RNA        320610..321519
FT                   /gene_synonym="SPNG1179"
FT                   /locus_tag="SPNCRNA.301"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(321634..321661)
FT                   /gene_synonym="SPBP26C9.01c"
FT                   /locus_tag="SPBC1773.17c"
FT   CDS_pept        complement(321662..322684)
FT                   /transl_table=1
FT                   /gene_synonym="SPBP26C9.01c"
FT                   /locus_tag="SPBC1773.17c"
FT                   /product="glyoxylate reductase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1773.17c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1773.17c.1"
FT                   /db_xref="GOA:O94574"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC1773.17c"
FT                   /db_xref="PomBase:SPBC1773.17c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94574"
FT                   /protein_id="CAA21922.3"
FT                   /translation="MKQSRTKRVLAIGELKFATNTLKRLSEKYHFEFIVPDPHDRSKTI
FT                   EKIHEAASKSTFDACFWLFRNAAISPFTEEMLGPLLPTCKLFVTGAAGYNNVDVDWATR
FT                   NGVYVANTPNGPTEGTANMNLMLFMCTLRGAREAEQSLRLGKWRQNLSLTDDPYGKRVG
FT                   IIGMGAIGKSFAQKILPLGCEIVYHNRNRLEAEEEKRLGASFVSFDELLSSSDVISINC
FT                   PLTPATHDLISTKEFEKMKDGVYIINTARGAIINEDAFIKAIKSGKVARAGLDVFLNEP
FT                   TPNKFWLECDKVTIQPHCGVYTNFTVAKTEECVLASIETFLDTGIPTNPVNGPFGMNGC
FT                   "
FT   5'UTR           complement(322685..322998)
FT                   /gene_synonym="SPBP26C9.01c"
FT                   /locus_tag="SPBC1773.17c"
FT   3'UTR           complement(323944..324190)
FT                   /gene="car1"
FT                   /locus_tag="SPBP26C9.02c"
FT   CDS_pept        complement(324191..325162)
FT                   /transl_table=1
FT                   /gene="car1"
FT                   /locus_tag="SPBP26C9.02c"
FT                   /product="arginase Car1"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP26C9.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP26C9.02c.1"
FT                   /db_xref="GOA:P37818"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="PomBase:SPBP26C9.02c"
FT                   /db_xref="PomBase:SPBP26C9.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37818"
FT                   /protein_id="CAC08237.1"
FT                   /translation="MSPHKIPEVHRHIMSSRYMEGNAVSIINMPFSGGQPKDGAELAPE
FT                   MIEAAGLPEDLERLGYSVNVVQNPKFKSRPLKEGPNQALMKNPLYVSNVTRQVRNIVQQ
FT                   ELEKQRIAVNIGGDHSLAIGTVEGVQAVYDDACVLWIDAHADINTPDSSPSKNLHGCPL
FT                   SFSLGYAEPLPEEFAWTRRVIEERRLAFIGLRDLDPMERAFLRERSITAYTMHDVDKYG
FT                   IARVVEMALEHINPGRRRPIHLSFDVDACDPIVAPATGTRVPGGLTFREAMYICESVAE
FT                   TGSLVAVDVMEVNPLLGNKEEAKTTVDLARSIVRTCLGQTLL"
FT   5'UTR           complement(325163..325565)
FT                   /gene="car1"
FT                   /locus_tag="SPBP26C9.02c"
FT   tRNA            326235..326305
FT                   /locus_tag="SPBTRNAGLY.05"
FT                   /product="tRNA Glycine"
FT   tRNA            complement(326652..326724)
FT                   /locus_tag="SPBTRNAARG.04"
FT                   /product="tRNA Arginine"
FT   3'UTR           complement(327424..327991)
FT                   /gene="fet4"
FT                   /locus_tag="SPBP26C9.03c"
FT   CDS_pept        complement(327992..329746)
FT                   /transl_table=1
FT                   /gene="fet4"
FT                   /locus_tag="SPBP26C9.03c"
FT                   /product="iron/zinc ion transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP26C9.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP26C9.03c.1"
FT                   /db_xref="GOA:Q9HFE1"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="PomBase:SPBP26C9.03c"
FT                   /db_xref="PomBase:SPBP26C9.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HFE1"
FT                   /protein_id="CAC08238.1"
FT                   /translation="MTASITEIDSISEESNVESVSHLQHSPSFEKKGADFSISLNEKKD
FT                   FASPITEEIPSPDGIATPEPETKKKLSFGARVWDLICSPGRQHDVCVAAPTQLVRSCDD
FT                   YANSASTLVTNDDGTKTKVDSDEKKHKHKNVRDYIRFKHVDIGGRIFDLITRLAGTSFT
FT                   FILMLIILIVWAIVGGIYRAPDNWQIVMQDGSSIQCYVSDTLLMRQQQNQHIQVLTMIS
FT                   QLRSRLLTTSRLLGPVLNDKTKISSVNVALMKDDVGDAEKLPTENWFDFICNYVSFMVG
FT                   SIIFLVVYWIGIFIWIGFGRMLGWSDEWQLYINTAVAVELTFTSVFLQNVRHRHMKYID
FT                   RCVTSIFRIDSVIEEELRRMMGDKEPNEEITIKMDKINLGERSIDYYADLIGSGVGVVV
FT                   STCVFVAWIAIGNVMHWDSNWWLIIGTYTGLVGFLDGFVLRNVYFRESSKEATEIQTLI
FT                   DEDYALYQKLDLPLPHEHITNYKSTFGGSLSQWIGWLCALPISVLFSVFVILGLIIAAG
FT                   SLRFNETAQLFCNTPTMIIEGALLIVLIEAHNIANLKRRIQFRQIHLRRLTILKMLAGD
FT                   NYSTTSTV"
FT   5'UTR           complement(329747..331064)
FT                   /gene="fet4"
FT                   /locus_tag="SPBP26C9.03c"
FT   misc_RNA        329976..330635
FT                   /locus_tag="SPNCRNA.1339"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        332494..333584
FT                   /locus_tag="SPNCRNA.1340"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           333519..334387
FT                   /locus_tag="SPBC1271.15c"
FT   CDS_pept        334388..336448
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.15c"
FT                   /product="mitochondrial translation initiation factor
FT                   IF-2Mt (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.15c.1"
FT                   /db_xref="GOA:O59683"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="PomBase:SPBC1271.15c"
FT                   /db_xref="PomBase:SPBC1271.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59683"
FT                   /protein_id="CAA22205.1"
FT                   /translation="MAFLSACTSWRHVHNAGFTFITKFPFVRNVHKLSYHISPLSSRFS
FT                   LADISVKENNHPNGPQLRLQTHFFHSSSPMHATKGFRFPKSSTPLTLPAVLSVASFANL
FT                   LQIPTRRILRDLNRLGIKDVFPEYLITYEYSSLLAEEYGFDVQEAAAYSAPSPKSLNSK
FT                   KDSGPLRPPVVTLMGHVDHGKTTLLDAFRKSTIASTEHGGITQKIGAFTVPFDKGSKFI
FT                   TFLDTPGHMAFEAMRKRGANIADIVVLVVAGDDGVKPQTVEAIKHIQSADVPVVVALTK
FT                   SDRPGTPIHKIYEQLLNNGIQVEALGGETQIIPISAKTGKGIPELEAAILTLAEIMEIR
FT                   ASPRDPFQGWIVESSVTKGVGSSATVVVKRGTVKKGMYLVAGKSWCKVRSLVDVNKKSI
FT                   KQVLPGQAAQVYGWKDLPIAGDLAYEVKSESEAKRILSDIYRQSNEQNFYELAESQNEQ
FT                   RVSALAAKKSGPAAIQEETSVSKSFNIIAKCEDTGSMEALSDYLKPLQFGKVKSRVLYT
FT                   GVGPVTETDIERAETSDAIIISFGVSVPKATFRLAEKHNVKLLFHNVIYHLMDDVRKLF
FT                   ALRLPPILVQRVTGEAIISAIFDIKAKRAVVHVAGCRVTNGTIEKSHKIRLVRNDKIIW
FT                   SGEIDSLKHLKEEVTSIKKGRECGILLKNFDEIVTGDKLQTFVEEYKPPDF"
FT   3'UTR           complement(336351..336800)
FT                   /locus_tag="SPBC1271.14"
FT   3'UTR           336449..336676
FT                   /locus_tag="SPBC1271.15c"
FT   CDS_pept        complement(336801..338138)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.14"
FT                   /product="glutamate N-acetyltransferase (predicted)"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.14.1"
FT                   /db_xref="GOA:O94346"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="PomBase:SPBC1271.14"
FT                   /db_xref="PomBase:SPBC1271.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94346"
FT                   /protein_id="CAA22204.1"
FT                   /translation="MQTKIFARLAGIGRARFVGTMPDKTKFISKSGTYPQGFSLNGIAS
FT                   GVKANGKKDLAILFSSRPCNAAAVFTKNAFQAAPVQVSRQTLNGCGGKDIHCVVFNSGC
FT                   ANAVTGEGGLMDAQLITAEADNLTRPHWTSWTENSEEFPSSLVMSTGVIGQRLKLDKIQ
FT                   SGLEHAVEDLGSTHEYWMRAAEAICTTDTFPKLVSRELSIAGKVYRIAGFAKGAGMINP
FT                   NLATLLGLFVTDAPISVDAVRSILRHAINNSFNSISIDGDTSTNDTIAFLANGAAGGSE
FT                   ITKSSPAYKEIRDAVTDIAQQLAKLVVRDGEGATKFVTVQVRGARSEKDAALVASTISN
FT                   SALVKTAFFGEDANWGRILCAVGYSGAAVNPPATTVSFIPADGTEPLKLLVNGEPQNVD
FT                   ETRASEILSQDELTVDVDLGCGPYAKTNWTCDFSYDYVRINADYRS"
FT   5'UTR           complement(338139..338426)
FT                   /locus_tag="SPBC1271.14"
FT   misc_RNA        complement(339346..340012)
FT                   /gene="sme2"
FT                   /gene_synonym="SPNCRNA.1341"
FT                   /locus_tag="SPNCRNA.103"
FT                   /product="meiRNA sme2"
FT   misc_RNA        340209..340750
FT                   /locus_tag="SPNCRNA.1342"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(340696..340969)
FT                   /gene="mrpl8"
FT                   /locus_tag="SPBC1271.13"
FT   CDS_pept        complement(join(340970..341519,341583..341656))
FT                   /transl_table=1
FT                   /gene="mrpl8"
FT                   /locus_tag="SPBC1271.13"
FT                   /product="mitochondrial ribosomal protein subunit L8
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.13.1"
FT                   /db_xref="GOA:O94345"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="PomBase:SPBC1271.13"
FT                   /db_xref="PomBase:SPBC1271.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94345"
FT                   /protein_id="CAA22203.1"
FT                   /translation="MTKTLYYRKLGRTSAHRQALLRNLVTSLVKHESIQTTWAKAKEAQ
FT                   RFAEKLITMAKRANPQNNRKGLAEGMVFEKETTLKKVFDVLVPRYNGRRCGYTRLLKLP
FT                   PRSTDNAPMGVLEFVDGPKDIRFHMTAKTVGICLAQQKALTPITRKNIHKVLLFRKNGK
FT                   AEFDQLVQKEKESEHARLKEDHEDEKTVKKDWKRGDPIPRPTYI"
FT   5'UTR           complement(341657..341753)
FT                   /gene="mrpl8"
FT                   /locus_tag="SPBC1271.13"
FT   3'UTR           complement(join(341909..342098,342145..342408))
FT                   /gene="kes1"
FT                   /locus_tag="SPBC1271.12"
FT   CDS_pept        complement(join(342409..342950,343010..343322,
FT                   343505..343627,343771..343849,344022..344047,
FT                   344123..344135,344186..344256))
FT                   /transl_table=1
FT                   /gene="kes1"
FT                   /locus_tag="SPBC1271.12"
FT                   /product="oxysterol binding protein (predicted)"
FT                   /db_xref="GOA:O74178"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74178"
FT                   /protein_id="CAA22202.1"
FT                   /translation="MSKTTSSDDSRDGEGDKRLRSTTKSTWLSFLKSIATFSGDLSSLT
FT                   APSFILSSTSLIEYSAYWAEHPELFISLPRGETPLERQLLVTKWFASTLKNQYAARNER
FT                   YGSEKKPLNPILGELFTGKWNTDIGEDTELTSEQVSHHPPITAYHIYNKKAGVRLEGYN
FT                   GHKSGFSGPQIHVKQIGHARLILEPHNEVYYITFPLVTLEGLWYGSPYIELGKKSYIIS
FT                   TSGYLTTIEYSGKGYFTGKKNTFKATIVNAKTKSEPIYRIEGSWTGMLKYCTFEDQKRS
FT                   AWEDFLDCGNYKPVNISVAPIEEQGEYESRRVWKNFAVALDAGDYAAASQEKSKIEEGQ
FT                   RELRRQEEEHNEVWHRKYFEWKDKDEGFEEATKCLRQPVKEGFWYYLR"
FT   intron          complement(342951..343009)
FT                   /gene="kes1"
FT                   /locus_tag="SPBC1271.12"
FT   intron          complement(343323..343504)
FT                   /gene="kes1"
FT                   /locus_tag="SPBC1271.12"
FT   intron          complement(343628..343770)
FT                   /gene="kes1"
FT                   /locus_tag="SPBC1271.12"
FT   intron          complement(343850..344021)
FT                   /gene="kes1"
FT                   /locus_tag="SPBC1271.12"
FT   5'UTR           complement(344257..344384)
FT                   /gene="kes1"
FT                   /locus_tag="SPBC1271.12"
FT   3'UTR           complement(344847..345363)
FT                   /locus_tag="SPBC1271.11"
FT   CDS_pept        complement(join(345364..345947,346058..346178,
FT                   346246..346253,346310..346337,346403..346438))
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.11"
FT                   /product="mitochondrial tricarboxylate transporter
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.11.1"
FT                   /db_xref="GOA:O94344"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="PomBase:SPBC1271.11"
FT                   /db_xref="PomBase:SPBC1271.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94344"
FT                   /protein_id="CAA22201.1"
FT                   /translation="MTDDEVQWKPILVGGLSGLVAETLVFPLSTIITRVQSSLSFQQAG
FT                   GFQHLYRGLSSVLVSTLPSASSFFFVYEYAKARQKPGVRNHLVSASVAEVVSCGILAPA
FT                   EVVRQRAQISKTSVSQIFQSMIHNYRDLWHSFKGMCGRNVPATAFQFVLYEQFKKKFSA
FT                   TDHVFGAPKGAALSGAITAAVLTPLDVIKTQINLRPESYRKVVRRIYKENGIFGFEKGL
FT                   GLRVFASSLGLSIYLGTYEHVKSHLHIRKAGEVSVA"
FT   5'UTR           complement(346439..346528)
FT                   /locus_tag="SPBC1271.11"
FT   5'UTR           347590..348313
FT                   /locus_tag="SPBC1271.10c"
FT   CDS_pept        348314..350059
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.10c"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.10c.1"
FT                   /db_xref="GOA:O94343"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1271.10c"
FT                   /db_xref="PomBase:SPBC1271.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94343"
FT                   /protein_id="CAA22200.1"
FT                   /translation="MEPDGYVEELPGTILIYKENQYAASEHSVLKKDGDIVLQPQPSDD
FT                   PNDPLNWNKFRKNWHLVLICLVSLVTGAIANDAGSAQDQMNAELGISYDAMDNAAGVLF
FT                   ICVGYFTYLAMPATFLYGRRCVYLVCLLFGMLGSMWFALVKTTSNSIGNQAFIGISEAC
FT                   AEALTQFSVSEVFFEHERGIKIGIYILSTSVGTYLGPLAAGYIASSQGWRWIGWWGLII
FT                   SGITFVLFLFTFEETTFDRAAAIDRKQIQISNDQLTVKEDFDLKDMQSDIKPDVEKSDA
FT                   MDDSKMKVDYTVNEISNAVQPIYSKPSYWKRIALITPANSLSGIGFRQYIMRLFQTLRI
FT                   FLFPAVLYSGLQWGAQDAWLSFYLTTEEEDWMEAPYNYGDNAVAIMNVPCIIGATIGCI
FT                   YGGYFGDYFTLWAAKRNNGIKEAESRLWLMILPCIINPIGLFMFGIGTARHWHWGPTYV
FT                   GLGFIGFGWGCAGDISMAYLMDAYPGMVLEAMVGVSVINNTFGYVFTFACQSWIDSLGT
FT                   ERTYISIGVLCFIFIATSFPMILCGKRLRKWTAKQYYTFLNVRNRLDEKIPDQDRRGQD
FT                   GVESR"
FT   3'UTR           350060..350376
FT                   /locus_tag="SPBC1271.10c"
FT   CDS_pept        complement(join(350692..350740,350787..352369))
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.09"
FT                   /product="glycerophosphodiester transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.09.1"
FT                   /db_xref="GOA:O94342"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC1271.09"
FT                   /db_xref="PomBase:SPBC1271.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94342"
FT                   /protein_id="CAA22199.1"
FT                   /translation="MSGGWDESKYVDNGEDEVVRQVSEPSVEEPIEASVTRYRSDEEKL
FT                   DDKSSGAHVTEKEAEFDIEGGSRETSQWKHFLNVAVAGVALMSDGYCSNSIGTVITILR
FT                   KLYPEETTHNKSLQDIGMIAYVGTIVGQLSFGWYSDRFGRKNGMITATIILIVSTALCT
FT                   GAYGYKGSINGMLSALIAYRFFLGIGIGAEYPCGSVAASESSNELKSGLRHAAFIVVTD
FT                   GAIDFGFVVGALVPYILVCIFGEHHLRIVWRLSIGLGLVIPCVLLPFRIAMKDPKTYVK
FT                   HKVPLTKIPWLLVLKMYGFRLFILCLIWFVYDLSAFAFGLYSSTIVDGVLPADASTARS
FT                   FGWNVLINTFYLPGALLGGVFSDLLGPKYCLITGLVLQSIFGFFMSGFYNQLVHKIAGF
FT                   CVIYGIFLTLGEFGPGGNIGLLASKTSPTAIRGVYYGIAAAIGKCGAIAGVYAFGGDQV
FT                   RNYFYAASAMAIFVAVLALLFVPKLKQTCIEDEDKRFIQACIDAGYGNPYNYEKNEPEQ
FT                   LEEPDRPPAFNPFLSATFSFHHIILC"
FT   misc_RNA        354031..355573
FT                   /locus_tag="SPNCRNA.1343"
FT                   /product="intergenic RNA (predicted)"
FT   tRNA            355920..355991
FT                   /locus_tag="SPBTRNAGLN.04"
FT                   /product="tRNA Glutamine"
FT   5'UTR           355980..356909
FT                   /locus_tag="SPBC1271.08c"
FT   misc_RNA        complement(355997..357265)
FT                   /locus_tag="SPNCRNA.1344"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        356910..357332
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.08c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.08c.1"
FT                   /db_xref="GOA:O94341"
FT                   /db_xref="PomBase:SPBC1271.08c"
FT                   /db_xref="PomBase:SPBC1271.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94341"
FT                   /protein_id="CAA22198.1"
FT                   /translation="MLISRSSMPNLQKRHSDFKTPVYISRSISILNKIFHPCMYIYSRG
FT                   ITNDTYSSDTYELDWYDLGFVHFSKWVELAWCFLTLATWSFMKLLKTLRIVIYICTSDH
FT                   WTHSLRFYYIELSKILLYLLICGVSLYGAIRIFINL"
FT   3'UTR           357333..358079
FT                   /locus_tag="SPBC1271.08c"
FT   5'UTR           358067..358854
FT                   /locus_tag="SPBC1271.07c"
FT   misc_RNA        complement(358510..359373)
FT                   /locus_tag="SPNCRNA.1345"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        358855..359346
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.07c"
FT                   /product="N-acetyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.07c.1"
FT                   /db_xref="GOA:O94340"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PomBase:SPBC1271.07c"
FT                   /db_xref="PomBase:SPBC1271.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94340"
FT                   /protein_id="CAA22197.1"
FT                   /translation="MMKPSNISISAVKLPQDLDDFKMLVQEYLQEFGMDLTFQNVDDEL
FT                   ANPMRKYGPPHGIMLVARDEHGTALGCVAVHPFGGPGCCEMKRLYVRPESRGLKLGVLL
FT                   VKEIIQYSEKLGYSSMVLDTLDTLLPAVRLYKSFGFKTTEPYYHNPIPNVVYMRLEMSK
FT                   "
FT   3'UTR           359347..359856
FT                   /locus_tag="SPBC1271.07c"
FT   misc_RNA        complement(359391..359866)
FT                   /locus_tag="SPNCRNA.1346"
FT                   /product="intergenic RNA (predicted)"
FT   CDS_pept        359903..360343
FT                   /transl_table=1
FT                   /gene="mug96"
FT                   /locus_tag="SPBC1271.06c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.06c.1"
FT                   /db_xref="GOA:O94339"
FT                   /db_xref="PomBase:SPBC1271.06c"
FT                   /db_xref="PomBase:SPBC1271.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94339"
FT                   /protein_id="CAA22196.1"
FT                   /translation="MVIFSSYFSKQMNRFSTPFVFFFKKLNNTLKKSLQFIMRFHSYHP
FT                   MFICLLRDSSRNENRKKKVSIGLRTIMRAFSFLMQVATCLIRYSLILTCLVAILLSVLW
FT                   RIQFAALRMHDLIEEELKMFVLQHNCTLADLWSGKCPSSEDE"
FT   3'UTR           360344..360366
FT                   /gene="mug96"
FT                   /locus_tag="SPBC1271.06c"
FT   misc_RNA        complement(360425..362854)
FT                   /gene_synonym="SPNG1193"
FT                   /locus_tag="SPNCRNA.304"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(360439..363023)
FT                   /locus_tag="SPNCRNA.1347"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        361402..362298
FT                   /locus_tag="SPNCRNA.1348"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           362405..363441
FT                   /locus_tag="SPBC1271.05c"
FT   CDS_pept        363442..364089
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.05c"
FT                   /product="zf-AN1 type zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.05c.1"
FT                   /db_xref="GOA:O94338"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="PomBase:SPBC1271.05c"
FT                   /db_xref="PomBase:SPBC1271.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94338"
FT                   /protein_id="CAA22195.1"
FT                   /translation="MVLLQIIASQSYSIEVDEHSSLGNIFDLLSDQGILPKNAKSLHAF
FT                   YYHGTRLNMNMTCADYGIIHDSAVHIAPLPSSCDIDFKDYSTSAFHLHFSPLTPNHAST
FT                   EAVSNFKQSSTIPSISKSNLTNPPLESEKSSDKALLTRPATSRRRCCHPTCTRITLRLA
FT                   GNCLHCNGRFCAAHRLMEDHDCVALFSLRKEEHERNRIKLEKEHGDTLISKV"
FT   3'UTR           364090..364861
FT                   /locus_tag="SPBC1271.05c"
FT   5'UTR           365078..365414
FT                   /locus_tag="SPBC1271.04c"
FT   CDS_pept        join(365415..365630,365766..366542,366595..366654)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.04c"
FT                   /product="eIF-5A-deoxyhypusine synthase (predicted)"
FT                   /EC_number="2.5.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.04c.1"
FT                   /db_xref="GOA:O94337"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="PomBase:SPBC1271.04c"
FT                   /db_xref="PomBase:SPBC1271.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94337"
FT                   /protein_id="CAA22194.2"
FT                   /translation="MDESLAKDAVFVASSKPSDLTTEVVGPDFNKYDERKKAGGPGITV
FT                   EELVESYGKIGFQATNLHDAVTIINEMRNWRDPNPPEEKSDRATIFLGYTSNLISSGVR
FT                   EVLRYLVQHKCVDVIVTTAGGVEEDIIKCLGPTYVGDFHLDGKNLRAKGLNRIGNLIVP
FT                   NDNYCRFEEWIFPILNKMVEEQETLGTHWTPSSFIRRLGKEINDESSVLYWAYKNNIPI
FT                   YSPALTDGSIGDMLYFHTYKATPRPLVLDIVADIRNMNTHAVRANKSGIIILGGGVVKH
FT                   HICNANLMRNGAEWSVYINSANEFDGSDAGARPDEAVSWGKIRGDAKKVKVYGEVSLLF
FT                   PLIVAATFAK"
FT   3'UTR           366655..367258
FT                   /locus_tag="SPBC1271.04c"
FT   5'UTR           join(367192..367278,367331..367530)
FT                   /locus_tag="SPBC1271.03c"
FT   CDS_pept        367594..368328
FT                   /transl_table=1
FT                   /locus_tag="SPBC1271.03c"
FT                   /product="NLI interacting factor family phosphatase
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.03c.1"
FT                   /db_xref="GOA:O94336"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PomBase:SPBC1271.03c"
FT                   /db_xref="PomBase:SPBC1271.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94336"
FT                   /protein_id="CAA22193.1"
FT                   /translation="MAPEPSLTYLSQASSCNGATDNRKLVILDLNGTLLCRALAVRSEK
FT                   SVYEASRNPIPRPGLHNFLKYIFANFSVMVFSSSKPHNVQAMLSAIMNEEQKKALIACW
FT                   TRVDMKLTKHQFDRKVQTYKNLDTVWEKIHHDSTGKPVSWSQYNTIIVDDSKTKCAAHP
FT                   YNHIAVSDFVAKSHSNIPKDIELACVIRYLKHLKSVPNVSYYIYKFPFKILADKSLEDN
FT                   LKYLDELDENYKKECQVDNPQP"
FT   3'UTR           368329..368573
FT                   /locus_tag="SPBC1271.03c"
FT   3'UTR           complement(368439..368557)
FT                   /gene="stt3"
FT                   /locus_tag="SPBC1271.02"
FT   CDS_pept        complement(join(368558..370716,370776..370875))
FT                   /transl_table=1
FT                   /gene="stt3"
FT                   /locus_tag="SPBC1271.02"
FT                   /product="oligosaccharyltransferase subunit Stt3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.02.1"
FT                   /db_xref="GOA:O94335"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="PomBase:SPBC1271.02"
FT                   /db_xref="PomBase:SPBC1271.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94335"
FT                   /protein_id="CAA22192.1"
FT                   /translation="MANSATITSKKGVKSHQKDWKIPLKVLILICIAVASVSSRLFSVI
FT                   RYESIIHEFDPWFNFRASKILVEQGFYNFLNWFDERSWYPLGRVAGGTLYPGLMVTSGI
FT                   IFKVLHLLRINVNIRDVCVLLAPAFSGITAIATYYLARELKSDACGLLAAAFMGIAPGY
FT                   TSRSVAGSYDNEAIAITLLMSTFALWIKAVKSGSSFWGACTGLLYFYMVTAWGGYVFIT
FT                   NMIPLHVFVLLLMGRYTSKLYIAYTTYYVIGTLASMQVPFVGFQPVSTSEHMSALGVFG
FT                   LLQLFAFYNYVKGLVSSKQFQILIRFALVCLVGLATVVLFALSSTGVIAPWTGRFYSLW
FT                   DTNYAKIHIPIIASVSEHQPPTWSSLFFDLQFLIWLLPVGVYLCFKELRNEHVFIIIYS
FT                   VLGTYFCGVMVRLVLTLTPCVCIAAAVAISTLLDTYMGPEVEEDKVSEEAASAKSKNKK
FT                   GIFSILSFFTSGSKNIGIYSLLSRVLVISSTAYFLIMFVYHSSWVTSNAYSSPTVVLST
FT                   VLNDGSLMYIDDFREAYDWLRRNTPYDTKVMSWWDYGYQIAGMADRITLVDNNTWNNTH
FT                   IATVGKAMSSPEEKAYPILRKHDVDYILIIYGGTLGYSSDDMNKFLWMIRISQGLWPDE
FT                   IVERNFFTPNGEYRTDDAATPTMRESLLYKMSYHGAWKLFPPNQGYDRARNQKLPSKDP
FT                   QLFTIEEAFTTVHHLVRLYKVKKPDTLGRDLKQVTLFEEGKRKKLRRPAKTNEIPLRV"
FT   misc_RNA        370395..371030
FT                   /locus_tag="SPNCRNA.1349"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           complement(370876..370940)
FT                   /gene="stt3"
FT                   /locus_tag="SPBC1271.02"
FT   5'UTR           371015..372358
FT                   /gene="pof13"
FT                   /locus_tag="SPBC1271.01c"
FT   CDS_pept        372359..373549
FT                   /transl_table=1
FT                   /gene="pof13"
FT                   /locus_tag="SPBC1271.01c"
FT                   /product="F-box protein Pof13"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1271.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1271.01c.1"
FT                   /db_xref="GOA:O94334"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="PomBase:SPBC1271.01c"
FT                   /db_xref="PomBase:SPBC1271.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94334"
FT                   /protein_id="CAA22191.1"
FT                   /translation="MRPTHWSSNQCEVDFTAEALTTLSLSNRNHEEDPIQPVLKNSNLF
FT                   LLNRDIWSLIINYLDAFDILRLMHSSRQFYYWLRKSAVDECCFNNNFLNLQPYQRTVPV
FT                   ASDLEWATEVDLYGNPPILKLQLRDSFVWSMLAKFQGLQTIALDGTGVTISSVTNILLN
FT                   IPTVKTLSIRWCVGVCSLSLIEFLQNSKSRTFSLENLYVLGVKGLELLKPVLLDGSEDD
FT                   TLTSNWHSRVILFQNALDALPTTHGNPVECDISRCPLNACKIAGQETELADLFSLQKVP
FT                   ACIYCLREWKKPICRYCIDLRSCLVCDSFVCPSCISLDFDLQIQAFARQHRVISTLGVV
FT                   YPEREDSCFHKIKAAQWHQISPRSLLFQFQEQNHIHHKKIRRKLLAAGWKWPQSQI"
FT   3'UTR           373550..373651
FT                   /gene="pof13"
FT                   /locus_tag="SPBC1271.01c"
FT   5'UTR           373692..373888
FT                   /gene="mph1"
FT                   /gene_synonym="SPBC1271.16c"
FT                   /gene_synonym="SPBC243.01"
FT                   /locus_tag="SPBC106.01"
FT   CDS_pept        373889..375925
FT                   /transl_table=1
FT                   /gene="mph1"
FT                   /gene_synonym="SPBC1271.16c"
FT                   /gene_synonym="SPBC243.01"
FT                   /locus_tag="SPBC106.01"
FT                   /product="dual specificity protein kinase Mph1"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.01.1"
FT                   /db_xref="GOA:O94235"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027084"
FT                   /db_xref="PomBase:SPBC106.01"
FT                   /db_xref="PomBase:SPBC106.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94235"
FT                   /protein_id="CAB72266.2"
FT                   /translation="MSKRNPPVTNIADLVSDSSLDEDSLSFLEELQDPELYFKNDTFSS
FT                   KSSHSDGTVTGDTLRRQSSGATALERLVSHPRTKNFDLQGNGGQNSALKEVNTPAYQSM
FT                   HHFEHLITPLPSTNASHSEVSLSAGVNDLNSNSEHDLLPKSVNKTPGSLSISRRRRIGR
FT                   IGLGPPKRAEYTLTDPSKTSDTKNSTEADEDIEMKSREVSPASNSVAATTLKPLQLHNT
FT                   PLQTSQEHPKPSFHPSQFESSFSPRVQFDHDVERRASELHSRPVTVFQEPQRSASQPYE
FT                   SHALSPKVAPLFDNSQATPIPKRQQDVVTVANLQFIKLGVVGKGGSSMVYRIFSPDNSR
FT                   LYALKEVNFINADQTTIQGYKNEIALLRKLSGNDRIIKLYAAEVNDTLGQLNMVMECGE
FT                   TDLANLLMKNMKKPINLNFIRMYWEQMLEAVQVVHDQNIVHSDLKPANFLLVEGNLKLI
FT                   DFGIAKAIGNDTTNIHRDSHIGTINYMAPEALTDMNAHTNSGVKLVKLGRPSDVWSLGC
FT                   ILYQMVYGRAPFAHLKMIQAIAAIPNEQYHIHFPEVALPANAVQEKEGSLPGVTVGPDL
FT                   MDVMKRCLERDQRKRLTIPELLVHPFLNPLPSYLTPLAKKPLPVSGHTNNAHPLRLSTE
FT                   ISASQLSMIIERSVELSKHKRLNKELIDSMAYDCVSNLRKMPE"
FT   3'UTR           375926..376292
FT                   /gene="mph1"
FT                   /gene_synonym="SPBC1271.16c"
FT                   /gene_synonym="SPBC243.01"
FT                   /locus_tag="SPBC106.01"
FT   3'UTR           complement(376253..376461)
FT                   /gene="srx1"
FT                   /locus_tag="SPBC106.02c"
FT   CDS_pept        complement(376462..376836)
FT                   /transl_table=1
FT                   /gene="srx1"
FT                   /locus_tag="SPBC106.02c"
FT                   /product="sulfiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.02c.1"
FT                   /db_xref="GOA:Q9URV9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="PomBase:SPBC106.02c"
FT                   /db_xref="PomBase:SPBC106.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV9"
FT                   /protein_id="CAB53718.1"
FT                   /translation="MTSIHTGSNNNIVELDMSELIRPIPPVLDMNKVNSMMETMTGKTP
FT                   PASCGLTSEDLEAGELPPVDVLTFKKSGKPYYFAFGGCHRLRAHDEAGRKKVRCKLVNC
FT                   SPNTLRLYLGASANKFLDSD"
FT   5'UTR           complement(376837..377036)
FT                   /gene="srx1"
FT                   /locus_tag="SPBC106.02c"
FT   misc_RNA        complement(376976..378395)
FT                   /locus_tag="SPNCRNA.1350"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        377318..377617
FT                   /gene_synonym="SPNG1197"
FT                   /locus_tag="SPNCRNA.305"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           378360..378626
FT                   /locus_tag="SPBC106.03"
FT   CDS_pept        378627..379700
FT                   /transl_table=1
FT                   /locus_tag="SPBC106.03"
FT                   /product="DUF1776 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.03.1"
FT                   /db_xref="GOA:Q9URV8"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="PomBase:SPBC106.03"
FT                   /db_xref="PomBase:SPBC106.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV8"
FT                   /protein_id="CAB53719.1"
FT                   /translation="MNPERWAADLVSNVKDYGKRIIDYAHEKTSNPQPVTVHTTNSAKG
FT                   RLGEFLYQNRVSVGLGSAALFLAGLSYYKRYDYVRKRRAPRAPNHQKTQVVVLSAWNPL
FT                   ASVIAHDLDRRGFIVVVLVRDASEAATVSLQQRPYIQSLIVTHNEAVERFLLSFSNQSG
FT                   PKEYALRLRGLILVPTGDSLYTPIENIGKDAWISAFQQLSESFSNVSRMIPLLKSQKAR
FT                   IIGLSHGILSAYEPPNYAVPSILSSSIETFLRTLKRETGLQVICIKLGNLSFLNYDHSS
FT                   SPGKSNYPPSLCTERKVLNKIFDSLLGCWPSPTRHVGCRTFFMVTVSRFLPTCVIDGIF
FT                   SLFGKFHFFSCSLIKRS"
FT   3'UTR           379701..380053
FT                   /locus_tag="SPBC106.03"
FT   5'UTR           380287..380389
FT                   /gene="ada1"
FT                   /locus_tag="SPBC106.04"
FT   CDS_pept        join(380390..380560,380624..382948)
FT                   /transl_table=1
FT                   /gene="ada1"
FT                   /locus_tag="SPBC106.04"
FT                   /product="adenosine deaminase Ada1 (predicted)"
FT                   /EC_number="3.5.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.04.1"
FT                   /db_xref="GOA:P50998"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PomBase:SPBC106.04"
FT                   /db_xref="PomBase:SPBC106.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50998"
FT                   /protein_id="CAB53720.2"
FT                   /translation="MNMEQEDDQVPAVAAETVPLKRYVTNPGANRDEEVAAAPSSQDTP
FT                   YFDYAYERSLRHQDAKFLAMNGTQNGRDGLPSKSPRRPSVSASTVRNSDDVNHSKAGPG
FT                   SGKLLNDTLQSKISSIHMPHVQQGDNAVVSSVGGPETDPGNMETTDPLFSDELAEIYLS
FT                   IHKCMDMRHKYIRVSLQGELDNPIDDDSWIIYPDCKEGEDDTGLFNFADCKIPGIENEM
FT                   EYHMDHQGIFQVYENDSAYIAGTPSFHIPTIRDYYIDLEFLLSASSDGPSKSFSFRRLQ
FT                   YLEGRWNMYMLLNEYQELADTKKVPHRDFYNVRKVDTHVHHSALANQKHLLRFIKAKLR
FT                   KCPNEKVIWRDGKFLTLQEVFDSLKLTSYDLSIDTLDMHAHTDTFHRFDKFNLKYNPIG
FT                   ESRLRTIFLKTDNDINGRYLAELTKEVFTDLRTQKYQMAEYRISIYGRNREEWDKLAAW
FT                   IIDNELFSPNVRWLIQVPRLYDVYKKSGIVETFEEVVRNVFEPLFEVTKDPRTHPKLHV
FT                   FLQRVIGFDSVDDESKPERRTFRKFPYPKHWDINLNPPYSYWLYYMYANMTSLNSWRKI
FT                   RGFNTFVLRPHCGEAGDTDHLASAFLLSHGINHGILLRKVPFLQYLWYLDQIPIAMSPL
FT                   SNNALFLAYDKNPFLTYFKRGLNVSLSTDDPLQFAFTREPLIEEYAVAAQIYKLSAVDM
FT                   CELARNSVLQSGFERQLKERWLGVDFQDIDRTNVPIIRLAYRALTLTQEIALVNKHVQP
FT                   SKHPSNHDLEELIHKYDAMTGTSDPLSASPRTNDATISSRLSLHDGHDHGAFFPGLSVI
FT                   SERRRRKDSMASSSQDLKD"
FT   intron          380561..380623
FT                   /gene="ada1"
FT                   /locus_tag="SPBC106.04"
FT   3'UTR           382949..383300
FT                   /gene="ada1"
FT                   /locus_tag="SPBC106.04"
FT   3'UTR           complement(383297..383526)
FT                   /gene="tim11"
FT                   /locus_tag="SPBC106.05c"
FT   CDS_pept        complement(join(383527..383612,383703..383874,
FT                   383940..383960))
FT                   /transl_table=1
FT                   /gene="tim11"
FT                   /locus_tag="SPBC106.05c"
FT                   /product="F0-ATPase subunit E (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.05c.1"
FT                   /db_xref="GOA:Q9URV6"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="PomBase:SPBC106.05c"
FT                   /db_xref="PomBase:SPBC106.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV6"
FT                   /protein_id="CAB53721.3"
FT                   /translation="MNSINVKTLRWSALVLGLGAGMYEHRSHIQCQKQKEIDENYHRQE
FT                   SLIESAKIAYLNTKNTPPKEDSMLPNLKKDSEDFDMDEFVKELEKNV"
FT   5'UTR           complement(383961..384085)
FT                   /gene="tim11"
FT                   /locus_tag="SPBC106.05c"
FT   5'UTR           384208..384320
FT                   /gene="cct4"
FT                   /locus_tag="SPBC106.06"
FT   CDS_pept        384321..385904
FT                   /transl_table=1
FT                   /gene="cct4"
FT                   /locus_tag="SPBC106.06"
FT                   /product="chaperonin-containing T-complex delta subunit
FT                   Cct4"
FT                   /db_xref="GOA:P50999"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50999"
FT                   /protein_id="CAB53722.1"
FT                   /translation="MSKAATVPVAFQDREKPQEVRLSNIMAARSVADAIRTSLGPKGMD
FT                   KMIQTGKGEVILTNDGATILKHLSVLHPAAKMLVDLSAAQDVEAGDGTTSVVILAGSML
FT                   ACAEKLLKKGIHPTVIAESFQRAAGFTVDCMKENALAIELSDRESLLRAATTSLNSKIV
FT                   SQYSNLLAPIAVDAVLKVIDPRVATNVDLKDIRIVKKLGGIIDDTELIPGLALTQTAVK
FT                   SAGGPTRIEKANIALIQFQLSPPKPDMENQVVVNDYRQMDKILKEERQYLLNMCKKIKK
FT                   AGANVILIQKSILRDAVNDLALHFLAKLKIMVIKDIERDEVEFICKSTGCKPIADIESF
FT                   AEDKLGHADLVEETSSSGEKIVKFSGVKNAGKTVSILCRGANLLTLEEAERSLHDALCV
FT                   IRCLVKQRALIAGGGSPEIEAAQRLLEHARQLEGREAICIRAFSEALEIIPVTLAENAG
FT                   LNAIQVVTELRSRHANGEKTAGINVRKGIVTNILEENVLQPLLVNISAIQLAAETTKMI
FT                   MKIDDITLAR"
FT   3'UTR           complement(384370..386505)
FT                   /locus_tag="SPBC106.07c"
FT   3'UTR           385905..386095
FT                   /gene="cct4"
FT                   /locus_tag="SPBC106.06"
FT   CDS_pept        complement(386506..387009)
FT                   /transl_table=1
FT                   /locus_tag="SPBC106.07c"
FT                   /product="N alpha-acetylation related protein Nat2
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.07c.1"
FT                   /db_xref="GOA:Q9URV4"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="PomBase:SPBC106.07c"
FT                   /db_xref="PomBase:SPBC106.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV4"
FT                   /protein_id="CAB53723.1"
FT                   /translation="MSNLWRNLKSVRLPFRRAPTLPLYNVPVRRSISSSSSIPPSSSPP
FT                   PRLTITQRVKELTKKYGWWSLGVYIGISVLDFSASFVLVRTLGAERIGYLEHSILNSIR
FT                   RYFNWEIPESTASGEPEAYHSSIWTELAFAYGIHKALVVARVPLTAAIVPPLAKRFRGP
FT                   RIRP"
FT   5'UTR           complement(387010..387219)
FT                   /locus_tag="SPBC106.07c"
FT   3'UTR           complement(387156..387840)
FT                   /gene="mug2"
FT                   /locus_tag="SPBC106.08c"
FT   misc_RNA        387803..388988
FT                   /locus_tag="SPNCRNA.1351"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(387841..388731)
FT                   /transl_table=1
FT                   /gene="mug2"
FT                   /locus_tag="SPBC106.08c"
FT                   /product="cell surface glycoprotein (predicted), DUF1773
FT                   family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.08c.1"
FT                   /db_xref="GOA:Q9URV3"
FT                   /db_xref="InterPro:IPR013902"
FT                   /db_xref="PomBase:SPBC106.08c"
FT                   /db_xref="PomBase:SPBC106.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV3"
FT                   /protein_id="CAB53724.1"
FT                   /translation="MKKENWQKIENVYLLGKKIDKAKRMANKGESNTNMLSTEENIVKA
FT                   KAVSRKKPVDVSYAGLARHESHVDTDYHGQALNTDNQDPKNYQARSFVKENELYESSQD
FT                   CGHSRLAQILSEENQIKRLPQSDNTTTERIIENNPNYSNKPSKLKRALSGENSVFSIHQ
FT                   RNTLSPSSNLPRIPSDLYDIKQFLENLDARSFKSDMDLKRSQNMRRRATGYPAIVVPFL
FT                   NGSLPQADLPPLRTIEDIDNLTREQCLTFIQGYGIPIDSSDTVYLKEKLRDAIGMRAFT
FT                   DMSFEMNSFHLESPR"
FT   5'UTR           complement(388732..388840)
FT                   /gene="mug2"
FT                   /locus_tag="SPBC106.08c"
FT   misc_RNA        388954..390296
FT                   /locus_tag="SPNCRNA.1352"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           390925..390988
FT                   /gene="cut4"
FT                   /gene_synonym="apc1"
FT                   /locus_tag="SPBC106.09"
FT   CDS_pept        390989..395365
FT                   /transl_table=1
FT                   /gene="cut4"
FT                   /gene_synonym="apc1"
FT                   /locus_tag="SPBC106.09"
FT                   /product="anaphase-promoting complex subunit Apc1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.09.1"
FT                   /db_xref="GOA:Q9URV2"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="PomBase:SPBC106.09"
FT                   /db_xref="PomBase:SPBC106.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV2"
FT                   /protein_id="CAB53725.1"
FT                   /translation="MLELKTNVIQDPELKDSLDLQENDRVEIIGDAVHYIVNDHLNRVF
FT                   NYTVDQQKIHAALITTFASGKKAIVVILDDIGYVYYVGDNNNDSYIINVPFSTESAWSS
FT                   PSGLYLQRHRSSDENLNTDLPHIFCLNDPLDELTLIKFDGKKILSLFDSIVYVVGEIVV
FT                   THNKKEKKLSFWRSRFIDPESDQSIKSSRNRRRESSFSREKNPDLTRSDSIHYTANTRL
FT                   SEKFEEQGLAYSTIFSHIESFPITGSTSFDSILGNGVLVITTLVKELEKGYMMLFRLVR
FT                   DRSPYFLDSLQLHAINLSAIKSKHLQKIVVLSSKGKVSLESPMSPSLPIEGTFRSFRVH
FT                   GATLYLEDTDGVQRYISLDNRASNSLVKWCLSVIRYVLPLREYEIFYTGHLYALFAFKL
FT                   SHDEAFISSILACFTFFSRDKVHVEPIEDCNEAYSLSSKFHFKKEILIASQLSSHLDYS
FT                   TFKNYLMPLAITLHFISEELRLDSVVKPRKDQLVALLLQITTWLKWPRYCEYYNFDIAE
FT                   TFLSIPLSIQVDVEEPVGPTSILQWIIECLRSQSTVPFYGLESYGLPHSCSTMFPQTLS
FT                   LMQLLDCLLNPNMTLQNLVEEMVRLGISRKRCERYPFGILCIIFTVLEIAAEEYSPNWE
FT                   SEELRLVNRLDVDSFLHPKTPKWVFNKQDQEVKEIKALTSTVTDSTLVDTQSFHPYKVV
FT                   TDMIFREDRRLAEVNKLLNYSSQITIMTEHFDVDLSSVPMQQKVAQCICVRTLSVPIGA
FT                   GMLTYGSKNPLPTEKVTPRLFNFTLHLHPGTLIIQPNKEFVTQELTEWPEFNVGVALGL
FT                   SISKFSKEINTSWIMFNRPETLTAYHAGFLFGLGLNGHLKALATWHSFIYLTSKHDTTS
FT                   IGLLLGLASSYLGSMDAKVTKLLSVHISALLPVGSNELNISPLTQTAGILGIGLLFHDS
FT                   CHRRMSEVTMEEILASNESELKNEGYKLAAGFSLGLINLGRGSNLPGMSDLKLVSRLQV
FT                   GISSQATFQSLEAGSPGAIMALTMIYMKTNDLEVAKKIDIPKSRYLLDFYRPDLILLRV
FT                   AGKNLIMWDEVKADYEWVKYQIPDIMLSQFDLQEKKVLSSDDLLLYNVLAGICFSLGLR
FT                   FAGTGNPKAKEILINFLDSFIRLCHLPAKTHDERVTAVTVIRCTQIVALSSSCVMAGYC
FT                   DLDVLRRLRVLHGRMEPVNYGAQMATHMALGILSLGGGRYSLSRSNLAIAALLISFYPQ
FT                   FPRTTQDNRAHLQAARNLWALAVEERCIIPRNQDTKQPCIVPLNVVQKSGAVQKLEAPI
FT                   LLPPYDSISSVSTLGDKYWNLKIDLDNNSDYRELLRESQTLTLMPYDRTSSKEEPLNLF
FT                   PKLKDTSSPLWNLVKTSRLFQSSNSPLNVASLQESNNKTSLGVKLLLSMDFDNLTRDRL
FT                   LSLQILLQFFESCWTGVLLNKFHSRQYLFLSRDLVEDLSLRVWEYVYSHNHNEESV"
FT   3'UTR           395366..396037
FT                   /gene="cut4"
FT                   /gene_synonym="apc1"
FT                   /locus_tag="SPBC106.09"
FT   5'UTR           396752..396991
FT                   /gene="pka1"
FT                   /gene_synonym="tpk"
FT                   /gene_synonym="git6"
FT                   /locus_tag="SPBC106.10"
FT   CDS_pept        396992..398530
FT                   /transl_table=1
FT                   /gene="pka1"
FT                   /gene_synonym="tpk"
FT                   /gene_synonym="git6"
FT                   /locus_tag="SPBC106.10"
FT                   /product="cAMP-dependent protein kinase catalytic subunit
FT                   Pka1"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.10.1"
FT                   /db_xref="GOA:P40376"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPBC106.10"
FT                   /db_xref="PomBase:SPBC106.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40376"
FT                   /protein_id="CAB53726.1"
FT                   /translation="MDTTAVASKGSTNVGSSTDTLSTSASLHPSMNAGSVNEYSEQQRH
FT                   GTNSFNGKPSVHDSVGSDASVSNGHNNHNESSLWTSGIPKALEEATKSKKPDSLVSTST
FT                   SGCASAHSVGYQNIDNLIPSPLPESASRSSSQSSHQRHSRDGRGELGSEHGERRSAMDG
FT                   LRDRHIRKVRVSQLLDLQRRRIRPADHTTKDRYGIQDFNFLQTLGTGSFGRVHLVQSNH
FT                   NRLYYAIKVLEKKKIVDMKQIEHTCDERYILSRVQHPFITILWGTFQDAKNLFMVMDFA
FT                   EGGELFSLLRKCHRFPEKVAKFYAAEVILALDYLHHNQIVYRDLKPENLLLDRFGHLKI
FT                   VDFGFAKRVSTSNCCTLCGTPDYLAPEIISLKPYNKAADWWSLGILIFEMLAGYPPFYS
FT                   ENPMKLYENILEGKVNYPSYFSPASIDLLSHLLQRDITCRYGNLKDGSMDIIMHPWFRD
FT                   ISWDKILTRKIEVPYVPPIQAGMGDSSQFDAYADVATDYGTSEDPEFTSIFKDF"
FT   3'UTR           398531..398957
FT                   /gene="pka1"
FT                   /gene_synonym="tpk"
FT                   /gene_synonym="git6"
FT                   /locus_tag="SPBC106.10"
FT   3'UTR           complement(399003..399367)
FT                   /gene="plg7"
FT                   /locus_tag="SPBC106.11c"
FT   CDS_pept        complement(399368..400684)
FT                   /transl_table=1
FT                   /gene="plg7"
FT                   /locus_tag="SPBC106.11c"
FT                   /product="phospholipase A2, PAF family homolog"
FT                   /EC_number="3.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.11c.1"
FT                   /db_xref="GOA:Q9URV1"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016715"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PomBase:SPBC106.11c"
FT                   /db_xref="PomBase:SPBC106.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV1"
FT                   /protein_id="CAB53727.1"
FT                   /translation="MGLGFSSKKQLPAYCGPLPVGSLVLELSVPEEFRCEYKTIEHKLR
FT                   TVKVRIFYPLDPTKDVEPRTDELWLPFHEGIPEVAKGFRWWLLRAFASGLTNLALPVYK
FT                   GELFHPPNNGKLPVFIFSHGLVGSRNVYSSLCGTIASYGIVVLAMEHRDNSAIISTVRD
FT                   PLHPEEPPYVVQYREISDFYADATVVLQNERLLFRQQEIQIALQMIRNINDLGTPDENL
FT                   PFLCSVDSSFYNSVFQSMKGNLNTAQGELIVAGHSFGAATCAFISGSSTKSLYNDYMFH
FT                   TEFKCSILYDIWMLPVRQLHLSTMRYPTLMIISYEFRRFVDNFQALESWLVNKDSENQN
FT                   AGESADEKMSVVPLKKYSHVFVYDGTVHANQSDLPILLPRMVLRVLKGKFEADPYEALR
FT                   INTRSSVQFLRENHVENVQGDNDPSSLQTNIIPGWERIM"
FT   5'UTR           complement(400685..401020)
FT                   /gene="plg7"
FT                   /locus_tag="SPBC106.11c"
FT   misc_RNA        400819..401999
FT                   /locus_tag="SPNCRNA.1353"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(400954..401164)
FT                   /locus_tag="SPBC106.12c"
FT   CDS_pept        complement(join(401165..401683,401844..401910,
FT                   402017..402141,402195..402263,402305..402349))
FT                   /transl_table=1
FT                   /locus_tag="SPBC106.12c"
FT                   /product="THO complex subunit (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.12c.1"
FT                   /db_xref="GOA:Q9URV0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025715"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PomBase:SPBC106.12c"
FT                   /db_xref="PomBase:SPBC106.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URV0"
FT                   /protein_id="CAB53728.1"
FT                   /translation="MSLEKSLDEIINERTNGFDHKHSRRRGSQNRISKKSRLTYKFKRA
FT                   SKEHNSSPDDGPWQHDLDQEQDAHPRTTHLQKRQHSENRFGVRVENLHYQVLEKDVLSL
FT                   FENFHPIRVIMNYDRAGRSEGSCDVYFETSQDAEDAQKTLQSTNLKGSEIQISKKSPPS
FT                   LFDRISDMPHSARKPSRSSRSNRGFNRSSKKDDRSFRSSSKKSSNNSISHEDLDKELDE
FT                   YAMSFHAASTVSSHSSQDFTPSIANAHEKNEPVAPSKDSNLTEEMDLQMEAV"
FT   5'UTR           complement(402350..402514)
FT                   /locus_tag="SPBC106.12c"
FT   5'UTR           402509..402695
FT                   /locus_tag="SPBC106.13"
FT   CDS_pept        join(402696..402923,402986..403507,403558..404022)
FT                   /transl_table=1
FT                   /locus_tag="SPBC106.13"
FT                   /product="ubiquitin ligase complex subunit, involved in
FT                   proteasome-dependent catabolite inactivation of FBPase
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.13.1"
FT                   /db_xref="GOA:Q9URU9"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027714"
FT                   /db_xref="PomBase:SPBC106.13"
FT                   /db_xref="PomBase:SPBC106.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9URU9"
FT                   /protein_id="CAB53729.1"
FT                   /translation="MNFRPEQQYILEKPGILLSFEQLRINFKHILRHLEHESHVINSTL
FT                   TTLISQENASMDEKIEKIDSLLSRVSTVKKKMKHLHDCEALFIKQTKSRLLFMNRLQGI
FT                   RDMESADFLDWSRVRLNRLVADYMMANGYHGAAALLCKDSQLENLVDLGIYKRYQLIHD
FT                   SILQQELKEVLSWCSEHRAILKKNNSTLELEVRLQRFIELIKSKKLCQAIAFAKAHFGT
FT                   WANEHPARLQLAAALLAFPEFTNGSPYSLLLSDDRWEYLASLFTSNFTAVHNIPSVPLL
FT                   HALLAAGLSSLKTPLCYLDANDDNPLALQSQTVKQCPVCTPCLNDLGKALPYAHITQSA
FT                   IVDSLTGEGLDSDNCPVAFPNGRVYGIQSLISWNEANGTREGFLRDPYSGKEFPFQLLR
FT                   KVYVV"
FT   3'UTR           404023..404213
FT                   /locus_tag="SPBC106.13"
FT   3'UTR           complement(404099..404261)
FT                   /gene="sda1"
FT                   /locus_tag="SPBC106.14c"
FT   misc_RNA        404224..406445
FT                   /locus_tag="SPNCRNA.1354"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(404262..406421)
FT                   /transl_table=1
FT                   /gene="sda1"
FT                   /locus_tag="SPBC106.14c"
FT                   /product="SDA1 family protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.14c.1"
FT                   /db_xref="GOA:Q10342"
FT                   /db_xref="InterPro:IPR007949"
FT                   /db_xref="InterPro:IPR012977"
FT                   /db_xref="InterPro:IPR027312"
FT                   /db_xref="PomBase:SPBC106.14c"
FT                   /db_xref="PomBase:SPBC106.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10342"
FT                   /protein_id="CAB53730.1"
FT                   /translation="MVKRRTAAVLPNNLPHLQHLVKKDPKSYREEFLQQWNHYETAREI
FT                   FLVNPSSDISEFCSLIDFISQTCNYYHDVTADFPSELIELLQKNHTIFPFELCEKIVLC
FT                   LVLLKNKTVISPITLLQCFFPLFRENPTRGVRELLYQQVSLTIRNANKQAKNDKLNKAV
FT                   QSALFTLVDGSGSGSATHTDYSGQKREYSASELSGVWAVKMVRDLWKRNVWSGDARAVN
FT                   IMKSAALSSNPKVMLAGIYFFLGADNQEEEEESDDEGPDVSKLLHQANVNKKTKSREAA
FT                   LLRARAVVKKKERGKQNVPTNVNFPALQLLHDPQGFAEELFEKHLASSKSRLSMDQKLV
FT                   VLRLLTRLVGSHKLTVLGLYSFLMKYLTPHQRDVTQFLACLAQASHEFVPPDALEPLVR
FT                   KIADEFVTSGVANEVVCAGINAIREVCARAPLAMTPDLLQDLTEYKSSKDKGVMMASRS
FT                   LITLYREVAPDMLKRKDRGKLASIEMKDRTPLKYGEELNVTHGIQGLELLAQYKAEHGE
FT                   EGENGDDWDNWEVSEDGQNSDDSGGWIDVDSDDNIELSDSDEEEEKATARKESDEKGSS
FT                   SQKELVDRMTELASQSILTPNDLKKLEELREQAGVDRLVNGPKRSLKRPDDAVEADEIE
FT                   GPRKKAKNDREARIASVMEGREGRDKFSSKKAGFNPTSLSNKRKQRNKNFMMIKHKLKG
FT                   KAGRSLVQKQKVLREHVAREKRKIK"
FT   5'UTR           complement(406422..406902)
FT                   /gene="sda1"
FT                   /locus_tag="SPBC106.14c"
FT   5'UTR           406839..406867
FT                   /gene="idi1"
FT                   /locus_tag="SPBC106.15"
FT   CDS_pept        join(406868..406991,407056..407394,407451..407677)
FT                   /transl_table=1
FT                   /gene="idi1"
FT                   /locus_tag="SPBC106.15"
FT                   /product="isopentenyl-diphosphate delta-isomerase Idi1"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="GOA:Q10132"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10132"
FT                   /protein_id="CAB53731.2"
FT                   /translation="MIMSSQQEKKDYDEEQLRLMEEVCIVVDENDVPLRYGTKKECHLM
FT                   ENINKGLLHRAFSMFIFDEQNRLLLQQRAEEKITFPSLWTNTCCSHPLDVAGERGNTLP
FT                   EAVEGVKNAAQRKLFHELGIQAKYIPKDKFQFLTRIHYLAPSTGAWGEHEIDYILFFKG
FT                   KVELDINPNEVQAYKYVTMEELKEMFSDPQYGFTPWFKLICEHFMFKWWQDVDHASKFQ
FT                   DTLIHRC"
FT   intron          406992..407055
FT                   /gene="idi1"
FT                   /locus_tag="SPBC106.15"
FT   intron          407395..407450
FT                   /gene="idi1"
FT                   /locus_tag="SPBC106.15"
FT   3'UTR           407678..407908
FT                   /gene="idi1"
FT                   /locus_tag="SPBC106.15"
FT   5'UTR           409158..409495
FT                   /gene="pre6"
FT                   /locus_tag="SPBC106.16"
FT   CDS_pept        join(409496..409594,409655..410028,410147..410453)
FT                   /transl_table=1
FT                   /gene="pre6"
FT                   /locus_tag="SPBC106.16"
FT                   /product="20S proteasome component alpha 4 Pre6"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.16.1"
FT                   /db_xref="GOA:Q10329"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="PomBase:SPBC106.16"
FT                   /db_xref="PomBase:SPBC106.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10329"
FT                   /protein_id="CAB53732.1"
FT                   /translation="MSGYDRALSVFSPDGRLLQVEYGQEAVRRGTTAIALRGNECIVIG
FT                   VERKNVPKLQNVSNFQKIAMVDNHVCLAFAGLNADARILIDKARVEAQNHKLNLADPVS
FT                   IEYLTRYVAGVQQKYTQSGGVRPFGVSTLIAGFDVGDNTPRVYQTEPAGIYNAWKATAI
FT                   GRASKAAREYLEKNWKEGLSRDETIHLAVSSLLEVVQTASGNIELAIMDPGKDVEFLHS
FT                   DKIDTIVKEIQDEKEAEAARKKSGRSAPGVSTTSTIQ"
FT   3'UTR           410454..410766
FT                   /gene="pre6"
FT                   /locus_tag="SPBC106.16"
FT   3'UTR           complement(410720..411119)
FT                   /gene="cys2"
FT                   /locus_tag="SPBC106.17c"
FT   CDS_pept        complement(411120..412634)
FT                   /transl_table=1
FT                   /gene="cys2"
FT                   /locus_tag="SPBC106.17c"
FT                   /product="homoserine O-acetyltransferase (predicted)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.17c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.17c.1"
FT                   /db_xref="GOA:Q10341"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PomBase:SPBC106.17c"
FT                   /db_xref="PomBase:SPBC106.17c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10341"
FT                   /protein_id="CAB53733.1"
FT                   /translation="MLRASSKRLQLSWQVFRRFQSSNPQLSFPCVDQAQERSRQFEQSL
FT                   QKQQACPNSVDPSASITSPSLSSGPEPVYGKIVSGFKKFYHNKPFLCDHGGILPKFEIA
FT                   YETWGTLNKDHSNAILLHTGLSASSHAHSHPENTAPGWWEQFIGPGKDVDTNKFFVICT
FT                   NVLGSCYGSTGPSSVDPGDGKHYATRFPIITVNDMIRAQLLLLDHLKIEKLYASVGSSL
FT                   GGMQSLTLGALAPHRVGRIASISGGARSHPYSIALRFTQRQILMNDPYWNRGFYYDGVP
FT                   PHTGMKLAREVATISYRSGPEWEQRFGNRRADPSVSPAFCPDFLIETYLDHAGEKFCLQ
FT                   YDPNSLLYISKAMDMHDMSASHQRSLSENRKKNQHKLDKYLSADVSAEEIIKLNEDTSV
FT                   LPDVPYQEIANEDRAPEPDPETNLIAGLAPLKDTPVMVMGVESDNLMPVECQRETARCL
FT                   EKAGNKQVVYHELDANESFYGHDTFLIYRKDLDLVGGKLKKFLELS"
FT   5'UTR           complement(412635..412795)
FT                   /gene="cys2"
FT                   /locus_tag="SPBC106.17c"
FT   misc_RNA        complement(412735..413409)
FT                   /locus_tag="SPNCRNA.1355"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           413462..413555
FT                   /gene="rpl2501"
FT                   /gene_synonym="rpl25a"
FT                   /locus_tag="SPBC106.18"
FT   CDS_pept        join(413556..413653,413894..414221)
FT                   /transl_table=1
FT                   /gene="rpl2501"
FT                   /gene_synonym="rpl25a"
FT                   /locus_tag="SPBC106.18"
FT                   /product="60S ribosomal protein L25 (predicted)"
FT                   /db_xref="GOA:Q10330"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10330"
FT                   /protein_id="CAB53734.1"
FT                   /translation="MSVAKAKGAQKTVQKGIHNKVAKKVRTSTTFRRPKTLQLSRKPKY
FT                   ARKSVAHAPRLDEYKIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKEAVRKLYSV
FT                   EPVKINTLIRPNGTKKAFVKLSADADALDVANRIGFL"
FT   intron          413654..413893
FT                   /gene="rpl2501"
FT                   /gene_synonym="rpl25a"
FT                   /locus_tag="SPBC106.18"
FT   3'UTR           414222..414503
FT                   /gene="rpl2501"
FT                   /gene_synonym="rpl25a"
FT                   /locus_tag="SPBC106.18"
FT   5'UTR           414886..415110
FT                   /gene_synonym="SPBC582.01"
FT                   /locus_tag="SPBC106.19"
FT   CDS_pept        415111..416658
FT                   /transl_table=1
FT                   /gene_synonym="SPBC582.01"
FT                   /locus_tag="SPBC106.19"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.19"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.19.1"
FT                   /db_xref="GOA:Q10340"
FT                   /db_xref="PomBase:SPBC106.19"
FT                   /db_xref="PomBase:SPBC106.19.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10340"
FT                   /protein_id="CAB53735.1"
FT                   /translation="MFLRPWSRNFLCSCRGFSVCTPYASIKSASELALKNISELQALQK
FT                   IQNHTEKLKFFSSKLHNKGEPFTLQLGDLITEHTSVPELNEILDKFSQSNELFTMRFLE
FT                   KASIIAHKNRSAELARRLRTYAANAMIDLSRVAFVNIFWTLLKTRDKEGIVETIEGQPI
FT                   AFKVARRIFRRLLVYTSEAGENIEICFFLTNSLFKRLLNNREALSKDEKSELQNLYYDL
FT                   LLCFSYSYYVPGVKLLLPMLYNGSFKEINRTAIDRSLLALLSTGELEAALELLVYLKNN
FT                   NIPINDAYLRMMVINFCLANKPTLAVRFCQAWFKQSKMLSSTENLLLIAESLSRASNDF
FT                   AAISKQMQPFSIESSSFYLPSHRLLMLVALMMKNSSGILHSYAVLKKANAITNKELRIM
FT                   MQHAMDLRSTEFAEAVLKESEFTLQSNRSQLLMDFVAILFLNKEYTKAFATLEKTFASK
FT                   IKPSHNIISFSLSLVKRFGTKNDLFFLRRSFKNMGIETLDEIEKNLPPKVVYRCFNY"
FT   3'UTR           416659..417163
FT                   /gene_synonym="SPBC582.01"
FT                   /locus_tag="SPBC106.19"
FT   5'UTR           417141..417318
FT                   /gene="exo70"
FT                   /gene_synonym="SPBC582.02"
FT                   /locus_tag="SPBC106.20"
FT   CDS_pept        join(417319..417320,417371..417399,417460..417618,
FT                   417665..419219,419273..419309,419411..419476)
FT                   /transl_table=1
FT                   /gene="exo70"
FT                   /gene_synonym="SPBC582.02"
FT                   /locus_tag="SPBC106.20"
FT                   /product="exocyst complex subunit Exo70 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC106.20"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC106.20.1"
FT                   /db_xref="GOA:Q10339"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="PomBase:SPBC106.20"
FT                   /db_xref="PomBase:SPBC106.20.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10339"
FT                   /protein_id="CAB53736.2"
FT                   /translation="MSGGIFDDNKAGFETFQKNLNSVAKNVSDASNILLSMDKRLSGLE
FT                   ASAGILRDDVTNYNRVSSNIYDTLKEMESLQVIHSHLPVLQKGLQECQNLNKSVSQNLK
FT                   SVMDILKSLAEDYTSLEGSPLQFASKSQQKVEMMLSEGCQILGALCYNILETYAASSLN
FT                   KASTLLDLSIPWSFPNESLQQFIGLIQQFDADVLFPVSCSSDISNIYIKIKGECVVKLL
FT                   HAVSMRTDEIKLNEGSVNFVTGKEDVSINLVALSRLLPAVASELLLLFDQVTAKALYPK
FT                   IVKPAINTVTNATRQLEGVYEKRGAAENFVLLSLIDCIVVTRQNMNNLMPFEDASFLGF
FT                   VNGVGREMEKILISSISRLYNGTCHNNKTVPLTTDRVSEMTHGIMSFLNELAEHENASY
FT                   LLESIGNWGWRHEINADLSPARSVQDITRNYVMDCMDSYLTSVQTAAQAVDTIGWKMGV
FT                   MLLNISVYFEAKCLESKIASFLQDVDLEKLGDRSQKYSTMYMEVWRQCSQNMLDSTYTK
FT                   SQNKSTMSAKEREITKEKFRNFNEQVTSVVQVHRESVRFETGVATFLLQEVKKTVLPLY
FT                   QRFYDKYINSDFTKNKDKYIKFTKADLDSFITSAFAPSL"
FT   3'UTR           419477..419867
FT                   /gene="exo70"
FT                   /gene_synonym="SPBC582.02"
FT                   /locus_tag="SPBC106.20"
FT   5'UTR           join(420076..420308,420662..421122)
FT                   /gene="cdc13"
FT                   /locus_tag="SPBC582.03"
FT   CDS_pept        421123..422571
FT                   /transl_table=1
FT                   /gene="cdc13"
FT                   /locus_tag="SPBC582.03"
FT                   /product="G2/M B-type cyclin Cdc13"
FT                   /db_xref="GOA:P10815"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10815"
FT                   /protein_id="CAB46666.1"
FT                   /translation="MTTRRLTRQHLLANTLGNNDENHPSNHIARAKSSLHSSENSLVNG
FT                   KKATVSSTNVPKKRHALDDVSNFHNKEGVPLASKNTNVRHTTASVSTRRALEEKSIIPA
FT                   TDDEPASKKRRQPSVFNSSVPSLPQHLSTKSHSVSTHGVDAFHKDQATIPKKLKKDVDE
FT                   RVVSKDIPKLHRDSVESPESQDWDDLDAEDWADPLMVSEYVVDIFEYLNELEIETMPSP
FT                   TYMDRQKELAWKMRGILTDWLIEVHSRFRLLPETLFLAVNIIDRFLSLRVCSLNKLQLV
FT                   GIAALFIASKYEEVMCPSVQNFVYMADGGYDEEEILQAERYILRVLEFNLAYPNPMNFL
FT                   RRISKADFYDIQTRTVAKYLVEIGLLDHKLLPYPPSQQCAAAMYLAREMLGRGPWNRNL
FT                   VHYSGYEEYQLISVVKKMINYLQKPVQHEAFFKKYASKKFMKASLFVRDWIKKNSIPLG
FT                   DDADEDYTFHKQKRIQHDMKDEEW"
FT   3'UTR           422572..423276
FT                   /gene="cdc13"
FT                   /locus_tag="SPBC582.03"
FT   CDS_pept        complement(join(423269..423598,423669..423738,
FT                   423782..423871,423912..424373,424424..424692,
FT                   424747..424872,424921..425160,425223..425350,
FT                   425410..425446))
FT                   /transl_table=1
FT                   /locus_tag="SPBC582.04c"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC582.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC582.04c.1"
FT                   /db_xref="GOA:Q10338"
FT                   /db_xref="PomBase:SPBC582.04c"
FT                   /db_xref="PomBase:SPBC582.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10338"
FT                   /protein_id="CAB46667.2"
FT                   /translation="MAENKKFSIRKKRECSYPTFRTLYEFNKFFLRYKTEISKIQRRTS
FT                   SLIQYEEHSSAIFIYYETPQMFDLATKALQTLYNSHTREGETKAASKWYRNPRKDFPSQ
FT                   EAALVRKKKRDALILKKYLLNVDPSLSFRAEGLFTLPSDDLDVYEFFGGENLTLFNQVR
FT                   VDCQCYIHYLPKLAAFYVRCDSVKNLKVALKRVKHIFYEQVSLIRLERTQPILHLMNFD
FT                   DYSTSYELFYDRNFPLAKKYKPNSIYLHRLPESIPTPVDSVKINLIRERSFNLLKNFVS
FT                   ASLFNVFLFSGTVFMRVKVGIPLFERLKVGTNKVKNNSVNIAQSFLEPQTRSTFLRYLF
FT                   SDEVSVKVCHVLKELRSPTGEKLFESFSDDPITAVHFEVMNCKGVQDTLTAIWNTNSGK
FT                   PSGWYLESTMYKALDVTYYNLNTLSWNLYIEYGHPTQNSTFYKEFISNISMSDDGRIYF
FT                   MNTRDIKVRSLVVKLKHKYWHLSSGFHLHITRFEAHDMGKVKDIDTDFEPGLQCYQVGS
FT                   DTSVLRYGLSFWDPKWDYLLADNQHKQQWQAPSYKPLISEFFPMGIEHFIETAQSIVMA
FT                   VNRSTID"
FT   CDS_pept        complement(join(426160..428547,428634..428771,
FT                   428903..429013))
FT                   /transl_table=1
FT                   /gene="brc1"
FT                   /locus_tag="SPBC582.05c"
FT                   /product="BRCT domain protein Brc1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC582.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC582.05c.1"
FT                   /db_xref="GOA:Q10337"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="PDB:3L40"
FT                   /db_xref="PDB:3L41"
FT                   /db_xref="PomBase:SPBC582.05c"
FT                   /db_xref="PomBase:SPBC582.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10337"
FT                   /protein_id="CAB46668.1"
FT                   /translation="MEKIKLLNVKTPNHYTIIFKVVAYYSALQPNQNELRKKELFIKND
FT                   GKALSFPYDWKLATHVICDDFSSPNVQEGSKRSLRLAKTNWIRDCVDKNTLLNYSFYSC
FT                   NPYLLFKGICASSCQIDSYQSSLIDDALETFGGRFSKGLMKSMTHLFTYSGMGAKCKKV
FT                   LDKPSLSIKLIHPQWLLDCLQFGQLIDQDPYLFPNPSYKKNDSSISKAEPTSLFRNVLH
FT                   GKRIYFSNDLNLPTNFRHSLQKFSVGIGAKIAESINDCDIFIGLKRDTIEFNLASNKNT
FT                   TIGTISWLLNLFVLGSWKSPLLNALHYPFPSVGFLKDQMVAVTNYTDAARIYLEKLLLA
FT                   CGATYTKDLKPTNTLLIAASSYGQKYGAAKVWNIPTVHHSWLYSSFKNLSSQAFTDFPV
FT                   PLDDSYMDFIFPCPLNVEKGSFEDTLKSSLTKGNSEVLLDDLSDPSVSSIKGNKTNEEL
FT                   EKEFKSTSDNFGKHIILTSSFSNQSADKGSSLAAEDDRNDEGSTITGVNRELQDEGRLE
FT                   IDAKSSKTNTPPSPLLVGTPSKESLKEASSDDELPVLATKLVDNVIKEKSPLSLTPKVV
FT                   VPSHKETYTDEKKLIDELDRVNPLNSSQLLRSKRKSAATALSMLQNVIMPDVLAFEREK
FT                   KRRQTHRSVSSGEVSRESSESRNTNAKASKRVYITFTGYDKKPSIDNLKKLDMSITSNP
FT                   SKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELEL
FT                   GCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKR
FT                   LARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIA
FT                   DEFARAV"
FT   misc_RNA        428944..430390
FT                   /locus_tag="SPNCRNA.1356"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(429183..430166)
FT                   /transl_table=1
FT                   /gene="mcp6"
FT                   /gene_synonym="hrs1"
FT                   /gene_synonym="mug3"
FT                   /locus_tag="SPBC582.06c"
FT                   /product="horsetail movement protein Hrs1/Mcp6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC582.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC582.06c.1"
FT                   /db_xref="GOA:Q10336"
FT                   /db_xref="PomBase:SPBC582.06c"
FT                   /db_xref="PomBase:SPBC582.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10336"
FT                   /protein_id="CAB46669.1"
FT                   /translation="MEYQEEASLASAEDSTFIASSPVQSVSEMKSIKQKSFQYFDDYEK
FT                   NVSDKTIQFQKLQMTAKEIIDAFERDSTQRTLQIESLESKIGEQERDLNNEKLASETLR
FT                   EKTQLLEKENGALKVENGYLYEKSRKLEEEMAHLKKKCNVYKSKFEESSLRCKSLYSSN
FT                   TKLKDSMETMKRRMETETKEMNKIKPKNDSESDRFKRNSQSLSQQSPLLDVHSPDNSNH
FT                   RTMLNINNSSPIKPKKIFKPNEVKNRISRLQKTFADLENQHHSFQQICQTLRKRLENDS
FT                   STTKQRLSKLEEIIRNRAPPSYSFSLNCSHTYQPVSCVEPVNHDLS"
FT   3'UTR           complement(430393..430550)
FT                   /gene="rpn7"
FT                   /locus_tag="SPBC582.07c"
FT   CDS_pept        complement(430551..431780)
FT                   /transl_table=1
FT                   /gene="rpn7"
FT                   /locus_tag="SPBC582.07c"
FT                   /product="19S proteasome regulatory subunit Rpn7"
FT                   /db_xref="GOA:Q10335"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="InterPro:IPR035268"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10335"
FT                   /protein_id="CAB46670.1"
FT                   /translation="MCSPSATLTHRTMTEKARTVSDLTISQAIFELSSPFLENKSQKAL
FT                   DTLFSAIRDHDLAPLYKYLSENPKTSASIDFDSNFLNSMIKKNEEKLAEFDKAIEDAQE
FT                   LNGEHEILEAMKNKADYYTNICDRERGVQLCDETFERATLTGMKIDVLFSKIRLAYVYA
FT                   DMRVVGQLLEKLKPLIEKGGDWERKNRLKAYQGIYLMSIRNFSGAADLLLDCMSTFSST
FT                   ELLPYYDVVRYAVISGAISLDRVDVKTKIVDSPEVLAVLPQNESMSSLEACINSLYLCD
FT                   YSGFFRTLADVEVNHLKCDQFLVAHYRYYVREMRRRAYAQLLESYRALSIDSMAASFGV
FT                   SVDYIDRDLASFIPDNKLNCVIDRVNGVVFTNRPDEKNRQYQEVVKQGDVLLNKLQKYQ
FT                   ATVMRGAFKV"
FT   5'UTR           complement(431781..431802)
FT                   /gene="rpn7"
FT                   /locus_tag="SPBC582.07c"
FT   5'UTR           432523..432549
FT                   /locus_tag="SPBC582.08"
FT   CDS_pept        join(432550..433012,433204..434003,434057..434311)
FT                   /transl_table=1
FT                   /locus_tag="SPBC582.08"
FT                   /product="alanine aminotransferase (predicted)"
FT                   /EC_number="2.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC582.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC582.08.1"
FT                   /db_xref="GOA:Q10334"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PomBase:SPBC582.08"
FT                   /db_xref="PomBase:SPBC582.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10334"
FT                   /protein_id="CAB46671.1"
FT                   /translation="MFTDYPNDINCESPRMSDLDGFCQNAFSDLNSLNQQVFKANYAVR
FT                   GALAILADEIQDDLLENPSSYPFSEIVYANIGNPQQMGQSPITFVRQVLSLCQYPTLLD
FT                   HAEEKWFQNLFPTDVVQRSKMLLKESGSLGAYSASQGIPLVRRHVADFIRARDGFDCEP
FT                   SDIYLTSGASHAARLIMTLIIARPTDGVMVPAPQYPLYGAQIDLMSGSMVSYSLSEENN
FT                   WDIDFDQFKKSFDEASKKGINVRLCVVINPGNPTGACISENSMEKVLRFAKAKGIVLLA
FT                   DEVYQNNIYQNKFHSFRRKLGELREKEPDNHWDQVSLISVNSVSKGQFGECGQRGGYLD
FT                   VVNIPEPAKDQILKLATIDICPPVAGQLLVDMLVNPPKPGDPSYDLFIKEVDEIHEALR
FT                   LQCRQLYEGTKRMKRVSCLEPHGAMYLHPSVSLPEKLITTAKAQKIQPDEFYAIELLKR
FT                   SGICVVPGSGFGQPEGDYHIRITFLAKGTEYIERFVKAHNEIMDLYE"
FT   3'UTR           434312..434527
FT                   /locus_tag="SPBC582.08"
FT   5'UTR           434811..434872
FT                   /gene="pex11"
FT                   /locus_tag="SPBC582.09"
FT   CDS_pept        join(434873..434917,434962..434991,435283..435761,
FT                   435811..435973)
FT                   /transl_table=1
FT                   /gene="pex11"
FT                   /locus_tag="SPBC582.09"
FT                   /product="peroxisomal biogenesis factor 11 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC582.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC582.09.1"
FT                   /db_xref="GOA:Q10333"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="PomBase:SPBC582.09"
FT                   /db_xref="PomBase:SPBC582.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10333"
FT                   /protein_id="CAB46672.1"
FT                   /translation="MAVIFENPQYVHVLRMLNSMPARDKTFRALQFVAKLLSWHLFYGG
FT                   SSLSTVNKWKKLESNISFSRKLFSIGKVLDYICKVYFDSLKLQNPLSGNKSALPTISFT
FT                   KDVAFAGYATAELIGWFNKTELMPCSHSKQISTIGKQCLAVALLSSCLAGCYELQQNSK
FT                   KIKSATQEASEKDSTSLQTLQKERKEILFFALQNALDATIPLAELDILKVNDGFVAAAG
FT                   ITTSLMSVYKTWIGSY"
FT   intron          434918..434961
FT                   /gene="pex11"
FT                   /locus_tag="SPBC582.09"
FT   intron          434992..435282
FT                   /gene="pex11"
FT                   /locus_tag="SPBC582.09"
FT   intron          435762..435810
FT                   /gene="pex11"
FT                   /locus_tag="SPBC582.09"
FT   3'UTR           435974..436173
FT                   /gene="pex11"
FT                   /locus_tag="SPBC582.09"
FT   3'UTR           complement(436090..436232)
FT                   /locus_tag="SPBC582.10c"
FT   CDS_pept        complement(join(436233..437936,437989..438777))
FT                   /transl_table=1
FT                   /locus_tag="SPBC582.10c"
FT                   /product="ATP-dependent DNA helicase Rhp16b (predicted)"
FT                   /db_xref="GOA:Q10332"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10332"
FT                   /protein_id="CAB46673.1"
FT                   /translation="MEKASKNKESGVKKANNSFLQNFGVNTAGKENESTSLPRLPKSED
FT                   ESIPKQSIKSKNKKKTQHFLSDAFESLKRQEIDTNEKEVIVSAPITSKPAQVFYSKKLE
FT                   RKDEGIRKWEKDPFAPISVKSGAWKKPYTKVPEVSINKATSKRTDLINDKPIVIPIPRA
FT                   STSTLYFGKHNKPTSENRKGPIGIPTEEILTSQNTQAMLHKLFENNVLDNVKDDSMQRQ
FT                   SSFIPGMHIRLLDHQVQGLTWLKSRETVSKSSASGGILADDMGLGKTIQMIALILSHPL
FT                   PKKKHSIKSTLVVAPLSLIKQWESEVQTKSKLTAIVYHGASRYKLLKVIHEYDVVITTY
FT                   QILVSEWVSHNTTGTDGKSPTEAKSYEKKKPSLFAFYWWRIILDEAHTIKNKSSKSALA
FT                   CCALQGINRWCLTGTPLQNNVDELYSLVKFLHINPFNDQSVWKDQISLPLCQGEENLVF
FT                   KRLRMLLSVIMLRRTKTLLEANAGKDGTGGALKLSKRLVYKVICKFEESERDFYSNLAR
FT                   NMERTMSNFVNSGKLGKNYTNILCLLLRLRQACNHPQSLNFQFEQDVDAFNALDGAANT
FT                   NKLASDQDVDDLANLLETVEIGSRKKSFCTICMAELPPDFHEKKCKDCSRNFKELDKGI
FT                   QDPNDKTLYKSSKIREILKILSLDEQEEDDTVRGLRKTIIFSQFTTFLDIIDLHLRKAG
FT                   IGFVRYDGRMNNRAREKSLDLLRSDSGTQVLLCSLKCGALGLNLTCASRVILCDVWWNP
FT                   AIEEQAIDRVHRIGQRRDVLVYKLVVENTIEEKIVELQNLKRDLAKQALGDGKKSVFTS
FT                   KKLTLNDLLFLFNKRAAA"
FT   misc_RNA        437846..439998
FT                   /locus_tag="SPNCRNA.1357"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(438778..439017)
FT                   /locus_tag="SPBC582.10c"
FT   3'UTR           complement(438999..439273)
FT                   /gene="nup107"
FT                   /gene_synonym="SPBC582.11c"
FT                   /locus_tag="SPBC428.01c"
FT   CDS_pept        complement(join(439274..441187,441229..441337,
FT                   441392..441484,441541..441667,441718..441751,
FT                   441793..441840,441916..442032))
FT                   /transl_table=1
FT                   /gene="nup107"
FT                   /gene_synonym="SPBC582.11c"
FT                   /locus_tag="SPBC428.01c"
FT                   /product="nucleoporin Nup107"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.01c.1"
FT                   /db_xref="GOA:Q10331"
FT                   /db_xref="InterPro:IPR007252"
FT                   /db_xref="PomBase:SPBC428.01c"
FT                   /db_xref="PomBase:SPBC428.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10331"
FT                   /protein_id="CAE54931.2"
FT                   /translation="MACCCYSTILTHTRLDFKTMHQNALNNATLNVLGHKKNGSSSIQE
FT                   LIEMDEEEAEMNQNVVCIGPNETAVSVELGDEYEKFNIITSLKKDNLFSKDGLLYAYYE
FT                   LCQEKFEKCLKEDDEEWIELWDLESRTWDLIQRLYSFRLSEQQGHIQSHAFSSRAVLEE
FT                   EYYSQNPEAFENNIVFNWARDNSSDPPSIEIRGNRWFYTREDIKMKNRGGSRFSSNISG
FT                   TIVSNLDPDADIRDDKRLDERDDNFERQFFHTAFCLFRSGSFEELLELCRRTGNHWRSA
FT                   SLQGILEYRDNLIDDVLQSETSGNKRKELLRRSCLALTKNKRIDSYERALYGALCGDLN
FT                   SVLDVCTTWEDAMWAYYNSMTQYNLDVYLSSKAPQTETQLPPVDSGLGLTPELIFNSLS
FT                   NSSIASIQEEASHPLIKLQTHIICNKISEILSSAHIQLEAIRTGNAPESGDLVTPPLLR
FT                   ILTHIILFLKISGLAVDEYTSDSIIQAYIELLASAKKVNLVPLYIQYLSNQVQYEAYSR
FT                   FLILVDEESARSEQLQLAKKYSLDINHAALLAVEYVYDEVVSVSPEEVHTVYLKSIEEP
FT                   VEPSYKKLICTLEWLLITSQTDELLRFANLVYRFFLSIGELNSAYDLYTHIPSDALNTL
FT                   SSSDGEPENDSKFRDAYELMNYRALCRALKFYQEWEELSKQEVFEDSAVTKASTSYKVW
FT                   KKKLNFASRKCVKSFTDLLQANWLHPSTLELKPDDDPLLYKTLMTIRNLYVPELILGLH
FT                   NVYFSLEDYDSCFALANEVASEDLKLYHCLIKSGRLVEYVSYLGKAGECSLSTPNGLFS
FT                   L"
FT   intron          complement(441841..441915)
FT                   /gene="nup107"
FT                   /gene_synonym="SPBC582.11c"
FT                   /locus_tag="SPBC428.01c"
FT   5'UTR           complement(442033..442078)
FT                   /gene="nup107"
FT                   /gene_synonym="SPBC582.11c"
FT                   /locus_tag="SPBC428.01c"
FT   3'UTR           complement(442344..442630)
FT                   /gene="eca39"
FT                   /gene_synonym="SPBC582.12c"
FT                   /locus_tag="SPBC428.02c"
FT   CDS_pept        complement(442631..443914)
FT                   /transl_table=1
FT                   /gene="eca39"
FT                   /gene_synonym="SPBC582.12c"
FT                   /locus_tag="SPBC428.02c"
FT                   /product="branched chain amino acid aminotransferase Eca39"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.02c.1"
FT                   /db_xref="GOA:O14370"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="PomBase:SPBC428.02c"
FT                   /db_xref="PomBase:SPBC428.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14370"
FT                   /protein_id="CAB46675.2"
FT                   /translation="MSLMFLRRAGNIKGRNIRFALQRGSVGYSQQSSEACKNFLNTTQL
FT                   RTMVQTAALHGPKPMDSSHIKVTNVKELKPLPEWKSLKFGENFTDHMLIMKWNREKGWS
FT                   TPEIVPFGKLCFHPASSVFHYGFECFEGMKAFRDEKGVPRLFRPIKNAERMLSTGTRIS
FT                   LPSFDPAELAEIIRKFVAHENRWVPDQRGYSLYIRPTFIGTDEALGVHHCDNAMLYVIA
FT                   SPVGPYYSSGFKAVKLCCSEESVRAWPGGTGHYKLGGNYAPSVLPQKEAAKKGYAQILW
FT                   LYGDEDYITEVGTMNCFTVWINKNGEKEIITAPLDGMILPGVTRDSILEICRERLAPKG
FT                   WKITEGKYSMKEVAQASKEGRLLEVFGAGTAALVSPVKAINYKGTEYEIPMPEGQEAGP
FT                   ITSEISKWILDIQYGKEPNNPWSVPALP"
FT   misc_RNA        443757..445437
FT                   /locus_tag="SPNCRNA.1358"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           complement(443915..443980)
FT                   /gene="eca39"
FT                   /gene_synonym="SPBC582.12c"
FT                   /locus_tag="SPBC428.02c"
FT   misc_RNA        complement(443917..444828)
FT                   /locus_tag="SPNCRNA.1359"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   3'UTR           complement(445324..445416)
FT                   /gene="pho4"
FT                   /locus_tag="SPBC428.03c"
FT   CDS_pept        complement(445417..446808)
FT                   /transl_table=1
FT                   /gene="pho4"
FT                   /locus_tag="SPBC428.03c"
FT                   /product="thiamine-repressible acid phosphatase Pho4"
FT                   /EC_number="3.1.3.2"
FT                   /db_xref="GOA:Q01682"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01682"
FT                   /protein_id="CAA22278.1"
FT                   /translation="MKLSGISLWLLAASIVHAGKSQFEAFENEFYFKDHLGTISVYHEP
FT                   YFNGPTTSFPESCAIKQVHLLQRHGSRNPTGDDTATDVSSAQYIDIFQNKLLNGSIPVN
FT                   FSYPENPLYFVKHWTPVIKAENADQLSSSGRIELFDLGRQVFERYYELFDTDVYDINTA
FT                   AQERVVDSAEWFSYGMFGDDMQNKTNFIVLPEDDSAGANSLAMYYSCPVYEDNNIDENT
FT                   TEAAHTSWRNVFLKPIANRLNKYFDSGYNLTVSDVRSLYYICVYEIALRDNSDFCSLFT
FT                   PSEFLNFEYDSDLDYAYWGGPASEWASTLGGAYVNNLANNLRKGVNNASDRKVFLAFTH
FT                   DSQIIPVEAALGFFPDITPEHPLPTDKNIFTYSLKTSSFVPFAGNLITELFLCSDNKYY
FT                   VRHLVNQQVYPLTDCGYGPSGASDGLCELSAYLNSSVRVNSTSNGIANFNSQCQAHSTN
FT                   VTVYY"
FT   5'UTR           complement(446809..447177)
FT                   /gene="pho4"
FT                   /locus_tag="SPBC428.03c"
FT   5'UTR           448638..448933
FT                   /gene="apq12"
FT                   /locus_tag="SPBC428.04"
FT   CDS_pept        448934..449281
FT                   /transl_table=1
FT                   /gene="apq12"
FT                   /locus_tag="SPBC428.04"
FT                   /product="nuclear membrane organization protein Apq12
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.04.1"
FT                   /db_xref="GOA:O94353"
FT                   /db_xref="InterPro:IPR024316"
FT                   /db_xref="PomBase:SPBC428.04"
FT                   /db_xref="PomBase:SPBC428.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94353"
FT                   /protein_id="CAA22279.1"
FT                   /translation="MSLTSVLWNFVAKLAVDHGLNTNPDQVFQTVENVGKSFEKYETSF
FT                   LKSLFNGNLGLSLPSAINILTLIIVLYFSLVIVNKTTSIALALFKTLAVISFFLLIGCL
FT                   FAYWFINNGSF"
FT   3'UTR           449282..449398
FT                   /gene="apq12"
FT                   /locus_tag="SPBC428.04"
FT   3'UTR           complement(449440..449770)
FT                   /gene="arg12"
FT                   /locus_tag="SPBC428.05c"
FT   CDS_pept        complement(449771..451003)
FT                   /transl_table=1
FT                   /gene="arg12"
FT                   /locus_tag="SPBC428.05c"
FT                   /product="argininosuccinate synthase (predicted)"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.05c.1"
FT                   /db_xref="GOA:O94354"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="PomBase:SPBC428.05c"
FT                   /db_xref="PomBase:SPBC428.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94354"
FT                   /protein_id="CAA22280.1"
FT                   /translation="MPQEVKRCVLAYSGGLDTSCILAWLIEEGWEVICYMANVGQEEDW
FT                   DAAREKALKVGAKKVYVEDLREEFINDTVIPAAQANAIYENVYLLGTSLARPIIARRQI
FT                   QIAEKENCIAVSHGCTGKGNDQVRFELAYYALKPDVQVIAPWRLPVFFERFAGRKDLLE
FT                   YAAAKGIPVTQTTKKPWSMDENIVHCSYEAGILEDPSMTPPKDMWKLTVDPKDAPDEVE
FT                   ELSIHFEKGAPTKLECKDGTFSGVVSIFYQLNAIARRNGVGRIDIVENRFSGLKSRGCY
FT                   ETPGLTILRTAHMDLEGLTMEREVRALRDQFVTFNLAKILYNGQFFSPCTRMLLAANNV
FT                   SQEVVNGVVKLSVYKGNVTVLGRKSDTAHLYDEKLSSMDELGGFDPTWTSGFIQIESMR
FT                   LRNSDEGKHWM"
FT   misc_RNA        450808..451618
FT                   /locus_tag="SPNCRNA.1360"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           complement(451004..451091)
FT                   /gene="arg12"
FT                   /locus_tag="SPBC428.05c"
FT   3'UTR           complement(451027..451988)
FT                   /gene="rxt2"
FT                   /locus_tag="SPBC428.06c"
FT   CDS_pept        complement(join(451989..452416,452597..452705,
FT                   452755..452879,452930..452964,453014..453039))
FT                   /transl_table=1
FT                   /gene="rxt2"
FT                   /locus_tag="SPBC428.06c"
FT                   /product="histone deacetylase complex subunit Rxt2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.06c.1"
FT                   /db_xref="GOA:O94355"
FT                   /db_xref="InterPro:IPR013904"
FT                   /db_xref="InterPro:IPR039602"
FT                   /db_xref="PomBase:SPBC428.06c"
FT                   /db_xref="PomBase:SPBC428.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94355"
FT                   /protein_id="CAA22281.2"
FT                   /translation="MKQFEEQIERFKQALFEDSDASDSDSSIGEALTNRGLKRKKGSKN
FT                   VYYGCVGNSSGSSIDIDYYNIGNTKRGVVSHFRRRIDPEWLDHDNPYNDINIAEIMSPL
FT                   TKPQDLLTHPAISSIFEQNYLSILASSALEIISAEHKYTAHLEQLMVALLGDDPSLPGP
FT                   PHEVFGISPEQCRELTITVQEALEKSKEFIRCWTNVRMDLLRAIRFKNKVIAYCQGEDY
FT                   NGNTQVLSKNESDGKPNS"
FT   5'UTR           complement(453040..453062)
FT                   /gene="rxt2"
FT                   /locus_tag="SPBC428.06c"
FT   3'UTR           complement(453996..456574)
FT                   /gene="clr4"
FT                   /locus_tag="SPBC428.08c"
FT   5'UTR           454108..454229
FT                   /gene="meu6"
FT                   /locus_tag="SPBC428.07"
FT   CDS_pept        join(454230..454597,454668..454944,455002..456312)
FT                   /transl_table=1
FT                   /gene="meu6"
FT                   /locus_tag="SPBC428.07"
FT                   /product="meiotic chromosome segregation protein Meu6"
FT                   /db_xref="GOA:O94356"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR039483"
FT                   /db_xref="InterPro:IPR039712"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94356"
FT                   /protein_id="CAA22282.1"
FT                   /translation="MSYEGREERPEQIAEPTFENVSEHNEHDSGSAEAQVETLEVPLSN
FT                   ETDNDDATENAVPAEVQAPEEPKEPETVDNIDPADDDPNSVAAPKVEEKKSKKKAKDEK
FT                   PLTYTTGGYLYCRSNGLIPHVMKRYFYMLEGPMSMDLLDHYYKKHFHGTLQGNPTEPSL
FT                   ASEQMHDSDADSLFQSANDHLNRIAKATQDCRGLLFYSKSQSTSVPSGIINLTDAVSIE
FT                   PGTGNKFTINFNNGKSETLEALDPESKNTWITDLKNAIAKKKETKDKIKELRAYNDTLK
FT                   RLGKLAARSGPSASETFRYFLPMLSNGRDAKKSSSKSHGGKQNNSVAKDGLFDFFQNMI
FT                   KGKTPQNDTASPIDNETSADPVDTTVEAQSVEVPENETNQIPTTEEHFPATTEEVAPAS
FT                   EEKPATGPAEESTSTQNVEQASTQNDNGTPIGQIADAIEEDVKGTAQSVEQAFIEETDI
FT                   ALPDIALPDVATPTADDQDPSTAATNEESVVSNEDRTSKKAGKKHHRHHKKKKGGNKRV
FT                   FGFKLHKYAKPTKSVKTLQADPSLEFAKAGFEIFPSNLSKKLSGLVQKKVHKKFDKDGR
FT                   LKEISQFSKTTIKPETPLTPTTTPTPRTAAQEDPAEETTDALASAEGENNQMPQVLETE
FT                   AAPSIASEGRSITVNA"
FT   3'UTR           456313..456553
FT                   /gene="meu6"
FT                   /locus_tag="SPBC428.07"
FT   CDS_pept        complement(456575..458047)
FT                   /transl_table=1
FT                   /gene="clr4"
FT                   /locus_tag="SPBC428.08c"
FT                   /product="histone H3 methyltransferase Clr4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.08c.1"
FT                   /db_xref="GOA:O60016"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR007728"
FT                   /db_xref="InterPro:IPR011381"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="PDB:1G6Z"
FT                   /db_xref="PDB:1MVH"
FT                   /db_xref="PDB:1MVX"
FT                   /db_xref="PDB:6BOX"
FT                   /db_xref="PDB:6BP4"
FT                   /db_xref="PomBase:SPBC428.08c"
FT                   /db_xref="PomBase:SPBC428.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60016"
FT                   /protein_id="CAA22283.1"
FT                   /translation="MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPE
FT                   NLSGCSAVLAEWKRRKRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSR
FT                   ELNVKKENKKVFSSQTTKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEES
FT                   QKRELVSNSIKEATSPKTSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVT
FT                   LVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDD
FT                   LDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGW
FT                   GVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQ
FT                   NYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFS
FT                   PVQSQKSQQNRISKLRRQCKCGSANCRGWLFG"
FT   5'UTR           complement(458048..458487)
FT                   /gene="clr4"
FT                   /locus_tag="SPBC428.08c"
FT   repeat_region   458478..458824
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        458872..460189
FT                   /locus_tag="SPNCRNA.1361"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        complement(458982..461993)
FT                   /locus_tag="SPNCRNA.1362"
FT                   /product="antisense RNA (predicted)"
FT   misc_RNA        complement(459469..459925)
FT                   /gene_synonym="SPNGAF44"
FT                   /locus_tag="SPNCRNA.534"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           460831..461023
FT                   /locus_tag="SPBC428.10"
FT   CDS_pept        461024..463561
FT                   /transl_table=1
FT                   /locus_tag="SPBC428.10"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.10.1"
FT                   /db_xref="GOA:O94358"
FT                   /db_xref="PomBase:SPBC428.10"
FT                   /db_xref="PomBase:SPBC428.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94358"
FT                   /protein_id="CAA22285.2"
FT                   /translation="MKRKSSHYNDAHASHINEDIEESYKDLYNNLSPSSTILLLLYARW
FT                   FPATLIHFLDKYYTSTPILIDMIHKQCIYNPPKGSLHVQLEYYLAFLNRMALIFDRFPD
FT                   LFPTEISKVKFFTKDFSKKDKLTALDTYRSFPGSTWKTIVTFATQEVFYLPEGLEPLKR
FT                   DFSSMDKLKLIGKITYKLRLKGDTALKFAYLHAPSDVRDKVFDDAFWQEIITPKASLEQ
FT                   QSNNIPTGIQDSSKYTVNGPTERDNKSMKSFVRSFFTSTDSSVADTTIIPSMTQQFDKD
FT                   PSTLVQSSIDKEIQVKEDGTTSSVAVNAETAVQNVNGTIKESQGTESISFASKNNSAPS
FT                   ADANNGNMTKLVSKEKAFLNTVTTPNADLIISEEDELTEMTLRTANGSEPTKKSNRSEQ
FT                   SKTVANTNVGSKNGTTPRSFAQKSSKRIKPTEGSANLNTVTELTGIGSRIAMNGSSVKA
FT                   SNISTEKSKTIAKPKPAKELSPQATLNSPIQSAEAGNVELKLHPQTPDRIVKVERKVHS
FT                   LNMTLRSPKAGSAGKENSWRSKYLSEGKNSKAKYTAKQPSYDRAGSSLASPTKSSASPL
FT                   VKAPKETPERLCTENQSTENEDQANLKESELPKEKSDIQPKNSRSTIEYIETSTRVYEM
FT                   PKDTIPSRFKTSISTEVHDGRLKKYPYYHVKTPEKGTTVVSRTVTSPKSGAYASPSKAS
FT                   YNQDSSPNASLEQCFVQRSPSKMLTTLRNNSSTFPSLRKNAMIARKSTADSLSSPKRQS
FT                   VPSTPKASLSPRVHKSMTYSPSEASPLYANKSPKSSTMVPLMKYKSGLNEGMRTSSIYS
FT                   STSSPYIRDQYFLNRMLTNGSHNGSPSWRDGLL"
FT   3'UTR           463562..464017
FT                   /locus_tag="SPBC428.10"
FT   tRNA            464238..464309
FT                   /locus_tag="SPBTRNAHIS.01"
FT                   /product="tRNA Histidine"
FT   rRNA            464527..464645
FT                   /locus_tag="SPRRNA.28"
FT                   /product="5S rRNA"
FT   5'UTR           465475..465632
FT                   /gene_synonym="met17"
FT                   /locus_tag="SPBC428.11"
FT   CDS_pept        465633..466922
FT                   /transl_table=1
FT                   /gene_synonym="met17"
FT                   /locus_tag="SPBC428.11"
FT                   /product="homocysteine synthase Met17"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.11.1"
FT                   /db_xref="GOA:O13326"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PomBase:SPBC428.11"
FT                   /db_xref="PomBase:SPBC428.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13326"
FT                   /protein_id="CAA22286.1"
FT                   /translation="MPVESEHFETLQLHAGQEPDAATSSRAVPIYATTSYVFRDCDHGG
FT                   RLFGLQEPGYIYSRMMNPTADVFEKRIAALEHGAAAIATSSGTSALFMALTTLAKAGDN
FT                   IVSTSYLYGGTYNLFKVTLPRLGITTKFVNGDDPNDLAAQIDENTKAVYVESIGNPMYN
FT                   VPDFERIAEVAHAAGVPLMVDNTFGGGGYLVRPIDHGADIVTHSATKWIGGHGTTIGGV
FT                   IVDSGKFDWKKNSKRFPEFNEPHPGYHGMVFTETFGNLAYAFACRTQTLRDVGGNANPF
FT                   GVFLLLQGLETLSLRMERHVQNAFALAKYLEKHPKVNWVSYPGLESHVSHKLAKKYLKN
FT                   GYGAVLSFGAKGGPDQSRKVVNALKLASQLANVGDAKTLVIAPAYTTHLQLTDEEQISA
FT                   GVTKDLIRVAVGIEHIDDIIADFAQALEVA"
FT   3'UTR           466923..467247
FT                   /gene_synonym="met17"
FT                   /locus_tag="SPBC428.11"
FT   3'UTR           complement(467841..468133)
FT                   /locus_tag="SPBC428.12c"
FT   CDS_pept        complement(join(468134..468198,468260..468418,
FT                   468514..468609,468799..468829))
FT                   /transl_table=1
FT                   /locus_tag="SPBC428.12c"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.12c.1"
FT                   /db_xref="GOA:O94359"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034168"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PomBase:SPBC428.12c"
FT                   /db_xref="PomBase:SPBC428.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94359"
FT                   /protein_id="CAA22287.2"
FT                   /translation="MERRKATVHVGNLAPSVTESLLYNAFIPFGEIISVALHRKEKAVD
FT                   RSYAFVEFDEPEDAKEAMENMNYSILCDRCIRVSPANFALSAEETAVPDIAMLHPESAD
FT                   FQTFKSTSTPTS"
FT   5'UTR           469369..470651
FT                   /locus_tag="SPBC428.14"
FT   CDS_pept        complement(join(469388..469445,469494..469893,
FT                   469951..470125))
FT                   /transl_table=1
FT                   /gene="mob1"
FT                   /locus_tag="SPBC428.13c"
FT                   /product="Sid2-Mob1 kinase complex regulatory subunit Mob1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.13c.1"
FT                   /db_xref="GOA:O94360"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="PomBase:SPBC428.13c"
FT                   /db_xref="PomBase:SPBC428.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94360"
FT                   /protein_id="CAA22288.1"
FT                   /translation="MFGFSNKTAKTFRVRKTEAGTKHYQLRQYAEATLGSGSLMEAVKL
FT                   PKGEDLNEWIAMNTMDFYTQINMLYGTITEFCTAASCPQMNAGPSYEYYWQDDKIYTKP
FT                   TRMSAPDYINNLLDWTQEKLDDKKLFPTEIGVEFPKNFRKVIQQIFRRLFRIYAHIYCS
FT                   HFHVMVAMELESYLNTSFKHFVFFCREFGLMDNKEYAPMQDLVDSMV"
FT   5'UTR           complement(470126..470150)
FT                   /gene="mob1"
FT                   /locus_tag="SPBC428.13c"
FT   CDS_pept        470652..471704
FT                   /transl_table=1
FT                   /locus_tag="SPBC428.14"
FT                   /product="1-acylglycerol-3-phosphate acyltransferase
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.14.1"
FT                   /db_xref="GOA:O94361"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="PomBase:SPBC428.14"
FT                   /db_xref="PomBase:SPBC428.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94361"
FT                   /protein_id="CAA22289.1"
FT                   /translation="MTCRIAIRKYSFILCLAVGSVTIYTSEVIGTPLYFVNKELYNKYI
FT                   AFTKSFAGILFTALVQLFSPTPVTLTYDPELRNLFYLDRNGCLETIAAERNIVIANHQL
FT                   YSDWMYVWWLSYTAKQHGHVYIMLKNSLKWLPVIGWGMQLFRFIFLSRKWDKDYETMSR
FT                   HFKFIRNVRDSVSLILFPEGTNLVESTYQRSRVYADKIGVKMPKHLMLPRVRGLFYSIS
FT                   QLRDSMTYLYDYTFYFSDPSPKKYAADAFSLPKLFFEGVPIKRLHIHVRRFPISEIPTE
FT                   EDQFTDWLYQRWYEKDKLIDTLLETGNFPGPKKLHTTVRLKHRLEILSLFSVLFTCIVA
FT                   GLFLKLFISH"
FT   3'UTR           471705..472140
FT                   /locus_tag="SPBC428.14"
FT   misc_RNA        complement(472031..473716)
FT                   /locus_tag="SPNCRNA.1363"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           472084..472209
FT                   /locus_tag="SPBC428.15"
FT   CDS_pept        472210..473439
FT                   /transl_table=1
FT                   /locus_tag="SPBC428.15"
FT                   /product="Obg-like ATPase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.15.1"
FT                   /db_xref="GOA:O94362"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="PomBase:SPBC428.15"
FT                   /db_xref="PomBase:SPBC428.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94362"
FT                   /protein_id="CAA22290.1"
FT                   /translation="MGRDILIGFVGKPSSGKSTMLNALTDATAKTGNFPFTTIEPNRAI
FT                   GYAQIECACSRFGLQDKCKPIYGGCKNGVRSIPIQLLDVAGLIPGAHAGKGLGNKFLDD
FT                   LRHADALVHVVDVSGTTDAEGKVCRGYDPSVDIAWLYKEITAWIGNNLREKWPNIVRRH
FT                   IATKANPVNTLQSQFSGYGSTPAVTAKVLDSLHLDTPLEKWDDDTIEKVVNRFVDIKFP
FT                   TVIALNKIDHPDADANISKIARKEDPNRLVLASAISEVFLRRLAKQGFVKYEEGSEFVD
FT                   TLDDFPDSGLKPLSENLKTRIADLQDMVLFRHGSTGVCNVLAKAMELLNLIPVFPVKNV
FT                   HNFANSPNEGVFRDCILVKQGTTAGQVSQMVLGGEAMSIVGVNGNVGESDVIVPGKTDI
FT                   LHFRLRKAEA"
FT   3'UTR           473440..473687
FT                   /locus_tag="SPBC428.15"
FT   3'UTR           complement(473670..473826)
FT                   /gene="rhb1"
FT                   /locus_tag="SPBC428.16c"
FT   CDS_pept        complement(join(473827..474063,474118..474376,
FT                   474436..474497))
FT                   /transl_table=1
FT                   /gene="rhb1"
FT                   /locus_tag="SPBC428.16c"
FT                   /product="Rheb GTPase Rhb1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.16c.1"
FT                   /db_xref="GOA:O94363"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPBC428.16c"
FT                   /db_xref="PomBase:SPBC428.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94363"
FT                   /protein_id="CAA22291.1"
FT                   /translation="MAPIKSRRIAVLGSRSVGKSSLTVQYVENHFVESYYPTIENTFSK
FT                   NIKYKGQEFATEIIDTAGQDEYSILNSKHSIGIHGYVLVYSITSKSSFEMVKIVRDKIL
FT                   NHTGTEWVPIVVVGNKSDLHMQRAVTAEEGKALANEWKCAWTEASARHNENVARAFELI
FT                   ISEIEKQANPSPPGDGKGCVIA"
FT   intron          complement(474064..474117)
FT                   /gene="rhb1"
FT                   /locus_tag="SPBC428.16c"
FT   intron          complement(474377..474435)
FT                   /gene="rhb1"
FT                   /locus_tag="SPBC428.16c"
FT   5'UTR           complement(474498..474573)
FT                   /gene="rhb1"
FT                   /locus_tag="SPBC428.16c"
FT   3'UTR           complement(474574..474626)
FT                   /gene="wpl1"
FT                   /locus_tag="SPBC428.17c"
FT   CDS_pept        complement(join(474627..474881,474927..474979,
FT                   475020..476520))
FT                   /transl_table=1
FT                   /gene="wpl1"
FT                   /locus_tag="SPBC428.17c"
FT                   /product="Wings apart-like homolog Wpl1"
FT                   /db_xref="GOA:O94364"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="InterPro:IPR039874"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94364"
FT                   /protein_id="CAA22292.1"
FT                   /translation="MKRGKCKEKDNGLKRISSESEVWNFLDVTVSELNKQKRSPGQTVS
FT                   KRLHKKQRVVSNPDLSLPSSPVKQILRNGLQNSKYGSHKTGLERSASCSSIDASANHSS
FT                   TTYREQRSYLMEEGLDTQPIVPREVSSGRELDSTNHTIGTERAFLIEEDVSEDDEIQMK
FT                   SIHELRFAGEQQRIVDEIEYLVDGVTFSGNSSASRYLSLIGIAEKMFDNSFRLCLKSIR
FT                   DVFLRIFEEIDPKDTLHTFLQIYIFATMANEMDCMSSLLDAYSNNVKLLLQTAITLEPQ
FT                   VPVSILAKSLPKSVKGAVQEFVIKAELTFSFSNESLASSDSISLAAIALMKTSSGVFAE
FT                   SELFTELINLLIEKSYPILKENDGSNNFLLHALCSSLEKFTDFQGSEKIQKVSQILSSK
FT                   LQILIDEHNETNSPKIDDTVVHACSEKLLRTLIQTVNSNSDHALAVSKSEVPLFAYKIL
FT                   QKFSNFSSDDETTRELIILILGLLLGLVEESHEFIQTITHVEVSFGASALDVLISFYQK
FT                   NESIVEISGYVVMILSHCFLNDPKAFAQLKPLISQFYESLHKFKNFHLKLKEELMMMGS
FT                   NGLAIVSIIDELHKSLQDYLRSDLVK"
FT   5'UTR           complement(476521..476783)
FT                   /gene="wpl1"
FT                   /locus_tag="SPBC428.17c"
FT   5'UTR           477189..477364
FT                   /gene="cdt1"
FT                   /locus_tag="SPBC428.18"
FT   CDS_pept        477365..478699
FT                   /transl_table=1
FT                   /gene="cdt1"
FT                   /locus_tag="SPBC428.18"
FT                   /product="replication licensing factor Cdt1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.18"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.18.1"
FT                   /db_xref="GOA:P40382"
FT                   /db_xref="InterPro:IPR014939"
FT                   /db_xref="InterPro:IPR032054"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PomBase:SPBC428.18"
FT                   /db_xref="PomBase:SPBC428.18.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40382"
FT                   /protein_id="CAA22293.1"
FT                   /translation="MKCRALYSHDNNILIFGFCVQIMSAGSQTKLNFSVRKTRSSSKRS
FT                   NAAIIEPPKNPEDSQIIPAVKRLKENLDTESLEQNEVLPPVKNESVLFLEKVFNAVDIC
FT                   VKFHLSINTKPTFVLLENKVSGLTKISLKITHLAQILTVWPESFAITPCFTIHQGKRVA
FT                   TYELSYPRNANLPEAFSRSIEFKRRLEKWLLEHCSETEIPAQQLQALPSLSKNTVNESS
FT                   LVRKLNLEKSTSRELRIPTQTLEPKFTTNTAKYANELVSCSMLDSSSTLSKSVNSKINL
FT                   KSHQSSSSVQNSSRKLTSSQLTLRQSSLFDRVRKKQKAMEAKKAEEFKNNLVVHTLAKE
FT                   KVSFVRIIDLIFVQLSTWPTKRSFSMSEIVTSMQMSISSSLSPDQCAKAIELLSKALPA
FT                   WCTINLLGNIQVVTFSRIVNGKPYLRSQLIEELQTKASITILSNS"
FT   3'UTR           478700..478738
FT                   /gene="cdt1"
FT                   /locus_tag="SPBC428.18"
FT   3'UTR           complement(478913..479202)
FT                   /gene="utp15"
FT                   /locus_tag="SPBC428.19c"
FT   CDS_pept        complement(join(479203..480369,480579..480896))
FT                   /transl_table=1
FT                   /gene="utp15"
FT                   /locus_tag="SPBC428.19c"
FT                   /product="U3 snoRNP protein Utp15 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.19c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.19c.1"
FT                   /db_xref="GOA:O94365"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC428.19c"
FT                   /db_xref="PomBase:SPBC428.19c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94365"
FT                   /protein_id="CAA22294.1"
FT                   /translation="MSAPAGRLQPQRFAALPNPVTAENKFWRSFKVPVVAKEYSAITSI
FT                   HFSAESPYDFAVTSGARVQIYGASSRSVKKTIARFKDTAYSGNIRKDGKLLLAGDATGL
FT                   VQIFDLSTRSILRALDAHQFPVHVTQFCPYANTTFLSGSDDKTVKVWDLSTGAVQYDLS
FT                   GHEDYVRTASWMSATRLVSGGYDGTIRLWDTRIADPEVMSFSHGEAIDVVLPMQSGSTV
FT                   ISAGGPSIKVWDLVAGRQTPTKKLSNHQKSITCLAMNSENTRLLSGGLDGHVKIYNISD
FT                   WKVVHGMKYSGPILSMGLSPDSCNLVVGMSNGTLSQRTRRITKQTSSKTPFLGGVGSAF
FT                   GVVGKKKQIYKGENDEFYVEEARRKRLRPFDKALKSFCYSDALDMVLENGSPVLIITML
FT                   IELLHVGGLRIALSNRDDLSLTPLINFLRKYIRDPRFSETLCIVTSTILDIYGAALGGS
FT                   VMVENAISKLREKVEQEVAVTQRANELVGMLQMLSA"
FT   5'UTR           complement(480897..481013)
FT                   /gene="utp15"
FT                   /locus_tag="SPBC428.19c"
FT   3'UTR           complement(480948..481075)
FT                   /gene="alp6"
FT                   /gene_synonym="SPBC902.01c"
FT                   /locus_tag="SPBC428.20c"
FT   CDS_pept        complement(join(481076..481552,481606..483437,
FT                   483478..483539,483579..483706))
FT                   /transl_table=1
FT                   /gene="alp6"
FT                   /gene_synonym="SPBC902.01c"
FT                   /locus_tag="SPBC428.20c"
FT                   /product="gamma tubulin complex Spc98/GCP3 subunit Alp6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC428.20c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC428.20c.1"
FT                   /db_xref="GOA:Q9USQ2"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="PomBase:SPBC428.20c"
FT                   /db_xref="PomBase:SPBC428.20c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ2"
FT                   /protein_id="CAA22295.3"
FT                   /translation="MSEIHVKTALSRLADKYLQNSKNPSVPYTIETIVSFFQEIIHSIS
FT                   PDTFQLDIDDILYKIYSKIPPEENNDALFSKLSNLVSRLKSQTVIHNKSQILYFLYLLS
FT                   PISQSSRDVSSHLLDESISNPINIPSTEVESSNFGQTRYDQVPENPQITDWDEGLENES
FT                   SISIAHDSSRLNRSTETSSVQHTLITEADLLSSISYVLQGISTEYVQFKNELALLSKRI
FT                   PVQYLLQMRALSETGLLYQELKVFSNYDPSVSQSIDGDNVSKAFINDQSLALQSLKSVI
FT                   SKELTNFLALIASLDSQIRADASLEKPMVTIRRCIAWTQVAKLKLRILSSVVNDNMNQE
FT                   NKKRLIQVVSKYNVHGDPLIQELSDKILTEITGPLYEMIENWIYKGELVDPYQEFFVKE
FT                   KNGSESHDHQGQGDVVWKGKYFLDKELIPSFLSEELVDKIFLIGKSLNFARYGCGDFDW
FT                   AQEHYQKLVKKLSYRDPHSLETVVDKAYTESINHLVYLMEEVFHLTDHLKAIKKYLLLG
FT                   QGDFVDLLMESLGNSLDQPANTLFRHNLTASLESAIRSSNASYEPEYVLKRLDARLLEL
FT                   SHGETGWDVFTLEYKVDSPINVIITPYCSRQYLKIFNFLWRLKRIEFALAHSWRRVNLG
FT                   ERNVFRNLDYTKFEWHFVSCHLAEMIHFVCQLQYYILFEVIEISWQELQLAMEKPNATL
FT                   DTYIEAHEKYVTSITHKGLLGGGKSRNEDSFLHQLHDILKVILNFHDAIELLYNFSCSL
FT                   SNRIRINVPISTDALAAQYTPIKNELSNFTEEFQVRLQKLLHGLASHKDPEMRFLSVRL
FT                   NYNEFYVSHRRRHDKDVTSQ"
FT   5'UTR           complement(483707..483826)
FT                   /gene="alp6"
FT                   /gene_synonym="SPBC902.01c"
FT                   /locus_tag="SPBC428.20c"
FT   3'UTR           complement(483878..483948)
FT                   /gene="ctf18"
FT                   /gene_synonym="chl12"
FT                   /locus_tag="SPBC902.02c"
FT   CDS_pept        complement(join(483949..484312,484362..484492,
FT                   484573..486960))
FT                   /transl_table=1
FT                   /gene="ctf18"
FT                   /gene_synonym="chl12"
FT                   /locus_tag="SPBC902.02c"
FT                   /product="RFC-like complex subunit Ctf18"
FT                   /db_xref="GOA:Q9USQ1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ1"
FT                   /protein_id="CAB62096.1"
FT                   /translation="MDSIPNEDDLEKLLVAEQNVPYGKNYESFEDEENYLLELRNANAL
FT                   ENLEHRSIPNDLFHSSQPVGSPTRNGDDIPSTLDLYSSDNAAIDTDISEDETINQRHAP
FT                   QTDYRYPNTSANPKMGLEESMDIDMPSIDLDISNAAAFPRDSNLLFRNYNSHTKTSEKG
FT                   SPVNFEKENQDSNVLFSTGRTSVLHIDAEQSQTNNTVTPLKDDALSLFSFENDVNGAVN
FT                   DNSLDQKLSASKNSQRVSLPFFSKIELDEGSSFSGPKISARTSSGKIIYFPKKKNRHSD
FT                   GLLLQPKRLADEISQVNEIGKDFNQDLLNSVRIWSENFLIVSKEKSVALKTEKLDSLQI
FT                   TNCTTKPQSQKLWVDTYRPQLFRDLLGDERVHRAAMHWIKAWDPCVFGKSRLQPSKSMR
FT                   FNPRFTNITSDSDRPDKRIMMLTGLAGAGKTTLAHVIAHQAGYKVLEINASDDRTAHTV
FT                   HEKVSSAISNHSALSSQPTCVIVDEIDGGDPAFVRALLSLLESDEKATEYSQAGNSKKK
FT                   KKFKKLCRPIICICNDLYTPALRPLRPYAQIIYFRPPPQASLVGRLRTICRNENIAVDS
FT                   RSLTLLTDIYNSDIRSCINSLQLLSLNNKRIDSETIKLLQPKSNSFSTSSLIQSLFLQL
FT                   DNKQIRAIEASQPTYSHLDALLARIDGANDSESVLMNCFHTYLDLPFTDSLLSKPALTS
FT                   EWLYFFDQLHSQCYKGNYELWRYIPYSIIHFHYLYATPEKCRLPHPPRSDLEALKLYRT
FT                   RKEILDSFISTLNAYENQMHGERSILLELIRTILITINPTLKQKEDSMPRSALPSKIEH
FT                   AINILNHYNLRFQQLPVGDGNYVYRLEPPLDELVWDAPTSSYSVRQMLSQELLKKRLAD
FT                   IKKQTLTDNPTSSNSSRKRKDFNSGKAIKRDFFGRIISEPKSEAVTSNNAALNTGDHPV
FT                   SIKHAINIKFHDGFSNAVRKPISLNEILNF"
FT   5'UTR           complement(486961..486999)
FT                   /gene="ctf18"
FT                   /gene_synonym="chl12"
FT                   /locus_tag="SPBC902.02c"
FT   misc_RNA        487382..487504
FT                   /gene_synonym="SPNG1211"
FT                   /locus_tag="SPNCRNA.307"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           487884..488229
FT                   /locus_tag="SPBC902.03"
FT   CDS_pept        488230..488772
FT                   /transl_table=1
FT                   /locus_tag="SPBC902.03"
FT                   /product="Nem1-Spo7 complex regulatory subunit Spo7
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC902.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC902.03.1"
FT                   /db_xref="GOA:Q9USQ0"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="PomBase:SPBC902.03"
FT                   /db_xref="PomBase:SPBC902.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ0"
FT                   /protein_id="CAB62097.1"
FT                   /translation="MSSYVPNTLSVYHNLLILEASFRKTYLQLQVRRQKYMAFYVSLLV
FT                   WNFYFGYRVFYRISKYSLIDLTYKLCLLCGIVTLLLFYFSGLYRTTIVYPSRYVQQVNK
FT                   AMRFFNIRLVITPVPWFQVRKPLDCGVHLILSSKRFDILVIEGWEAFRSSYFASIHRKN
FT                   NSIQSNESSESPSSKQN"
FT   3'UTR           488773..489600
FT                   /locus_tag="SPBC902.03"
FT   5'UTR           489823..489881
FT                   /locus_tag="SPBC902.04"
FT   CDS_pept        join(489882..489911,489950..489987,490078..491620,
FT                   491675..491833)
FT                   /transl_table=1
FT                   /locus_tag="SPBC902.04"
FT                   /product="RNA-binding protein"
FT                   /db_xref="GOA:Q9USP9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USP9"
FT                   /protein_id="CAB62098.1"
FT                   /translation="MPLFLEEHAEYLKRYLEQALEPISDADASVLSDYAMALLRHDSSE
FT                   EEVRQLCYSQLEDFLRQETIPFVDKIFDVLREKSYLEGASNMPSTGMVTEEVSRYSPTS
FT                   SMIPATNSMETNFNNSLPAVGKTNTFPSQVPNMFGPPLYHPAATAPSEFMPSIPGFGNL
FT                   PNPAMPPIPFLPFNPAAQPPFPPPFKMRGKRGFGMRHEHNSELRRHSPGNRRFNPYKAY
FT                   PQPHLGHRFSRNAGNDPTSTALEVRNIPEEHFNEENIRSFFSKFGVLEKVELNPTHHSC
FT                   VLEFTSHEAANNAWSSPEPIFNNRFIKIFWYNPSKGFHNRPKKFASHKSPTTSDSSNVE
FT                   SSEDVDPASLLQNEEFHKLIEERQRQHEERLKRINANKKALEELNQKKRELAQQQLKEQ
FT                   ELLMQKIKETDRSGNKRLMLLETQHSLLKAEADCLGLPVSNVSESPAASNGSHHPYASG
FT                   LPQRGTNTFFRGRGRGRGDMFASMSIDNRPTKLRVINVSPEKNEALLQYLFTVGGYEEI
FT                   TEPSTTERLISFQNRNSAEKFFGGVRNVEKLQELELAWVPKTAVTTNTTSMETGESNTS
FT                   DNMNIEVEEGRWR"
FT   3'UTR           491834..492221
FT                   /locus_tag="SPBC902.04"
FT   3'UTR           complement(491874..492161)
FT                   /gene="idh2"
FT                   /gene_synonym="glu2"
FT                   /locus_tag="SPBC902.05c"
FT   CDS_pept        complement(join(492162..492268,492319..493083,
FT                   493238..493286,493334..493480,493584..493655))
FT                   /transl_table=1
FT                   /gene="idh2"
FT                   /gene_synonym="glu2"
FT                   /locus_tag="SPBC902.05c"
FT                   /product="isocitrate dehydrogenase (NAD+) subunit 2"
FT                   /EC_number="1.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC902.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC902.05c.1"
FT                   /db_xref="GOA:Q9USP8"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="PomBase:SPBC902.05c"
FT                   /db_xref="PomBase:SPBC902.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USP8"
FT                   /protein_id="CAB62099.2"
FT                   /translation="MSMLSTLRTAGSLRTFSRSACYSFQRFSSTKAAAGTYEGVKNANG
FT                   NYTVTMIAGDGIGPEIAQSVERIFKAAKVPIEWERVKVYPILKNGTTTIPDDAKESVRK
FT                   NKVALKGPLATPIGKGHVSMNLTLRRTFGLFANVRPCVSITGYKTPYDNVNTVLIRENT
FT                   EGEYSGIEHEVIPGVVQSIKLITRAASERVIRYAFQYARQTGKNNITVVHKATIMRMAD
FT                   GLFLECAKELAPEYPDIELREEILDNACLKIVTDPVPYNNTVMVMPNLYGDIVSDMCAG
FT                   LIGGLGLTPSGNIGNQASIFEAVHGTAPDIAGKGLANPTALLLSSVMMLKHMNLNDYAK
FT                   RIESAIFDTLANNPDARTKDLGGKSNNVQYTDAIISKLK"
FT   5'UTR           complement(493656..493812)
FT                   /gene="idh2"
FT                   /gene_synonym="glu2"
FT                   /locus_tag="SPBC902.05c"
FT   5'UTR           494592..494741
FT                   /gene="mto2"
FT                   /locus_tag="SPBC902.06"
FT   CDS_pept        494742..495935
FT                   /transl_table=1
FT                   /gene="mto2"
FT                   /locus_tag="SPBC902.06"
FT                   /product="MT organizer Mto2"
FT                   /db_xref="GOA:Q9USP7"
FT                   /db_xref="PDB:6GDJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USP7"
FT                   /protein_id="CAB62100.1"
FT                   /translation="MSEHNYQSDREVAEDPFLNYEASANQLSSNSRESTPRGSPWRAGM
FT                   RSASLMTEPLEDSMYSDNNYLDNGVSFTKDENPLYSPSWPSLADANVNSMKSNNAIQEH
FT                   KAAKFVSEKSLEKVSTADNNLVLQELENLRERLNQVELQLSERPSSYLGYHNNLSPYRS
FT                   PNSYPSLLPSTHSPHSPAPLSTMQTALMRLRTYHPSPIILKPVEQAVNHAITLVNTSPS
FT                   SVVDALCRSLAELCLGLVQEAIDASILSQQESSNSLDLVRHTPPLNYTSSVDSSPQRMA
FT                   SDSYGRPSLHLNDPFPSVDLQSNELSHHNVRTTLFSDDSRFHSKIHTHSTPPSQMYSAA
FT                   SHFRYRSDPSTRHVSNSTNKSSLHPSPTSLRVAHPIIPQRASPASQSFPSLQDTPSP"
FT   3'UTR           join(495936..496011,496129..496423)
FT                   /gene="mto2"
FT                   /locus_tag="SPBC902.06"
FT   5'UTR           496534..496680
FT                   /gene="pmp1"
FT                   /locus_tag="SPBC1685.01"
FT   CDS_pept        496813..497649
FT                   /transl_table=1
FT                   /gene="pmp1"
FT                   /locus_tag="SPBC1685.01"
FT                   /product="dual-specificity MAP kinase phosphatase Pmp1"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.01.1"
FT                   /db_xref="GOA:O13453"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="PomBase:SPBC1685.01"
FT                   /db_xref="PomBase:SPBC1685.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13453"
FT                   /protein_id="CAA20049.1"
FT                   /translation="MSQKLPPLKIYTSQLPLVSHKNMLENEEEASHSQLFTPCPVPPSF
FT                   PKASKPNSNQPYPNGPVCIYPPNIYLYAKPTMPIIQSFDVVINVAKEVLHPFRTDGRHY
FT                   RDSKHNLDIQVFDHIEYVHIHWDHDTQFALELDKLVSFVAYNAMQLNKKVLINCQMGIS
FT                   RSACLMIAFIMKTLNLNVSDAYEYVKERSPWIGPNMSLIFQLSEYQQIIRKNSSQGPYQ
FT                   SSSLKQSKRKSEGNLLFPEKPHSAQLPLVSPSTSESSMFTNLRRTRSSGSISNDAS"
FT   misc_RNA        complement(496923..497897)
FT                   /gene_synonym="SPNG2A43"
FT                   /locus_tag="SPNCRNA.565"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           497650..499230
FT                   /gene="pmp1"
FT                   /locus_tag="SPBC1685.01"
FT   3'UTR           complement(498389..498486)
FT                   /gene="rps1202"
FT                   /gene_synonym="rps12-2"
FT                   /locus_tag="SPBC1685.02c"
FT   CDS_pept        complement(join(498487..498543,498601..498990))
FT                   /transl_table=1
FT                   /gene="rps1202"
FT                   /gene_synonym="rps12-2"
FT                   /locus_tag="SPBC1685.02c"
FT                   /product="40S ribosomal protein S12 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.02c.1"
FT                   /db_xref="GOA:O74322"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PomBase:SPBC1685.02c"
FT                   /db_xref="PomBase:SPBC1685.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74322"
FT                   /protein_id="CAA20050.1"
FT                   /translation="MSTEGDHVPQAEEVIETVEVVEEETGSSPLSVEDSLKEVLKRALV
FT                   HDGLARGIREASKALDRRQAHLCVLCESCDQEAYVKLVEALCAESQTPLVKVADPKILG
FT                   EWAGLCVLDRDGNARKVVGCSCVAVTDYGEDSVALQTLLSSFAA"
FT   intron          complement(498544..498600)
FT                   /gene="rps1202"
FT                   /gene_synonym="rps12-2"
FT                   /locus_tag="SPBC1685.02c"
FT   5'UTR           complement(498991..499069)
FT                   /gene="rps1202"
FT                   /gene_synonym="rps12-2"
FT                   /locus_tag="SPBC1685.02c"
FT   5'UTR           499181..499373
FT                   /gene="sec11"
FT                   /locus_tag="SPBC1685.03"
FT   CDS_pept        join(499374..499397,499556..499869,499930..500161)
FT                   /transl_table=1
FT                   /gene="sec11"
FT                   /locus_tag="SPBC1685.03"
FT                   /product="signal peptidase subunit Sec11 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.03.1"
FT                   /db_xref="GOA:O74323"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="PomBase:SPBC1685.03"
FT                   /db_xref="PomBase:SPBC1685.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74323"
FT                   /protein_id="CAA20051.1"
FT                   /translation="MQKLSFRQGLAQILNLLLVLSSAYMGYKTLSFVTDCESPVVVVLS
FT                   ESMEPSFQRGDLLFLDNRNPSFDEAKVPSVFEKIIYGSPVGIGDIVVYSLPDRPIPIVH
FT                   RVVKLYESENQTHLITKGDNNKIDDVAMFPKSINYLDRENHILGVVRGYFPYLGMITIW
FT                   LTDYPILKYIMLGGLGLLTLIQKEEQ"
FT   3'UTR           500162..500762
FT                   /gene="sec11"
FT                   /locus_tag="SPBC1685.03"
FT   5'UTR           501253..501304
FT                   /gene="vma9"
FT                   /locus_tag="SPBC1685.16"
FT   CDS_pept        join(501305..501396,501685..501735,501802..501862)
FT                   /transl_table=1
FT                   /gene="vma9"
FT                   /locus_tag="SPBC1685.16"
FT                   /product="V-type ATPase V0 subunit e (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.16.1"
FT                   /db_xref="GOA:Q69Z14"
FT                   /db_xref="InterPro:IPR008389"
FT                   /db_xref="PomBase:SPBC1685.16"
FT                   /db_xref="PomBase:SPBC1685.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q69Z14"
FT                   /protein_id="CAH05006.2"
FT                   /translation="MGGLVVLLVGLLTALMSVVSYYVSPKGNNTSTWQMSLILTFSCCY
FT                   LLWAITYLAQLHPLEAPSRVLE"
FT   3'UTR           join(501863..501894,501935..502441)
FT                   /gene="vma9"
FT                   /locus_tag="SPBC1685.16"
FT   5'UTR           502384..502872
FT                   /locus_tag="SPBC1685.04"
FT   CDS_pept        502873..503850
FT                   /transl_table=1
FT                   /locus_tag="SPBC1685.04"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.04.1"
FT                   /db_xref="GOA:O74324"
FT                   /db_xref="PomBase:SPBC1685.04"
FT                   /db_xref="PomBase:SPBC1685.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74324"
FT                   /protein_id="CAA20052.1"
FT                   /translation="MKQEYIPLDEFPNKSNEGMLNDEGTSSSGLSTRTRSLELFDNMEE
FT                   SGSFPKVERKIQSLLDELAEVLFQSKQPNDLTRIRKAIAEQLQLWCQACQENADLYRSQ
FT                   QRKLKSRWDSQTDILSQIESTKASLAEVHKAEEISNLKTSITHLDEEIQILQEKLAIVT
FT                   NQRNTLVKRLQTYDNLEKKKALSMEDRLLTLQEQYDAHANVSSLEKRMEVLKKREDLLR
FT                   LMVGQALPGMQFFQRLIHQIQAVETKLISILGPTSLSEAALPPLTDVQRTSVLSLLTST
FT                   LHSLESARQIADSNTWKPIIVCLELEIVYFENMLTAITSTPVSS"
FT   3'UTR           503851..504193
FT                   /locus_tag="SPBC1685.04"
FT   misc_RNA        complement(503961..505097)
FT                   /locus_tag="SPNCRNA.1364"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           504397..505922
FT                   /locus_tag="SPBC1685.05"
FT   CDS_pept        505923..508916
FT                   /transl_table=1
FT                   /locus_tag="SPBC1685.05"
FT                   /product="serine protease (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.05.1"
FT                   /db_xref="GOA:O74325"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="PomBase:SPBC1685.05"
FT                   /db_xref="PomBase:SPBC1685.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74325"
FT                   /protein_id="CAA20053.1"
FT                   /translation="MTPVSSDYRPNHIFLPKFRPDKITSECNTPQQQNVIAEGLYNVSE
FT                   PFPIRNTDEERYLDTKEIHHTWDNTIKNVVRSIVSIKGSALRSFDTESAGSFCATGFVV
FT                   NKTLGLILSNRHVVSPGPISARASFINYEEIDIYPIYRDPVHDFGFFRYDPSSIRFHDV
FT                   TEISLSPESAKVGIDIRIIGNDAGEKLSILSSTLARLDRPAPNYGIDNYNDFNTFYYQA
FT                   ASGTSGGSSGSPVLDISGAAVALNSGGSNSSASSFYLPLDRVVRALRCIENNTPITRGT
FT                   LLTEFLHWSYDELSRIGLPREFEYDCRTRVPSSTGLLVVSRVLRNSEVSKALEPGDILI
FT                   AFKTDSHKSTYIVDFVSLFEVLDEMVGKTIELHVYRPKRGFLTFQLTVQDLHNVTPSRF
FT                   LEVGGAVLHDLSYQLARSYQFSLNSGTYVASSGMLNWSSGTRDFLVTRLANKPTPTLDA
FT                   FIDVLVQLTDNARVPMHFRVLGKYEEEFTIVTVDRHFFLASIFSRNDEKGTWDRQSLPP
FT                   PQPSISRRPSVIPRPQEGSKSMEAIQNALVLVHCRMPYSINGFSSTKLYSGTGVIVSVV
FT                   PPLIVVDRSVIPVDICDIRLTFQSMSAMGHLTFLDNRIAVVSCDYLPSNSVQLNFVADF
FT                   LRTGDECTLAALDEDLQLLTKKTTVRSVSVVETERSSPPRFRYVNCEVISLMDSLASTG
FT                   GLVFREVGDDREIVALWISVVHQDVGGKDYTTKYGLSMSYILPVLERLKLPPSARAQHV
FT                   PTTAGVEWSHITLAGASTLGLSQTRSSEFYMKSRENGTIPRPLYVISHLRPLLHKTSLG
FT                   VGDILLEVNGKMITRLSDLHEFETESEIKAVILRDGIEMEITIPLYPEYPTFSSRAICW
FT                   MGAIIHPTHSSVFEQVEPDVDLPGPEGVYVGSILYGSPALNMLRAAHWIVAVDGHDINT
FT                   FDDFYHMLLEKPTDTFVQVKQMNRRGATSIVSVRPDPLFWPTCIIERDSNGRWCTKHLQ
FT                   RKTKEVCS"
FT   3'UTR           508917..509056
FT                   /locus_tag="SPBC1685.05"
FT   5'UTR           509412..509501
FT                   /gene="cid11"
FT                   /locus_tag="SPBC1685.06"
FT   3'UTR           complement(509491..511203)
FT                   /gene="avt5"
FT                   /locus_tag="SPBC1685.07c"
FT   CDS_pept        join(509502..509895,509942..510984)
FT                   /transl_table=1
FT                   /gene="cid11"
FT                   /locus_tag="SPBC1685.06"
FT                   /product="poly(A) polymerase Cid11 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.06.1"
FT                   /db_xref="GOA:O74326"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="PomBase:SPBC1685.06"
FT                   /db_xref="PomBase:SPBC1685.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74326"
FT                   /protein_id="CAA20054.1"
FT                   /translation="MELLTFTCCPFEGQMQQKKRRFDANLVQLQESEHRNDQINETVDA
FT                   ELTNECWKLYMRLKPSNEEVSRRQQFVDKLRTILSTEIKDAKLDLFVFGSTENNLAIQQ
FT                   SDVDVCIITNGSKYLNSTCQLAQLLYSYGMKQIVCVSRARVPIVKIWDPQFDIHCDLNI
FT                   NNDVAKINTKMLRLFVSIDPRVRPLGLIIKYWAKQRALCDAAGSGTITSYTISCMLVNF
FT                   LQTRNPPILPAMLDLMSNDDNKMFVDDIVGFKEKATLNKTSLGRLLIDFFYYYGFSFNY
FT                   LDSVVSVRSGTVLNKQEKGWAMEVNNSLCVEEPFNTARNLANTADNPSVKGLQSEFQRA
FT                   FRLMSENNACERLCKICEEYQFLDITNEANYGNTNTPFNTAYESFGCNHTVLPEAAAYP
FT                   KPYYPPQITLSDGGNMNFLYYIPDESNHQSYENKANRDSDFQGQTSLTQGSAPPWHYIP
FT                   CQSWLVWYPSEDASNPASGN"
FT   3'UTR           510985..511089
FT                   /gene="cid11"
FT                   /locus_tag="SPBC1685.06"
FT   CDS_pept        complement(511204..512466)
FT                   /transl_table=1
FT                   /gene="avt5"
FT                   /locus_tag="SPBC1685.07c"
FT                   /product="vacuolar amino acid efflux transporter Avt5"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.07c.1"
FT                   /db_xref="GOA:O74327"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="PomBase:SPBC1685.07c"
FT                   /db_xref="PomBase:SPBC1685.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74327"
FT                   /protein_id="CAA20055.1"
FT                   /translation="MSGYSPLSSGPADVHIGKAGFFSSVINLANTILGAGILSLPNAFT
FT                   KTGLLFGCLTIVFSAFASFLGLYFVSQCAARLPRGKASFAAVAKHTFPSLAVVFDASIA
FT                   VKCFGVAVSYLVIVGDLMPQIAPSLGLSSPMFLRRQTWIVFALFVLTPLSFLKRLDSLR
FT                   HTSVISLIALCYLVFIVLYHFIIGDTVKGEIRYFVPESGFGYLSVLPVFVFGFTCHQNA
FT                   FSVINEVRNFSQGFVNFTMFTAIISSTLLYLLVAITGYLSFGSLASGNIIAMYDNTSIW
FT                   IIGGKLAIVVLVLFSYPLQCHPCRNSVYQAIRRSYSAHDMSDGYHAVITLCILLFTHSL
FT                   ALLLSSLEMVLAFVGSTGSTFISFILPGSLYYFFSHKVASPGNSSPLQLRISRAFAAGL
FT                   AIYGTVVMILCLNINIAKLSH"
FT   5'UTR           complement(512467..512924)
FT                   /gene="avt5"
FT                   /locus_tag="SPBC1685.07c"
FT   misc_RNA        complement(513254..514175)
FT                   /locus_tag="SPNCRNA.1365"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           514147..514215
FT                   /gene="cti6"
FT                   /locus_tag="SPBC1685.08"
FT   CDS_pept        join(514216..514553,514724..514927,514972..515704)
FT                   /transl_table=1
FT                   /gene="cti6"
FT                   /locus_tag="SPBC1685.08"
FT                   /product="histone deacetylase complex subunit Cti6"
FT                   /db_xref="GOA:Q1MTR4"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MTR4"
FT                   /protein_id="CAA20056.1"
FT                   /translation="MPSNSTPANEEKEEESEKIQKSPVDTPHTPNGSVSDNEENETSST
FT                   GEVTRCVCGIVESDDEASDGGLYIQCDQCSVWQHGNCVGFADESEVPEVYYCEICHPEF
FT                   HKVYQRGRGAKQSKYLGNGKPIEASQTEESSSTPPSPATKKSSKQRLTMNSRDAALDYE
FT                   EYLAIAKEKSLIPRRSRGRTSSKSLSPPAPQDESQGTEINLKQKIEEENDEILEDSKES
FT                   KDENEENKETSTTNVAETDAPEEETVDTVEEIADEEKHSVKEESGEASPQSSQQSTITS
FT                   ISTTTRSTRKAKREAAAEDKADLPAAVAPKPSKTRKVGGRRGKSSSNDNHRIPQLHPDG
FT                   TFVETITKPKGLHSRITMTEMRRRVASMLEYIGHIQVEMAAQSAGNQSSTKSSKEGPEE
FT                   EKETLRMVDNLTRDLLHWEQRFSRT"
FT   3'UTR           515705..515953
FT                   /gene="cti6"
FT                   /locus_tag="SPBC1685.08"
FT   5'UTR           516426..516441
FT                   /gene="rps29"
FT                   /locus_tag="SPBC1685.09"
FT   CDS_pept        join(516442..516503,516555..516654,516727..516735)
FT                   /transl_table=1
FT                   /gene="rps29"
FT                   /locus_tag="SPBC1685.09"
FT                   /product="40S ribosomal protein S29 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.09.1"
FT                   /db_xref="GOA:O74329"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="PomBase:SPBC1685.09"
FT                   /db_xref="PomBase:SPBC1685.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74329"
FT                   /protein_id="CAA20057.1"
FT                   /translation="MAHENVWFSHPRKYGKGSRQCAHTGRRLGLIRKYGLNISRQSFRE
FT                   YANDIGFVKYR"
FT   intron          516655..516726
FT                   /gene="rps29"
FT                   /locus_tag="SPBC1685.09"
FT   3'UTR           516736..516879
FT                   /gene="rps29"
FT                   /locus_tag="SPBC1685.09"
FT   5'UTR           517273..517343
FT                   /gene="rps27"
FT                   /locus_tag="SPBC1685.10"
FT   CDS_pept        join(517344..517349,517388..517480,517685..517837)
FT                   /transl_table=1
FT                   /gene="rps27"
FT                   /locus_tag="SPBC1685.10"
FT                   /product="40S ribosomal protein S27 (predicted)"
FT                   /db_xref="GOA:O74330"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74330"
FT                   /protein_id="CAA20058.1"
FT                   /translation="MVLAVDLLNPSHESEMRKHKLKQLVQGPRSFFMDVKCPGCFNITT
FT                   VFSHAQTVVICGSCASVLCQPTGGKARLMEGCSFRRKN"
FT   intron          517481..517684
FT                   /gene="rps27"
FT                   /locus_tag="SPBC1685.10"
FT   3'UTR           517838..517984
FT                   /gene="rps27"
FT                   /locus_tag="SPBC1685.10"
FT   5'UTR           518095..518371
FT                   /gene="rlp1"
FT                   /locus_tag="SPBC1685.11"
FT   CDS_pept        518372..519463
FT                   /transl_table=1
FT                   /gene="rlp1"
FT                   /locus_tag="SPBC1685.11"
FT                   /product="RecA family ATPase Rlp1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.11.1"
FT                   /db_xref="GOA:O74331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPBC1685.11"
FT                   /db_xref="PomBase:SPBC1685.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74331"
FT                   /protein_id="CAA20059.1"
FT                   /translation="MNAAEWVAELKRKSQIESFKEQKGLVYDDHIEKVLYSGSVNGTLL
FT                   VIEGNSCSGKTELLYHLASNVLLRSSQELVLIVSSEWDWSIKRLTFILHERLISSRGVS
FT                   QTCKCNCAVKLENESTVHLQNAAREDGTDEDINSNSVNDVSLSSGETMLQFPEHEEQHE
FT                   CNREMEQLYESASSTVYPCSFWEDAERKIDAQCAILWPMEFSGVVESIPQSTKDLLRIW
FT                   KEAKIQMHEDFRCNKTEFNEACFDASSSRLGCILMDGLSTFYWQLRLERGYTQVYADLQ
FT                   NRLCTSSKLFGCPVVCTNWLLNNKQHLPIQCKRFRSERRANARFYLENCVSKLGETFYL
FT                   SVKGVQTKTEMASPYSQQEMEKV"
FT   3'UTR           519464..519645
FT                   /gene="rlp1"
FT                   /locus_tag="SPBC1685.11"
FT   rRNA            520254..520494
FT                   /locus_tag="SPRRNA.29"
FT                   /product="5S rRNA"
FT   misc_RNA        complement(520406..522725)
FT                   /locus_tag="SPNCRNA.1366"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           522603..522739
FT                   /locus_tag="SPBC1685.17"
FT   3'UTR           complement(522659..523886)
FT                   /locus_tag="SPBC1685.12c"
FT   CDS_pept        522740..522985
FT                   /transl_table=1
FT                   /locus_tag="SPBC1685.17"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.17"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.17.1"
FT                   /db_xref="GOA:G2TRS0"
FT                   /db_xref="PomBase:SPBC1685.17"
FT                   /db_xref="PomBase:SPBC1685.17.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS0"
FT                   /protein_id="CCD31351.1"
FT                   /translation="MLSYGMPCHVLRRNTRILMKEKKKRLGIMFWQNVERRRCPETHSN
FT                   EGASQGKRKRSERLKSVDFKKGVYCACACACTFQQE"
FT   3'UTR           522986..523313
FT                   /locus_tag="SPBC1685.17"
FT   misc_RNA        523271..525609
FT                   /locus_tag="SPNCRNA.1367"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   CDS_pept        complement(523887..524240)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1685.12c"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.12c.1"
FT                   /db_xref="PomBase:SPBC1685.12c"
FT                   /db_xref="PomBase:SPBC1685.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74332"
FT                   /protein_id="CAA20060.1"
FT                   /translation="MVSNHVEWYLLLSIVSTAVESLLPDEKRHSQTLTYADPRNISITV
FT                   DRVLQRIQCTSTDGDDDDASLMTMRFKASEGDACVCASACRNFLFLQDAMQCNATATMT
FT                   ATPTDAHRQMHQM"
FT   5'UTR           complement(join(524241..525525,525614..525686))
FT                   /locus_tag="SPBC1685.12c"
FT   5'UTR           525509..526090
FT                   /gene="fhn1"
FT                   /locus_tag="SPBC1685.13"
FT   CDS_pept        526091..526642
FT                   /transl_table=1
FT                   /gene="fhn1"
FT                   /locus_tag="SPBC1685.13"
FT                   /product="Fhn1 plasma membrane organization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1685.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1685.13.1"
FT                   /db_xref="GOA:O74333"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="PomBase:SPBC1685.13"
FT                   /db_xref="PomBase:SPBC1685.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74333"
FT                   /protein_id="CAA20061.1"
FT                   /translation="MVGIRQYGVFTWVFRTFQLAIDTIVLALASALVNQQTSGGSPGKI
FT                   NFSVAVGSFAILTFFLTAVGRFLPTILGNPWLIAFYDFVNWVFALTGGCCIAVAIRVHA
FT                   CDNQKYLDRNHYTQGSMRRCQELKALCFFLWFMFGLYVASFIVQIFIAKNDTPNYTFRG
FT                   RGRGKGSGPAVAPRPVMSAV"
FT   3'UTR           526643..528544
FT                   /gene="fhn1"
FT                   /locus_tag="SPBC1685.13"
FT   misc_RNA        527043..528366
FT                   /locus_tag="SPNCRNA.133"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(527680..528304)
FT                   /locus_tag="SPNCRNA.134"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(528890..529452)
FT                   /locus_tag="SPBC1685.14c"
FT   CDS_pept        complement(join(529453..531742,531812..531904,
FT                   531957..531979))
FT                   /transl_table=1
FT                   /locus_tag="SPBC1685.14c"
FT                   /product="Vid27 family protein"
FT                   /db_xref="GOA:Q1MTR3"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR040458"
FT                   /db_xref="InterPro:IPR040768"
FT                   /db_xref="InterPro:IPR040979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MTR3"
FT                   /protein_id="CAA20062.2"
FT                   /translation="MFMLKSLGKYIWGNTNSTEIVQIPYGQLYSVHENYRECMFKDASA
FT                   SIRRTTAEFQYQLVIQRAYEEGEEELEDDGDEAEDEQSFLLDEKLHLRFDVNKDSITIM
FT                   WDNPDFQDGTLYEFTCENCLQEGVAYTFEMVALQCMYERKYRQSHEKATLADLEQFSNP
FT                   ITRPSKEVDSLENIVTKLDLESEDLMRLKKQEQLDDEIAKKYLLGQQEAEEPLVQQQTS
FT                   IVNPEKEEVTKTENIKSLEGELMGTISAELHLFDAVEEVFILQDPNVEASVFDLGDWNY
FT                   WFTISTEEKTWLSQSVDADMNPVFSFEHLSFIWNYFDANSNAFSWLLRFDSQVRMEQFQ
FT                   ELLMRALWESLNQQRWLKIDDEQRDYVMETFHEDEELEDSEDEEFARQQLLSRKEEEEE
FT                   EDEEASDFEDSFADFSDGEADDLDESRWRKEAAKEHNSLLAVGYKNDRSYVVRNNKIGV
FT                   FKHVDEKGLKFQTALNNLSTPKGKSLRPSKLMLHNQDSSILFQTENAPHSLYHMDIEYG
FT                   KIVDEWKVHDDVPLVTFTPDNKFAQMTAEQTLIGLSNNSIFRIDPRVEGNKLVAEQFKQ
FT                   YATKNDFSSAATTENGYIAVASNKGDIRLFDRIGVNAKTALPALGEAIIGVDVTASGDF
FT                   VLATCKTYILLIDTRIKEGRYAGRLGFERNFAKDKKPKPKRLQLSPQHIAMMQRELKGG
FT                   ASFTPAKFNTGIDAKETTIVSSIGPFLISWNLDRVKRGFTDSYKIRRYDANVQAEDFRF
FT                   GTDRSLIVALPDDVAMVDKSSLRRPTRESICTPVKKLRSKHDIVNAPY"
FT   5'UTR           complement(531980..532062)
FT                   /locus_tag="SPBC1685.14c"
FT   3'UTR           complement(532193..532696)
FT                   /gene="klp6"
FT                   /gene_synonym="sot2"
FT                   /gene_synonym="SPBC649.01c"
FT                   /locus_tag="SPBC1685.15c"
FT   CDS_pept        complement(join(532697..535020,535061..535091))
FT                   /transl_table=1
FT                   /gene="klp6"
FT                   /gene_synonym="sot2"
FT                   /gene_synonym="SPBC649.01c"
FT                   /locus_tag="SPBC1685.15c"
FT                   /product="kinesin-like protein Klp6"
FT                   /db_xref="GOA:O59751"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59751"
FT                   /protein_id="CAA20063.2"
FT                   /translation="MKEGSSISVAVRVRPFTEREKGLLAETPKSKEFLGDGSLAVSNTS
FT                   SNTFCTNGIRKIVRVLDDNVLIFDPPEENPLAKVQKSLLPAGKRFRDVRYAFDRLFGEE
FT                   ASQEDVYKGTTEPLLDSVLQGYNATVFAYGATGCGKTHTISGRPDDPGIIFLTMRALLD
FT                   RVEGLKRTMNVDISVSYLEIYNEKIRDLLVQDPLSMEKPKSLNICEDAEQNVSVPGLSY
FT                   FTPTNLEEVMEIIIRGNSNRTMSPTEANAVSSRSHAVLQIYITQTPKSGEKQEESESQN
FT                   SHKVRSVFSFIDLAGSERASATKNRGKRLVEGANINRSLLALGNCINSLCEPRRRQHVP
FT                   YRDSKLTRLLKFSLGGNCRTCMIVCISPSSEHYDETHNTLKYGNRAKNIKTKVSRNVVS
FT                   VDRHVSEYVRTIYELRQKVSILQKRIAEESKQLALNKEVRKISSREIKMLDARSMLKNS
FT                   FDGSRDLQKSLIEHVRTLRRIEDEITLTKMWISIAKESDAMSGHNIKSVETRLAKLYDQ
FT                   RSLITAKVNPEEICKTFQNSISHIVSSFKGEGADMYADMLQDDVDLLKSIIENQILDAK
FT                   HESETFSSTSRKLIQNLFLLFPLLPGNAIDVNESLARAFDQLVGIVPSEPTIQVPNLIE
FT                   KGKAPLLSMFEIPRSPSRFKARSPSKAARVLKKPLKKRVRFSEVPTTSSVPPVEIKNKD
FT                   SKPKVEKSLDKHNMNNDRSFLVPSRDARNSLTSLSLHSNVAKNKSSHSSKWPTHTLSPI
FT                   ITTALKQPVRRISLVSQPLQKTGGTENTPNA"
FT   5'UTR           complement(535092..535263)
FT                   /gene="klp6"
FT                   /gene_synonym="sot2"
FT                   /gene_synonym="SPBC649.01c"
FT                   /locus_tag="SPBC1685.15c"
FT   5'UTR           535304..535382
FT                   /gene="rps1902"
FT                   /gene_synonym="rps19-2"
FT                   /gene_synonym="rps19"
FT                   /locus_tag="SPBC649.02"
FT   CDS_pept        join(535383..535458,535632..535987)
FT                   /transl_table=1
FT                   /gene="rps1902"
FT                   /gene_synonym="rps19-2"
FT                   /gene_synonym="rps19"
FT                   /locus_tag="SPBC649.02"
FT                   /product="40S ribosomal protein S19 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC649.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC649.02.1"
FT                   /db_xref="GOA:P79016"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="PomBase:SPBC649.02"
FT                   /db_xref="PomBase:SPBC649.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79016"
FT                   /protein_id="CAA19044.1"
FT                   /translation="MAGVSVKDVDAQQFINAYAAFLKRSGKMTTPQWIDIVKTGTHKEL
FT                   APYDPDWYYVRAAAIARHIYLRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVV
FT                   QSLEKIGVLEKSDNGGRRISQQGQRDLDRIAYSLLEDEE"
FT   intron          535459..535631
FT                   /gene="rps1902"
FT                   /gene_synonym="rps19-2"
FT                   /gene_synonym="rps19"
FT                   /locus_tag="SPBC649.02"
FT   3'UTR           535988..536041
FT                   /gene="rps1902"
FT                   /gene_synonym="rps19-2"
FT                   /gene_synonym="rps19"
FT                   /locus_tag="SPBC649.02"
FT   5'UTR           536652..536984
FT                   /gene="rhp14"
FT                   /locus_tag="SPBC649.03"
FT   misc_RNA        complement(536739..539154)
FT                   /locus_tag="SPNCRNA.1368"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        536985..537854
FT                   /transl_table=1
FT                   /gene="rhp14"
FT                   /locus_tag="SPBC649.03"
FT                   /product="XP-A family homolog Rhp14"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC649.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC649.03.1"
FT                   /db_xref="GOA:O59753"
FT                   /db_xref="InterPro:IPR000465"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022652"
FT                   /db_xref="InterPro:IPR022656"
FT                   /db_xref="InterPro:IPR037129"
FT                   /db_xref="PomBase:SPBC649.03"
FT                   /db_xref="PomBase:SPBC649.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59753"
FT                   /protein_id="CAA19045.1"
FT                   /translation="MENSSIVKSPNPTIEEQRNEIEKLKNLTGIEEVHVDGAKVNKRKR
FT                   TFDEQSEITKDYIEYDFSKIEDTKGGYLLEEKKVEDLREKPAERELREQEERQKKLRLA
FT                   PLNLDPETAPKCFECDSIELDTKYFDIFHCRVCHTCREKYPDKYSLLTKTECKLDYLLT
FT                   EPELQDQELLPRLLKANPHQQGWSNMMLYLRYQVEEFAKKKWGSMEALDAEFERREVQK
FT                   KEMKEKKFEKQLLELRKRTRTSNYSRMSIREKRKHVHSYDEEFEKPNEPGVIVQRCKCG
FT                   LEIEQLEI"
FT   3'UTR           537855..538069
FT                   /gene="rhp14"
FT                   /locus_tag="SPBC649.03"
FT   5'UTR           539327..539417
FT                   /gene="uvi15"
FT                   /locus_tag="SPBC649.04"
FT   CDS_pept        join(539418..539453,539523..539704,539915..539960)
FT                   /transl_table=1
FT                   /gene="uvi15"
FT                   /locus_tag="SPBC649.04"
FT                   /product="UV-induced protein Uvi15"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC649.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC649.04.1"
FT                   /db_xref="GOA:P40388"
FT                   /db_xref="PomBase:SPBC649.04"
FT                   /db_xref="PomBase:SPBC649.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40388"
FT                   /protein_id="CAA19046.1"
FT                   /translation="MSAQQFYGDKGYAPAPPQQAYGGPNYYPPQQNYPQQGYAPPQGYP
FT                   QGGYPAQQPMYVQQPQASDPGGDLCCGLLTGLACCCCLDAMF"
FT   intron          539454..539522
FT                   /gene="uvi15"
FT                   /locus_tag="SPBC649.04"
FT   intron          539705..539914
FT                   /gene="uvi15"
FT                   /locus_tag="SPBC649.04"
FT   3'UTR           539961..540117
FT                   /gene="uvi15"
FT                   /locus_tag="SPBC649.04"
FT   5'UTR           541153..541282
FT                   /gene="cut12"
FT                   /gene_synonym="stf1"
FT                   /locus_tag="SPBC649.05"
FT   CDS_pept        join(541283..541289,541332..542971)
FT                   /transl_table=1
FT                   /gene="cut12"
FT                   /gene_synonym="stf1"
FT                   /locus_tag="SPBC649.05"
FT                   /product="spindle pole body protein Cut12"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC649.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC649.05.1"
FT                   /db_xref="GOA:O59755"
FT                   /db_xref="InterPro:IPR021589"
FT                   /db_xref="PomBase:SPBC649.05"
FT                   /db_xref="PomBase:SPBC649.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59755"
FT                   /protein_id="CAA19047.1"
FT                   /translation="MSETLNTPPTYAWVLKAFSSKLAGTVTKPVTKMSSYIEDAESDAE
FT                   LPQDAKEDLRPTETLTPLKSKAAQNGILKTPGTLQIKKTVNFKDISKDAATWNRPTKNN
FT                   FLFTRLDDENPLMGHEEFKSPLLQSTPKPNINNPDNENKSKHDEFDNRYNININESYKN
FT                   ETKSNQRLGEDVPSKKKYPHSMDAEISKFKWDSNNNNDWSSLMKDCFRDVVNNNRKMKE
FT                   IIKDVMIDTSQAFPSESLDEPDYTINLDAPRSSSGKYWKQKFSMLDSAHSDLELELTSI
FT                   RERLESLILEKQEEINFWKQRCRALETEKIHNHQGQQSKYKGKEFVGNRFSQMRELYTA
FT                   KPSPITTKVVSRPSQSDVREPQEQVPSKNLHRGADMSHLAAQMLTHSSKKSHTTNLIPS
FT                   EGIISSTPISAASKVRMNLMQSNQTPTPAPFSIAAKKSHLPSKLSFPQDGGSLSSATTL
FT                   QQLPKARVTPNVLSSLSSNLGKTNPTSVYQSKANVTTSADVEKPQVKVATSSRVDYDLK
FT                   SPNQRTANAKKRLEERRRRRKLKLQELQLNS"
FT   3'UTR           542972..543168
FT                   /gene="cut12"
FT                   /gene_synonym="stf1"
FT                   /locus_tag="SPBC649.05"
FT   5'UTR           543359..543420
FT                   /gene="gtp1"
FT                   /gene_synonym="SPBC649.06"
FT                   /locus_tag="SPBC354.01"
FT   CDS_pept        join(543421..543438,543484..543552,543668..543838,
FT                   543892..544725)
FT                   /transl_table=1
FT                   /gene="gtp1"
FT                   /gene_synonym="SPBC649.06"
FT                   /locus_tag="SPBC354.01"
FT                   /product="GTP binding protein Gtp1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.01.1"
FT                   /db_xref="GOA:P32235"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="PomBase:SPBC354.01"
FT                   /db_xref="PomBase:SPBC354.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32235"
FT                   /protein_id="CAA19048.3"
FT                   /translation="MGVLEKIQEIEAEMRRTQKNKATEYHLGLLKGKLAKLRAQLLEPT
FT                   SKSGPKGEGFDVLKSGDARVAFIGFPSVGKSTLLSAITKTKSATASYEFTTLTAIPGVL
FT                   EYDGAEIQMLDLPGIIEGASQGRGGRQAVSAARTADLILMVLDATKAADQREKIEYELE
FT                   QVGIRLNRQPPNVTLTIKKNGGIKFNHTVPLTHMDYKMAYNILHEYRIHNADILIREDI
FT                   TVDDFIDLVMGNRRYINCLYCYSKIDAVSLEEVDRLARLPKSVVISCNMKLNLDFLKER
FT                   IWEELNLYRIYTKRKGEMPDFSEALIVRKGSTIEQVCNRIHRTLAEQLKYALVWGTSAK
FT                   HSPQVVGLNHRVEEGDVVTIVTK"
FT   intron          543439..543483
FT                   /gene="gtp1"
FT                   /gene_synonym="SPBC649.06"
FT                   /locus_tag="SPBC354.01"
FT   intron          543553..543667
FT                   /gene="gtp1"
FT                   /gene_synonym="SPBC649.06"
FT                   /locus_tag="SPBC354.01"
FT   intron          543839..543891
FT                   /gene="gtp1"
FT                   /gene_synonym="SPBC649.06"
FT                   /locus_tag="SPBC354.01"
FT   3'UTR           544726..544836
FT                   /gene="gtp1"
FT                   /gene_synonym="SPBC649.06"
FT                   /locus_tag="SPBC354.01"
FT   3'UTR           complement(544751..545070)
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT   CDS_pept        complement(join(545071..546152,546331..546464,
FT                   546590..546622,546679..546791,546845..546912,
FT                   546957..546966))
FT                   /transl_table=1
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT                   /product="translocon alpha subunit Sec61"
FT                   /db_xref="GOA:P79088"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79088"
FT                   /protein_id="CAA17802.1"
FT                   /translation="MSDLRFLDLVKPFAPFLPEIAAPERKVPFKQKMLWTGVTLLIFLV
FT                   MSQVPLYGIVSSDSSDPLLWLRMILAANRGTLMELGISPIVTSSMLVQLLVGSQLIEVN
FT                   MELKSDREMYQLVQKFLAIIIAFGQATAYVLTGMYGRPQDLGAGICLLLILQLAAASLI
FT                   VLLLDELLQKGYGLGSGISLFIATINCENIFWKAFSPTTYHIANGVQFEGAVINFVYVM
FT                   FTWDNKAAALYQAFFRSGLTSSQIQLPNLWNFFATLLVFGVVIYLQDFRVEIPIRSQKF
FT                   RGYRSTFPVKLLYTSNTPIMLQSALTSNLFFASRLLFNRFSSNFLVRFLGVWEQTATSG
FT                   LSYYLSPPASFQDALIDPIHTLVYVFFTMFACALFSKLWIEVSGASPRDVAKQLKSQQL
FT                   VMAGHREGSMYKELKRIIPTAAWLSGAVVGALAVASDLLGALGSGTAVLLCTTTIYGYY
FT                   EQLQKEIKGDQYGLPVTPMMQ"
FT   intron          complement(546153..546330)
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT   intron          complement(546465..546589)
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT   intron          complement(546623..546678)
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT   intron          complement(546792..546844)
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT   intron          complement(546913..546956)
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT   5'UTR           complement(546967..547039)
FT                   /gene="sec61"
FT                   /locus_tag="SPBC354.02c"
FT   misc_RNA        complement(546996..548377)
FT                   /locus_tag="SPNCRNA.1369"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        547325..547761
FT                   /gene="prl66"
FT                   /locus_tag="SPNCRNA.66"
FT                   /product="non-coding RNA, poly(A)-bearing (predicted)"
FT   misc_RNA        547327..547670
FT                   /locus_tag="SPNCRNA.104"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           548382..548669
FT                   /gene="swd3"
FT                   /locus_tag="SPBC354.03"
FT   CDS_pept        548670..549812
FT                   /transl_table=1
FT                   /gene="swd3"
FT                   /locus_tag="SPBC354.03"
FT                   /product="WD repeat protein Swd3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.03.1"
FT                   /db_xref="GOA:O43017"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037866"
FT                   /db_xref="PomBase:SPBC354.03"
FT                   /db_xref="PomBase:SPBC354.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43017"
FT                   /protein_id="CAA17803.1"
FT                   /translation="MDSTAQQFPLNHDLQVQKDQKGVVEEDEEQIHKRIRNYESHSGFS
FT                   EYCTLFGHEKSVTCVSVSPNKRWIATSSSDGTIKIWSALTFRLECTLFGHYRGISQVKW
FT                   ATGSKYLASASDDKTIRIWDFEKRCSVRCLKGHTNYVSSIDFNPLGTLLVSGSWDETVR
FT                   IWNLQDGTCLRMLPAHSEPIISVSISADGTLCATASYDGMARIWDVLSGQCLKTLVEPI
FT                   NVPLSNLQFTENRKYLLVSNLNSQIRLWDYRRNRVVRIFDSHVNTRYSMSWDCYSSKNI
FT                   PKNTEALPNNDSSYPDDAESFMHDAYLLIPSEDGTIQITDPSTKIIIDDSIRHSDDPET
FT                   SLLNVTSLGPFIITSGTDPYVRVWAPSLLLSKHEKDGFSP"
FT   3'UTR           549813..550229
FT                   /gene="swd3"
FT                   /locus_tag="SPBC354.03"
FT   5'UTR           550165..550295
FT                   /locus_tag="SPBC354.04"
FT   CDS_pept        550296..550787
FT                   /transl_table=1
FT                   /locus_tag="SPBC354.04"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.04.1"
FT                   /db_xref="GOA:O43018"
FT                   /db_xref="PomBase:SPBC354.04"
FT                   /db_xref="PomBase:SPBC354.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43018"
FT                   /protein_id="CAA17804.1"
FT                   /translation="MSENPAHKDLDSLQVDEKAKSWIAEKVEEELRRLESVGAKAIPLD
FT                   VKNYSVMLDEDTDTVVNRIELMTSFDFDHVQQILLSAVQPYPYDKNLMFVYLVILTPLP
FT                   HPMLIPYLFAPKVVGKNLLPRADGLVENTLKRWTFINDKLKRSDTVVREFQEIEEEATK
FT                   "
FT   3'UTR           550788..551271
FT                   /locus_tag="SPBC354.04"
FT   3'UTR           complement(551130..551742)
FT                   /gene="sre2"
FT                   /locus_tag="SPBC354.05c"
FT   CDS_pept        complement(551743..554124)
FT                   /transl_table=1
FT                   /gene="sre2"
FT                   /locus_tag="SPBC354.05c"
FT                   /product="membrane-tethered transcription factor
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.05c.1"
FT                   /db_xref="GOA:O43019"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="PomBase:SPBC354.05c"
FT                   /db_xref="PomBase:SPBC354.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43019"
FT                   /protein_id="CAA17805.1"
FT                   /translation="MCPSQHSSLKDIHRQLENTAISNPTENADPSSYVDGSNIMDFKHP
FT                   SIVSSSASSSYPISHVPSVGTRGIPRSYSMASAYPYQVNSNSMDASTAFNLNQDVADKP
FT                   MLARNSIDSSINTELGPLESNHWFTQAQDHSRQYSSSWDPSIDPFEVKNSLHDSTDLSI
FT                   THHPHLPINHQGNTWKHANESLQSNQGPVPNTKFVGLETTQTDSYQQSSVNSVVKIEEA
FT                   DATYALREESGQFNTFTGAENPSISPHSLNPNFPQYTEKPALTLLQSPKQNSNYDTSNF
FT                   QNSVSDSSMQFTNEGMPSPVKGIMSSDDAVAFNFSQYSTVYPQNAPENGNEFETPNKLK
FT                   RTVSSPCASISSKRSYGDIAQDCSYISSKTNGGGPSDSPSSSSTSVRGSVNDSNSPISS
FT                   SATFAIQSNGVEPVGLSTQEQNLSPLSKRSAHNMIEKRYRSNLNDKIAELRDAVPTLRS
FT                   GYNSTTADELKGTYVPLSRKLNKATILSKATEYIKSLQSKNKKLIEENKILQKRLSEYT
FT                   SVIQASLTAPSQPASLSLLGPPGNTPGHRNVPPILKRSSIGTPSQQAYFPDAPHNCHSV
FT                   PQNSSYPRPPMQVNRSPIDSMQTIPHANFNEMHNAYSSRYPLKYSKSCNAVSHTSMMHP
FT                   QEYGGSLPSSTVPSDYNQPQLVSPRAQADQQGLSYKNVGRAVLNGLVGLETVHMLTNPD
FT                   DAGSSNRFSMSVLPISPSLHSILRFLLLLLAFLCFAMHILLTPEATLRKWASSIYLSFR
FT                   LECVFISFLIFSVPIYDWGNYLNLRGKLLSELNLESGVAT"
FT   5'UTR           complement(554125..555362)
FT                   /gene="sre2"
FT                   /locus_tag="SPBC354.05c"
FT   5'UTR           554749..555892
FT                   /gene="mrps16"
FT                   /locus_tag="SPBC354.06"
FT   CDS_pept        join(555893..555969,556399..556579,556846..556878)
FT                   /transl_table=1
FT                   /gene="mrps16"
FT                   /locus_tag="SPBC354.06"
FT                   /product="mitochondrial ribosomal protein subunit S16
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.06.1"
FT                   /db_xref="GOA:O43020"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="PomBase:SPBC354.06"
FT                   /db_xref="PomBase:SPBC354.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43020"
FT                   /protein_id="CAA17806.2"
FT                   /translation="MVVKIRLARHGVRNRPFYHIVVANAWKAPQAKPIETIGTFDPIPK
FT                   KIDSQDSIPRIKDIQLNVERFKYWISVGAQPSDTVRSLAEKFQLLPKKPVS"
FT   3'UTR           556879..557248
FT                   /gene="mrps16"
FT                   /locus_tag="SPBC354.06"
FT   3'UTR           complement(557827..558334)
FT                   /locus_tag="SPBC354.07c"
FT   CDS_pept        complement(join(558335..559225,559273..559474,
FT                   560003..560028,560151..560163,560231..560292))
FT                   /transl_table=1
FT                   /locus_tag="SPBC354.07c"
FT                   /product="oxysterol binding protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.07c.1"
FT                   /db_xref="GOA:O43021"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="PomBase:SPBC354.07c"
FT                   /db_xref="PomBase:SPBC354.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43021"
FT                   /protein_id="CAA17807.4"
FT                   /translation="MSETSEQMEETVQSGNEPISKSTWMGFIKNLATFTGDLSTLSAPS
FT                   FILSGTSLLEYMSYWFEFPELFVTIVDFPTPKERMLAVLKWYITGLSREYASRNKNYGT
FT                   EKKPLNPILGELFYGSWDSSKGKVELTAEQVSHHGPESAAHVVCKEAGITVDTHNKYRS
FT                   GFSGRTVYVNQLGQLRVHLEKYNETYYITLPNISLEGLWFMAPYIELYGSTYIVSNTNY
FT                   ITKIDYSGRGYFRGTKNSFKATIFEKNEDPDYIVEGVWTGESKLTIPSLKSTIFFLSIP
FT                   SLEATPITVKPESEMGDWESRNVWKEVSAALASGNYDIVSSKKSTIEQSQRDMRKKEEA
FT                   EGAVWARRYFKWEEHDSDARNALAQAVLEVIEPGFWIYIGDTHPSLPAGEQPVKRME"
FT   intron          complement(560164..560230)
FT                   /locus_tag="SPBC354.07c"
FT   5'UTR           complement(560293..560416)
FT                   /locus_tag="SPBC354.07c"
FT   misc_RNA        560462..561113
FT                   /locus_tag="SPNCRNA.1370"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        561072..562378
FT                   /locus_tag="SPNCRNA.1371"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(561122..561503)
FT                   /locus_tag="SPBC354.08c"
FT   CDS_pept        complement(join(561504..563928,563965..564137))
FT                   /transl_table=1
FT                   /locus_tag="SPBC354.08c"
FT                   /product="DUF221 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.08c.1"
FT                   /db_xref="GOA:O43022"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR027815"
FT                   /db_xref="InterPro:IPR032880"
FT                   /db_xref="PomBase:SPBC354.08c"
FT                   /db_xref="PomBase:SPBC354.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43022"
FT                   /protein_id="CAA17808.1"
FT                   /translation="MVIEKRESFIEVVINSLLNDNPAQAKFDKYSILVSLGFSSLLSVI
FT                   LLCIFTLLRTKFNTYDRCIPPMKKSLWGWIEPLWSIKVEDCLYNMGADAVISLLFSRFC
FT                   RDVFLILAAICCTILIPINIVATNKTLANSDSQNAYAKLSIQNVTGNWTWAHVVICYVF
FT                   NVLVLFLLARYYQIVMRIRQRYYRSPTYQQSMSSRSLLIMDIPTTMRSNNGLSILASRL
FT                   KSSEAPMHVHICHAIKNLPKILKKHDNAVRSLEAVLAKFFKNPKKLPDDRPVRRVKQGL
FT                   LTSEKVDAIDYYSAKIENYGLRVDAARESLYENEFEHYGFITYKSSYIAHDTARHNSRV
FT                   AGASVSMAPEPSDFLWDNLSLAWSTRLFNRMIGNILFIILIIAWIIETALVAIFISNLY
FT                   HLGSVWPWLQQQLTSRSGFWSIVQGILSPAVAGFTFMILEIIMRRISYWQGSFTKSSRE
FT                   RGVLNKLHIIFTLDNFIIYTLMAVFWRLGVIIAYKTKEEGNFAEGMSAFATFDTVGLSV
FT                   SSFVQFSTFWIMFIAHSTCSFFVEIAQPITLTIRLIKTKFFSPTPRDLLEWTAPTKYVY
FT                   SQVLNKLIYFFTIAICYACINPLVLLFASVLFCVNYLTQKYILMYVSNSSTESGGGYWR
FT                   PVVNRILLGLELANIILFLCLWVQGGRVRAYCIIPNFSFAIAFKIWCMFALDPKSHYMI
FT                   EDPYMKVVEPLENEISESEMCFGHPSTYAPLLVPMVRSDARALLPLFYSGRTETHNKFD
FT                   FATDSDDASEKHLRGEEEPLENVDFVDIDNVDTAKEVHDQQQVQQLKKNLSRSYTRSRG
FT                   VSLRARLNEEELPLTESITQDSQISIPETLESQSTEITPINVSEHYDKYYHIF"
FT   5'UTR           complement(564138..564808)
FT                   /locus_tag="SPBC354.08c"
FT   3'UTR           complement(565094..565309)
FT                   /locus_tag="SPBC354.09c"
FT   CDS_pept        complement(565310..567694)
FT                   /transl_table=1
FT                   /locus_tag="SPBC354.09c"
FT                   /product="Tre1 family protein, involved in vacuolar protein
FT                   degradation (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.09c.1"
FT                   /db_xref="GOA:O43023"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="PomBase:SPBC354.09c"
FT                   /db_xref="PomBase:SPBC354.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43023"
FT                   /protein_id="CAA17809.1"
FT                   /translation="MTDEKHVYVPPPKDPPSYEEVALHSALNNSAPPNDGEQNETSMEE
FT                   MEIIEPPSEDSSRFPLLRTKLAAIHEGWESACHSFEIRFASTFHRIPFQFLYLAVIATV
FT                   IILASYYGYFDGVPAWRSVHHYGEDVLLNYIKGCDISDTRQQVMTLSSIPHLAGTVGDS
FT                   SLLQMIMNRLYYEKGTIVDFREFYAYLNFPQLVSLSIDGDDSFHPSLIESYQVGGYDGV
FT                   SIPTPATFGGSPSGFVNAPLVYANRGRIEDFEWLVNSGIYVESSIVLVRANQSDFALAT
FT                   ANAEKYNASAILIFEDTYLTSLDNLNQVYPAGPYPSANSLYRGSVANHYYYVGDPLTPG
FT                   WSAHEETNRISPKDANVLPSIVSIPITFNDGIELLKRLQGHGHLVKDSNWCQDLAPVLS
FT                   EVWTGSKISSPGLEVNVLQDIEDKQKIINIMAQIDGYESDQILVVGAPRDSWCTGASDS
FT                   SVGTSLLIDVISTFANMAQDLSWKPRRTIVFASWDARQFNAIGSTEFLEYWKESLEAKA
FT                   VAYINVDVAVSGDTFTARTVPGLKKVIQRAFDVANEEDEMKAANIITDDFDYTSDLTSF
FT                   LTFAGIPVVNLAFERNEENPTPMPFLGSCEDTVSWIDTFGSEYWENAARLGKIWSYLIL
FT                   FLANDPVVPYDLEDEINGVGEMLKRIPEIPGANALDLRKINEEFSELLESLIRFEDEIR
FT                   EWKSLMMHNSYTVSVKKHPELEGYNAKLARFERSFLDEAGLPGHEWYKHLIYGPNLRNS
FT                   HSQLFPSIFDALLYGDVEAAQKEVKRIALALDRAHNEIRFA"
FT   5'UTR           complement(567695..568419)
FT                   /locus_tag="SPBC354.09c"
FT   rRNA            569121..569305
FT                   /locus_tag="SPRRNA.30"
FT                   /product="5S rRNA"
FT   tRNA            570156..570226
FT                   /locus_tag="SPBTRNAGLY.06"
FT                   /product="tRNA Lysine"
FT   5'UTR           570905..571060
FT                   /gene="def1"
FT                   /locus_tag="SPBC354.10"
FT   CDS_pept        571061..573952
FT                   /transl_table=1
FT                   /gene="def1"
FT                   /locus_tag="SPBC354.10"
FT                   /product="RNAPII degradation factor Def1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.10.1"
FT                   /db_xref="GOA:O43024"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR041803"
FT                   /db_xref="PomBase:SPBC354.10"
FT                   /db_xref="PomBase:SPBC354.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43024"
FT                   /protein_id="CAA17810.1"
FT                   /translation="MSENKKFRPKKVGNTEQVSEKQHTDTALNISQDNKTSSSSAKRGA
FT                   KGRRGTKGKSGPANSSQTSNIEGSNALELEFDRDSQLSVLQELFPSWTIDDLSFALEEA
FT                   DRDLELTILHITEGHASKWGEVKKKPIPKTKSKPTSHAPVSDNVSSTFRNATRKSKKPS
FT                   ASKDTSRGVRKSKAGAPSDPSSVHAPSSLEKPAGTGDLPSSEISTKAPASTTVSSSVDP
FT                   GTINEDSSMKDHTTSNEQASVLTSANTAASTNTNGTAGGTSASAKSTSAADQAVASSKP
FT                   IKKAWASVAKSKKKVTPAPAPAPESEPSKPSIAPSQPSKTNVSAAYEKPAELSSSSVPF
FT                   PHKSQDSATPANVETTPSTATSAPKKSTAPFAINAVKPAPGLSNISSASLPKPSFAKQA
FT                   AVGSQSSTTSMTTARLLSDRFPVVMPVANTAAIPEKVQVRFGSLTLGGEDKKSTKSSSD
FT                   NIAQSGPRSSYFPKKTVSPKPEAKKEASKVAESTKIPKKQHTSAYESRAPQSKVPENLK
FT                   ESHVNETPYRGLHDVNLPASGNASSVSAIPPQVSAQTTIPAASTSATSGPVVGKQSAGY
FT                   GGIYSPATHGISPQPYAGASLIPPSTGAAFNNETASSNAGETTALPYSSRFMNPVENRS
FT                   ANSPFDNFQHIDHSTELGYASNTSQQYQQTSHPAYTTMSPIEYGQAAPAAHYYNERNQY
FT                   SQYDNVAGSASNTPDVHSVMHNKVASSNATSLPAAGTATPSPVVSQQQPQPYAFPPMYP
FT                   IPYVSYGYGTMPYNNNKFGQPQQGYMSQSGFNDFPPIFGGHSNVYNRQQPGNVSGMSGT
FT                   QTSNPINNATANTSGMTEKAAGHRDSVIGNGGVTGANSMSSTLGGLSSMSGMGRAAPGM
FT                   FMGNVGSFENLSANAASPYGLPPQQTPLTNAATQQTTSFQSNANKVNNANSQPAGFPFN
FT                   SGASTNAGSNGLGGYNAYNQSFINRPGGWYGNA"
FT   3'UTR           573953..574320
FT                   /gene="def1"
FT                   /locus_tag="SPBC354.10"
FT   misc_RNA        574632..575459
FT                   /gene_synonym="SPNG1231-32"
FT                   /locus_tag="SPNCRNA.312"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(574658..575772)
FT                   /locus_tag="SPBC354.11c"
FT   CDS_pept        complement(575773..576291)
FT                   /transl_table=1
FT                   /locus_tag="SPBC354.11c"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.11c.1"
FT                   /db_xref="GOA:O43025"
FT                   /db_xref="PomBase:SPBC354.11c"
FT                   /db_xref="PomBase:SPBC354.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43025"
FT                   /protein_id="CAA17811.1"
FT                   /translation="MGSSSLANLPILLAIHPALHYATYRVSPSSLHIRLSSWRSRKQTG
FT                   CLIKGIPLFLFFFFFESFLLPLSFAHLIKQRKLIFNKAIDFKLNSLCCSFTCYPSILFA
FT                   SSLPIQFIALPPTVFLLFFKFYSRLFFFRIIPSHILYNSFRIVLFLSHASPAILHTIFT
FT                   FTLSIPNLP"
FT   5'UTR           complement(576292..578723)
FT                   /locus_tag="SPBC354.11c"
FT   misc_RNA        576376..576873
FT                   /gene_synonym="SPNG1233"
FT                   /locus_tag="SPNCRNA.313"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           join(578063..578181,578725..578730)
FT                   /gene="gpd3"
FT                   /locus_tag="SPBC354.12"
FT   CDS_pept        578731..579738
FT                   /transl_table=1
FT                   /gene="gpd3"
FT                   /locus_tag="SPBC354.12"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase Gpd3"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.12.1"
FT                   /db_xref="GOA:O43026"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC354.12"
FT                   /db_xref="PomBase:SPBC354.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43026"
FT                   /protein_id="CAA17812.1"
FT                   /translation="MAIPKVGINGFGRIGRIVLRNAILTGKIQVVAVNDPFIDLDYMAY
FT                   MFKYDSTHGRFEGSVETKGGKLVIDGHSIDVHNERDPANIKWSASGAEYVIESTGVFTT
FT                   KETASAHLKGGAKRVIISAPSKDAPMFVVGVNLEKFNPSEKVISNASCTTNCLAPLAKV
FT                   INDTFGIEEGLMTTVHATTATQKTVDGPSKKDWRGGRGASANIIPSSTGAAKAVGKVIP
FT                   ALNGKLTGMAFRVPTPDVSVVDLTVKLAKPTNYEDIKAAIKAASEGPMKGVLGYTEDSV
FT                   VSTDFCGDNHSSIFDASAGIQLSPQFVKLVSWYDNEWGYSHRVVDLVAYTASKD"
FT   3'UTR           579739..580056
FT                   /gene="gpd3"
FT                   /locus_tag="SPBC354.12"
FT   misc_RNA        580157..581149
FT                   /gene_synonym="SPNG1237-42"
FT                   /locus_tag="SPNCRNA.315"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           581098..581246
FT                   /gene="rga6"
FT                   /locus_tag="SPBC354.13"
FT   CDS_pept        581247..583448
FT                   /transl_table=1
FT                   /gene="rga6"
FT                   /locus_tag="SPBC354.13"
FT                   /product="Rho-type GTPase activating protein Rga6
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.13.1"
FT                   /db_xref="GOA:O43027"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="PomBase:SPBC354.13"
FT                   /db_xref="PomBase:SPBC354.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43027"
FT                   /protein_id="CAA17813.1"
FT                   /translation="MTLNPSTLNNGTLGDLKEHKDVVLSSNAQTDEKRFEEPSLEVGGS
FT                   LAKVENGLSTSISSSASNLEGQQAPFFTKQNSCLSRFRELAQTYNIHEINLEEYVSQIK
FT                   EVKQSLYSDDSVFNESKSSSPPDAHTDKYFTPCGSPTKLIHSTLLEERDTPSSLEHVSF
FT                   YLQESAVSEVRFDKPSNNGPLGRSSLNLSSLSHELQTSQDSPSLSATNQLSSSDTLEPL
FT                   QYPPSSFGSQRQFNASQDSPKRSPSKGSWSSILRRPSLTYSPKRQSTGLHRRSLTNYFK
FT                   FPHRNAHQHNAIAHNPSVFGKPIGDLTSDPTNLCKFTFPTPECAPPSLLLPHIFAQCVH
FT                   FLSLNALHVPGIFRISGSGPVIKAITEYFYSPPHFWLDETSEIFKRIGFPSYIDIAAVL
FT                   KRYIMLLPGGLFTHKDILNLLVPLYVDSSRVKVPIDIRNEMAALCFSQIDSYVRFSILC
FT                   SLLALLHQIATRTQELENGMENTKDSTLMKPEALGIIFGPLLLGNSSTDLSKSCPSGNV
FT                   NDLMRFETEKARVEAKIVEGLIIHWPEVLLKINSLDIPNCFSDVGLTDQVAIFTPAVPK
FT                   EDSPEQIPENVNASEESYPNVKHISKLPLINDSSDNESGNQENDDAVANESTKVVVDNQ
FT                   QPQPKISTVSDTAVPSMSFANNISSRSVISAATDSKPSTRTSPPFVNNTKPIVAKSPVT
FT                   VTASSETNKKSQKINKKASPRVSLWTKLFGKFRSNKKKS"
FT   3'UTR           583449..583861
FT                   /gene="rga6"
FT                   /locus_tag="SPBC354.13"
FT   3'UTR           complement(583608..583793)
FT                   /gene="vac8"
FT                   /locus_tag="SPBC354.14c"
FT   CDS_pept        complement(join(583794..583960,584042..584935,
FT                   585052..585411,585571..585691,585754..585836,
FT                   585882..585909))
FT                   /transl_table=1
FT                   /gene="vac8"
FT                   /locus_tag="SPBC354.14c"
FT                   /product="vacuolar protein Vac8 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.14c.1"
FT                   /db_xref="GOA:O43028"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PomBase:SPBC354.14c"
FT                   /db_xref="PomBase:SPBC354.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43028"
FT                   /protein_id="CAA17814.2"
FT                   /translation="MGNCLSCCEKSKDEQYEPLLADREREAVADLLSFLEDRNEVNFYS
FT                   EEPLRALTILAYSDNLDLQRSAALAFAEITEKDVREVDRETIEPVLFLLQSPDAEIQRA
FT                   ASVALGNLAVNAENKALVVKLNGLDLLIRQMMSPHVEVQCNAVGCITNLATLDENKSKI
FT                   AHSGALGPLTRLAKSKDIRVQRNATGALLNMTHSYENRQQLVSAGTIPVLVSLLPSSDT
FT                   DVQYYCTTSISNIAVDAVHRKRLAQSEPKLVRSLIQLMDTSSPKVQCQAALALRNLASD
FT                   ERYQIEIVQSNALPSLLRLLRSSYLPLILASVACIRNISIHPLNESPIIDAGFLRPLVD
FT                   LLSCTENEEIQCHAVSTLRNLAASSERNKRAIIEANAIQKLRCLILDAPVSVQSEMTAC
FT                   LAVLALSDEFKSYLLNFGICNVLIPLTDSMSIEVQGNSAAALGNLSSNVDDYSRFIECW
FT                   DSPAGGIHGYLVRFLSSEDSTFAHIAAWTIVQLLEAGVPRLTAFIQSSDDIIELLNDIV
FT                   ARDANNGEYEDGEGDVILLSGRALHLIEQDTDS"
FT   intron          complement(583961..584041)
FT                   /gene="vac8"
FT                   /locus_tag="SPBC354.14c"
FT   5'UTR           complement(585910..586015)
FT                   /gene="vac8"
FT                   /locus_tag="SPBC354.14c"
FT   5'UTR           586279..586542
FT                   /gene="fap1"
FT                   /locus_tag="SPBC354.15"
FT   CDS_pept        586543..587781
FT                   /transl_table=1
FT                   /gene="fap1"
FT                   /locus_tag="SPBC354.15"
FT                   /product="L-pipecolate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC354.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC354.15.1"
FT                   /db_xref="GOA:O43029"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PomBase:SPBC354.15"
FT                   /db_xref="PomBase:SPBC354.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43029"
FT                   /protein_id="CAA17815.1"
FT                   /translation="MVKNTSVIIVGAGVFGLSAALELTKRGGYTIKILDRAPPPVIDGS
FT                   SVDANRIIRSDYADAVYCSMGIDALEEWRTNPLFKEQFYGSGLMFVGRDNVEYRDMSLE
FT                   NLTKMGVSAAKFQTTEELRKLFPKWIGELNDGEAGYANFSSGWANAEQSVKSVVNYLAH
FT                   AGVSFISGPEGTVEELITEENVVKGVRTTTGAYMAEKLIFATGAWTASLLPNDHTRFLA
FT                   TGQPVAYIKLTPEEYIRFLTNPVYLDFDTGFYIFPPTPDGYLKFARHGYGFTRMQNLKS
FT                   GKVESVPPKKPLVSPILPKEAELDLRRNLQRTYGEEISQRPFYKTRICYYTDTADAEFV
FT                   FDYHPDYENLFVCTGGSGHGFKFFPILGKYSIGCMFRELEEPLLKKWRWKKENLEFAAL
FT                   DHSRAGPSRQELS"
FT   3'UTR           587782..588261
FT                   /gene="fap1"
FT                   /locus_tag="SPBC354.15"
FT   5'UTR           588338..588728
FT                   /gene="tea4"
FT                   /gene_synonym="wsh3"
FT                   /locus_tag="SPBC1706.01"
FT   CDS_pept        588729..591194
FT                   /transl_table=1
FT                   /gene="tea4"
FT                   /gene_synonym="wsh3"
FT                   /locus_tag="SPBC1706.01"
FT                   /product="tip elongation aberrant protein Tea4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1706.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1706.01.1"
FT                   /db_xref="GOA:O60132"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="PomBase:SPBC1706.01"
FT                   /db_xref="PomBase:SPBC1706.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60132"
FT                   /protein_id="CAA19002.2"
FT                   /translation="MLHMNSASSADSMEIMESHFDPTQQNDSTIIESRYSPEEYLEQSF
FT                   EIQRIISGENSEPQTVASQEISDSQEEDTTLTSSQFEDCGTEYNEVVEDDEFRSEDEDD
FT                   FMDEEEEYALYEAELSSSPSIHEEVIDCNFVHAIRGFEATVEGQVDATKGDMMILLDDS
FT                   NSYWWLVKMCKNLAIGYLPAEYIETPSERLARLNKYKNSETSNSQQSVTLPPLDIVEKT
FT                   LEAPSPNFRIKRVTFTCSSNSSDDEMDSENDYEAMVNRTVAENGLEIEFSDSSDSSLSA
FT                   EYRSESEDHVTDSPAYVDLTELEGGFNQFNSTSFQSTSPLGLEIVETEINGSSTTADSK
FT                   NSHSPYSKFSSAYPDAENSNISKINISIAGNKELYGNATQSDPSLYSTWIANKHKTASS
FT                   ATVDSPLRRSLSVDAMQSNASFSSYSSTSNTDKSLRPSSYSAVSESSNFTHDVSRDNKE
FT                   ISLNAPKSIIVSQSDSFDTSNVTQDAPNDVEKEPISGQMPNNLSVQSLKQLEVYPIRHS
FT                   VSIEMPSEKLLSPRLYSSSTPSSPTKGFQKDDEEDSENRKQADKVELSPSSLLRQMSLP
FT                   VDSSSQSDAQCTTSSVYITAERKAFSQSSIDLSTLSNHHVNNEINRRSFAGGFTSLADE
FT                   LSEMRELLHESPAPLECNEEMVIPTPELDASSAIPSSSISHDEDLLPRKNTEESTSSSS
FT                   FSSLITSPASLQYDENPFKQSVVAELNNNSSSVPFVDSAHASDIHAYDNDHVSTKNKEF
FT                   NRRLREFILDPDSLSGLYWSVKSAGVRASRRVSRNIEGESVSSDLDDIFANVLKGLSDE
FT                   MASLLNTNR"
FT   3'UTR           591195..591434
FT                   /gene="tea4"
FT                   /gene_synonym="wsh3"
FT                   /locus_tag="SPBC1706.01"
FT   misc_RNA        591646..592613
FT                   /gene_synonym="SPNG1243"
FT                   /locus_tag="SPNCRNA.316"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        complement(591798..592612)
FT                   /locus_tag="SPNCRNA.1372"
FT                   /product="intergenic RNA (predicted)"
FT   repeat_region   complement(592650..594176)
FT                   /locus_tag="wtf2"
FT   CDS_pept        complement(join(593188..593261,593311..593368,
FT                   593437..593575))
FT                   /pseudo
FT                   /transl_table=1
FT                   /gene="wtf2"
FT                   /gene_synonym="SPBC1706.02"
FT                   /locus_tag="SPBC1706.02c"
FT                   /product="pseudogene wtf element Wtf2"
FT   repeat_region   complement(593824..594176)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           594151..594471
FT                   /gene="fzo1"
FT                   /gene_synonym="SPBC839.01"
FT                   /locus_tag="SPBC1706.03"
FT   CDS_pept        594472..596748
FT                   /transl_table=1
FT                   /gene="fzo1"
FT                   /gene_synonym="SPBC839.01"
FT                   /locus_tag="SPBC1706.03"
FT                   /product="mitochondrial dynamin family fusion GTPase
FT                   protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1706.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1706.03.1"
FT                   /db_xref="GOA:Q9USY7"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="PomBase:SPBC1706.03"
FT                   /db_xref="PomBase:SPBC1706.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USY7"
FT                   /protein_id="CAA19004.1"
FT                   /translation="MEKSARQLSVAEQNGESGRLNNGYTSNNIQQYKDETNRHQFEYNQ
FT                   NRNQLLRSIHIIQNLLNELDNYVDRSDCLFHSVWRTDKEKSKFSGNYYPFSPSKMNVIT
FT                   IDLSLRSSSTADEKLISQLGEEAHESLLKVHIEKANKHLFSLFSRVEDTSSKILITGDL
FT                   NAGKSTLCNALVHKDILPEDQQPCTEVFCEVHDAELNDGKDCVHAIPHGLTYSHTDSST
FT                   YKVFPIEDLKRLVYETENWSMLIVYVNDGRPAHESLLHNGITDIALIDAPGLNTDSMKT
FT                   TSVFACQEEIDVVVFVVNAENHFTLSATDFLRNASTEKSHIFIIVNKFDNIRDKERCKR
FT                   LILEQIHTLSPGTFADAKDLVHFVSCRVARDPNNREDALYSSFFQMENSLRSFILENRS
FT                   KSKLAPVRRYLSGLVGDILNICEYNIKLIDFDINHLQQRLTDLSPKFRKVKHEQQFTYQ
FT                   KNESLVEATVQSISQHTHSELEDAIDSLGSFASVKYSGFFFAYQYAISVRDAMQQYLEE
FT                   KLLESEDYARKRTEEAVLCIQKDVKDNFDSAVLPVFHANQMFIKKHRLQLQKHFRFELG
FT                   LLDFIDLDLTERLGTWSASLSTILLVLGKTTPSFTTLGAFTGNLGYPIFKYFQNNSLQH
FT                   LLVPVLGLASICVFGYVIYDIPRALPLKVAEKIKKSLRETDFCHNASIWIGTESRKVLN
FT                   IPLNDLRRMFHQQWDKQRETISVAENDLRICQKARKFFGEIESRTREAKKKIMMVQLEG
FT                   CDINY"
FT   3'UTR           596749..597186
FT                   /gene="fzo1"
FT                   /gene_synonym="SPBC839.01"
FT                   /locus_tag="SPBC1706.03"
FT   5'UTR           597310..597610
FT                   /locus_tag="SPBC839.02"
FT   CDS_pept        join(597611..599124,599256..599334)
FT                   /transl_table=1
FT                   /locus_tag="SPBC839.02"
FT                   /product="arrestin Aly1 related, implicated in endocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.02.1"
FT                   /db_xref="GOA:Q8WZK5"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="PomBase:SPBC839.02"
FT                   /db_xref="PomBase:SPBC839.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZK5"
FT                   /protein_id="CAB46695.1"
FT                   /translation="MYIPNLRNYHDKVFPYGPSSNGYNPVIRLTDRTTQPDPSQHIYQE
FT                   EKISKCEGLSYRAREWLLLSSNSNARVAIALAEPVLYLPGATSSEIQSEHSAVLRGSLC
FT                   IQIYKPVKLKKIQLSFKGKSRTEWPEGIPPKLFDTYEENSIMNHCWVFFHSEQKVDENS
FT                   HGAVWYKVLPHYADTAHYPRSMECFYPGEYVYNFELPISCTYPESIQTDMGRVYYFLET
FT                   LVDRSSTFSGKSTGRIPIELIRSPCSTSVATSEPILVSKSWEDRLHYEVQVGEKCVVMG
FT                   QVVPVNFKFTLLGEVKFHKLRLFLMERRYYYCRQRSVRRKEKTRQLLLYERSAPKNQCL
FT                   LSDWKQVRPDVYELSDQVRIPGCHDMAANIVHFDTTYPNIKITHTVRTVLRFSCENSPE
FT                   LMGSAKYLEIYIDSPVRLLSCRCSDGSTMLPAYCPIIPSSEVNFCSIDNRIIAGMNRDL
FT                   ALDSDIIGNSPPSFDSWTAVPYQAPPPKYDDIFQSGSSHDENHDDNYFINIFIIFLIIK
FT                   HMCLITKMFLGLN"
FT   3'UTR           complement(599279..599427)
FT                   /locus_tag="SPBC839.03c"
FT   misc_RNA        599413..600456
FT                   /locus_tag="SPNCRNA.1373"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        complement(599428..600183)
FT                   /transl_table=1
FT                   /locus_tag="SPBC839.03c"
FT                   /product="neddylation protein Dcn1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.03c.1"
FT                   /db_xref="GOA:Q8WZK4"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="PomBase:SPBC839.03c"
FT                   /db_xref="PomBase:SPBC839.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZK4"
FT                   /protein_id="CAB46696.1"
FT                   /translation="MKPDTVSLTRAFSKATSTSSKAALSWLKKYNFDYDVAYTKWIQQK
FT                   SREEAEKQLNNVFSQFSSKEDKDLIELDGSVQLFTALDISLEDPETLLVSYFLKSPRMG
FT                   EFHRESFVEGALNLSTTSLDQLKLAIKEKVQVWRSDASLQKAIYIYTYPLACDKGKKTL
FT                   STSIAIEFFQILLKDTFPLLDDWIAFLKVSPIIEKSLPKDTWNELWDFSVFVKSDPNCS
FT                   NYDFEGAWPTLIDEFVSYYREHGYKNSSS"
FT   5'UTR           complement(join(600184..600529,600606..600645))
FT                   /locus_tag="SPBC839.03c"
FT   regulatory      601181..601190
FT                   /regulatory_class="promoter"
FT   5'UTR           601209..601280
FT                   /gene="rpl803"
FT                   /gene_synonym="rpl8-3"
FT                   /gene_synonym="rpk5-b"
FT                   /gene_synonym="rpkD4"
FT                   /locus_tag="SPBC839.04"
FT   CDS_pept        601281..602042
FT                   /transl_table=1
FT                   /gene="rpl803"
FT                   /gene_synonym="rpl8-3"
FT                   /gene_synonym="rpk5-b"
FT                   /gene_synonym="rpkD4"
FT                   /locus_tag="SPBC839.04"
FT                   /product="60S ribosomal protein L8 (predicted)"
FT                   /db_xref="GOA:P0CT72"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT72"
FT                   /protein_id="CAB46697.1"
FT                   /translation="MGRVIRAQRKSGGIFQAHTRLRKGAAQLRTLDFAERHGYIRGVVQ
FT                   KIIHDPGRGAPLAKVAFRNPYHYRTDVETFVATEGMYTGQFVYCGKNAALTVGNVLPVG
FT                   EMPEGTIISNVEEKAGDRGALGRSSGNYVIIVGHDVDTGKTRVKLPSGAKKVVPSSARG
FT                   VVGIVAGGGRIDKPLLKAGRAFHKYRVKRNCWPRTRGVAMNPVDHPHGGGNHQHVGHST
FT                   TVPRQSAPGQKVGLIAARRTGLLRGAAAVEN"
FT   3'UTR           602043..602186
FT                   /gene="rpl803"
FT                   /gene_synonym="rpl8-3"
FT                   /gene_synonym="rpk5-b"
FT                   /gene_synonym="rpkD4"
FT                   /locus_tag="SPBC839.04"
FT   tRNA            complement(602625..602699)
FT                   /locus_tag="SPBTRNALYS.06"
FT                   /product="tRNA Lysine"
FT   misc_RNA        602940..603531
FT                   /gene_synonym="SPNG1246"
FT                   /locus_tag="SPNCRNA.317"
FT                   /product="non-coding RNA (predicted)"
FT   CDS_pept        603314..603556
FT                   /transl_table=1
FT                   /gene="new14"
FT                   /locus_tag="SPBC839.20"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.20"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.20.1"
FT                   /db_xref="PomBase:SPBC839.20"
FT                   /db_xref="PomBase:SPBC839.20.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS1"
FT                   /protein_id="CCD31352.1"
FT                   /translation="MQKKEKIIENLEKAGNTFHLIIKCNTIARILKNLSTYAILLNSNI
FT                   LEEHVDLLLIYLSTQRMWKLNNLKKTLQYKGSKKK"
FT   3'UTR           complement(603508..603703)
FT                   /gene="rps1701"
FT                   /gene_synonym="rps17-1"
FT                   /locus_tag="SPBC839.05c"
FT   CDS_pept        complement(join(603704..604096,604375..604377))
FT                   /transl_table=1
FT                   /gene="rps1701"
FT                   /gene_synonym="rps17-1"
FT                   /locus_tag="SPBC839.05c"
FT                   /product="40S ribosomal protein S17 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.05c.1"
FT                   /db_xref="GOA:O42984"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="PomBase:SPBC839.05c"
FT                   /db_xref="PomBase:SPBC839.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42984"
FT                   /protein_id="CAB46698.1"
FT                   /translation="MGRVRTKTTKRASRVVIEKYYPRLTLDFQTNKRIVDEVAIIASKR
FT                   LRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSELEVDRVNVDQDTKD
FT                   MLKSLGYDQIPVRVLAPAPQERFRRRQ"
FT   5'UTR           complement(604378..604436)
FT                   /gene="rps1701"
FT                   /gene_synonym="rps17-1"
FT                   /locus_tag="SPBC839.05c"
FT   CDS_pept        complement(join(604418..604577,604733..604920))
FT                   /transl_table=1
FT                   /gene="new20"
FT                   /locus_tag="SPBC839.19"
FT                   /product="conserved eukaryotic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.19"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.19.1"
FT                   /db_xref="GOA:G2TRS2"
FT                   /db_xref="InterPro:IPR029704"
FT                   /db_xref="PomBase:SPBC839.19"
FT                   /db_xref="PomBase:SPBC839.19.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS2"
FT                   /protein_id="CCD31353.1"
FT                   /translation="MSNQGKDSFKAYSYFCPCGQLFLTIHVSLTRLPQRQLDKRHVVDE
FT                   KLNHIAHFSTGNKYYITRSDGGYEQRIQLLCRRCTLECAYALEAAPGYIYVDPTLVNEK
FT                   PVTVSVSNLKE"
FT   regulatory      complement(604445..604452)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(604467..604476)
FT                   /regulatory_class="promoter"
FT   intron          complement(604578..604732)
FT                   /gene="new20"
FT                   /locus_tag="SPBC839.19"
FT   misc_RNA        605716..606557
FT                   /gene_synonym="SPNG1248"
FT                   /locus_tag="SPNCRNA.318"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        606728..607395
FT                   /gene_synonym="SPNG1249"
FT                   /locus_tag="SPNCRNA.319"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           607214..608170
FT                   /gene="cta3"
FT                   /locus_tag="SPBC839.06"
FT   misc_RNA        complement(608000..611638)
FT                   /locus_tag="SPNCRNA.1374"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        608171..611284
FT                   /transl_table=1
FT                   /gene="cta3"
FT                   /locus_tag="SPBC839.06"
FT                   /product="P-type ATPase, calcium transporting Cta3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.06.1"
FT                   /db_xref="GOA:P22189"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PomBase:SPBC839.06"
FT                   /db_xref="PomBase:SPBC839.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22189"
FT                   /protein_id="CAB46699.1"
FT                   /translation="MVTINISNPVYFSDIKDVESEFLTSIPNGLTHEEAQNRLSEYGEN
FT                   RLEADSGVSAWKVLLRQVLNAMCVVLILAAALSFGTTDWIEGGVISAIIVLNITVGFIQ
FT                   EYKAEKTMDSLRTLASPMAHVTRSSKTDAIDSHLLVPGDVVVLKTGDVVPADLRLVETV
FT                   NFETDEALLTGESLPVIKDAHATFQMNEDVPIGDRINLAYSSSIVTKGRAKGICYATGM
FT                   QTQIGAIAAGLRQKGKLFQRPEKDEPNYRRKLNKYYLKVTSYYVQRVLGLNVGTPLQRK
FT                   LTVLAYILFCIAIILAIIVMAAHSFHVTNEVSIYAISLGISIIPESLIAVLSITMAMGQ
FT                   KNMSKRRVIVRKLEALEALGGVTDICSDKTGTITQGKMITRRVWIPSYGYLSVDTSDAN
FT                   NPTIGTVSGLEAAMQDVLKEKKQEMKNIDPSNQPSDQFIPLLKTCALCNLSTVNQTETG
FT                   EWVVKGEPTEIALHVFSKRFNYGKEDLLKTNTFVREYPFDSEIKRMAVIYEDQQGQYTV
FT                   YAKGAVERILERCSTSNGSTLEEPDRELIIAQMETLAAEGLRVLALATKVIDKADNWET
FT                   LPRDVAESSLEFVSLVGIYDPPRTESKGAVELCHRAGIRVHMLTGDHPETAKAIAREVG
FT                   IIPPFISDRDPNMSWMVMTGSQFDALSDEEVDSLKALCLVIARCAPQTKVKMIEALHRR
FT                   KAFVAMTGDGVNDSPSLKQANVGIAMGQNGSDVAKDASDIVLTDDNFSSIVNAIEEGRR
FT                   MFDNIMRFVLHLLVSNVGEVILLVVGLAFRDEVHLSVFPMSPVEILWCNMITSSFPSMG
FT                   LGMELAQPDVMERLPHDNKVGIFQKSLIVDMMVYGFFLGVVSLMTWVVIMYGFGTGNLS
FT                   YDCNAHYHAGCNDVFKARSAVFAVVTFCILIMAVEVKNFDNSLFNLHGIPWGEWNFRYF
FT                   LHTLVENKFLAWAIALAAVSVFPTIYIPVINRDVFKHTYIGWEWGVVAVAVMFYFFYVE
FT                   IWKSIRRSLTNPQKKGKFRRTLSNTITTESKLSEKDLEHRLFLQSRRA"
FT   3'UTR           611285..611989
FT                   /gene="cta3"
FT                   /locus_tag="SPBC839.06"
FT   5'UTR           612456..612669
FT                   /gene="ibp1"
FT                   /locus_tag="SPBC839.07"
FT   CDS_pept        612670..613086
FT                   /transl_table=1
FT                   /gene="ibp1"
FT                   /locus_tag="SPBC839.07"
FT                   /product="Cdc25 family phosphatase Ibp1"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.07.1"
FT                   /db_xref="GOA:Q8WZK3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="PomBase:SPBC839.07"
FT                   /db_xref="PomBase:SPBC839.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZK3"
FT                   /protein_id="CAB46700.1"
FT                   /translation="MSTLSYVSPDALKGWLMESPNEISIIDVRDYDYEGERIPGSVRIP
FT                   SDTFLASVDQHVDDLMKKRSLIVHCTYSQVRGPKAARVLSEILRNRITESKEKLSLSQK
FT                   EKLFQNLPTVYILHGGFSAWKRRYGGQQGLIEYD"
FT   3'UTR           613087..613319
FT                   /gene="ibp1"
FT                   /locus_tag="SPBC839.07"
FT   3'UTR           complement(613331..613506)
FT                   /gene="its8"
FT                   /locus_tag="SPBC839.08c"
FT   CDS_pept        complement(join(613507..616163,616316..616466))
FT                   /transl_table=1
FT                   /gene="its8"
FT                   /locus_tag="SPBC839.08c"
FT                   /product="pig-N (predicted)"
FT                   /db_xref="GOA:Q8WZK2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="InterPro:IPR037671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZK2"
FT                   /protein_id="CAB46701.1"
FT                   /translation="MFGRLLLLGILFHVVFLKSIFDIYFVTPLIHGMKQYSAGEAPAKR
FT                   LFLIVGDGLRPDKLLQPHSEKVIGEEQTYAAPFLRSIIQNNGTFGVSHTRVPTESRPGH
FT                   VALIAGFYEDVSAVTKGWKKNPVNFDSVFNQSRHTYSFGSEDILPMFSEGASDPSRVDT
FT                   FMYSSELEDFSSNGIVLDEWVFDRLDELLAQSLEDKELWDMLHRDKIVFFLHLLGIDTI
FT                   GHNKHPDSVEYVENIQYIDGKIQELVDKMNNYYNNDGASSWVFTADHGMSDFGSHGDGN
FT                   LDNTRTPIIAWGAGIQSPTHEKNYGHDEYSLPWNLTEIKRIDIQQADIAALMSYLVGLN
FT                   FPVNSVGQIPLDYLDCSSRRKAEVALMNALEIGEQYNLKSASKDQTSIFFRPYSPLRNY
FT                   TEVQASFYNSVIADIESGEYEIAIEHCFHFSQTVLSGLRYLQRYDWLLLRSIVFFGYLS
FT                   WIGYVICFVFSLNIEPSSKIVKPVSVVKRVAFNIPFLLICIFFYIQSSPPFYYGYALFP
FT                   TIFLQLIHSIFPNTKLGFKNFLTVAKQKHGFSLLKILFISLCILCLLQFIVYSYFHREG
FT                   FSVILMGLAAWPWLLHADYAFSHKTISVSWSVLTSLLCFFTILPVNKKESLLFIFAGGF
FT                   AMSVAGVFYILYRRNQAFQYSSTVTNKQLVLQVLIIMATVPVTLKIADSLQRNIAIPPI
FT                   LRLVAFGLFITSYIIPSHHIRSCKHYFLDRLAILFLTFSPTMCMLSISFEALFYVVLFI
FT                   TLGLWMELETELQKYTEQLHPEYSRKKDAKFHLSLSHIRISLFFYIFINVAFFGTGNVA
FT                   SLSTFALDSVKRFIPVFNPVTQGALLMYTILVPFIALSAAFGIMNKRLGGIQQVTFFLA
FT                   VGMADIVTINFFYLVKDEGSWKDIGVSISHFCISNFLILFITALEHASAILCKNITYTI
FT                   HEKVN"
FT   5'UTR           complement(616467..616647)
FT                   /gene="its8"
FT                   /locus_tag="SPBC839.08c"
FT   3'UTR           complement(617191..617678)
FT                   /gene="mrp21"
FT                   /locus_tag="SPBC839.09c"
FT   CDS_pept        complement(join(617679..617968,618063..618138))
FT                   /transl_table=1
FT                   /gene="mrp21"
FT                   /locus_tag="SPBC839.09c"
FT                   /product="mitochondrial ribosomal protein subunit Mrp21
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.09c.1"
FT                   /db_xref="GOA:Q8WZK1"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="PomBase:SPBC839.09c"
FT                   /db_xref="PomBase:SPBC839.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZK1"
FT                   /protein_id="CAB46702.1"
FT                   /translation="MNSSYFPGVLGVRWVHTNRKLQKRKEEHGAFQDSLHFMIPAAETK
FT                   DLGASVTVGNSLTRAFRQVDRICQRNNVPRLFRSQRFYEKPSEKRSRVRSERHRARFRA
FT                   GIVRLVNLAKNMRRWGY"
FT   5'UTR           complement(618139..618244)
FT                   /gene="mrp21"
FT                   /locus_tag="SPBC839.09c"
FT   5'UTR           618349..618353
FT                   /gene="usp107"
FT                   /gene_synonym="snu71"
FT                   /locus_tag="SPBC839.10"
FT   CDS_pept        join(618354..618372,618422..620259,620309..620539)
FT                   /transl_table=1
FT                   /gene="usp107"
FT                   /gene_synonym="snu71"
FT                   /locus_tag="SPBC839.10"
FT                   /product="U1 snRNP-associated protein Usp107"
FT                   /db_xref="GOA:Q8WZK0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034268"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZK0"
FT                   /protein_id="CAB46703.1"
FT                   /translation="MQRQNTQAAGMPMMPQVPMVGNGVPYVVPIQPVFAPLPPDYRSLY
FT                   KKLYGQGAFLVDNPVEASSPYDFSQPILKFGKLPIKQVLRDNESQQKDRKNLPRNQKSN
FT                   EIQEKQTFQTPSSEKSTTERESRPFVPPNSQQMRRMLFIGNIPKELDDFWMDKILRLSG
FT                   KLASWRRVADADNSMTSFGFAEFESNEQFSRALEALNDFVVPPLYEGGPSTRLSLITDV
FT                   ENEGLYREWQTSRYARNKQKEINILQQIRFNLERICQDIGNFDVRSRIERAARQAREKN
FT                   EKLLQNVKTSEIPINAADLEGINPELLPVIEEEIRSFRDQSAMKKREKQRSKDEYASLY
FT                   KEYTRKEQEKLRKQNDDLQNLLSKHRISRIPMSTVNAFLRAEDSIPESFSDEQAYYEEK
FT                   RRKDQLEAEEYYARERRWMNREKARTAALEREAAREEEERVNNTSFGTYLSEKLASFDD
FT                   DEEARVSRDEYFVDRAAWIRHRAVARAREEDADALDRKEEERELRTRGEGATVETENYV
FT                   ENGKLVTSEMPQHENGPFKIKIQTKKPAVPSERREFGLPERLLLEEEDEEPQGYSPNPQ
FT                   KPKPAMEENDAEKTKRLRSLIEKIPVEAESLWALPIDWSKVTEDLLKEEMQAFVTKKII
FT                   EYIGIQEDSLITFTIDHIRQHKGAEQLVSELDLALAEDAPEFVSKVYRYLHVLLILRSE
FT                   A"
FT   3'UTR           complement(618428..620634)
FT                   /gene="hut1"
FT                   /locus_tag="SPBC839.11c"
FT   3'UTR           620540..620884
FT                   /gene="usp107"
FT                   /gene_synonym="snu71"
FT                   /locus_tag="SPBC839.10"
FT   CDS_pept        complement(620635..621603)
FT                   /transl_table=1
FT                   /gene="hut1"
FT                   /locus_tag="SPBC839.11c"
FT                   /product="uridine diphosphate-N-acetylglucosamine
FT                   transporter Hut1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.11c.1"
FT                   /db_xref="GOA:Q8WZJ9"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="PomBase:SPBC839.11c"
FT                   /db_xref="PomBase:SPBC839.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZJ9"
FT                   /protein_id="CAB46704.1"
FT                   /translation="MAGFMRQLFVCMIGIYGSFLSWAVMQEKIITRPYDGERFSSPALL
FT                   SLAQSFMTVLCGLLWNWFHGVSARGLLEPKFLGYFSSIAISASLSSYFGYASMFHLSYP
FT                   TVILGKSCKLLPVIALHVFVYKRKFPPHKYLIVTMITAGVSIFSYFQNTSSKGKHAEHD
FT                   SPIGLLLLFFNLLMDGITNTTQDKVFGKYKLSSVTMMIAVNLGIACLNGLYLISPFCNQ
FT                   QPLSFINRHPSILKDMLLFACTGSVGQLFIFFTLEKFGSITLVTITLTRKIFTMLLSVF
FT                   HFHHTVSSIQWLGILLVFLGISLEAGLKILNNNSTAKKKAS"
FT   5'UTR           complement(621604..621873)
FT                   /gene="hut1"
FT                   /locus_tag="SPBC839.11c"
FT   5'UTR           621883..622331
FT                   /gene="rpc31"
FT                   /locus_tag="SPBC839.12"
FT   CDS_pept        622332..622964
FT                   /transl_table=1
FT                   /gene="rpc31"
FT                   /locus_tag="SPBC839.12"
FT                   /product="DNA-directed RNA polymerase III complex subunit
FT                   Rpc31"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.12.1"
FT                   /db_xref="GOA:Q8WZJ8"
FT                   /db_xref="InterPro:IPR024661"
FT                   /db_xref="PomBase:SPBC839.12"
FT                   /db_xref="PomBase:SPBC839.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZJ8"
FT                   /protein_id="CAB46705.1"
FT                   /translation="MRRGARGSTNLGGMTWQEVLEFNANSTPTKLYPDRDIPLQRSIRP
FT                   EELLELRFYKEIRTSFLDESAFYIRRNPISVVQRNEDGLVRYSDRNKPKRKNDNLSLSD
FT                   LDLDPKFFPEELRKTLGAASATGRKRARRKLDMKTFIDFTIKAQDLKDESSEAAHPNIE
FT                   EEPDEGLEEEDEDFGDDDDNDYGENYFDNGEGDDYDDYDGDEGAIYE"
FT   3'UTR           622965..623102
FT                   /gene="rpc31"
FT                   /locus_tag="SPBC839.12"
FT   3'UTR           complement(623323..623399)
FT                   /gene="rpl1601"
FT                   /locus_tag="SPBC839.13c"
FT   CDS_pept        complement(join(623400..623952,623999..624039))
FT                   /transl_table=1
FT                   /gene="rpl1601"
FT                   /locus_tag="SPBC839.13c"
FT                   /product="60S ribosomal protein L13/L16 (predicted)"
FT                   /db_xref="GOA:O42991"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42991"
FT                   /protein_id="CAB46706.1"
FT                   /translation="MSEFQKVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNIS
FT                   GHFFRNKLKYLAYLRKACRYNPSRGAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQ
FT                   AVEGIPPPFDKQKRVVVPAALRVLRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRKV
FT                   KSAAFYQAKLAKQKKIASAKEASPVNQKLSQFGY"
FT   intron          complement(623953..623998)
FT                   /gene="rpl1601"
FT                   /locus_tag="SPBC839.13c"
FT   5'UTR           complement(624040..624091)
FT                   /gene="rpl1601"
FT                   /locus_tag="SPBC839.13c"
FT   regulatory      complement(624092..624098)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(624114..624123)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(join(624426..625101,625157..625197))
FT                   /transl_table=1
FT                   /locus_tag="SPBC839.14c"
FT                   /product="methyltransferase involved in endocytosis
FT                   (predicted)"
FT                   /db_xref="GOA:Q9P7Z3"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026635"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7Z3"
FT                   /protein_id="CAB46707.1"
FT                   /translation="MSGLPESKLGTKQYWDNVYEREVSNFTEFNDEGEVWFGEEAEERI
FT                   VQWLEDHISTSFREVSEAAPFRVLDLGTGNGHLLFRLLEEEDTLLPSPCQLVGVDYSEA
FT                   AIVLAKNIARHRQFSDKVKFQQLDIIKDSKFCSKDWDLILDKGTFDAISLSGELLDGRP
FT                   LNSVYVDRVRGMLSPNGIFLITSCNWTIQELEERFTKNGFIVHSTVPVPVFEFQGSTGS
FT                   STSVIAFQIDPSFNRK"
FT   misc_RNA        complement(625487..625917)
FT                   /locus_tag="SPNCRNA.1375"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(626004..626105)
FT                   /gene="ef1a-c"
FT                   /locus_tag="SPBC839.15c"
FT   CDS_pept        complement(626106..627488)
FT                   /transl_table=1
FT                   /gene="ef1a-c"
FT                   /locus_tag="SPBC839.15c"
FT                   /product="translation elongation factor EF-1 alpha Ef1a-c"
FT                   /db_xref="GOA:P0CT55"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CT55"
FT                   /protein_id="CAB46708.1"
FT                   /translation="MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE
FT                   ATELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMIT
FT                   GTSQADCAILIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDTTGWSQA
FT                   RFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNMPWYQGWQKETKAGVVK
FT                   GKTLLEAIDSIEPPARPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMIVTFAPA
FT                   GVTTEVKSVEMHHESLDAGLPGDNVGFNVKNVSVKDIRRGNVCGDSKNDPPMGCASFTA
FT                   QVIILNHPGQISAGYSPVLDCHTAHIACKFAELIEKIDRRSGKKIEESPKFVKSGDACI
FT                   AKMVPSKPMCVEAFTDYAPLGRFAVRDMRQTVAVGVIKAVEKVAPGAAKVTKAAVKAGA
FT                   KK"
FT   misc_RNA        626485..626809
FT                   /locus_tag="SPNCRNA.1376"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(627489..627556)
FT                   /gene="ef1a-c"
FT                   /locus_tag="SPBC839.15c"
FT   5'UTR           627934..628029
FT                   /locus_tag="SPBC839.16"
FT   CDS_pept        join(628030..628064,628115..628259,628538..631171)
FT                   /transl_table=1
FT                   /locus_tag="SPBC839.16"
FT                   /product="C1-5,6,7,8-tetrahydrofolate (THF) synthase"
FT                   /EC_number="6.3.4.3"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.16.1"
FT                   /db_xref="GOA:Q8WZJ7"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC839.16"
FT                   /db_xref="PomBase:SPBC839.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZJ7"
FT                   /protein_id="CAB46709.1"
FT                   /translation="MALLLEGTSLARKVREELREQISSIKSVDPYFNVSLKIIQVGGRE
FT                   DSNVYVRMKTRAANEAGISCEHVNFPEDITEYDLLLAIKGFNEDPTVHGIIVQLPLPAH
FT                   INEQIITEAVAPEKDVDGFCETNLGKLTKREGQPLFTACTPKGIMCILKHYGINVQGKH
FT                   AVVIGRSNIVGRPMSILLEKANATVTLCHSKTESIADIVRTADIVVAAIGIPHFVKADW
FT                   LKKGVVAIDVGINSIPDATKKSGYRLTGDIDFENAKEVASAITPVPGSVGPMTVAMLLQ
FT                   NVVESAVRFRKMSRKRKPTLLPLKLQTPVPSDIEIARSQTPKNIGDLASEIGIAKSELE
FT                   FYGSHKAKVNLEILQRLAHRRDGHYVVVTGITPTPFGEGKSTLTAGLVQALSNLDKLAI
FT                   ACVRQPSQGPTFGIKGGAAGGGYSQFIPMEEFNLHLTGDIHAITAATNLLAAAIDTRMF
FT                   HENTQSDAALYKRLTLVKGNKREFAPVMFRRLKKLGIDKTNPEELTEEEQRKFARLDIE
FT                   PSTISWNRTLDVNDRFLRKITIGENPTEKGFTRQTGFDLSVASECMSVLALATDLKDMR
FT                   ERLGRMVVASNKSGEPVTADDLGVGGALTVLLKDAIKPTLMQTLEGTPALVHAGPFANI
FT                   SIGASSILADRIALKLAGTEVDEDAKKEAGYVVTEAGFASDIGMEKFFNIKCRTSGLKP
FT                   DAIVIVATVQALKLHGGGPPVGPGKPIPEVYKREDVDLVRKGCANLAKHISNARKYGLP
FT                   VVVAINKFSSDSPNEISAIREEALAAGATDAVDSNHWAEGGKGALGVARALINACENVD
FT                   SEFRLLYDVHEPIEKKIEIIAKEMYGADGIELSPLAKERLETFTKQGYNNLPICIAKTQ
FT                   YSLSHDPDLKGAPTNFTVPIRDMRLSAGAGFIYPLAAAISTIPGLPTKPAYYNIDIAEN
FT                   GDIVGLS"
FT   3'UTR           631172..631710
FT                   /locus_tag="SPBC839.16"
FT   3'UTR           complement(631697..631841)
FT                   /gene="fkh1"
FT                   /locus_tag="SPBC839.17c"
FT   CDS_pept        complement(join(631842..631881,631929..632142,
FT                   632248..632267,632396..632433,632616..632642))
FT                   /transl_table=1
FT                   /gene="fkh1"
FT                   /locus_tag="SPBC839.17c"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   Fkh1"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC839.17c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC839.17c.1"
FT                   /db_xref="GOA:O42993"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="PomBase:SPBC839.17c"
FT                   /db_xref="PomBase:SPBC839.17c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42993"
FT                   /protein_id="CAB46710.1"
FT                   /translation="MGVEKQVISSGNGQDFPKPGDRITMHYTGTLTNGKKFDSSVDRGS
FT                   PFVCTIGVGQLIRGWDEGVPKMSLGEKAKLTITPDYGYGPRGFPGLIPPNSTLLFDVEL
FT                   LAINDKKA"
FT   intron          complement(631882..631928)
FT                   /gene="fkh1"
FT                   /locus_tag="SPBC839.17c"
FT   intron          complement(632143..632247)
FT                   /gene="fkh1"
FT                   /locus_tag="SPBC839.17c"
FT   intron          complement(632268..632395)
FT                   /gene="fkh1"
FT                   /locus_tag="SPBC839.17c"
FT   5'UTR           complement(632643..632706)
FT                   /gene="fkh1"
FT                   /locus_tag="SPBC839.17c"
FT   3'UTR           complement(633724..634343)
FT                   /gene_synonym="SPBC839.18c"
FT                   /locus_tag="SPBC115.03"
FT   CDS_pept        complement(634344..635450)
FT                   /transl_table=1
FT                   /gene_synonym="SPBC839.18c"
FT                   /locus_tag="SPBC115.03"
FT                   /product="gfo/idh/mocA family oxidoreductase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC115.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC115.03.1"
FT                   /db_xref="GOA:O42896"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC115.03"
FT                   /db_xref="PomBase:SPBC115.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42896"
FT                   /protein_id="CAB46711.2"
FT                   /translation="MPPIKTAVLGTGVSAFVFHFPFLEALPSKFEIYACLERRATVTQS
FT                   KARSAYPNILVYTNLDELLADVNIELVVVSLPPNVHSEIVKKALNAGKHVVCEKPFTPT
FT                   YEEAKELYELAESKSLLLAIYQNRRWDGDFLTAKKIIESGRLGQVVEFESHFDRYRLGR
FT                   KSGSWKDEPRPGNGMVYGIGSHLIDQAVSLFGTPYSVTAKLEAQRQIPPLEVEDYFRII
FT                   LHYPAKGNKLPINVILSSTNVSCGCEMRFCIKGTRGSFMKFGFDPQESQLHSGMKPNDH
FT                   GFGTDRFELYGNLWTVPLDADVKALPEPTKITVPTVQGNYRDFYDAVFEEILKKANEFP
FT                   IKSDQVLAVEKIMEAAYKSSESSSSIQL"
FT   5'UTR           complement(join(635451..635544,635734..635913))
FT                   /gene_synonym="SPBC839.18c"
FT                   /locus_tag="SPBC115.03"
FT   5'UTR           637370..637653
FT                   /locus_tag="SPBC115.02c"
FT   misc_RNA        complement(637575..639965)
FT                   /locus_tag="SPNCRNA.1377"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        637654..639018
FT                   /transl_table=1
FT                   /locus_tag="SPBC115.02c"
FT                   /product="AFG1 family mitochondrial ATPase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC115.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC115.02c.1"
FT                   /db_xref="GOA:O42895"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPBC115.02c"
FT                   /db_xref="PomBase:SPBC115.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42895"
FT                   /protein_id="CAA17914.1"
FT                   /translation="MLQVLRVSAPCFAFVDTIGSIGVCRVVRFTTFHNTPIEVYNKKVN
FT                   DGVWKRDPYQETAVKAINRLYTELESYTQPPITQDSMPAEKGSILSWISPLKKMFSRKK
FT                   SPTLTSSLPVPGMPKGIYLYGDVGCGKTALMDLFYHNLPPNVTRSQRIHFHAFMMQVHR
FT                   TSHDLQDRYGFEIDFIDHIASGIAKETTVLCFDELQVTDVADALLLRRLFEALMKYGVV
FT                   IFITSNRAPSDLYKNGIQRESFIPCIKLLEHRLQVICLDSPNDYRRLKSKTEDTYLYPA
FT                   NSPEVKKALENWFLCYADEKDPAHQDEVEVFGRKIIVPKASGNVAWFTFEQLCGEPKSA
FT                   ADYLSLASRYHVFIVSDIPKLSIESKDLIHRFITFIDALYDTHGKLILSSEVPVQEIYP
FT                   TAPSEVLSSTADPAAKGKIESHYHGAFGGIEEVFTFTRCLSRLSEMKKQSWIHSP"
FT   3'UTR           639019..639291
FT                   /locus_tag="SPBC115.02c"
FT   5'UTR           639273..639373
FT                   /gene="rrp46"
FT                   /locus_tag="SPBC115.01c"
FT   CDS_pept        join(639374..639428,639512..640137)
FT                   /transl_table=1
FT                   /gene="rrp46"
FT                   /locus_tag="SPBC115.01c"
FT                   /product="exosome subunit Rrp46 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC115.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC115.01c.1"
FT                   /db_xref="GOA:O42894"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="PomBase:SPBC115.01c"
FT                   /db_xref="PomBase:SPBC115.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42894"
FT                   /protein_id="CAA17913.1"
FT                   /translation="MNRIGILSRSDGSSEWKQGSARVICGVNGPIDVKIRDERLNKATV
FT                   EVLVQPVSGVAETLEKMISSRIVGILEDAIFLNTYPRTLIQVSIQIIEEDGTDTLAAVI
FT                   NGAVLALLDAGISLKYIPCAINCHWKNKITQDEPDVDGTINKLESIITICYSISSEPAK
FT                   LIFLETAGPIPEEDFFRVLETAPLHAEEVSKKMKELLFETYNESDGHENEKNPKEDVEM
FT                   DVVA"
FT   3'UTR           640138..641343
FT                   /gene="rrp46"
FT                   /locus_tag="SPBC115.01c"
FT   5'UTR           641285..641685
FT                   /locus_tag="SPBC947.15c"
FT   CDS_pept        641686..643341
FT                   /transl_table=1
FT                   /locus_tag="SPBC947.15c"
FT                   /product="mitochondrial NADH dehydrogenase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.15c.1"
FT                   /db_xref="GOA:O43090"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PomBase:SPBC947.15c"
FT                   /db_xref="PomBase:SPBC947.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43090"
FT                   /protein_id="CAA17043.1"
FT                   /translation="MSVSKARLQSVVRLSRTVPYSKTMVRSFHVSCAVKNSGNVPTPRN
FT                   KSFFSRALEMAEVTSSLSMLGAVALFQSLRRLNNSSPKGKSGVPKKNIVVLGSGWGAVA
FT                   AIKNLDPSLYNITLVSPRDHFLFTPMLPSCTVGTLRLPSITEPIVALFKGKIDPSNIHQ
FT                   AECTAIDTSAKKVTIRGTTEANEGKEAVIPYDTLVFAIGAGNQTFGIQGVRDHGCFLKE
FT                   AGDAKKVFNRIFEILEQVRFNKDLSPEERARLLHITVVGGGPTGMEFAAEMQDFIDNDV
FT                   KDMFPELQKDIHVTLIEAAPGVLPMFTKSLITYTENLFKNLNIKIMTKTVVKDVNEKNL
FT                   IVQKTNPDGSKAMQEIPYGMLVWAAGITARPLTRTLMSSIPEQSGARKGLIVDEFFRVK
FT                   GVPEMYAVGDCAFSGLPATAQVANQQGAWLAKNLNVEGKKFALHERIQALEKQLGEKEA
FT                   PSQVAGLKQQVEQLKLEPFKYHHQGALAYVGDEKAIADLKLPFMKKMLPLQGIVGHTFW
FT                   RLAYLNELISARSQFMVLIDWLKTRLFGRYDAKV"
FT   3'UTR           643342..643906
FT                   /locus_tag="SPBC947.15c"
FT   misc_RNA        complement(643863..644853)
FT                   /locus_tag="SPNCRNA.1378"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           644120..644290
FT                   /gene="cbp6"
FT                   /locus_tag="SPBC947.14c"
FT   CDS_pept        join(644291..644479,644547..644669)
FT                   /transl_table=1
FT                   /gene="cbp6"
FT                   /locus_tag="SPBC947.14c"
FT                   /product="mitochondrial respiratory chain complex assembly
FT                   protein Cbp6 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.14c.1"
FT                   /db_xref="GOA:O43089"
FT                   /db_xref="InterPro:IPR037653"
FT                   /db_xref="PomBase:SPBC947.14c"
FT                   /db_xref="PomBase:SPBC947.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43089"
FT                   /protein_id="CAA17042.1"
FT                   /translation="MSLNQKITKAVALWPKDELRPWLSFPKTLDTSIRARLQKMPPQQA
FT                   NKQLNALNNLLDNVYWNKYIPKQVVLKPQFKPSYYESLTQIRRKEEKAPLWKRLFKRK"
FT   3'UTR           644670..645012
FT                   /gene="cbp6"
FT                   /locus_tag="SPBC947.14c"
FT   3'UTR           complement(644833..645219)
FT                   /gene="rba50"
FT                   /locus_tag="SPBC947.13"
FT   CDS_pept        complement(645220..646578)
FT                   /transl_table=1
FT                   /gene="rba50"
FT                   /locus_tag="SPBC947.13"
FT                   /product="RNA polymerase II associated protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.13.1"
FT                   /db_xref="GOA:O43088"
FT                   /db_xref="InterPro:IPR013929"
FT                   /db_xref="InterPro:IPR013930"
FT                   /db_xref="InterPro:IPR039913"
FT                   /db_xref="PomBase:SPBC947.13"
FT                   /db_xref="PomBase:SPBC947.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43088"
FT                   /protein_id="CAA17041.1"
FT                   /translation="MENHRSVFSNVIGDIVEKPPKQLVEVKRSVQRHARGFPAVSRTLP
FT                   KRESKSMSAYKEKMLRKNKESPGLEGKGNLDDQGIDEENRVRLERMNDLEIEGAQEEIR
FT                   ATIRDDLLEMLKKRAFKKKAERELAQRKDRSSQVNTPDLSQRPSDDSFLSNEKLRSSEK
FT                   LNRNLQSVLSSEAVDSSSGSPSPPMALSQAEIRSRQTKRVMFPDKAEELTKIFSLPTLA
FT                   PIKGNEEDDASEDAKHSPKKHSPALSDGTTSNDGAPLEFDTTHLPEKQVTLDPNDPSFY
FT                   EQLHDKYFPNLPVDEKQMQWLHDPSPAENSYHPSVESLHAHEIRFGFKGEIITPSQSQT
FT                   IPVNEGLHHHGDAPFSAGYTLVELAHLLRSSFPTQRCIAIQTIGRIIYRLNSGEFREVL
FT                   SPELHTLVEDAHIYELLAAAASDQVKHLTVRSLAIEALWLCSQSQHGSSRSAV"
FT   5'UTR           complement(646579..646781)
FT                   /gene="rba50"
FT                   /locus_tag="SPBC947.13"
FT   3'UTR           complement(646936..647506)
FT                   /gene="kms2"
FT                   /locus_tag="SPBC947.12"
FT   CDS_pept        complement(join(647507..648070,648137..648883,
FT                   648927..648989))
FT                   /transl_table=1
FT                   /gene="kms2"
FT                   /locus_tag="SPBC947.12"
FT                   /product="spindle pole body protein Kms2"
FT                   /db_xref="GOA:O43087"
FT                   /db_xref="InterPro:IPR030268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43087"
FT                   /protein_id="CAA17040.1"
FT                   /translation="MDEYIPFDDIVRQYDPDYTGKVSIQAFLEIVDDVDALRLNPEAPL
FT                   LDNEQRQSAQDFIKDNSEIVVSTSEIKNLFYELTGLDPDTLPVNKLALRENGVLPRKSV
FT                   AKPQKISENRIKRKDMFYQDASYITPRKGSPLSHSTPLSMFRTKNEYGSNKGFSHINKE
FT                   NADDSLIQQLYERIELQAAELRSKDEQVKELNARNAKLLEELDSSEEACKSCYTQAKTW
FT                   EKKFREALRDSKEYAAQLQTIHEEYEQQQAHIVRMEELIHAVEKERKTETDYMKKESLS
FT                   EQKERGAFMESNMILEEKVAHLQLENEQLRLFFKEKAPQPFQNHPPYQNLKITFPSPFF
FT                   HIPYIPKTETLNDSQFAAGLSLLASELESQKNLLKKFENLKKKSSKDFLSPSTILSNAF
FT                   SKVSLPNSLILRVLFFSLLFIIGIHIFYFLFFHVATIQQWPFLFWLPSTKFDNRWSPT"
FT   5'UTR           complement(648990..649028)
FT                   /gene="kms2"
FT                   /locus_tag="SPBC947.12"
FT   5'UTR           649865..649979
FT                   /gene="elg1"
FT                   /locus_tag="SPBC947.11c"
FT   CDS_pept        join(649980..651564,651609..652452,652500..652833)
FT                   /transl_table=1
FT                   /gene="elg1"
FT                   /locus_tag="SPBC947.11c"
FT                   /product="DNA replication factor C complex subunit Elg1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.11c.1"
FT                   /db_xref="GOA:O43086"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPBC947.11c"
FT                   /db_xref="PomBase:SPBC947.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43086"
FT                   /protein_id="CAA17039.1"
FT                   /translation="MQIVGYLSADSQSNPDLKSENEAKEEKPIGRRHTMSPVPATSENK
FT                   YFGKSPLSGSRKPRRSRSLHKERSYMRKFFDMDMEESKDFENDQSLLVTLKVSTSLGQK
FT                   IENILHPKLSNDTNSTAFPPAKSSGEASDTNILVENINSQETVNSSPLVSELHYSNLAD
FT                   SPSNLRNTVTSMHPFFMSKSVKKNSEIKFVSEERGGTKPERLLDPLWPTPDSQSMLEYA
FT                   GSIEPSVFWFPKKHLEEAILEETSHLSFKEVLSSTTANMITPLAEKNKTEVLQVTPSKL
FT                   HTFALESLCFSPAPFIQKVLSRLLPSDPNVEMPMIPQILEKGLWVSKYAPSKTQDCCAF
FT                   SQCLSKIADWLRSCRLTKPESSSVPPSSSISRSSTIHSCTSSKRNEDSLSESDFEPDII
FT                   EEEDDSDEFNPSVSRKKAKLTSSQFSNWMLVTGVTGIGKTSCLYAICRELNFEVVEIHP
FT                   GMRRSGKELLERIGELTQSHIVDKSRLNNTPDILILLEEVDILFQDDRGFWQAVSTLIE
FT                   KSKRPVVMTCNETDFLPSAFLQEDHIVQFQSISSALLTDYISSVLYADRCIISRNVVES
FT                   ISYRYGSDLRGILMQLNFWSLVNFPSLPSKDKQDDSHEPFIEATISAFDEGVGVYNPRI
FT                   QTSEDLLQTYSEEQMGDIGLLFMPNLVNWRKVCVPKSEMEEKEAIMEKLIYSHQYADSL
FT                   SYVDYRFSSQPTIYETYELMNDSASFEDMSLECRDNCANAFQDNLVGFPTISNPFHANA
FT                   PPEPHELKLQYHSFCFINNLFSKSSLKAISSNDSIVPKALNNRELQLSALASTIGYKLD
FT                   PDDVYNILSFLSFANSQVTSYTPPNSIDRPNDILILEVAPFVRCMRRYDRIRLNSYKLL
FT                   LSSKGRSASHISRRGAASILRSAGYNYGRLQYLEGSDRILSTWFSTTLD"
FT   3'UTR           652834..652980
FT                   /gene="elg1"
FT                   /locus_tag="SPBC947.11c"
FT   3'UTR           complement(652950..653090)
FT                   /gene="dsc1"
FT                   /locus_tag="SPBC947.10"
FT   CDS_pept        complement(join(653091..653363,653432..655246))
FT                   /transl_table=1
FT                   /gene="dsc1"
FT                   /locus_tag="SPBC947.10"
FT                   /product="ubiquitin-protein ligase E3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.10.1"
FT                   /db_xref="GOA:O43085"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="PomBase:SPBC947.10"
FT                   /db_xref="PomBase:SPBC947.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43085"
FT                   /protein_id="CAA17038.2"
FT                   /translation="MDRRRWVPSTPVVTLLLLFMLFAPAPRLPSRNGESSEKSIKAEKR
FT                   AFSEIKNATFLNIPERVEHSLTFPTEIWETRDGLFEEPVGKGDSHLNHTSVMTGNWNIL
FT                   PYPSFGKVSPNVTWHTTLRNIVMSQSGRFSANLYEYVDGNSDGISFVLNLENNNDTSVY
FT                   HMTFHGDRVKPINVFLGSTDVTPNFGGVDVIPWLLKDSPYKDAPPLDGTEYFPLLQNRS
FT                   LERIETRLQDAQTVGWSPLVFEEEEVTCSAFVFLHNKNTGLDKETLKAIENEFYHPQGV
FT                   STQKMPEVFVSGLVYSPDCNVAFTFSNTKGPRNFVLENHLVRFSSLYIFIVLSQIFVLL
FT                   RQMRINSPSHVQRLSFLTIAMQAGLDAYIAIFFLSTNAVIEKGYLPFVSVAFLSLVPSV
FT                   MFTMRYLALILRVQNSNMPPPAPRPVTNNSSNNNTNQSNASNENSPNAPSAANDNTETT
FT                   TVNPPQEDDQPMTQHERDQRDWSAVCLRFYFIILVVCIASLYSAFWPVIYRFYFISALI
FT                   FTSYSFWIPQIIQNVKQGTSRSFTWTYILGASVLRLYLPLAIFIDSELILGFPPKYFFA
FT                   LGLVLWMLFQVLVLLVQDTLGPRFFLPKKFFLSSPVYDYHPVIQQDDLEAFMRDANVCP
FT                   ICMQPIELVSTGSTLNPASMMVRRNYMLTPCHHLYHRQCLLQWMETRSICPVCRCHLPA
FT                   V"
FT   5'UTR           complement(655247..655450)
FT                   /gene="dsc1"
FT                   /locus_tag="SPBC947.10"
FT   3'UTR           complement(656117..656322)
FT                   /locus_tag="SPBC947.09"
FT   CDS_pept        complement(656323..657108)
FT                   /transl_table=1
FT                   /locus_tag="SPBC947.09"
FT                   /product="ThiJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.09.1"
FT                   /db_xref="GOA:O43084"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PomBase:SPBC947.09"
FT                   /db_xref="PomBase:SPBC947.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43084"
FT                   /protein_id="CAA17037.1"
FT                   /translation="MPAKTRNVLIACSDYYGPFYKDGENTGAFFLELLHPYLVFRDACF
FT                   NVDIVTESGKIQFDDHSVAGPAIDKGSKGEEFLSYDDHIASGPELSKAEKYVLENKDDM
FT                   FWRIVQNSKTADEVNPDKYDIFFVAGGHATLFDFPKATNLQKLGTSIYENGGVVAAVCH
FT                   GPTLLPFMKRQTSDGSVSIVCGKDVTAFDRVAEDKSKLMEALKKYNLEVLDDMLNDAGA
FT                   NFIKSPNPFGDFVIADGRLVTGSNPASATSTAKTALRVL"
FT   5'UTR           complement(657109..657873)
FT                   /locus_tag="SPBC947.09"
FT   tRNA            658451..658531
FT                   /locus_tag="SPBTRNAMET.04"
FT                   /product="tRNA Methionine"
FT   5'UTR           658624..659084
FT                   /gene="hip4"
FT                   /gene_synonym="hpc2"
FT                   /locus_tag="SPBC947.08c"
FT   CDS_pept        659085..660101
FT                   /transl_table=1
FT                   /gene="hip4"
FT                   /gene_synonym="hpc2"
FT                   /locus_tag="SPBC947.08c"
FT                   /product="histone promoter control protein Hip4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.08c.1"
FT                   /db_xref="GOA:O43083"
FT                   /db_xref="InterPro:IPR014840"
FT                   /db_xref="PomBase:SPBC947.08c"
FT                   /db_xref="PomBase:SPBC947.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43083"
FT                   /protein_id="CAA17036.1"
FT                   /translation="MSLLSGDQRIICLEIPLQGKENVHINFAKEVEKLYGPSVQENSKK
FT                   NDLSDSADSEGESTHVDEQQAANGAADGTQTIKKKKRKRRYADEYYDRTDPFIDDAELY
FT                   IEEKAAATKDGFFVFSGPLVAEGDTVKIERSKKTKKKKKTSLSNATHPAPAVSAVVASA
FT                   DASFDDSRDIESEDEQPLRTLSIEMAAKNALKEAKRENAKVPKDVSKKEAKTTKSKEKA
FT                   TKKTSSSVPKQSTGENTKKAVKLETPLTSTPPIPPLSEPKHSPATVNEHISPPSALTNP
FT                   STEELKPSTSLPIDQGNASVVSKPTQQVSIVLSQNASLPVDEHQAEPEKSIPTSSIP"
FT   3'UTR           660102..660231
FT                   /gene="hip4"
FT                   /gene_synonym="hpc2"
FT                   /locus_tag="SPBC947.08c"
FT   3'UTR           complement(660284..660383)
FT                   /locus_tag="SPBC947.07"
FT   CDS_pept        complement(660384..661085)
FT                   /transl_table=1
FT                   /locus_tag="SPBC947.07"
FT                   /product="ribosome biogenesis protein Rrp14-C (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.07.1"
FT                   /db_xref="GOA:O43082"
FT                   /db_xref="InterPro:IPR007019"
FT                   /db_xref="InterPro:IPR029190"
FT                   /db_xref="PomBase:SPBC947.07"
FT                   /db_xref="PomBase:SPBC947.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43082"
FT                   /protein_id="CAA17035.1"
FT                   /translation="METTEGKNDLRAKLAEKIQTFRSQRKATEKVDRALLLQRRKEKAK
FT                   ARAEAKKLAKKESKAKQESKVAAYDTGNSSDNIADEENDNHKSTITYGTLIVGDDKFSN
FT                   GKLKVAGKKRGPTDVFGALKHLEAKKRRIESMDEEKRRKIEESDKWHRVLLQAEGKKLK
FT                   DNEQLLKKSIRRKEKEKKKSSDAWKERKDNEKKAMLMRQQRREENLKKRRESKKSKKGK
FT                   APKKKKPSKKK"
FT   5'UTR           complement(661086..661497)
FT                   /locus_tag="SPBC947.07"
FT   5'UTR           661588..662939
FT                   /locus_tag="SPBC947.06c"
FT   CDS_pept        662940..664436
FT                   /transl_table=1
FT                   /locus_tag="SPBC947.06c"
FT                   /product="spermidine family transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.06c.1"
FT                   /db_xref="GOA:O43081"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC947.06c"
FT                   /db_xref="PomBase:SPBC947.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43081"
FT                   /protein_id="CAA17034.1"
FT                   /translation="MKENDHLNSVSSSEIEKCDEDVEEELYSYPDSDFLVTFNGEDDPE
FT                   KPLNWPVSIKLLNTALYGLTTFAAQFNSTTMSPTTSHLVNAYPIGHEVAVLPTCLYILG
FT                   IAFGPMIFAPFSEVNGRKIGVLVPFFLSILFTIGTASSDSVAAIMCTRFFAGLFAGAPV
FT                   VSSGGVMADLWCPAQRGTALIFYAFFVVSGADFGPIISSLVTEHSDTAWRWPLWTIVII
FT                   ECFILTLDVFLIKETFGPVILATKAKNLRLTTKNWGLHAAHDEYRLDFKEFVTLHLVRP
FT                   FAMLATPIVFFIAMFASYVYGILYLVLTTIPYTFGMTKNWQGTISTLPMIAMFTGVVIG
FT                   GSFNIMWNQRYAKLITANGGKPLPEQRLPLMMAVGWLMPAGIFVFAWTNSPNIHWIAPF
FT                   IGISMMGAGFFVIFQGCLNYLVDTFTKFAASAIAANTFTRSIFAGTFPLFSEIMFKKLG
FT                   VHWGGSLVGFIALGMIPIPFIFYMMGDKLRRKNRFIKLIT"
FT   3'UTR           664437..665070
FT                   /locus_tag="SPBC947.06c"
FT   CDS_pept        667125..668819
FT                   /transl_table=1
FT                   /gene="frp2"
FT                   /locus_tag="SPBC947.05c"
FT                   /product="ferric-chelate reductase Frp2 (predicted)"
FT                   /EC_number="1.16.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.05c.1"
FT                   /db_xref="GOA:O94727"
FT                   /db_xref="InterPro:IPR000778"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="PomBase:SPBC947.05c"
FT                   /db_xref="PomBase:SPBC947.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94727"
FT                   /protein_id="CAA17033.1"
FT                   /translation="MILARDDKWTLGSIALIFVLLIGFALLFLLERFRVKEKSRTFKDC
FT                   VNVYQCPSKGERVYLALRHWFIFLATHKAQMTLILSPLVMLVTIPFTGKETKNSIASYD
FT                   WNLTGVAARLGYLSCGLFFVSYFFSLKNNPFCLMLFSSHEKMNYLHRWLSVYAVLISVL
FT                   HGILFMIFSAQSYKPLLYDKISIYGYFITVVLFLMTVASLPSVRRKFFEWFFVLHHTCS
FT                   VLIIFLIWLHHPRTIVYMKACIIIYAFDRGCRLFRSIWNRSNFRIYLLNEDMIYMVGRK
FT                   PKRSFFALPWAAGSHVYINIPSLSYWQVHPFTLASAPFDDFIELFVAVHSGFTERLANR
FT                   LYSMPHEYPNFSLAPGTPESLSNTYRELNSFKSYAVEIENTAQGHTYEPEDLYLETTVF
FT                   MDGPYGTTSNVFKEYSYVLLIAGGVGFSYTLPILRDLILKECNVTSITFIWSCRSLSLL
FT                   KVASKSLNSLLHQSNVRLKIINHFTGSISCKESSEFSNQTTENSEMEFFDDRPDLDMYI
FT                   QKFFDYVGYQTAALAACGSQSFLKRIKNSVNKSISSTTDIYQHYEEL"
FT   3'UTR           complement(669581..669739)
FT                   /locus_tag="SPBC947.04"
FT   CDS_pept        complement(669740..672661)
FT                   /transl_table=1
FT                   /locus_tag="SPBC947.04"
FT                   /product="cell surface glycoprotein (predicted), DIPSY
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.04.1"
FT                   /db_xref="GOA:Q874R4"
FT                   /db_xref="InterPro:IPR021746"
FT                   /db_xref="PomBase:SPBC947.04"
FT                   /db_xref="PomBase:SPBC947.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q874R4"
FT                   /protein_id="CAA17032.1"
FT                   /translation="MSLFPQILLRLLFLAFTLKSTSNAEKHDKVDYKDFVRRDDGDTCL
FT                   RYTTIYSQGEYETTITIPPNSYSNGVSLSNGTLLSTSSPLISTSGQFTSNNVSTTSSQR
FT                   HNTKTITFFSGTSDYTSVYYDTTGTDDVVYEYHPSSERHKSTNDTWSTNLPTNPTTTAI
FT                   YSTSGSSNITTPYSNRITNSNTSVNDITSKYLSVGTITLTTISGSDLYTSTFPANGTTS
FT                   GTVEVVIPTAGTVTETAVSGSELYTSTFPANGTTSGTVEVVIPTAGTRTVTKISGSKFF
FT                   TTTTDASGTVSGTVEVVLPTAGTNTMTVVSGSRFFTSVVSASGTVSGEQVIVYPTAGMV
FT                   TETIVSGSEIFNTTYPASGTRTGTVEVVIPTAGTVTETEISGSELYTSTFPANGTTSGT
FT                   VEVVIPTAGTRTVTKISGSKFFTTTTDASGTVSGTVEVVLPTAGTNTMTVVSGSRFFTS
FT                   VVSASGTVSGEHIIVEPTAGVVTETVVSGSVGYTTTYPAHDTVSGTVEVVEPTAGVVTE
FT                   TVVSGSVGYTTAYPAHDTVSGTVEVVEPTAGVVTETVVSGSVGYTTTYPAHDTVSGTVE
FT                   VVEPTAGVVTETVVSGSVGYTTTYPAHDTVSGTVEVVEPTAGVVTETVVSGSVGYTTTY
FT                   PAHDTVSGTVEVVEPTAGVVTETVVSGSVGYTTTYPAHDTVSGTVEVVEPTAGVVTETV
FT                   VSGSVGYTTTYPAHDTVSGTVEVVEPTAGVVTETVVSGSVGYTTTYPAHDTVSGTVEVV
FT                   EPTAGVVTETVVSGSVGYTTTYPVQGTVSGTVMIVEPTAGYVTVTTSLGSSSYATTVAT
FT                   ASGTSTGTVLQVVPSLFPGCNSKCTSSNAFRILVENDSISPSYLTYRESDGFGIASSNP
FT                   SPAGSEGIFYYDSTLKRVVTCCDERPYYRTMEGDLAKTYFFIEDEGDGTYKFKLTYGAF
FT                   SEYLDVKILADSTFFFKAMDSSSSTILNQKVRASNVYFKAVPL"
FT   misc_RNA        672533..673656
FT                   /locus_tag="SPNCRNA.1379"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           complement(672662..673842)
FT                   /locus_tag="SPBC947.04"
FT   misc_RNA        672953..673783
FT                   /gene_synonym="SPNG1260"
FT                   /locus_tag="SPNCRNA.321"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        674049..676227
FT                   /locus_tag="SPNCRNA.1380"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        674078..676143
FT                   /gene_synonym="SPNG1262"
FT                   /locus_tag="SPNCRNA.322"
FT                   /product="non-coding RNA (predicted)"
FT   repeat_region   676281..676634
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   CDS_pept        join(676629..676908,677057..677127)
FT                   /transl_table=1
FT                   /gene="naa38"
FT                   /gene_synonym="mak31"
FT                   /locus_tag="SPBC947.03c"
FT                   /product="NatC N-acetyltransferase non catalytic Sm-like
FT                   domain subunit Naa38 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.03c.1"
FT                   /db_xref="GOA:O43080"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034110"
FT                   /db_xref="PomBase:SPBC947.03c"
FT                   /db_xref="PomBase:SPBC947.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43080"
FT                   /protein_id="CAA17031.2"
FT                   /translation="MALHYFLQYDVQILCIALMFSIFRVCISTAIDFTSPKLDEFSLIM
FT                   ENGEILLTSWLNRSVHIEIFDERKFIGKFLCTDREGAAILSNTTEYNKGFSRALGLVVI
FT                   PGKHIKSFSVRA"
FT   3'UTR           complement(676633..677582)
FT                   /gene="apl2"
FT                   /locus_tag="SPBC947.02"
FT   3'UTR           677128..679324
FT                   /gene="naa38"
FT                   /gene_synonym="mak31"
FT                   /locus_tag="SPBC947.03c"
FT   CDS_pept        complement(677583..679634)
FT                   /transl_table=1
FT                   /gene="apl2"
FT                   /locus_tag="SPBC947.02"
FT                   /product="AP-1 adaptor complex subunit beta subunit Apl2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.02.1"
FT                   /db_xref="GOA:O43079"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="PomBase:SPBC947.02"
FT                   /db_xref="PomBase:SPBC947.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43079"
FT                   /protein_id="CAA17030.1"
FT                   /translation="MVPKLFQSSRFKAFKKSETSELQKGLVSQYAYERIDAVKRTIAAM
FT                   TVGKDVSSLFPDVLKNLATRDITLKKLVYLYLINYAKTHPDLCILAVNTFVKDSEEYNP
FT                   TLRALAIRTMGCIRVNKIIGYLADPLRKALKDEHPYVRKAAAVCVVKMYDLDREYCASN
FT                   GFIEQLQALVSDPNPVVVANAVRSLAEIHDQDPEKGYFNVVYTMTDRLMVALSECNEWG
FT                   RITILNSLARFRTSDIKEAEYVCERVVPQFQHANSGVVLSAVKVIMVHIPLFSSDFTDF
FT                   LYKKMAPPLLTLLSTDSEIQYVALRNINLILQKRPSIFDVKTRVFFCKYNDPLYIKMEK
FT                   LKIITMLACDENINETISELRAYVSEVELEFVKQTIKCLGDVALKVPSVINDCISIFLE
FT                   IYELNISYMVQEVTVVMETVLRKYPQKIDLLLPYLSRVIEELGDPRARSSMAWILGEFS
FT                   HVIPTSSKLLSEMISTMADEDLQIQLALLTAVVKLSLMNGKGNDEELVQKVLNYAINQS
FT                   SNQDLRDRAFAYQRLLTPENVRKAQKIVCCEKPSVSYNNNLPEALLDALLCEITTLASV
FT                   YHKLPESFIGQGKFGADAIQRRAVEELNIEEANVHEAIEKGANVENLLDLDFTDPGATS
FT                   ASDSPITSAQPQSGSNSAMDLFMAFEAPSTNNAEPVKARSATDDLLGL"
FT   5'UTR           complement(679635..679966)
FT                   /gene="apl2"
FT                   /locus_tag="SPBC947.02"
FT   3'UTR           complement(679903..680548)
FT                   /locus_tag="SPBC947.01"
FT   CDS_pept        complement(join(680549..680766,680814..681222,
FT                   681271..682626))
FT                   /transl_table=1
FT                   /locus_tag="SPBC947.01"
FT                   /product="ATP-dependent microtubule severing protein
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC947.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC947.01.1"
FT                   /db_xref="GOA:O43078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="PomBase:SPBC947.01"
FT                   /db_xref="PomBase:SPBC947.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43078"
FT                   /protein_id="CAA17029.1"
FT                   /translation="MDSDLDRILPIASRALLCEGNRDWAGAYVSYCKVLEEMKKSSAAR
FT                   DRMGLGPLTGAEACSWNGLYDNCLSKASKLRKTILESEMERQNYQLAAKLSKKAPVDLH
FT                   PLRPVRSQTPAYTPMTTRMMYRQTRGAQSEVNLSTPKQIYSKHSPPSTSTSSIVSSSYG
FT                   DAPSYLAPSKPNRSPPLKPEDPFASFNSSASAIAAASKSAAASASALSSDTGRSATMNS
FT                   TTFPTAMKSQSTTKPTLSNSVSSPSIQVSNNQNANNSTPLSFHAPIPPLHVPAVPLTSA
FT                   SHSSSDGKSRKHPSPYKPYLNSSHDTLGSSTRPSSADTAGSPATSPPATADSKTIVSKT
FT                   ISASTTQQTEPLQQTTPSSDFEYAIMNEIISNHEPVYWSDIAGLDDAKNSLKEAVIYPF
FT                   LRPELFQGLREPVQGMLLFGPPGTGKTMLARAVATEAKATFFSISASSLTSKYLGDSEK
FT                   LVRALFEVAKRQTCSVIFVDEIDSILSARNDSGNEHESSRRLKTEFLIQWSSLTNAAPD
FT                   KQTGHSPRVLVLAATNLPWCIDEAARRRFVKRTYIPLPEKETRYKHLSHLLHNQVHCLT
FT                   EEDLEELVNLTEGYSGSDITALAKDAAMGPLRNLGDALLTTSAEMIPPISLNHFKASLR
FT                   TIRPSVSQEGIHRYEEWNKQFGSQR"
FT   5'UTR           complement(682627..682675)
FT                   /locus_tag="SPBC947.01"
FT   misc_RNA        683098..683487
FT                   /gene_synonym="SPNG1264"
FT                   /locus_tag="SPNCRNA.323"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           684100..684142
FT                   /gene="dps1"
FT                   /gene_synonym="SPBPJ694.01"
FT                   /locus_tag="SPBPJ4664.01"
FT   CDS_pept        join(684143..685117,685199..685360)
FT                   /transl_table=1
FT                   /gene="dps1"
FT                   /gene_synonym="SPBPJ694.01"
FT                   /locus_tag="SPBPJ4664.01"
FT                   /product="decaprenyl diphosphate synthase subunit Dps1"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPJ4664.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPJ4664.01.1"
FT                   /db_xref="GOA:O43091"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="PomBase:SPBPJ4664.01"
FT                   /db_xref="PomBase:SPBPJ4664.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43091"
FT                   /protein_id="CAB66154.1"
FT                   /translation="MIQYVYLKHMRKLWSLGKVRSTVLRFSTTNRNASHLIKNELEQIS
FT                   PGIRQMLNSNSEFLEECSKYYTIAQGKQMRPSLVLLMSKATSLCHGIDRSVVGDKYIDD
FT                   DDLRSFSTGQILPSQLRLAQITEMIHIASLLHDDVIDHANVRRGSPSSNVAFGNRRSIL
FT                   AGNFILARASTAMARLRNPQVTELLATVIADLVRGEFLQLKNTMDPSSLEIKQSNFDYY
FT                   IEKSFLKTASLISKSCKASTILGQCSPTVATAAGEYGRCIGTAFQLMDDVLDYTSKDDT
FT                   LGKAAGADLKLGLATAPVLFAWKKYPELGAMIVNRFNHPSDIQRARSLVECTDAIEQTI
FT                   TWAKEYIKKAKDSLLCLPDSPARKALFALADKVITRKK"
FT   intron          685118..685198
FT                   /gene="dps1"
FT                   /gene_synonym="SPBPJ694.01"
FT                   /locus_tag="SPBPJ4664.01"
FT   3'UTR           685361..685682
FT                   /gene="dps1"
FT                   /gene_synonym="SPBPJ694.01"
FT                   /locus_tag="SPBPJ4664.01"
FT   5'UTR           687626..687715
FT                   /locus_tag="SPBPJ4664.02"
FT   CDS_pept        687716..699631
FT                   /transl_table=1
FT                   /locus_tag="SPBPJ4664.02"
FT                   /product="cell surface glycoprotein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPJ4664.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPJ4664.02.1"
FT                   /db_xref="GOA:Q96WV6"
FT                   /db_xref="InterPro:IPR009306"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="PomBase:SPBPJ4664.02"
FT                   /db_xref="PomBase:SPBPJ4664.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96WV6"
FT                   /protein_id="CAC38347.1"
FT                   /translation="MVEKTSPILITLCIFLLIPISSALPFQTFEESLKLKSNISHTGSF
FT                   FANLSQSYSSTSIIHSVSSPVDCSLDVNNQINTINITSVSAGTNELFLPTLSHAHANDR
FT                   EASLFFPYTDIRYNGFPEPSNTDSTSILSFNTIRLIPSTNVINTSHYKGFNRYPTISST
FT                   VKVGKRAATASFSYTNVSSSVIATAYTSASSTILSSPSVEQSTPSIITQTESSTTTEGS
FT                   SVASSESTIANSDQSSFITYESTQNPTANKTDASQQSTESTSSSASAYSYITTLQTATT
FT                   AQQTTSENTYSTSGPNLTTSNTSPQISSTISSSSFIVESPSVALSTSSTTTITNASTPA
FT                   ANTIISRSSKPTDTTNSISFANTTPENTSTQITSPTAVNSSTPITSSSVLNSSTPITSS
FT                   SILNTSTPITSSSVLNSSTPITSSSILNSSTPITSSTVLNSSTPITSSTALNTSTPITS
FT                   SSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPIT
FT                   SSSVLNSSTPITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPI
FT                   TSSTVVNTSTPITRYSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTALNTSTP
FT                   ITSSSVLNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTST
FT                   PITSSSVLNSSTAITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSS
FT                   TPITSSSILNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVLNS
FT                   STPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSSVLNSSTPITSSTALN
FT                   TSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVL
FT                   NSSTPITSSTGLNTSTPITSSSVLNSSTPITSSTVLNSSTPITSSTALNTSTPITSSSV
FT                   LNSSTPITSSSVLNTSTPITSSSVLNSSTAITSSTALNTSTPITSSSVLNSSTPITSST
FT                   VVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSSTPITSS
FT                   SVLNSSTPITSSTVVNTSTPITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITS
FT                   STVVNSSTPITSSTVVNTSTPITSSTVVNTSTPITSSTVVNSSTPITSSTVLNTSTPIT
FT                   SSSVLNSSTPITSSSILNSSTPITSSSVLNSSTPITSSTVVNSSTPITSSTALNTSIPI
FT                   TSSSVLNSSTPITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTP
FT                   ITSSTVVNSSTPITSSTVVNTSTPITSSTVVNTSTPITSSTVVNSSTPITSSTVLNSST
FT                   PITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTVVNTSTPITSSSVLNSS
FT                   TPITSSTVVNTSTPITSSTVVNSSTPITSSTVVNTSTPITSSTVVNTSTPITSSTVVNS
FT                   STPITSSTVLNTSTPITSSSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVVN
FT                   SSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVL
FT                   NSSTPITSSTALNTSPPITSSTVVNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTA
FT                   LNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTVVNSSTPITSST
FT                   ALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSS
FT                   SVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITS
FT                   STALNTSTPITSSSVLNSSTPITSSTVLNSSTPITSSTALNTSTPITSSSVLNSSTPIT
FT                   SSSVLNSSTPITSSTVVNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPI
FT                   TSSSVLNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTP
FT                   ITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSSTPITSSTALNTST
FT                   PITSSSVLNSSTPITSSSVLNSSTPITSSTVVNSSTPITSSSVLNSSTPITSSTALNTS
FT                   TPITSSSVLNSSTPITSSTVVNSSTPITSSTVVNTSTPITSSTVVNTSTPITSSTVVNS
FT                   STPITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTVVN
FT                   TSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVL
FT                   NSSTPITSSTVVNTSTPITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSV
FT                   LNSSTPITSSTVVNTSTSITSSSVLNSSTPITSSSVLNSSTPITSSTVVNSSTPITSSS
FT                   VLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSS
FT                   TVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSLTALNSSTPITS
FT                   SSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPIT
FT                   SSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPI
FT                   TSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTP
FT                   ITSSTVVNTSTPITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSST
FT                   PITSSTVLNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTS
FT                   TSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNS
FT                   STPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSSTPITSSTVVN
FT                   TSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSTVL
FT                   NSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTAITSSSIVNSSTPITSSSV
FT                   LNSSTAITSSSILNSSTPITSSSILNSSTPITSSTVVNSSTPITSSTTLNTSTPITSSS
FT                   VLNSSTAITSSSIVNSSTPITSSSVLNSSTPITSSTTLNTSTPITSSSVLNSSTAITSS
FT                   SVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITS
FT                   STVVNSSTPITSSTTLNTSTPITSSSVLNSSTAITSSTALNTSTPITSSSVLNSSTAIT
FT                   SSSILNSSTPVTSSSVLNSSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPI
FT                   TSSTVVNSSTPITSSTALNTSTPITSSTVVNSSTPITSSSVLNSSTAIASSSILNSSTP
FT                   ITSSSVLNSSTPISSSTVITSSVVIGSSSVLSYASSIVSSVSLNSSLLSSSGGFSSSAF
FT                   STGSSSFSLTSENGSVSSSSLVSSSPVLSGYSESSFDSSVFVPSSVSRSFSYSRFSSGS
FT                   LDSSSVFNSTTVSTASGISQGSVLSSTRAIESESTASHRSSVLSELSSYDLSTSAFSSS
FT                   SSEPSTLDYSVSSSSLSSSIGVGSSFSSNSKVTSNKVPSTVSPHSSSISDTKSPATVTI
FT                   SSSSGQFTHSTFSTGSTMHNTVSHATSTSSSFTTSHLPTNTLASTFDNSQSIFSSSSGV
FT                   PGLSTKSSSLGKIGSSSISLTLSSSSIRDAELPTPSRMTSPSLSETIPQSSSISEASTS
FT                   NPNILSSTVLSFDSTITNSFTTASTSIMKTTSLNSNSYKWYNSTTQSVYYNATSSTVPW
FT                   SNSTFRNTSNTMTSRFVSNDFNSTISLQPVVQFNNFTKREITTILITASDGSAVTTSLS
FT                   TFYSASSLASSVVKPLYILSTFFVAAVFFIIF"
FT   3'UTR           699632..699886
FT                   /locus_tag="SPBPJ4664.02"
FT   misc_RNA        complement(700027..701807)
FT                   /locus_tag="SPNCRNA.1381"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           700291..700363
FT                   /gene="mfm3"
FT                   /locus_tag="SPBPJ4664.03"
FT   CDS_pept        join(700364..700476,700544..700556)
FT                   /transl_table=1
FT                   /gene="mfm3"
FT                   /locus_tag="SPBPJ4664.03"
FT                   /product="M-factor precursor Mfm3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPJ4664.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPJ4664.03.1"
FT                   /db_xref="GOA:P40849"
FT                   /db_xref="InterPro:IPR005555"
FT                   /db_xref="PomBase:SPBPJ4664.03"
FT                   /db_xref="PomBase:SPBPJ4664.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40849"
FT                   /protein_id="CAC38348.1"
FT                   /translation="MDSMANTVSSSVVNTGNKPSETLNKTVKNYTPKVPYMCVIA"
FT   3'UTR           700557..700700
FT                   /gene="mfm3"
FT                   /locus_tag="SPBPJ4664.03"
FT   5'UTR           701799..701889
FT                   /locus_tag="SPBPJ4664.04"
FT   CDS_pept        701890..705513
FT                   /transl_table=1
FT                   /locus_tag="SPBPJ4664.04"
FT                   /product="coatomer alpha subunit (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPJ4664.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPJ4664.04.1"
FT                   /db_xref="GOA:Q96WV5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PDB:4J87"
FT                   /db_xref="PDB:4J8B"
FT                   /db_xref="PDB:4J8G"
FT                   /db_xref="PomBase:SPBPJ4664.04"
FT                   /db_xref="PomBase:SPBPJ4664.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96WV5"
FT                   /protein_id="CAC38349.1"
FT                   /translation="MEMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTL
FT                   LDRFDGHDGPVRGIAFHPTQPLFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFH
FT                   HEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRV
FT                   WDISGLRMKNAAPVSMSLEDQLAQAHNSISNDLFGSTDAIVKFVLEGHDRGVNWCAFHP
FT                   TLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIR
FT                   VWDLNRRTAVQTFRRDNDRFWFITVHPKLNLFAAAHDSGVMVFKLERERPAHALNINTL
FT                   LYVNKEKSIVSYDLLRAQSTTVASVKHLGSAWLPPRSLSYNPAEKVALLTSSADNGVYE
FT                   LVNVSSRSNSLPLKDNIKGPGDDAIFVARNRFAVFSRSDQTIEIKDLSNKVTKTIQLPE
FT                   KTRDIFFAGMGHVLLSTATQVHLFDLQQKKIVSSFNANRVKYVVWSNDNSQAALLGKHY
FT                   VYIVKKNLELITSIHETIRIKSAVWVENNVLLYATLDHLKYALMSGDTGVIKTLESTLY
FT                   LVKAKGNMVFALNRAAEPVSFEIDPTEYLFKLALLRKDYEQVLHLIQNSNLVGQAIIAY
FT                   LQKKGYPEIALQFVEDPSTRFELALECGNLETALELARTIDRPEVWSRLASDAMSYGNH
FT                   KIAEITFQKLRYFEKLSFLYLITGNAEKLQKMAIIAEKRNDTLSLFQNSLYLNEVESRI
FT                   NILEQAGMYPIAYLTAKSNGLEEKAQQILSHCNKTEEEIKLPSLGSAFTTPVPVNETYT
FT                   HNWPLLDTSHSTFEKSLQERMEQLAIERQEEQESEEEYEEVEQSLMDVVDEMSDLAESV
FT                   PEEEVDGWEVEDLAPEEAVNDVVDDASAFVGADEIFLWKRNSPLAADHIAAGDFESAMK
FT                   ILNKQVGAINFSPLKTRFLEIYTASRVYLPTISGLDPLVSYVRRNAETAERSQALPFIT
FT                   RNLASIKSHELHEAYRLVKANKILEAQICFRSIIYLALTTVANSEEEADEISALIDECC
FT                   RYIVALSCELERRRLGEEDTKRALELSYYFASADLQPMHSIIALRLAINASHKLKNYKS
FT                   ASFLGNKLLQLAESGPAAEAANRAITLGDRNPHDAFEIEYDPHVEMRICPKTLTPVYSG
FT                   DDFDVCSVCGAVYHKGYVNEVCTVCDVGGIGQKGTGRRFFA"
FT   3'UTR           705514..705817
FT                   /locus_tag="SPBPJ4664.04"
FT   5'UTR           705788..705931
FT                   /locus_tag="SPBPJ4664.05"
FT   CDS_pept        join(705932..706077,706141..706666)
FT                   /transl_table=1
FT                   /locus_tag="SPBPJ4664.05"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPJ4664.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPJ4664.05.1"
FT                   /db_xref="GOA:Q96WV4"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="PomBase:SPBPJ4664.05"
FT                   /db_xref="PomBase:SPBPJ4664.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96WV4"
FT                   /protein_id="CAC38350.2"
FT                   /translation="MSSAISRSRFNSFILHTVATANLIWAFNWINHNSDVAIRRSYGSH
FT                   FQHLTVLSLAVTLLSMVVGLFSDISGSLTLVKLKNILLYIVCPLETIVSILYWSIVSYD
FT                   RSLLIPKDRPVPLPLNFDISVHLMPTVYTLIDYLFFSPPFSLSIGPSLLVYLSIAVSYM
FT                   LWVEKCYQMNKFYAYPILAILDPIKKTIFYTVASIISFSCYIVLKMVHPYALPSGAPPR
FT                   S"
FT   3'UTR           706667..707245
FT                   /locus_tag="SPBPJ4664.05"
FT   5'UTR           707511..707587
FT                   /gene="gpt1"
FT                   /locus_tag="SPBPJ4664.06"
FT   CDS_pept        707588..711934
FT                   /transl_table=1
FT                   /gene="gpt1"
FT                   /locus_tag="SPBPJ4664.06"
FT                   /product="UDP-glucose-glycoprotein glucosyltransferase
FT                   Gpt1"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPBPJ4664.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBPJ4664.06.1"
FT                   /db_xref="GOA:Q09140"
FT                   /db_xref="InterPro:IPR009448"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040497"
FT                   /db_xref="InterPro:IPR040525"
FT                   /db_xref="InterPro:IPR040692"
FT                   /db_xref="InterPro:IPR040693"
FT                   /db_xref="InterPro:IPR040694"
FT                   /db_xref="PomBase:SPBPJ4664.06"
FT                   /db_xref="PomBase:SPBPJ4664.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09140"
FT                   /protein_id="CAC38351.1"
FT                   /translation="MRWGFWFAIATLITICYAAKPLDVKIAATFNAPSFSALIAESLYQ
FT                   EKKEGFIWYLNHLSDLLDAENTTEKELYINVVNSLKREYVLSDEELSSLQFSLGLFSGA
FT                   PKLQAFSSIVQSRSCDCDTWLQLDEESQVCFSDLPKDSPLFSKLYSKNPLDYEVVKTSA
FT                   TGIPYAVVVTSFERDLIPFHELYYKLALEGKCNYVIRYSPPSSSKLNSKLYVKGFGTHV
FT                   SLKRTDYLVVDDREFPREKGDNPASFTSSRNKRSNERLFGMTSDSLQTVTPDKIAILDL
FT                   LATQSIASSTDMLTAFRELTQDFPIYAHYLSIQPDVSNDLIEELNQFQSQYVPEGINTI
FT                   WLNGLSLDLEETDAFSILSLIKKEKDMFDRFEALGIKSSKVLDIVTNEAFANEDSDFKF
FT                   VKFHCQDDIEDWKAIHWVNEIESNPKYDNWPKSIQILLKPIYPGQLHMLGKQLHTVIYP
FT                   IFPSSPSSLPLLSELIQFSRRPSPVQTGMVCAANDDDEFAQTVCKSFFYISKESGTDSA
FT                   LKFLYKCLNSDSSADLYSLLEEHLPLSEHDDDTLANLKKDLSSSFFDHYMSKSNSWVNR
FT                   LGIDSSASEVIVNGRIISHDENYDRSMYGIFLEDIPEVQIAVAEGKISEDDNLLDFILR
FT                   DASLTRNPLVYPSAKSSIKSIDIKRVLENVGSLNHEDILLIGSSNAKYSFWLVADFNEK
FT                   EGLEILSLLADLLSENKDANLMLIQEGKNHVVPPLFAKLLSSPKRSSKHLQEILNSSLD
FT                   PSSGVVNDMDKALKFLKKSKAVVKELGLTGECKSALLLNGRMICSFSVDSLNTADLKML
FT                   MQMEYDNYLSKLSNIAGSSRRLKNSRAISFLSSYLKTLESTPMSTSSPTKEEKLFPRDF
FT                   IYNKLGVGNATFETDDFSKAYYQFVAVLDPLSKDSQKWSAILEAVSKLNGVGVRIHFNP
FT                   KQTLSELPLTRFYRYSISAEPEFDALGHLEESYVEFDNLPADTLLTMDIEARDAWTVMQ
FT                   KDVDIDLFNIKLEHTSEAEALDSHTAIYELKNILVQGYSQEEFRKSPPRGMQLKLGNLT
FT                   NSHVTDTIVLSNLGYFQLKANPGVWTLEPMDGRSSQFYEILSLNKKNSYKDPQVIVDSF
FT                   EGVTLNPVMRRKPGFESADIMDEDLSSHKFFDKIKKSLSFFNFKRKEASINIFSVASGH
FT                   LYERFLYIMTKSVIEHTDKKVKFWFIENFLSPSFKSSIPAIAKKYNFEYEYITYNWPHW
FT                   LRKQEEKQREIWGYKILFLDVLFPLELHKVIYVDADQIVRADLQELMDMDLHGAPYGYT
FT                   PMCDSREEMEGFRFWKKGYWKKFLRGLKYHISALYVVDLDRFRKMGAGDLLRRQYQLLS
FT                   ADPNSLSNLDQDLPNHLQHLIPIYSLPQDWLWCETWCSDESLKTAKTIDLCQNPLTKEK
FT                   KLDRARRQVSEWTSYDNEIASVLQTASSQSDKEFEEKDNNSSPDEL"
FT   3'UTR           711935..712426
FT                   /gene="gpt1"
FT                   /locus_tag="SPBPJ4664.06"
FT   5'UTR           712424..712511
FT                   /gene="rpn3"
FT                   /gene_synonym="SPBPJ4664.07"
FT                   /locus_tag="SPBC119.01"
FT   CDS_pept        join(712512..712530,712577..712672,712717..714095)
FT                   /transl_table=1
FT                   /gene="rpn3"
FT                   /gene_synonym="SPBPJ4664.07"
FT                   /locus_tag="SPBC119.01"
FT                   /product="19S proteasome regulatory subunit Rpn3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.01.1"
FT                   /db_xref="GOA:O42897"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="InterPro:IPR035267"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PomBase:SPBC119.01"
FT                   /db_xref="PomBase:SPBC119.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42897"
FT                   /protein_id="CAC38352.2"
FT                   /translation="MIDDQRDMQVDSVNQEENVDSGETKQNTVTEVPRTVLQDVEANIA
FT                   ALMQATKQRDPRLVYRSLRTTSNICHRLNADVLGQLIKKYYSFDNSLKNELLELIDMPQ
FT                   NGDDSSTSITNGNGNTIFPEVDMYLQLLLSMTLYYNEKYEVGAEYIKKVIARLQSYDRR
FT                   TLDQIAAKLYFYYILFFEKCNRSVECRNTLLSVHRTASLRHDSETQAMVLTLLLRNYIQ
FT                   FNLYDQADRLVSKTSFLTNASNNLAIRYQYYLGRIRAIQLDYTTAHEHLVSAIRKAPNT
FT                   VYAVQFLEAVYKLHIVVQLLMGEIPERRIFRQKSLEKTLVPYLRISQAVRIGDLCAFTD
FT                   ALSKYEAEFRFDGLYTLICRLRHTVIKTGLRMISLSYSRISLRDVCIKLGLDSEESAEY
FT                   IVAKGIRDGVIDASIDHSNAFMASNEAMDIYSTEQPQQAFHERIQFCLALHNDSIKSMR
FT                   YPMDAHKSELEGVEEARRRMDKEMAEADLDDDEPDLGEF"
FT   3'UTR           714096..714152
FT                   /gene="rpn3"
FT                   /gene_synonym="SPBPJ4664.07"
FT                   /locus_tag="SPBC119.01"
FT   misc_RNA        complement(714523..715767)
FT                   /locus_tag="SPNCRNA.1382"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           715227..715332
FT                   /gene="ubc4"
FT                   /locus_tag="SPBC119.02"
FT   CDS_pept        join(715333..715452,715532..715609,715981..716226)
FT                   /transl_table=1
FT                   /gene="ubc4"
FT                   /locus_tag="SPBC119.02"
FT                   /product="ubiquitin conjugating enzyme Ubc4"
FT                   /EC_number="6.3.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.02.1"
FT                   /db_xref="GOA:P46595"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="PDB:4II2"
FT                   /db_xref="PomBase:SPBC119.02"
FT                   /db_xref="PomBase:SPBC119.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46595"
FT                   /protein_id="CAA17917.1"
FT                   /translation="MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPY
FT                   AGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLL
FT                   SICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI"
FT   intron          715453..715531
FT                   /gene="ubc4"
FT                   /locus_tag="SPBC119.02"
FT   intron          715610..715980
FT                   /gene="ubc4"
FT                   /locus_tag="SPBC119.02"
FT   3'UTR           716227..716311
FT                   /gene="ubc4"
FT                   /locus_tag="SPBC119.02"
FT   tRNA            717076..717148
FT                   /locus_tag="SPBTRNATRP.02"
FT                   /product="tRNA Tryptophan"
FT   5'UTR           717888..717965
FT                   /locus_tag="SPBC119.03"
FT   CDS_pept        717966..718766
FT                   /transl_table=1
FT                   /locus_tag="SPBC119.03"
FT                   /product="human COMT homolog 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.03.1"
FT                   /db_xref="GOA:O42898"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:5ZY5"
FT                   /db_xref="PDB:5ZY6"
FT                   /db_xref="PomBase:SPBC119.03"
FT                   /db_xref="PomBase:SPBC119.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42898"
FT                   /protein_id="CAA17918.1"
FT                   /translation="MPHMEDNGSEKEQLFLQHIQNLPQERLDAIRGHPELVLKEIDEFT
FT                   YPDGSGVRMCIGDVKGGFIVGKIRERKPKIMVELGGYLGYSAILFGNEISKIPGGRYYS
FT                   LEVNEDYAKIAYELVKLAGLDEIVTIMIGKACDSLVELQQKLLHKDLGFQALDMVFIDH
FT                   WKDLYVPDLRVIESLNMIAPGTLLVADNIITPGAPEYHKYVNMSPEERRGYQAKVRNVN
FT                   GFDFIGRWDLIYKTETKEFEGVIRNKHRKDAVDVTECVGYAKKD"
FT   3'UTR           718767..718991
FT                   /locus_tag="SPBC119.03"
FT   misc_RNA        719163..719617
FT                   /gene_synonym="SPNG1268"
FT                   /locus_tag="SPNCRNA.324"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           719585..719805
FT                   /gene="mei3"
FT                   /locus_tag="SPBC119.04"
FT   CDS_pept        719806..720252
FT                   /transl_table=1
FT                   /gene="mei3"
FT                   /locus_tag="SPBC119.04"
FT                   /product="meiosis inducing protein Mei3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.04.1"
FT                   /db_xref="GOA:P08090"
FT                   /db_xref="PomBase:SPBC119.04"
FT                   /db_xref="PomBase:SPBC119.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08090"
FT                   /protein_id="CAA17919.1"
FT                   /translation="MSSQNTSNSRHPASSASALPNRTNTARRSTSPRTSTGSSSTNTNT
FT                   KTVDHAGTTFISSTSKRGRSTKAGSVHSVPMKRTKRVRRTPAQRIEHENKENIQTEKVY
FT                   RIKPVQRVLSPSDLTNELTILDLFHVPRPNETFDITDRVNNTSR"
FT   3'UTR           720253..720990
FT                   /gene="mei3"
FT                   /locus_tag="SPBC119.04"
FT   misc_RNA        720414..720516
FT                   /gene_synonym="SPNG1269"
FT                   /locus_tag="SPNCRNA.325"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(721007..721452)
FT                   /locus_tag="SPBC119.05c"
FT   CDS_pept        complement(721453..722343)
FT                   /transl_table=1
FT                   /locus_tag="SPBC119.05c"
FT                   /product="Wiskott-Aldrich syndrome homolog binding protein
FT                   Lsb1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.05c.1"
FT                   /db_xref="GOA:O43125"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="PomBase:SPBC119.05c"
FT                   /db_xref="PomBase:SPBC119.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43125"
FT                   /protein_id="CAA17920.1"
FT                   /translation="MDHKNYLNHVIRGIYNDFQFLVDEGVVERSALDWVHANIHLQDGP
FT                   ASPVTAPAAQPVESSVPLPLPKRKSSVEKRAGSVASAVAAMSLSQNSGEKRTPEEPRKL
FT                   PGVPAPQKQSEASSVNSSTEKLPPPPSYPGPNTAHKNVERVLAMYDFPGPDAGDLGFHA
FT                   GEVIIVLEHVNNDWWRGELNGKEGIFPSNYVRLLEDSAVKAQPPPPPPQQNYPPAASSS
FT                   APPMQYQQTAYPPQQAPYPPVQAYPQAPQQPIVVAQPTEHKHSSTFKKIGSGLGSAFVF
FT                   GAGATAGADLVNSIF"
FT   5'UTR           complement(722344..722432)
FT                   /locus_tag="SPBC119.05c"
FT   5'UTR           723524..723758
FT                   /gene="sco1"
FT                   /locus_tag="SPBC119.06"
FT   CDS_pept        723759..724550
FT                   /transl_table=1
FT                   /gene="sco1"
FT                   /locus_tag="SPBC119.06"
FT                   /product="copper chaperone Sco1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.06.1"
FT                   /db_xref="GOA:O42899"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PomBase:SPBC119.06"
FT                   /db_xref="PomBase:SPBC119.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42899"
FT                   /protein_id="CAA17921.1"
FT                   /translation="MFRRGLVFSRHCHYSLIRPRFPLNRTCLARFADGRKNLATDNRTQ
FT                   TYQSWRGMISIRALLLAAATSVGLYAYFQHEKKKVLERQNDKVLATIGRPQLGGAFSLI
FT                   DHHGNRVTDNDFKGKFSLIYFGFTRCPDICPDELDKMSAAIDIVNNVVGDVVYPIFITC
FT                   DPARDPPQEMAEYLEDFNPKIVGLTGSYEEIKDICKKFRVYFSTPKNIDPKKDDYLVDH
FT                   SVFFYLMDPEGKFIEVFGRNSTSEDLARAIGSYYLSRKKQK"
FT   3'UTR           724551..725026
FT                   /gene="sco1"
FT                   /locus_tag="SPBC119.06"
FT   5'UTR           725306..725342
FT                   /gene="ppk19"
FT                   /gene_synonym="vps15"
FT                   /locus_tag="SPBC119.07"
FT   CDS_pept        join(725343..725428,725481..725608,725683..726260,
FT                   726318..730646)
FT                   /transl_table=1
FT                   /gene="ppk19"
FT                   /gene_synonym="vps15"
FT                   /locus_tag="SPBC119.07"
FT                   /product="serine/threonine protein kinase Ppk19"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.07.1"
FT                   /db_xref="GOA:O42900"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC119.07"
FT                   /db_xref="PomBase:SPBC119.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42900"
FT                   /protein_id="CAA17922.1"
FT                   /translation="MGIQLSTIQTPQFHELFEEELPEYHNERSLGDSHFLRTFRMQDRK
FT                   GYDVLIKVFVNKLPEISLSSIVNLLKEEQENISYRVPNAVPYIKTLVTLRAAYLVRPYV
FT                   THNLYDRISTRPFLELTEKKWIMFQLLKGISDCHRLGVCHGDIKSENILITSWNWAYLS
FT                   DFSSFKPTYLPEDNPADYGYFFDTSSRRVCNIAPERFVPASQLQPAPLSPAMDIFSLGC
FT                   VFAELLLEESPLFTLSQLFSYKAHGSYDLQSVLEQIEDKSTQNMILSMLDRDPSQRLSA
FT                   DAYLQKYRGTVFPACFYDTLYDYCIGLVDPSGILSAKQPNDACSLYGSRIDDIYRDIMP
FT                   PNNNDISNLMHTPHEYNGIDSYSVPLFTTLDEFYNKNPAAKNWYLRLYNTMQEKKGFED
FT                   KEQGSTPAPSPSVIEDISSIETDENHLYGAAVLLPIVLSTIRHVNTRESKINALSLVQI
FT                   LSRNICDESKLDTVLPFVMTLLRDQYADVRISALITITRLVSNVTSIAPINAFLFQEYL
FT                   FPDLQHFLFDMNSRTRATYASCLPILAKQASKFLNLAQSLRNAGILSFPESEYENINHG
FT                   KAELLFETGRHDLVVTVERHVSTLLADSSSIVRRSLLNALAPLCVFFGKAKSNDLILSH
FT                   LITYLNDTDWMLRCAFFESITGLSIFIGPRSVDEYILPLMLQALVDPEPAVLESVLGSF
FT                   SGLIELHLFEKLVVVDILQLVLPLVAVPNAYIRRAALSVIYSAYQSFDDIDRDCIVTPL
FT                   LRPYLMSNLCDINSLEKLDQFILPMVSDSVWSTLTRWYEESENSSFWKCDKDASYSSLD
FT                   VSNDSLLGRTKNLQKREIMHHAEVYTHKKISLTGHVIITSTEMLELSEDDQKWADIIKE
FT                   MGVDVKHLWVLANLRDYVKKTKINLNGINYKRQSGLRELNTYPNAPLHILPETIFWNPE
FT                   RPPSSSIANETFLDRNSYAESIQTSRSYNDDLIARDPIAYVGTDMTNAFGTTTKPKDVS
FT                   QSDIKVDINRESNSDNGETITGTHDVYRQTDNPEIKLPSDTASSKVDTHNPTVTQPTDD
FT                   TGGLNSYNTENPLLTNNTLEPSSVEAIVSSKDSDKHAKESKGKSLAPLISSRVSTNDTT
FT                   NVAGIRSQRSFTTHIDLKKLTTRQNGAKKSSYTGTNPCVLNYLNKIYAEAAASTLNVGA
FT                   AVSPSWASNIPLRRRTKVSAKAANKIVQTHEWHPEGSRVAQIYLGSLLDGGTKKVLVSP
FT                   DSSFFVTLGSDGVVRAWQLVESVRHISTMRCECRLSYGHTRRNGERNRFSVVNGCFLGN
FT                   TYAFASVTQDGSVEVHRLDVNNQRHTLISAGRIPNLDFSDSVTSMEASTFHDGSIRLVV
FT                   VTKWSRIVYLDVGMMRVLSSDQLPLQCGSATSVVVSEGCNWALIGTTKGWLLLWDLRFG
FT                   TLSCSWHMPARIDQMHLLLDVTKKRSNVNEYTSGNNNSPVTKVPGSSSTSSSSTQPINS
FT                   TIPINPLENHGMLNSFGSTTVSISFSVLTNLDNKEVNLEDAVPASHRSASGIVNFDVEK
FT                   GKTEEVFLENWNSSLTSPIPVSVGIDAFNEKKKFDIDSGNDMGLRDLNTKFDSPWPCIS
FT                   SPIYRYRGPSAGSVEREPLFLIAASGSPHAFIWNPHNVSASSSVTNDSESSKLSLIHNK
FT                   PPIYQKVSEQQNVRPKSSGVSRPLLFLQQQKNLPSENRLHPIVDMAFLYQPYAIVLIVD
FT                   AFGSLELWT"
FT   3'UTR           730647..730835
FT                   /gene="ppk19"
FT                   /gene_synonym="vps15"
FT                   /locus_tag="SPBC119.07"
FT   5'UTR           730796..730859
FT                   /gene="pmk1"
FT                   /gene_synonym="spm1"
FT                   /locus_tag="SPBC119.08"
FT   CDS_pept        join(730860..730925,731026..731205,731479..731550,
FT                   731633..732583)
FT                   /transl_table=1
FT                   /gene="pmk1"
FT                   /gene_synonym="spm1"
FT                   /locus_tag="SPBC119.08"
FT                   /product="MAP kinase Pmk1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.08.1"
FT                   /db_xref="GOA:Q92398"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPBC119.08"
FT                   /db_xref="PomBase:SPBC119.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92398"
FT                   /protein_id="CAA17923.1"
FT                   /translation="MDRRHRVYRVFNQEMYVEPNFKVVKELGQGAYGIVCAARNVASKD
FT                   QEAVAIKKITNVFSKSILTKRALREIKLLIHFRNHRNITCIYDLDIINPYNFNEVYIYE
FT                   ELMEADLNAIIKSGQPLTDAHFQSFIYQILCGLKYIHSANVIHRDLKPGNLLVNADCEL
FT                   KICDFGLARGCSENPEENPGFMTEYVATRWYRAPEIMLSFSSYHKGIDVWSVGCILAEL
FT                   LGGTPLFKGKDFVHQLNLILHQLGTPDEETLSHISSSRAQEYVRSLPKQRPIPFETNFP
FT                   KANPLALDLLAKLLAFDPNRRISVDDALEHPYLAVWHDPSDEPVCDSVFDFSFEYIEDA
FT                   NELRRVILDEVLNFRQKVRRRSHPTNPTVNIPQPAQTVPSNDNGSFNVSSSSSSQTSNK
FT                   KRHDHSYNETAAIDHKSDDNRHN"
FT   3'UTR           732584..732952
FT                   /gene="pmk1"
FT                   /gene_synonym="spm1"
FT                   /locus_tag="SPBC119.08"
FT   3'UTR           complement(732953..733674)
FT                   /locus_tag="SPBC119.09c"
FT   CDS_pept        complement(733675..734235)
FT                   /transl_table=1
FT                   /locus_tag="SPBC119.09c"
FT                   /product="ORMDL family protein (predicted)"
FT                   /db_xref="GOA:O42901"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42901"
FT                   /protein_id="CAA17924.1"
FT                   /translation="MGSSSSRRRSSSLVTKVPKPTIDDRLDQGSATNYNSNWVNYKGAW
FT                   VIHIVLIAALRLIFHAIPSVSRELAWTLTNLTYMAGSFIMFHWVTGTPFEFNGGAYDRL
FT                   TMWEQLDEGNQYTPARKYLLVLPIILFLMSTHYTHYNGWMFLVNIWALFMVLIPKLPAV
FT                   HRKRIFGIQKLSLRDDDNDSIPR"
FT   5'UTR           complement(734236..734825)
FT                   /locus_tag="SPBC119.09c"
FT   5'UTR           join(734996..735288,735384..735415)
FT                   /gene="asn1"
FT                   /locus_tag="SPBC119.10"
FT   CDS_pept        735416..737089
FT                   /transl_table=1
FT                   /gene="asn1"
FT                   /locus_tag="SPBC119.10"
FT                   /product="asparagine synthetase"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.10.1"
FT                   /db_xref="GOA:P78753"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="PomBase:SPBC119.10"
FT                   /db_xref="PomBase:SPBC119.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78753"
FT                   /protein_id="CAA17925.1"
FT                   /translation="MCGILAVHHVAEDIEAFKPKALHLSKQLRHRGPDWSGKAIRNQTI
FT                   LCHERLAIVGVESGAQPLVSDDGKLVLTVNGEIYNHLKLRENLKGNYKFKTYSDCEVIL
FT                   YLYREHGPACANMLDGMFSWVLYDQDKDKVVAARDPIGITTLYQGFSSDSPDTAYFASE
FT                   LKALHPVCDKIIAFPPGHYYDSETKQTVRYFKPSWWDENKIPSNPVDYKLLRETLEASV
FT                   RKRLMAEVPYGVLLSGGLDSSLIASIAARETEKLANSTSQSEEARTITAWPKLHSFAIG
FT                   LPGSPDLLAARKVADFLHTFHHEHTFTIDEGLDALRDVIYHLETYDVTTIRASTPMYLL
FT                   SRKIKAQGVKMVLSGEGSDEIFGGYLYFGNAPSREAFHSECVRRVKNLHLSDCLRANKS
FT                   TMAWGLEARVPFLDKDFLEVALNIDPEEKMYINGRKEKYILRKAFDTTHDSSLQPYLPQ
FT                   DILWRQKEQFSDGVGYSWIDALKDTAELCISDDEFALPRREWGDDIPTTKEAFWYRKLF
FT                   DEIFPRQCADTVMRWVPKAEWGCPEDPSGRYQAGHVAALK"
FT   3'UTR           737090..737295
FT                   /gene="asn1"
FT                   /locus_tag="SPBC119.10"
FT   3'UTR           complement(737503..737703)
FT                   /gene="pac1"
FT                   /gene_synonym="hcs"
FT                   /locus_tag="SPBC119.11c"
FT   CDS_pept        complement(737704..738795)
FT                   /transl_table=1
FT                   /gene="pac1"
FT                   /gene_synonym="hcs"
FT                   /locus_tag="SPBC119.11c"
FT                   /product="double-strand-specific ribonuclease Pac1"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.11c.1"
FT                   /db_xref="GOA:P22192"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="PomBase:SPBC119.11c"
FT                   /db_xref="PomBase:SPBC119.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22192"
FT                   /protein_id="CAA17926.1"
FT                   /translation="MGRFKRHHEGDSDSSSSASDSLSRGRRSLGHKRSSHIKNRQYYIL
FT                   EKKIRKLMFAMKALLEETKHSTKDDVNLVIPGSTWSHIEGVYEMLKSRHDRQNEPVIEE
FT                   PSSHPKNQKNQENNEPTSEEFEEGEYPPPLPPLRSEKLKEQVFMHISRAYEIYPNQSNP
FT                   NELLDIHNERLEFLGDSFFNLFTTRIIFSKFPQMDEGSLSKLRAKFVGNESADKFARLY
FT                   GFDKTLVLSYSAEKDQLRKSQKVIADTFEAYLGALILDGQEETAFQWVSRLLQPKIANI
FT                   TVQRPIDKLAKSKLFHKYSTLGHIEYRWVDGAGGSAEGYVIACIFNGKEVARAWGANQK
FT                   DAGSRAAMQALEVLAKDYSKFAR"
FT   5'UTR           complement(738796..738906)
FT                   /gene="pac1"
FT                   /gene_synonym="hcs"
FT                   /locus_tag="SPBC119.11c"
FT   repeat_region   739738..740096
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        complement(740133..741158)
FT                   /locus_tag="SPNCRNA.1383"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           740220..740274
FT                   /locus_tag="SPBC119.12"
FT   CDS_pept        740275..741480
FT                   /transl_table=1
FT                   /locus_tag="SPBC119.12"
FT                   /product="Golgi matrix protein (predicted)"
FT                   /db_xref="GOA:O42903"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR019459"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42903"
FT                   /protein_id="CAA17927.1"
FT                   /translation="MAENAGNETKLVENENLQEDLSRLNLEDEKNELKLNEKGGVLKEN
FT                   DEHLECSESFKKLAEKEEAYQTLKNSYNSLKQQHSNLLGKVSGIKSTLGERLKKDSQEL
FT                   AQNRKRIQELEKSLGDAEEALKLSNEETVTLTAQVESLTQDITDLRQQNASLVEENQLL
FT                   STQSKQWERRARDEHEMQESLAVRLADCEEQLARETERQEQYEVEIQRHLTNQHQLEIE
FT                   LESTKASHTENLGELTRNWQKAMDDVTEKFASKSKEYEDLQNELDATQKRLSRVSDLEH
FT                   EVKEKTLLIGKLQHEAVVLNEHLTKALCMLKDGNNAEKIDKQLISNLFVSFLTLPRADT
FT                   KRFEILQLISSVLDWNDTQREQTGLQRPGSSVNNWSIPHSASSNSLFSDHSFSKRRSFH
FT                   DS"
FT   3'UTR           741481..741876
FT                   /locus_tag="SPBC119.12"
FT   3'UTR           complement(741836..741962)
FT                   /gene="prp31"
FT                   /locus_tag="SPBC119.13c"
FT   CDS_pept        complement(741963..743519)
FT                   /transl_table=1
FT                   /gene="prp31"
FT                   /locus_tag="SPBC119.13c"
FT                   /product="U4/U6 x U5 tri-snRNP complex subunit Prp31"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.13c.1"
FT                   /db_xref="GOA:O42904"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR019175"
FT                   /db_xref="InterPro:IPR027105"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="PomBase:SPBC119.13c"
FT                   /db_xref="PomBase:SPBC119.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42904"
FT                   /protein_id="CAA17928.1"
FT                   /translation="MSLADELLADLDDIEETTESTITDELGPDAKKRRLELQLEEGNGI
FT                   SAELENDLDITKISDSAQKLPSEVANKFNDNNENIYQLLNSTRLRDIIEGTEKYKGTEK
FT                   QAITGNIEDDLEYHLIVDSNSIAMEIDDEILRLHRLVKEWYHDRFPELSSLVLNAFDYC
FT                   KTVSSLLNDLDNSKTKLSFLPSATVMVIATTATTTVGKPLPDEMIKNVKNCCEAIQQLG
FT                   EEKQKIIEYVQSRISVVAPNLSAVVGSTTAANLIGIAGGLTRLGKFPACNLPALGKRRL
FT                   TTIGINNPAVSGDYGFLYMSEIVQKTPPDVRKQAIRMTAAKVALAARIDSIHEYPDGSF
FT                   GISARKEVERKIEKLLEPPSQKPTVALPVPDDRPKRRRGGRRIRKMKEQYAVTELRRLQ
FT                   NRVAFGKEEAEVFNFDETEGLGMLGQEGEGKIRAVSIDSRTKLRLPKARKAQLQSMAQK
FT                   NPLAASGLQSSLSFTPIQGIELVNPLLQRQQKVEEANKWFRDGVFTQIKKDSNEPKNKF
FT                   S"
FT   5'UTR           complement(743520..743917)
FT                   /gene="prp31"
FT                   /locus_tag="SPBC119.13c"
FT   5'UTR           743879..744068
FT                   /locus_tag="SPBC119.18"
FT   CDS_pept        join(744069..744107,744170..744340)
FT                   /transl_table=1
FT                   /locus_tag="SPBC119.18"
FT                   /product="mitochondrial distribution and morphology protein
FT                   Mdm35 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.18"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.18.1"
FT                   /db_xref="GOA:Q96VG1"
FT                   /db_xref="InterPro:IPR007918"
FT                   /db_xref="PomBase:SPBC119.18"
FT                   /db_xref="PomBase:SPBC119.18.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96VG1"
FT                   /protein_id="CAC51385.1"
FT                   /translation="MSSSVSEECTPAKKKYDACFNDWYANKFLKGDLHNRDCDELFAEY
FT                   KSCLLKALKTKKIDPLLEAARKED"
FT   3'UTR           744341..744637
FT                   /locus_tag="SPBC119.18"
FT   tRNA            complement(744754..744835)
FT                   /locus_tag="SPBTRNASER.05"
FT                   /product="tRNA Serine"
FT   3'UTR           complement(745971..749244)
FT                   /locus_tag="SPBC119.16c"
FT   CDS_pept        join(746035..746265,746364..746447,746601..746780,
FT                   746839..747091,747144..747222,747268..747556)
FT                   /transl_table=1
FT                   /gene="rti1"
FT                   /gene_synonym="rad22B"
FT                   /locus_tag="SPBC119.14"
FT                   /product="Rad22 homolog Rti1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.14.1"
FT                   /db_xref="GOA:O42905"
FT                   /db_xref="InterPro:IPR004585"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="InterPro:IPR042525"
FT                   /db_xref="PomBase:SPBC119.14"
FT                   /db_xref="PomBase:SPBC119.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42905"
FT                   /protein_id="CAA17929.1"
FT                   /translation="MGSLPDQSSCEEFTDSQQDKMTKLLAMQLGPEYISRRSGPGGGSV
FT                   TYLEAWKAIELANEIFGFNGWSSSIQDIHVDYVEETKEKKFNVGISVIVRVTLKDGSFH
FT                   EDVGYGSIENCRVKALAYEKCKKEGTTDALKRALRNFGSSMGNCLYDKRYIQKILKMAP
FT                   AQAEFNYDNLLRANKRPYARFAQKVSTPIESHANKSVKLEHKNSIEKKISNVDKPISDL
FT                   IENDIHESLPALQNPPIQSHSETDLYADEELDSILMHHERPPIPESPRVEEFEELLNQF
FT                   EGDEKVSVDKIDAHDKMTEAQVVKIPPVQFMNARVAAAENPHIKHEGMAFQLHKKSNSI
FT                   LKSSNIDHNRSMPIRRPSLTSNNSANTFSTK"
FT   3'UTR           747557..747734
FT                   /gene="rti1"
FT                   /gene_synonym="rad22B"
FT                   /locus_tag="SPBC119.14"
FT   5'UTR           747778..747851
FT                   /locus_tag="SPBC119.15"
FT   CDS_pept        join(747852..747909,747984..748137,748194..749085)
FT                   /transl_table=1
FT                   /locus_tag="SPBC119.15"
FT                   /product="AAA family ATPase at the interface between RNA
FT                   polymerase II and chaperone (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.15.1"
FT                   /db_xref="GOA:O42906"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030230"
FT                   /db_xref="PomBase:SPBC119.15"
FT                   /db_xref="PomBase:SPBC119.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42906"
FT                   /protein_id="CAA17930.1"
FT                   /translation="MTDKEKKPCAIIVVGMAGSGKTTFMQQLNAHLHSKNKPPYILNLD
FT                   PAVRNLPYEANIDIRDTINYKEVMKQYNLGPNGGIMTSLNLFVTKFDQVLKILEKRAPT
FT                   VDHILIDTPGQIEIFQWSASGSIICDTLASSWPTCIAYVVDTPRATSTSTWMSSMLYAC
FT                   SMLYKAKLPLIIVYNKCDVQDSEFAKKWMTDFEEFQQAVTKDEGMSSEGATSGYMGSLV
FT                   NSMSLMLEEFYRHLDFVSCSSVTGEGMDDFLEAVKAKVKEYEEEYVPEMERMKEIQRQT
FT                   KERQKEAQLSKLMKDMHVSKDKEDVGLTVSDAEDEYNGELVDPDEDDGLTAEDREDMIK
FT                   QYRVALGISDDISDEKLLEMLTERMKQ"
FT   3'UTR           749086..749216
FT                   /locus_tag="SPBC119.15"
FT   CDS_pept        complement(749245..750591)
FT                   /transl_table=1
FT                   /locus_tag="SPBC119.16c"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC119.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC119.16c.1"
FT                   /db_xref="GOA:O42907"
FT                   /db_xref="InterPro:IPR018626"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="PomBase:SPBC119.16c"
FT                   /db_xref="PomBase:SPBC119.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42907"
FT                   /protein_id="CAA17931.1"
FT                   /translation="MSIQAIVLATFDAKEGYNVENYYPGDFNVEGIEYLLFPSGIQELD
FT                   NCTIFFRFQDQLCLSVFSKLQHPSFERSAFFTSVGLILSDDINFGEAVVKYGETLLYIA
FT                   NGLSLATLKYKFGEDASETYASEKCTSHQLSDSDFFKSLQTSAVNLEFDSLFEKLQGNK
FT                   FAILGANSKELSQSYATILLDHLGPAFYCLYKFALQRKRILLISSHDDQLYSIIDMIVR
FT                   LSSIKRSSDASIPILLSDLHPFYSVGLANTSTLLDNDLEEGWIACTTDTVLLSKSSLYD
FT                   LALYWPDNSFNANKYPQIFNSNSIRIKPSYDDLINFKGLSRYLSFDGESSWGLTTYSLA
FT                   SKYIFNTSHHNLTDQEFLNENMLDYFQRYNQKLLTVLSSNAESFNVSDMQTLGLNPCHS
FT                   LDKSFVSEISQIWLKKHINWQYGKYFWLRRVSLIFLASTCFLFILWKLL"
FT   5'UTR           complement(750592..750738)
FT                   /locus_tag="SPBC119.16c"
FT   5'UTR           750719..750785
FT                   /gene_synonym="SPBC577.01"
FT                   /locus_tag="SPBC119.17"
FT   CDS_pept        join(750786..750905,750957..753815)
FT                   /transl_table=1
FT                   /gene_synonym="SPBC577.01"
FT                   /locus_tag="SPBC119.17"
FT                   /product="mitochondrial metalloendopeptidase (predicted)"
FT                   /db_xref="GOA:O42908"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42908"
FT                   /protein_id="CAA17932.4"
FT                   /translation="MNYAKLSIAFSKKTIKTHNCRLFQRWLHVGDKVHDFRVVDTKKVP
FT                   ELQLNYTRLKHEPTNADMIHLDREDPNSVFSIGFQTPAENDEGIPHILEHTTLCGSNKY
FT                   PVRDPFFKMLNRSLATFMNAFTASDFTFYPFATVNTTDYKNLRDVYLDATLFPKLRKLD
FT                   FLQEGWRFEHADVNDKKSPIIFNGVVYNEMKGQVSDSSYIFYMLFQQHLFQGTAYGFNS
FT                   GGDPLAIPDLKYEELVKFHRSHYHPSNAKILSYGSFPLEDNLSALSETFRPFSKRELNL
FT                   PNTFLKEFDQEKRVVEYGPLDPVMAPGRQVKTSISFLANDTSNVYETFALKVLSKLCFD
FT                   GFSSPFYKALIESGLGTDFAPNSGYDSTTKRGIFSVGLEGASEESLAKIENLVYSIFND
FT                   LALKGFENEKLEAILHQMEISLKHKSAHFGIGLAQSLPFNWFNGADPADWLSFNKQIEW
FT                   LKQKNSDGKLFQKLIKKYILENKSRFVFTMLPSSTFPQRLQEAEAKKLQERTSKLTDED
FT                   IAEIEKTSVKLLEAQSTPADTSCLPTLSVSDIPETIDETKLKFLDIAGMKAQWYDLAAG
FT                   LTYIRLLLPLKNFPESLIPYLPVYCDACLNLGTHSESIGDLEHQIRRYTGGISISPSAV
FT                   TNNSDVSKYELGIAISGYALDKNVGKLVELINKAFWNTNLSNTDKLAIMLKTSVSGITD
FT                   GIAEKGHSFAKVSSASGLTEKTSITEQLGGLTQVKLLSQLSREESFGPLVEKLTAIREI
FT                   LRGTSGFKAAINASPTQHEVVEKALQKFMKSRGVNQQTQTKSTSKERNGINSIKTYHEL
FT                   PFQTYFAAKSCLGVPYTHPDGAPLQILSSLLTHKYLHGEIREKGGAYGAGLSYSGIDGV
FT                   LSFFTYRDSDPIRSLSVFDEASEWATTHEFSQRDIDEAKLAVFQGIDSPVSESQKGMLY
FT                   FVDGVTDEMLQNRRKQLLNVSANDLKAVAKKYLVNPKKSYTAVLGPKSEKQLPTWVIDK
FT                   FES"
FT   3'UTR           753816..754123
FT                   /gene_synonym="SPBC577.01"
FT                   /locus_tag="SPBC119.17"
FT   3'UTR           complement(754411..755559)
FT                   /locus_tag="SPBC577.03c"
FT   5'UTR           754621..754651
FT                   /gene="rpl3801"
FT                   /gene_synonym="rpl38-1"
FT                   /locus_tag="SPBC577.02"
FT   CDS_pept        join(754652..754654,754784..754970,755150..755184)
FT                   /transl_table=1
FT                   /gene="rpl3801"
FT                   /gene_synonym="rpl38-1"
FT                   /locus_tag="SPBC577.02"
FT                   /product="60S ribosomal protein L38 (predicted)"
FT                   /db_xref="GOA:Q9USR7"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR7"
FT                   /protein_id="CAB54810.1"
FT                   /translation="MPRQISDIKQFLEIARRKDATSARIKKNTNKDVKFKLRCSKYLYT
FT                   LVVADAKKAEKLRQSLPPDLTVTEVGKKA"
FT   intron          754971..755149
FT                   /gene="rpl3801"
FT                   /gene_synonym="rpl38-1"
FT                   /locus_tag="SPBC577.02"
FT   3'UTR           755185..755300
FT                   /gene="rpl3801"
FT                   /gene_synonym="rpl38-1"
FT                   /locus_tag="SPBC577.02"
FT   CDS_pept        complement(join(755560..756023,756097..756283))
FT                   /transl_table=1
FT                   /locus_tag="SPBC577.03c"
FT                   /product="GCN5-related N-acetyltransferase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.03c.1"
FT                   /db_xref="GOA:Q9USR6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039135"
FT                   /db_xref="PomBase:SPBC577.03c"
FT                   /db_xref="PomBase:SPBC577.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR6"
FT                   /protein_id="CAB54811.1"
FT                   /translation="MKINQNTTVDCGNLILVPYQKCHVLKYHNWMKNEELQELTCSEPL
FT                   TLDEEYQMQASWSTDEDKLTFIVLLNENDEAKKPSILDHVKAHSVESMIGDVNMFLTEE
FT                   YADGIEEFDDSPSDANATNATKESEVHIVGELELMIAEPQNRRKGYGTKIVDAFLHYVE
FT                   SSGIAKNKQILKYRVKVGSQNKPSIRLFKKLGFSQVKYNAYFDHVELELMRTS"
FT   5'UTR           complement(756284..756616)
FT                   /locus_tag="SPBC577.03c"
FT   5'UTR           756549..756659
FT                   /locus_tag="SPBC577.04"
FT   CDS_pept        join(756660..756973,757057..757345)
FT                   /transl_table=1
FT                   /locus_tag="SPBC577.04"
FT                   /product="human THOC5 ortholog (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.04.1"
FT                   /db_xref="GOA:Q9USR5"
FT                   /db_xref="InterPro:IPR019163"
FT                   /db_xref="PomBase:SPBC577.04"
FT                   /db_xref="PomBase:SPBC577.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR5"
FT                   /protein_id="CAB54812.1"
FT                   /translation="MTENAISDCLNVLDSTRTLCLRIHELKQHSRDADDQNPEQIKRQL
FT                   MSKLLILREANRKSYEQLVQAKTITAEHKSELDNARIRLQALQYKKLHLKTIIKNYEEK
FT                   EHIYTALPLVSKEEFLKEHPEFKSSNDHDLMLAILEDELKERQRLSTLKQELLKRKAAL
FT                   ISENKAKRNALQKGDEKLQTFLRSSVPVQEYYNITSM"
FT   3'UTR           757346..758027
FT                   /locus_tag="SPBC577.04"
FT   3'UTR           complement(757399..757565)
FT                   /gene="rec27"
FT                   /gene_synonym="mug41"
FT                   /locus_tag="SPBC577.05c"
FT   CDS_pept        complement(join(757566..757746,757796..757951,
FT                   758130..758197))
FT                   /transl_table=1
FT                   /gene="rec27"
FT                   /gene_synonym="mug41"
FT                   /locus_tag="SPBC577.05c"
FT                   /product="meiotic recombination protein Rec27"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.05c.1"
FT                   /db_xref="GOA:Q9USR4"
FT                   /db_xref="PomBase:SPBC577.05c"
FT                   /db_xref="PomBase:SPBC577.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR4"
FT                   /protein_id="CAB54813.1"
FT                   /translation="MATHSCKGFMNVNLKKKQLQITSSEIIEHVLEELNLKNIERRVKK
FT                   YDQIESEYKTNIENEKKAFIKDVSQVQQKIKEFEIQKANQIKQLNEEKLSIEARKQQLE
FT                   IEIRNQLLQYAEKLRIVVKTPMNQPTNTEV"
FT   3'UTR           complement(758321..758407)
FT                   /gene="stt4"
FT                   /locus_tag="SPBC577.06c"
FT   CDS_pept        complement(join(758408..758421,758475..759495,
FT                   759535..760340,760382..764166,764222..764229))
FT                   /transl_table=1
FT                   /gene="stt4"
FT                   /locus_tag="SPBC577.06c"
FT                   /product="1-phosphatidylinositol 4-kinase Stt4 (predicted)"
FT                   /EC_number="2.7.1.67"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.06c.1"
FT                   /db_xref="GOA:Q9USR3"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="PomBase:SPBC577.06c"
FT                   /db_xref="PomBase:SPBC577.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR3"
FT                   /protein_id="CAB54814.1"
FT                   /translation="MDCIDKSIRRESLRKLGCLPDHGWNLFVQSSNRYSKLLEADSKLF
FT                   KAQRIEDTVLSICEVTLENKASENALTLFQQLRFYLLNYLFLEDTSEYKSVLCSLDESV
FT                   YPNLLPLTANICPCILKALLALVRQHRELSSDIVKFLNSIFLALTRILNTPHSSNNNPT
FT                   HTKTTIFEKVFYASHLGFFFEEIADACISALPQDACLWAMEVCNTILVSDLPCKLIDLH
FT                   NDSFLHHSNYYAGFGLSYYLYLSSMKAYINSSGCLWYEDATSFWDIVKHRPSSPEEKPF
FT                   LTQFQSILNLSDKFLSKTGTLRLQEKLGTSCNLFFVLVLKLALLSSSYIGFVPYTYSDW
FT                   INVLLGSISEDPELLPHLIELMASLACVFPTHFQFAMKRLRLIAIYAPRFDDGNVTYAQ
FT                   LASRKLAQLFNYSSRDTAITSIYQFANLLSPADTPDSYLAAPKERLSISDNMSSSSSQT
FT                   ATVNTISNYLNVIDSVREIALTVNDEKIYGLAISLLIQKFSRKFDSRVSTELVRTLADI
FT                   STKANDRDFSILVQFYSIQNKMLVKNGDEALTIAICDSRCLIARGTESNSFKRSDLLKS
FT                   LLEEIIHIGIVRDTPAPELKGYYFGMSKAVQALVECVAGTDWSSLPKEEMYPALFRDMW
FT                   FTLVINRFRYSVDLGETLEVDLENIAKNSPLLVFEDFGSNFESNLELNTVLRTHIEHSV
FT                   ISQIKSELLVRVPNIDLKPLSTSEICFLSAVLLLESLRCKSNKLSALVEYLLDPSLRDS
FT                   QLPQSIRAIALYNLTSFVESLSKERRVASSTIDEFQKLLCLCCNRVDCVRQLALECMNY
FT                   IMETLPHLLGIKEILFSVLELSSLLWKARTEECTDQYVPQLLYKSNKLNLSVILSDIYS
FT                   CREEVLFQFNRHARSWIQNSSKAIPYQVKNLLESYLADFVDFDDLEVVELGRSLAVELG
FT                   TRIVSSDRDNFVLPAFGNWTPDTSSEFMAEYTIRQRYSHVDNSILNIEGDMSTDRIDLI
FT                   LNEKSKLFETHLAALKSLEDDILQGNTVSPQRLRNEVRKAAAHAVQEPIFQFSVLARKI
FT                   VRIPFLDFSPSSFKLGITLWNWMMNQVPSFSSFLISNIIRNWKNEIVTEKRGYFSTAKS
FT                   KSPLALPMTYSPTERASFLSYKNKVMSQMIPHLLLLQLIAGNFEGFWYGDRQTAKLIVH
FT                   FMKFVLKKITSMEVNLNVLTRELHFKFVSFGLRIAENLLNSPLGSRFYNLCVDAGLCWF
FT                   SGMPNWTYGADKLHVAAEISVMRSLRDKLDSFLLRYPLKVSTTLKQKLLIILLNNEMYM
FT                   LYTWLTPVLHGRNVRMVEPIPDSDAASSPITLEMLQVAWNVSPNIVLYAPKRFQNAPLK
FT                   QMALNFVIANPFTSVKHEVALEYLFEHYPSGEFPIDRKFILYWEPMYPVSGPVMFMPNV
FT                   KWNPQLLQYTMRSMESYPVSVTFFYVPQIVQSLRYDSMGYAESFILETSGTSQLFAHQI
FT                   LWNMKANLYKDEAATVPDSIKPILDRVMDKMINSLSGEDKQFYEREFTFFNEVTSISGK
FT                   LKPFIRKSKPEKKAKIDEEMKKIKLDVGVYLPSNPDGVIVGIDRKSGKPLQSHAKAPFM
FT                   ATFKIRKEKLVDADPEELAVNGTEEEAGDSAKKQTYEVWQSAIFKVGDDCRQDVLTLQL
FT                   IAMFKNIFNSVGLDVYLFPYRVTATNPGCGVIDVLPNCISRDMLGREAVNGLYDYFRTK
FT                   FGDEDSIAFQKARSNFVQSMAAYSVITYLLQFKDRHNGNIMIDDQGHILHIDFGFIFDI
FT                   APGGITFESAPFKLTTEMIAVMGGSNKSQPFQWFQELCVKAFLACRPYAHYICQAVEVM
FT                   LDSGLPCFKGQLTITHCLERFALNLNERQASTFMLHLIEQSYANKRTLMYDQFQKATNG
FT                   IPY"
FT   5'UTR           complement(764230..764577)
FT                   /gene="stt4"
FT                   /locus_tag="SPBC577.06c"
FT   5'UTR           764540..764595
FT                   /gene="ubp10"
FT                   /locus_tag="SPBC577.07"
FT   CDS_pept        join(764596..764784,764833..765169,765271..766253)
FT                   /transl_table=1
FT                   /gene="ubp10"
FT                   /locus_tag="SPBC577.07"
FT                   /product="ubiquitin C-terminal hydrolase Ubp10 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.07.1"
FT                   /db_xref="GOA:Q9USR2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR033809"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PomBase:SPBC577.07"
FT                   /db_xref="PomBase:SPBC577.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR2"
FT                   /protein_id="CAB54815.1"
FT                   /translation="MSENKDKNNILKRHIEEDNNIDNGKRKKLELGKDMEDVHDIASKE
FT                   MEEHETTPIISQNLYLDTINRKLLDFDFEKVCSVSLTNLSVYACLVCGRYFQGRGPSSH
FT                   AYFHALTENHHVFVNCSTLKFYVLPESYQVESSALQDIAYVMRPTFTKLEVQRLDHTPQ
FT                   LSYDLMLKPYVPGFVGMNNIKNNDYFNVVIHMLAHVKPFRNYFLLKNFDNCPQLVQRLA
FT                   ILIRKLWNHKAFKSHVSPQELIQEVTVLSHKKYSINEQKDPVEFLSWFLNTLHNCLGGK
FT                   KSTIAKPTSIVHYSFQGFVRIESQKIRQHAEKGEQVVFTGDRVIQTNVVPFLYLTLDLP
FT                   PKPIFQDEFEGNIIPQVELKEILNKYNGVHTQELAGMRRRFHLMTAPPYFIFHIKRFMK
FT                   NNYFTERNQTIVTFPLDDFDMSPFIDDSFIQSNPKISTKYNLVANIIHESVTHAEEEFH
FT                   NFRIQIRNPSTNKWYQIQDLYVEEISSDMIRLGESFIQLWERSS"
FT   3'UTR           766254..766395
FT                   /gene="ubp10"
FT                   /locus_tag="SPBC577.07"
FT   3'UTR           complement(766352..766553)
FT                   /gene="txl1"
FT                   /gene_synonym="trx3"
FT                   /locus_tag="SPBC577.08c"
FT   CDS_pept        complement(join(766554..767202,767255..767478))
FT                   /transl_table=1
FT                   /gene="txl1"
FT                   /gene_synonym="trx3"
FT                   /locus_tag="SPBC577.08c"
FT                   /product="thioredoxin-like I protein Txl1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.08c.1"
FT                   /db_xref="GOA:Q9USR1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="PomBase:SPBC577.08c"
FT                   /db_xref="PomBase:SPBC577.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR1"
FT                   /protein_id="CAB54816.1"
FT                   /translation="MSVIEIRSYQHWISTIPKSGYLAVDCYADWCGPCKAISPLFSQLA
FT                   SKYASPKFVFAKVNVDEQRQIASGLGVKAMPTFVFFENGKQIDMLTGANPQALKEKVAL
FT                   ISSKATGTGALASSSSAPVKGFASLQGCIENPQLECLNQQDDHDLKSAFNSNPSSFLES
FT                   DVDEQLMIYIPFLEVVKVHSIAITPVKGETSSAPKTIKLYINQPNNLSFEDAESFTPTQ
FT                   VIEDIVYEQDDQPTIIPLRFVKFQRVNSLVIFIYSNVGEEETTKISRLELFGEPVGDSS
FT                   KGKLQKVEA"
FT   5'UTR           complement(767479..767536)
FT                   /gene="txl1"
FT                   /gene_synonym="trx3"
FT                   /locus_tag="SPBC577.08c"
FT   5'UTR           767556..767781
FT                   /gene="ckn1"
FT                   /locus_tag="SPBC577.09"
FT   CDS_pept        join(767782..767818,767869..768016,768080..768187,
FT                   768268..768385,768434..768512,768557..769281)
FT                   /transl_table=1
FT                   /gene="ckn1"
FT                   /locus_tag="SPBC577.09"
FT                   /product="ERCC-8 DNA repair homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.09.1"
FT                   /db_xref="GOA:Q9USR0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR042238"
FT                   /db_xref="PomBase:SPBC577.09"
FT                   /db_xref="PomBase:SPBC577.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USR0"
FT                   /protein_id="CAB54817.1"
FT                   /translation="MNSFLLAREWGQEPNSSFRRQLLQHRLQRLALNPDVKIKRRHGAG
FT                   ILGSVNALSIDNTIHQLMVSGGANSSINVWDLQNIDQKEDEDLILDTLNAVPARTSHKF
FT                   GITDLHWFPFDNGIFTSSSFDHTLKVWDVSTLQEAYTFTMEDMIYSHAWSPIASHCLIA
FT                   TAYRSSSIRLCDMQSGSYTHSLSGHTGNVLAVDWCPKNEFVLASGSADGTCRLWDIRKV
FT                   SSSFACMDLHNKYLPSNQTNISHYGTVNGLAWTSDARYLASCGTDDRIRVWNMESGRNT
FT                   LREFGPIIHNQTTSFAVHPCMIQPSMDSDVFVLFPNDDGSLALLNLLEGSFVRRLSTHS
FT                   LKRINCAAYRPDFEQCFTGDMNGNIYMWSPKALKSPTKISDLETRRNIIQEVYDSLINI
FT                   PVTYQ"
FT   3'UTR           769282..769555
FT                   /gene="ckn1"
FT                   /locus_tag="SPBC577.09"
FT   5'UTR           769641..769681
FT                   /locus_tag="SPBC577.10"
FT   CDS_pept        769682..770470
FT                   /transl_table=1
FT                   /locus_tag="SPBC577.10"
FT                   /product="20S proteasome component beta 7 (predicted)"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.10.1"
FT                   /db_xref="GOA:Q9USQ9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="PomBase:SPBC577.10"
FT                   /db_xref="PomBase:SPBC577.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ9"
FT                   /protein_id="CAB54818.1"
FT                   /translation="MSFLELTEVWGKPQKDIFFPSGSEVEESTDAPIQRTVQPIVTGSS
FT                   VLALKFADGVMIAADNLASYGSLARFYDVERLTKVGDNTIVGAGGDISDYQQIQRLLEK
FT                   LEIKEGNYGDGYALQPSYIHEYLSKVLYARRNKLDPYWNQLIVAGVDGENKEPYVAFAD
FT                   LRGTTYSAPAIATGFAMHLALPMLRKATDDDRWKTLSKESARATIDECMRVLFYRDARS
FT                   LNKFSVATITPEGIEFQTDQSVSSKWAFAEKQYGYGTQTV"
FT   3'UTR           770471..770937
FT                   /locus_tag="SPBC577.10"
FT   5'UTR           771284..771317
FT                   /locus_tag="SPBC577.11"
FT   CDS_pept        join(771318..771575,771756..771855,771986..772347)
FT                   /transl_table=1
FT                   /locus_tag="SPBC577.11"
FT                   /product="DUF3074 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.11.1"
FT                   /db_xref="GOA:Q9USQ8"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR024500"
FT                   /db_xref="PomBase:SPBC577.11"
FT                   /db_xref="PomBase:SPBC577.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ8"
FT                   /protein_id="CAB54819.1"
FT                   /translation="MQQDLFGSDSICPISSDDVLKATDPNFESWRERIVQDALKIVEQI
FT                   PKWKHLGNHDGVALYEKAPAYTGHTWYGRVSKHTRSLKTFKKGLLYEHIKKEADYDPLV
FT                   FSAHQLETIIEDEIEIWMYKYKTPWFFRNRVYRQLVVSVMLDPDSFIVLQTPVTYPGSS
FT                   SGGGNGVVALYDSVDFVSKKLDGDGKEEGVLWICAVRNDYGSMFSGLFSDTTFTKSLVR
FT                   QVKLYNEWLNRTYPRKG"
FT   3'UTR           772348..773342
FT                   /locus_tag="SPBC577.11"
FT   5'UTR           773121..773479
FT                   /gene="mug71"
FT                   /locus_tag="SPBC577.12"
FT   CDS_pept        join(773480..774485,774581..775395)
FT                   /transl_table=1
FT                   /gene="mug71"
FT                   /locus_tag="SPBC577.12"
FT                   /product="endoribonuclease (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.12.1"
FT                   /db_xref="GOA:Q9USQ7"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="PomBase:SPBC577.12"
FT                   /db_xref="PomBase:SPBC577.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ7"
FT                   /protein_id="CAB54820.1"
FT                   /translation="MKVLGLISGGKDSCFNLMHCVSLGHEVVALANLHPEDGKDEIDSF
FT                   MYQSVGHDVIPLYAECFDLPLYREKIGGQSINQNLDYQFTEKDETEDLYRLIKRVLTNH
FT                   PDLEAVSTGAILSTYQRTRVENVCKRLGLKSLSFLWQKDQEKLLNDMVVSGLNAILIKV
FT                   AAIGLTRKDLGKSLAEMQDKLLTLNKKFELHPCGEGGEYETLVLDCPLFKKRIVLTDKE
FT                   VVEHSSGEVCYLKVKACVKDKPEWQPISLKSELVPNEELLGEEYSHIYHTISKKYELID
FT                   DQEETPTSLIPIPLRESAFQQKKGSFLVLGNVVATKGSYNTFQGEAESAINNLNELLGT
FT                   YGYSNKNVYFVTVILSSMSKFAEFNSVYNKYFDFTNPPSRSCVAAPLASEYRIVMSCIV
FT                   GDVTEKRALHVQGQSYWAPANIGPYSQSICANGVVFISGQIGLIPSVMELKLHDKIFEM
FT                   VLALQHANRVAKAMRVGSLIACLAYVCDSRDADCVVKIWSEYTKNTGESSPVLVALVDA
FT                   LPRNASVEWQLLYNDSSCDVPLLSSLVTNQTLFGSDTAWDVALLNQNGLRMESSFIHHE
FT                   HPSAYAIVLNNAFPNSQLLHVRYTARDQNV"
FT   3'UTR           775396..775489
FT                   /gene="mug71"
FT                   /locus_tag="SPBC577.12"
FT   5'UTR           775718..775772
FT                   /gene="syj2"
FT                   /locus_tag="SPBC577.13"
FT   CDS_pept        join(775773..778006,778052..778270,778316..778367,
FT                   778418..778582)
FT                   /transl_table=1
FT                   /gene="syj2"
FT                   /locus_tag="SPBC577.13"
FT                   /product="inositol-polyphosphate 5-phosphatase,
FT                   synaptojanin homolog 2 (predicted)"
FT                   /EC_number="3.1.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.13.1"
FT                   /db_xref="GOA:Q9USQ6"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="PomBase:SPBC577.13"
FT                   /db_xref="PomBase:SPBC577.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ6"
FT                   /protein_id="CAB54821.1"
FT                   /translation="MQCYLKRKERSVAFITEKYAAIIQKPSVKDSDCIITFTCISLEEF
FT                   EKIKEYELLFGGEKILGTLGLFNYVCEDMKEGVFLCVARKAKLVLRIGNRDPISKLENV
FT                   SFISLDQELWDEELFEPMPRNSSPSSTFSTSTSDLNNIEKDNLVNSEYSSKYSSTTRIY
FT                   PYHSLSQLTDLLTDGSFYVSTNISCFSRFQSEQPYGPKDIYCWNRFLITELDNHFSEAH
FT                   ILEKFPNLLLHCFRGYVERMFIDSMSMSIISKVSSYGSRQTYPPSGIDDSSYCSMFVET
FT                   EFIVEIAQTVFSFVQVRGTVPCFWEEQFSSWYGPSISFLRSSQASQSLFNFHFSKLYKA
FT                   YGDIYVIDLLQTKGFEASLYEAYKHHLMLLPFPAVVKKFHFTPDPARPDIDPRLETDLA
FT                   DDLKEMGYTQKSIENDMLESFQKGVFRINDLDCLGRTNVIQYQISRLVLKDIFFNLQIG
FT                   VTFNILEYLRHLWSNNGDAIAKLITGVGSIGSSATRRGRKSIAGSLSDISKSFGRMYVG
FT                   RYPDVESQNAILLLLGCFPNQSPVLISESVSSYIQGVLRQRRSEYRVERDFSIFSSTFN
FT                   ANGKVPSTDEFKRLLLPFGERTSAYDLYVVAVQEIITLNMSHLVSSSNQKLRIWEEKIL
FT                   MILNSRDSNNKYMLISSIQMAGVFLGVFIRKDDHLVVSKVTKTTRKTGFGGFSANKGAV
FT                   AIEMNVCDSDFCFVSSHFAPKVNNISERNMEYTSISDNLVFPSGMKIYDHTNILWMGDF
FT                   NYRIDSDNEEVRKLVELDDLDKLASYDQLCTEMKKGTVFHGLVEPQLTFLPTYKFDNGT
FT                   NDYDTSDKQRVPSWTDRILATKSFTRNCYKSCDIRCSDHRPVFATFSLKIFSTCMDKKA
FT                   GIIRDARIAYIKSKNSNK"
FT   3'UTR           778583..778721
FT                   /gene="syj2"
FT                   /locus_tag="SPBC577.13"
FT   3'UTR           complement(778749..779187)
FT                   /gene="spa1"
FT                   /gene_synonym="spa"
FT                   /locus_tag="SPBC577.14c"
FT   CDS_pept        complement(join(779188..779667,779669..779869))
FT                   /transl_table=1
FT                   /gene="spa1"
FT                   /gene_synonym="spa"
FT                   /locus_tag="SPBC577.14c"
FT                   /product="ornithine decarboxylase antizyme with +1
FT                   programmed ribosomal frameshift Spa1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.14c.1"
FT                   /db_xref="GOA:Q9USQ5"
FT                   /db_xref="InterPro:IPR002993"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038581"
FT                   /db_xref="PomBase:SPBC577.14c"
FT                   /db_xref="PomBase:SPBC577.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ5"
FT                   /protein_id="CAB54822.2"
FT                   /translation="MAFRNRMYQLSNVDDADADILNSHFAPNPRGQNHTHGRRRNTLAL
FT                   CTTKDQMFVYGSTPAGGAEWCSEALERSRPRAAFKQQRRRHVPRWISDSFRTCLPKPSG
FT                   ILKEQTVNEEEGNSRHRGKYDCDERIGVAESMNYWHGIVRTEEDGSKTLFLIPESWEDV
FT                   HLKEGLVAIIDLAVDRLHCSKLVLFVDKNNSSLPYLVKSLHWVGFEPLPHLNCSDHALF
FT                   GMEL"
FT   5'UTR           complement(779870..779965)
FT                   /gene="spa1"
FT                   /gene_synonym="spa"
FT                   /locus_tag="SPBC577.14c"
FT   3'UTR           complement(780599..781071)
FT                   /gene="sim3"
FT                   /locus_tag="SPBC577.15c"
FT   CDS_pept        complement(781072..782262)
FT                   /transl_table=1
FT                   /gene="sim3"
FT                   /locus_tag="SPBC577.15c"
FT                   /product="NASP family CENP-A chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC577.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC577.15c.1"
FT                   /db_xref="GOA:Q9USQ4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019544"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="PomBase:SPBC577.15c"
FT                   /db_xref="PomBase:SPBC577.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USQ4"
FT                   /protein_id="CAB54823.1"
FT                   /translation="MSSDTKTLENSKGNSATDADTKNPSSSDSRAIEQLVTQGNMAYAQ
FT                   KNYEEAVDKYGQALMQSESIHGSESLENRNVLWLYGKSLFQIAIENSQVLGNALGAKES
FT                   VSQATESFEEPEAIGSFTFSGQKIENKYTVNEENSSIAHPEKESEEKETNEASPASEED
FT                   EDDFNVAWEVLDLTRVMQSKAVDAYPDSKDEKIRLADIYDLLGELSLEIENFSQASQDL
FT                   KTALEWKEKVYNVSNNTLLSEAHYKLALALEFTNPEDPSNKSRACEHVEKAAEILKNVL
FT                   NERENEVTDKKGKGKQKAEESTLTSDLENLREMLSELEQKTLDLKHGAPSLEEAVMSKM
FT                   HESSLLSKDSSSLAQAVAEAVKNANDLGGLVKRKRTKQEVTSSSQKEGPKDKKKKD"
FT   5'UTR           complement(782263..782579)
FT                   /gene="sim3"
FT                   /locus_tag="SPBC577.15c"
FT   misc_RNA        782740..783173
FT                   /gene_synonym="SPNG1273"
FT                   /locus_tag="SPNCRNA.327"
FT                   /product="non-coding RNA (predicted)"
FT   rRNA            783253..783498
FT                   /locus_tag="SPRRNA.31"
FT                   /product="5S rRNA"
FT   5'UTR           784303..785112
FT                   /gene="gyp1"
FT                   /locus_tag="SPBC530.01"
FT   CDS_pept        785113..786657
FT                   /transl_table=1
FT                   /gene="gyp1"
FT                   /locus_tag="SPBC530.01"
FT                   /product="GTPase activating protein Gyp1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.01.1"
FT                   /db_xref="GOA:O59737"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="PomBase:SPBC530.01"
FT                   /db_xref="PomBase:SPBC530.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59737"
FT                   /protein_id="CAA19167.1"
FT                   /translation="MESQSKKSSALKTLSSLWNGSSSATSDPVTVLDRSRTHHHRGRST
FT                   SSKAQPFRLDDSVYSDQPPKDHISLARSITRPESASESKIYAPSARSSLSLEAVVGKKV
FT                   SAKFAKYLSQTDDDWGVSNIKASKSLPRMARSTTPNSSSRSLFPQNGVDTTTSRQKLHS
FT                   SGRFPLPAKLAHRSVEVEVAESNALVSRIKKFSRILDAPIVDLNALRTLAWNGIPSEHR
FT                   PIVWKYLLGYLPCNASRREVTLKRKRDEYNAAKDSCFNTNTEPPPLDQTIWRQIVLDVP
FT                   RTNPSILLYQNPLTQRMLERILYVWASRHPASGYVQGISDLVTPFIQVFLSEYIGDKDP
FT                   MTYDIALLDETNRNDIEADAYWCLSKLLDGIQDNYIHAQPGIRRQVNNLRELTLRIDEP
FT                   LVKHLQMEGVDFLQFSFRWMNCLLMRELSISNIIRMWDTYMAEGVQGFSEFHLYVCAAF
FT                   LVKWSSELQKMEFQDILIFLQSIPTKDWSTKDIEILLSEAFLWKSLYSGAGAHLKR"
FT   3'UTR           786658..787145
FT                   /gene="gyp1"
FT                   /locus_tag="SPBC530.01"
FT   CDS_pept        787678..789303
FT                   /transl_table=1
FT                   /locus_tag="SPBC530.02"
FT                   /product="membrane transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.02.1"
FT                   /db_xref="GOA:O59738"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC530.02"
FT                   /db_xref="PomBase:SPBC530.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59738"
FT                   /protein_id="CAA19168.1"
FT                   /translation="MDLYLLASGRKFGVVKSDCISNNGVNVKDVGNALNEGVVGAIDAT
FT                   RKMVVSLGTVMPEIQKCGVTFEESSEDVSDFYLVRWDSIDDPLNPKNWPMWKKWIVVVQ
FT                   ISLIAFVVTFGSSVYSSGIGNVSMDFGVSISVSSLGSCVFLVGFGFGSLPFAPLSGIYG
FT                   RFVVYFCTLLMFTLFQIGGGCAQNIWTLVILRFFQGFFGSTPLSNCGGTLSDLFTPIQR
FT                   TYVLPGFCTFPFLGPIFGPIIGDFICQSYLGWCWVFWINMIMGAVVIVIIFFFMPETHG
FT                   DTILDYKARYLRNKTRNMKWHTIHERQRNPRSAIYQACTDSVSLLITEPIVVCFTLYLT
FT                   VVYIIGYIDFEGYPIVFAKYSFDQGEIGLSFIGIGIGIVLAGACTPIIYVHYNRVYTRR
FT                   NGVMSPEDRLYPLFFGSIMLPISMFWFAWTCYPYHPYVHWIVPLISSIFFGWSLLFVFF
FT                   VSYNYIIDSYQKLAASALAAATLVRYAASGGMSLVGRPMYVNLGDHWATSLLGFISVGM
FT                   IPIPFLFFIYGKKIRGLSKHAYKL"
FT   3'UTR           789304..789529
FT                   /locus_tag="SPBC530.02"
FT   CDS_pept        complement(join(789840..789896,789966..790017,
FT                   790090..790199,790238..790240))
FT                   /transl_table=1
FT                   /gene="ksh1"
FT                   /gene_synonym="new21"
FT                   /locus_tag="SPBC530.16"
FT                   /product="DUF1242 family protein, secretory pathway
FT                   component Ksh1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.16.1"
FT                   /db_xref="GOA:G2TRS3"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="PomBase:SPBC530.16"
FT                   /db_xref="PomBase:SPBC530.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS3"
FT                   /protein_id="CCD31354.1"
FT                   /translation="MTAIFNFESLLFVILLTICTCTYLHRQFPALLEKRKEGVTMVFWK
FT                   CARIGERASPYISLFCVFMALRFIFGSS"
FT   intron          complement(789897..789965)
FT                   /gene="ksh1"
FT                   /gene_synonym="new21"
FT                   /locus_tag="SPBC530.16"
FT   intron          complement(790018..790089)
FT                   /gene="ksh1"
FT                   /gene_synonym="new21"
FT                   /locus_tag="SPBC530.16"
FT   intron          complement(790200..790237)
FT                   /gene="ksh1"
FT                   /gene_synonym="new21"
FT                   /locus_tag="SPBC530.16"
FT   3'UTR           complement(790664..791258)
FT                   /gene="bag102"
FT                   /gene_synonym="bag1-b"
FT                   /locus_tag="SPBC530.03c"
FT   CDS_pept        complement(791259..791879)
FT                   /transl_table=1
FT                   /gene="bag102"
FT                   /gene_synonym="bag1-b"
FT                   /locus_tag="SPBC530.03c"
FT                   /product="BAG family molecular chaperone regulator Bag102
FT                   (predicted)"
FT                   /db_xref="GOA:O59739"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="InterPro:IPR017093"
FT                   /db_xref="InterPro:IPR036533"
FT                   /db_xref="InterPro:IPR039773"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59739"
FT                   /protein_id="CAA19169.1"
FT                   /translation="MSFFTQLCSMDKKYWISLAVLSVTVLISALLKKRATETEDIVVVH
FT                   YDGEKLNFVLRQPRLNMVSYTSFLRRVCNAFSVMPDKASLKLNGVTLKDGSLSDQNVQN
FT                   GSELELELPKLSPAMQQIEAYIDELQQDLVPKIEAFCQSSPASAQDVQDLHTRLSETLL
FT                   ARMIKLDAVNVEDDPEARLKRKEAIRLSQQYLSKLDSTKNQNK"
FT   5'UTR           complement(791880..792183)
FT                   /gene="bag102"
FT                   /gene_synonym="bag1-b"
FT                   /locus_tag="SPBC530.03c"
FT   misc_RNA        792137..793215
FT                   /locus_tag="SPNCRNA.1384"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           793151..793260
FT                   /gene="mod5"
FT                   /locus_tag="SPBC530.04"
FT   CDS_pept        join(793261..793320,793549..795057)
FT                   /transl_table=1
FT                   /gene="mod5"
FT                   /locus_tag="SPBC530.04"
FT                   /product="Tea1 anchoring protein Mod5"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.04.1"
FT                   /db_xref="GOA:O59740"
FT                   /db_xref="PomBase:SPBC530.04"
FT                   /db_xref="PomBase:SPBC530.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59740"
FT                   /protein_id="CAA19170.1"
FT                   /translation="MSALSESPAIPSFWRPETSEISKKPRPNTTVGFQFDNRNVGTSAP
FT                   STPAIRRNNTDSFERGLSLPLPSSKQDTGSSVLDPDGDAYVNRYARPVTAGSIYIPSNY
FT                   HKSFSPNTFSGFNVKRSASKSPKRSANGSTSEDISIEGSPSETAKGARSSFNSNFRTFD
FT                   IGSERRRRILEASQDSSRPGRYSYRTKSASPALIDTSTLDSRLNFTMGRLERSIAQLSK
FT                   NTMRAVSHLENPPKDITLPKLNVKNSAWPLQPYSPPANETPASSSSSAKARPVSVPDMS
FT                   SPVPASSVEYESLKAAVTYSPSQNPKKVAETDSESRKSSFQSSYNDADRPFQVGAQTQS
FT                   TPNRISRSDSPIVYDVDTHSEDNASTASSEAISQSMRSFQPQPNTGSPFPRFTSTNTED
FT                   EQESDIPQSDANDSTVNLNQPNYANLTPTPQVSPKRPTYSRSSPLPSASVPALGDGSPD
FT                   PPAAPSIQNSLSVHESEMPPHVTRDYTQPAASATPVPKEKPSEKSEKPPKKKGSKLEKF
FT                   CCILM"
FT   3'UTR           795058..796314
FT                   /gene="mod5"
FT                   /locus_tag="SPBC530.04"
FT   5'UTR           796255..796582
FT                   /locus_tag="SPBC530.05"
FT   CDS_pept        796583..798871
FT                   /transl_table=1
FT                   /locus_tag="SPBC530.05"
FT                   /product="transcription factor (predicted)"
FT                   /db_xref="GOA:O59741"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59741"
FT                   /protein_id="CAA19171.2"
FT                   /translation="MENLKSASPEEDSPRHGDNMGKPKRIPRACDMCRKRKIRCDGKQP
FT                   ACSNCVSHGIPCVFTARPKRRTGQRQMYIKSLVSRLEQMESTLRSVIPNYDQQPDIIHP
FT                   SSTPKNYHDLNCTKGETSSDDSTDDIAFLNEKMGTLVTTPIGSQKYFGSSSTFSIIQHA
FT                   AKFASGVESDKVLEHLSMAKSGCLFDPDESFDGSKAELPSSEIANIYIDAYFKSYNPLF
FT                   PVFTRENFYQKFGSPNCFKKPDGSIDLVNYASYVVVLSLGCLAIADTEEQVSRANALFK
FT                   NTLGISIEVTKDMSFRTLVFNFLTSVYYCAVSKPNAVWLNVGVVVRVAQTLGLHRNSAM
FT                   WSIGKEDAEEKARLFWYIYYLDRVSSMMTGKPVAFQDDDIDQMVPFYSIYCYYGLKPPE
FT                   GDPLGTFNFLEAEVQLTRIVGQVLKELYSVSGMKSNSSQVMEKILEFDLLLNNWYNSLP
FT                   DCMQPRNRFKIPKFCSSNLILTSAIYYSCLILIHRHSLTKNLQVNCVHRGTGSITDSQA
FT                   LCIAAARSITNLFVESVDLQPLIMKIIMYHAFTSSIIIFISILKRPLASICSEDLNCLI
FT                   SVKNRLISFETHGFVRLNVVMDALESMISTAQAAMQKAKQIAINFSSNLATNEDVTNSG
FT                   MPDIADVSLKSQSHVPPRISSNHSDTSVKSNSPSSIFDNSGYLNSLNNSILQMHQNLQN
FT                   SSNTNDQYKFDSVQENELHANITPVLDQTMSMFPFKDQLDLNFAAANVYNPNVFDDMGL
FT                   DCSFYGNGL"
FT   3'UTR           798872..798994
FT                   /locus_tag="SPBC530.05"
FT   3'UTR           complement(798995..799141)
FT                   /locus_tag="SPBC530.06c"
FT   CDS_pept        complement(join(799142..800838,800840..802651,
FT                   802839..802851))
FT                   /transl_table=1
FT                   /locus_tag="SPBC530.06c"
FT                   /product="translation initiation factor eIF3 alpha subunit
FT                   (p135) (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.06c.1"
FT                   /db_xref="GOA:O59742"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR027523"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="PomBase:SPBC530.06c"
FT                   /db_xref="PomBase:SPBC530.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59742"
FT                   /protein_id="CAA19172.3"
FT                   /translation="MSTIDLPTSSLPGSSGDPSGTEMSHSDVDVSVDIDVIFPDHTQTL
FT                   SFSLLLSNTIHDVRQVILELMLAPPHTCFHLEYKREKLHSFLEIGQIPHLKLSKTRKIV
FT                   LEVVLDPYTERESKYHIYTLLEFLSRKLPSSSTSPGIRAGFCIFPSLNIPSGENLQIKS
FT                   SSSLEEINKIPENIVTQSLSYTNLLKKFETSPNPSNNGCFRSLALSGWNPVPAEFVIQG
FT                   HLLYLTVLTIEGKTYNITSHVSGFYVNNCTSTKFDPSPCDDLQSHSLVLLLEQLSPLFK
FT                   ERLHLSLNDYKSGDAIAQASITGTLPQAPWITFPVPHRADLSRTQKSELFPYIENQGNL
FT                   RDWNEEIQSTREMDHEDVQDRVLRERLTVKTLQDFTDMAVEGAIDMVNGNIPSLNPLEP
FT                   TASQMFVHNNIFFSYGRDSVGIFSTKGGDSAAYSAVGKDILAIRLLNQFDLSNPSLLGT
FT                   CVVDYAGHRVVAQTIVPGIFKQLENGSSHLIYGKVEGESDFRFDESFEGELSRISDLLH
FT                   IKKHFFVDGKEKSFPLYTSMDAKALKGSDGRTYLMDLYSLFPLDAQFLEVISDEKNEEF
FT                   PAYPHKLVHVRPELVQLFYEMKLQAFVNANHNAPKKKNLNDSLKSVELEGNGIKLSSEK
FT                   GKNNVNKVRNDNARFDCGFNPDCFRSDYIFPPDNKELYDKDIENSYALSQYLHAEVIPN
FT                   FVKSLSEPSSFLPIDGVALCRAMHRSGINIRYLGEIANIILQKSPNNVILLKLVTSEIF
FT                   IRSIKHVFRNFLAVVPQVLRSHLLSHLLNNLFTVYGYVEPTKPLINENIANLFFQATQV
FT                   IYSINSTSLYSSIKKEASSRFRFNLTDDLLHSLNPICILRGTCLRLGIQISCKDYFSNK
FT                   SDDKICEEHAVPNGSTKFTGKKGNKKKRNLGKSQNTTNRQVESEQINIFRPKDILNLMP
FT                   VIKTCIPYSGLAQESLEACKACLLQGNKELCYNLLNESLSLHEQIYGVLHTEVARAYCQ
FT                   LAMIYHQLEKKEEAVELARKAVIVCERFLGFDSSETSLAYMNLSLYEFSQKNEMQAVMH
FT                   MQHALKLWYLVFGPDHPNTINSFTNLSLMLHGSEKFIQSQKCLQIAVDLSDKIFGKTTP
FT                   TASLYLQLAQLMVLNKDSRSALHAVRVAYDILKETLGPDHQNTKEAEHWLSEFTALAVN
FT                   QERQSRT"
FT   5'UTR           complement(802852..802902)
FT                   /locus_tag="SPBC530.06c"
FT   3'UTR           complement(804139..804364)
FT                   /locus_tag="SPBC530.07c"
FT   CDS_pept        complement(804365..805093)
FT                   /transl_table=1
FT                   /locus_tag="SPBC530.07c"
FT                   /product="TENA/THI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.07c.1"
FT                   /db_xref="GOA:O59743"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="PomBase:SPBC530.07c"
FT                   /db_xref="PomBase:SPBC530.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59743"
FT                   /protein_id="CAA19173.1"
FT                   /translation="MDPYTVAIIKKLGIEEQVETAATKSPFIEGLANGTAPPGAFKRWL
FT                   YEDRIYVQGCSLCLAKAINAITHEKGFPKEALDLFLGAYNVITPELAHFEARCKESNVE
FT                   MPKLKPVPTSWEQALQDNKPEEYYHLSAPDCKSYIQFMTQELFEIPGTSGIDYFMAFYL
FT                   NEVIYHRAWKFVRESKQFQKNCPEEMEFVKWWGQPSFGKFVENLARSIQDVPFTSATVD
FT                   IAKKICNFEYRFFSTAFEKA"
FT   5'UTR           complement(805094..805686)
FT                   /locus_tag="SPBC530.07c"
FT   5'UTR           806064..806833
FT                   /locus_tag="SPBC530.08"
FT   CDS_pept        806834..809281
FT                   /transl_table=1
FT                   /locus_tag="SPBC530.08"
FT                   /product="membrane-tethered transcription factor
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.08.1"
FT                   /db_xref="GOA:O59744"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PomBase:SPBC530.08"
FT                   /db_xref="PomBase:SPBC530.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59744"
FT                   /protein_id="CAA19174.1"
FT                   /translation="MDNESHSQETESKILEGAKVATRRRRVTRACDMCRRKKIKCDGLR
FT                   PCKNCKAGKLECTYHMPSSRKSSFSPEYVENLESRVRYLETLLKKNTNFDLSSNSPSFL
FT                   FFLREQKFQATNELENMSPERKVIFTSMINYGNLFVDAKHGTRYFRGGSSIHVLIQHLI
FT                   RRLPGDFEICEPYSAYPLGNKNIQFDDNDPEYQFFTPTPRFSIDFMVSSVDPREIQLPG
FT                   IEEALCITKAAVSYVSGIVFYTTYADFPKKIRLLYSGNYQGNFFPLFLSILCVGYYHHL
FT                   LNNPSNTELQSLIKKYSFYSERLVKSADNFTIESIQCLLILSIYRYCRTEISAAWYYMK
FT                   LGLNCCLRLGLHRNITEGFTEEQIDSRRRIFWAIYCYDRQLCTLFGFPLGVRDEDIDQC
FT                   LPVTPKFPSVTEIEANARLFFFHGVKLYKISSRILTKLYSPNSRNVTKKHISYAVIQDL
FT                   EQLLDGFYNSLPRVFRAEQPGEFQANHFFYNLQLVYYSFRMLIYRPLLHYLEADSPAMQ
FT                   ALKVPDRQTAFTLACKCVDSAIVCVQNLSHLSKGLKRTLDRYYWTTVYCGFSTIVTLIF
FT                   AALLTKNTNLLIHISVARESIEALAHECVTRRLLPLIDKMRESLMKILESNADGYKQMS
FT                   PTKAPQVFESESNVPINNGPQQSIDKESNSNTQLPQVETEGQQQSVFDGNIGTIPYQAY
FT                   NMNEDSFIDINTLSSMLNYHTQAVSIHHPSFYISRSDVPLEEEFQIPNELLAVDPVAES
FT                   MQENSDIINEAFGLVDPDVSDGKSRESSSLNNSTPFNPTVNIDPASILEHFSQNVMKDS
FT                   QNS"
FT   3'UTR           809282..809444
FT                   /locus_tag="SPBC530.08"
FT   3'UTR           complement(809383..809524)
FT                   /locus_tag="SPBC530.09c"
FT   CDS_pept        complement(join(809525..809650,809735..810499))
FT                   /transl_table=1
FT                   /locus_tag="SPBC530.09c"
FT                   /product="cation dependent mannose-6-phosphate cargo
FT                   receptor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.09c.1"
FT                   /db_xref="GOA:O59745"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR028927"
FT                   /db_xref="PomBase:SPBC530.09c"
FT                   /db_xref="PomBase:SPBC530.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59745"
FT                   /protein_id="CAA19175.1"
FT                   /translation="MRLLTCLINVLAGLTLFSQFQRAFGLTITRRGFKVQESDEEPFCA
FT                   LHHPNTGEYFDLSGLIRDNTSEKGDYSVNGYDFGTNFSINLCHPVVSNLTNYTVEGDVS
FT                   SEDSIGGFFTVEDDDLYSIGQAAYKPYFRGKKLIMQLDNGSLCPKSNHIRMSTLISFTC
FT                   NRDPYTAPSVITYVGNLNDCAFFFEWKTIHACPTVKKDSTLNPVSVFLLFCAIAFLAYF
FT                   VGGFVYQRVVLNARGLRQIPNYEMWRSLFGFISDIVIILYSSILSILPSSITRMRGNRR
FT                   NIDYVEDALIDDIDT"
FT   5'UTR           complement(810500..810978)
FT                   /locus_tag="SPBC530.09c"
FT   3'UTR           complement(811060..811412)
FT                   /gene="anc1"
FT                   /locus_tag="SPBC530.10c"
FT   CDS_pept        complement(811413..812381)
FT                   /transl_table=1
FT                   /gene="anc1"
FT                   /locus_tag="SPBC530.10c"
FT                   /product="mitochondrial adenine nucleotide carrier Anc1"
FT                   /db_xref="GOA:Q09188"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09188"
FT                   /protein_id="CAA19176.1"
FT                   /translation="MATSSAAAAASTPVNANTITETKNSTFFFDFMMGGVSAAVSKTAA
FT                   APIERVKLLIQNQDEMIRAGRLSHRYKGIGECFKRTAAEEGVISLWRGNTANVLRYFPT
FT                   QALNFAFKDKFKKMFGYKKERDGYAKWFAGNLASGGAAGAASLLFVYSLDYARTRLAND
FT                   AKSAKKGGERQFNGLVDVYRKTYRSDGLRGLYRGFGPSVVGIVVYRGLYFGMYDTLKPV
FT                   VLVGPLEGNFLASFLLGWAVTTGSGVASYPLDTIRRRMMMTSGEAVKYSSSFECGRQIL
FT                   AKEGARSFFKGAGANILRGVAGAGVLSIYDQVQLLMFGKKF"
FT   5'UTR           complement(812382..812897)
FT                   /gene="anc1"
FT                   /locus_tag="SPBC530.10c"
FT   misc_RNA        complement(812834..813724)
FT                   /locus_tag="SPNCRNA.1385"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        813467..813747
FT                   /gene_synonym="SPNG1280"
FT                   /locus_tag="SPNCRNA.328"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(814378..814818)
FT                   /locus_tag="SPBC530.11c"
FT   CDS_pept        complement(join(814819..817143,817199..817279,
FT                   817416..817469))
FT                   /transl_table=1
FT                   /locus_tag="SPBC530.11c"
FT                   /product="transcription factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.11c.1"
FT                   /db_xref="GOA:O59746"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="PomBase:SPBC530.11c"
FT                   /db_xref="PomBase:SPBC530.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59746"
FT                   /protein_id="CAA19177.1"
FT                   /translation="MLENSTAVHGVRLSDSPEDPFLRKRLASNTQLNQKKIRFTENEND
FT                   LSPERAQKEPVSIPHGRYTWSTSPDTDSSHLPSTPPTVDIPFHHPHTIHSPTFTLSVSP
FT                   DSQSSSATHQNDYISSPHADFSFSPPASKIQSHEPLNDMAAVHPLRPSHVSGPLSPPEP
FT                   KAASVDHSINPAYNASFRLPDGPLWTEGSENLPSLDIQLQLAHIYFIYAHGQPYVLFHR
FT                   DSFMEALKSQRLPPVLVLAMCAVAIRFWQTDKYDKNELFEQWFNRASAIAMANFDKLDL
FT                   VYVASFVMLSYVCAATSKYWMFAGMAIRMVVALHPNKTPNLPYYDRPDSPLPFEIRVQL
FT                   TRRLFWDCFMLDRLNSLYCNTQFLNLEDIHVPLPMRETLFMYKAHAVTETLTGKPSSPD
FT                   SFTNANPTTAPIVSRNAQDNMGMLAYMIRMVSIWGRVVRCLKSYSQKQSNPYPFWHAKS
FT                   TFKQLDQELYEWEKNLPNRLRYSRQTLLSYHMMGQGGQFACLHLIFLQIHLYVHRYAAS
FT                   ISSVPFSHVKSPPTVFENQSAVLASQCANAICRIIQDCTELSISLAAPFTASSAYLAGT
FT                   VLLYHYITRGSEVQASKAAVHLPIAKRHLAQLSVYWPALGMYAKALDAIAFHQGALVTP
FT                   SVPPVIATVSKTNTTNTGVQQRGNVGVTTTGSILTQSSPALPVQPVPLAYSKPAPTTKS
FT                   SLTELAYNTNVSLPPRSPGTGSLAAGNLPNEKAPSLMTMVNGGPVPGDIGEASIPVVQN
FT                   LQPSTAHVDPESDLGRVIKICDWYQSPSSDVLLSKPLQLNSSEEMEQQCIDLSRHNTLL
FT                   NLSSYGI"
FT   5'UTR           complement(817470..819357)
FT                   /locus_tag="SPBC530.11c"
FT   tRNA            820491..820562
FT                   /locus_tag="SPBTRNAGLU.05"
FT                   /product="tRNA Glutamic acid"
FT   3'UTR           complement(820804..821280)
FT                   /gene="pdf1"
FT                   /locus_tag="SPBC530.12c"
FT   CDS_pept        complement(821281..823149)
FT                   /transl_table=1
FT                   /gene="pdf1"
FT                   /locus_tag="SPBC530.12c"
FT                   /product="palmitoyl protein thioesterase-dolichol
FT                   pyrophosphate phosphatase fusion 1"
FT                   /EC_number="3.1.2.22"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.12c.1"
FT                   /db_xref="GOA:O59747"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="InterPro:IPR039666"
FT                   /db_xref="InterPro:IPR039667"
FT                   /db_xref="PomBase:SPBC530.12c"
FT                   /db_xref="PomBase:SPBC530.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59747"
FT                   /protein_id="CAA19178.2"
FT                   /translation="MLSCSSFLIFFLFSWVLLPMKSFAIPIISLDKVRLAINDGASEQL
FT                   PVVIWHGLGDTPTSFTLTEVSQRVQKLTKGAVYAIRVGDNEFEDIKAGYLGKLEDQLDE
FT                   VCDLIGNEDSLSNGFYALGLSQGGLFLRALAQTCDAAKIRSLITLGSPHSGINTIPGCS
FT                   PTNLICKAVVHSILGLGIWHSWIQNHVVQAQYYRTEKQYDKYLENNKFLTHLNNEVLHD
FT                   NYTRNIEKLKELDNLVAVSFERDDIVEPPYSTGFGWINETTGENIEMEDFVLYESLGLK
FT                   DLVNQGKLETISFPGRHLQMRWGDFDALVLKYFKDEKEEKTELEESTRPSNFLSTYFVS
FT                   PLVSAIDGTVDYLHGKSLFPEKRNFKELTMRKRSIVTPEDSEEVYPYISEFVAASNVSE
FT                   EKGPKSFANLAFITIFSHFFYHIDDMWRSTLGLFSLIPQIIGIIYLTVMFTGRELDTFM
FT                   QFGGQVVNEFINYVVKVSLKYPRPADIEYGVGYGMPSSHSQFMGFFSAYMIAWDYKYRR
FT                   SQCFSMLSFAKYAIYLTLSTFVCSSRYLLDFHYLTQVVYGYMIGFGVGLFWVYLVGKLR
FT                   SLGVTKWLLSLPPLQFFYIKDTIPHSKDNHKRQWLESKQFKNQKSN"
FT   misc_RNA        822239..823195
FT                   /locus_tag="SPNCRNA.1386"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(823150..823260)
FT                   /gene="pdf1"
FT                   /locus_tag="SPBC530.12c"
FT   5'UTR           824063..824373
FT                   /gene="lsc1"
FT                   /locus_tag="SPBC530.13"
FT   CDS_pept        join(824374..824534,824579..824660,824874..825011,
FT                   825065..825188,825245..825747)
FT                   /transl_table=1
FT                   /gene="lsc1"
FT                   /locus_tag="SPBC530.13"
FT                   /product="Lsk1 associated cyclin"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.13.1"
FT                   /db_xref="GOA:O59748"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="PomBase:SPBC530.13"
FT                   /db_xref="PomBase:SPBC530.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59748"
FT                   /protein_id="CAA19179.2"
FT                   /translation="MAENENHVLSIRMSHPYYSEKEISRILSTRDPKENNLRMQAFAWI
FT                   STLSKTLKFPVRTSGLAMLLYSRFQLFFPVNEIPLLECATACLVVASKIEDTAKKFRDI
FT                   LLAHYLQKHPGSEVDAHSQVCYKLIEENKKRILGLERMTLELICFDFRVRHPHNYMVKF
FT                   AKSLKFSSSTASIAWNVCTDAYKTYTMLKYPAHIVAVASISIACKLQQLPQPIIPRSFF
FT                   APPALTEAVIADILDLYMHYQPHTCIGNMYTTEKLLGLCVDFQRAQKNSGRPQKPPQID
FT                   PHSSSLADEYRESNKRLQESKESCARFILDCDRKYFNTEFEKRMLEERRNKGTV"
FT   3'UTR           complement(824805..826178)
FT                   /gene="dsk1"
FT                   /locus_tag="SPBC530.14c"
FT   3'UTR           825748..825870
FT                   /gene="lsc1"
FT                   /locus_tag="SPBC530.13"
FT   CDS_pept        complement(826179..827813)
FT                   /transl_table=1
FT                   /gene="dsk1"
FT                   /locus_tag="SPBC530.14c"
FT                   /product="SR protein-specific kinase Dsk1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.14c.1"
FT                   /db_xref="GOA:P36616"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPBC530.14c"
FT                   /db_xref="PomBase:SPBC530.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36616"
FT                   /protein_id="CAA19180.1"
FT                   /translation="MGSDGSSLSPKVSQPGHTEIVDHVSEKVITNGKNVNKKVNAEVDG
FT                   KSMVEKVKTHEENAEDYHYGGYHPVYIGEEFHHRRYVVERKLGWGHFSTVWLAYDRAAK
FT                   RRVALKVVRSAEHYRETSIDEIRILQKIREGDEKHLGKKHIISLLDYFVHRGPNGAHVC
FT                   MVFEVLGENLLSLIQSYGHRGVPVGIVKQIAYQLLIALDYLHRECGIIHTDLKPENVLI
FT                   CIDQDALQHIEAPATTSSPTSNTSSSKTRNNTGYTAKAPIIKRGQSVDNSAQERKTFAK
FT                   NPTKNSKPAGQVIPSSPFTSTLSRFPSLEGAVSEISLRDSQKHNSHPNSPFSSGDNSLI
FT                   LDGVNGSQEPVPKITVKIADLGNACWTRKHFTNDVQTRQYRSPEVILGCRWGASADCWS
FT                   FACIIFELLTGDYLFDPRNGNSYSKEDDHIAQIIELLVNYPKQMALSGKHSRDLFNRRG
FT                   ELRNIHKLKFWPLKDVLEQKYHFSAELAQQISDFLSPMLCFDPAKRTNAGYMSNSPWLR
FT                   EVADPTFKIETTGATGEDVPGWATEIR"
FT   5'UTR           complement(827814..827995)
FT                   /gene="dsk1"
FT                   /locus_tag="SPBC530.14c"
FT   3'UTR           complement(828602..829090)
FT                   /gene_synonym="SPBC661.01"
FT                   /locus_tag="SPBC530.15c"
FT   CDS_pept        complement(829091..830641)
FT                   /transl_table=1
FT                   /gene_synonym="SPBC661.01"
FT                   /locus_tag="SPBC530.15c"
FT                   /product="spermidine family transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC530.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC530.15c.1"
FT                   /db_xref="GOA:O74829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC530.15c"
FT                   /db_xref="PomBase:SPBC530.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74829"
FT                   /protein_id="CAA19181.2"
FT                   /translation="MAERTSESSSESASFDLEKQQSNHHDRYQSSVSSELEESLKKYPV
FT                   ISNPQDFIVTLDGPDDPDLAVNWPLAKKLRNVAVMGSACLCAGFGSSIFSGAVPEVMVK
FT                   FHVCRTVALLGISLYVLGFASGPVVWAPMCELFGRRRPMIIAVFIFCIFHIAVATAKDI
FT                   QTVMICRFFCGFFGSSPITTVAGSFSDMFSARTRGLVIAVYSAIIFNGPLMSPIVGGFI
FT                   GKSYLGWRWTSYITAIMGFTAFTSMIIFHRETYTRTITEIRASKVRVLTGNYCLHAKSE
FT                   EEPLEFSYFFHKYFTFPLRLLIFEPILLVVSTYTAFVYGILYGLLEAYPVIFGESRKWR
FT                   LGVESLPYLAIFVGVCIGCSSVALFQPYYFKKMDENKGRPVPEARLPSMMIGCIVFPIG
FT                   IFWLAWTGNYPWIHWIVPTLAGSFIGFGIITIFQQTINYIIDCYSGCSASAIAANTLLR
FT                   SSFGAAFPLFTTQMFNNLGIGWAGSLVGFVAVGLIPVPFMLFLYGPKLRQMSKHCLKD"
FT   5'UTR           complement(830642..832553)
FT                   /gene_synonym="SPBC661.01"
FT                   /locus_tag="SPBC530.15c"
FT   misc_RNA        831085..832524
FT                   /locus_tag="SPNCRNA.1387"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        831524..832704
FT                   /gene_synonym="SPNG1289"
FT                   /locus_tag="SPNCRNA.329"
FT                   /product="non-coding RNA (predicted)"
FT   3'UTR           complement(832780..833161)
FT                   /locus_tag="SPBC36.01c"
FT   CDS_pept        complement(833162..834904)
FT                   /transl_table=1
FT                   /locus_tag="SPBC36.01c"
FT                   /product="spermidine family transporter (predicted)"
FT                   /db_xref="GOA:O59698"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59698"
FT                   /protein_id="CAA19049.1"
FT                   /translation="MSESSVNADTPKNTNDVLNGAYQSATTEPEGQYRSATDNPSLYQV
FT                   PTHGSLYRNLSNSASAYYPANGNMNSREPANELSDISSLAEKGELEPPMAKLLSDPDFQ
FT                   GKQFPTVEAPELFIFELAPDSPSIALNWTFWRKMKTTSIYAYASLTIAWGSSVLSPASA
FT                   TLAKKYHIGMTTSLLNVSLFMLGYCLGPICWAPMSEITGRKTPLYIGLFLFSVFQIAVA
FT                   TAQDIQTIMICRFFGGYGACVPLCVVAAAFADMYPNRYRGTAITIFAAVIFVGPLVAPI
FT                   VGGFLTKSYLGWRWTEYITSFMGFLSIILIYLFCEETYLKTITENKVQEYREITGNQLV
FT                   HARSEEESLSARDIIMNYLLIPLKMLATEPIVFLVSLYCSFVYAIIYLLLEAYPVIFQE
FT                   GRHFPLGVSALPYIGILVGVFIGCGINCLFEPWYFRQVIKAGNKPAPEARLPPMMIGSF
FT                   LFPAGIFWLAWSGYYTYVHWIVPTLSGLLTGAGILLIFLQCLNYLLDAYLFRAASVFAA
FT                   NVIMRSAVAGGFPLFAVQMFHNMGVGWAGSLLGFIATALIPMPFAFFFFGKKIRAKSKM
FT                   TAQF"
FT   5'UTR           complement(834905..836971)
FT                   /locus_tag="SPBC36.01c"
FT   misc_RNA        835808..836248
FT                   /locus_tag="SPNCRNA.1388"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        835871..836243
FT                   /gene="prl34"
FT                   /locus_tag="SPNCRNA.34"
FT                   /product="non-coding RNA, poly(A)-bearing (predicted)"
FT   3'UTR           complement(836908..837551)
FT                   /locus_tag="SPBC36.02c"
FT   CDS_pept        complement(837552..839285)
FT                   /transl_table=1
FT                   /locus_tag="SPBC36.02c"
FT                   /product="spermidine family transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.02c.1"
FT                   /db_xref="GOA:O59699"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC36.02c"
FT                   /db_xref="PomBase:SPBC36.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59699"
FT                   /protein_id="CAA19050.1"
FT                   /translation="MSSTPTAEELALQNTVSQSASAHPELYHTVSHASNNSYQLPQLSR
FT                   SATSNFSTSARFAARYPTTAGESFQNLTPVNSNPSNQNSKTEPNPDDVEKCIQDPLLQV
FT                   FPVVEEPERFVFSIDPKSPLIAVNWPFKRKLKTTCILAYVALCSSFASSVFAVPAEAIT
FT                   TVFHISLTVSLLTMTVFLLGYCSGPIIWAPLSELSGRKPPILIGMLGFGIFNISVAVGK
FT                   DIQTIMMCRFFAGFFASAPLTVVAAALADMYSNKYRGTAITLFSAMVFDGPLVSPIVGG
FT                   FLTKSYLGWRWTEYITSFMGFFALIIVYLFCDETYSKAIIQGKAKEYRAITGNYFVHAK
FT                   SEEEVLTLSDIAKNYLLVPMKLLFTEPICFLITLYSSFVYAILYLLLEAYPIIFGEKRH
FT                   FSMGVAELPYIGLLVGVFIGSGINIAFEPWYYRKCLAQGGKPDPEARLPPMMIGCFMFP
FT                   AGIFWLSWSGHYSYVNWVVPALSGLATGCGILLIFLQCINYLIDAYLFRAASAIAANTI
FT                   MRSAMAAGFPLFAVQMFHNMGVGWAGSLLGFIATALIPMPFVFFFFGRKIRRMSKMAVD
FT                   F"
FT   5'UTR           complement(839286..841625)
FT                   /locus_tag="SPBC36.02c"
FT   misc_RNA        841331..842790
FT                   /locus_tag="SPNCRNA.1389"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        complement(841655..842563)
FT                   /locus_tag="SPNCRNA.1390"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(843017..843507)
FT                   /locus_tag="SPBC36.03c"
FT   CDS_pept        complement(843508..845124)
FT                   /transl_table=1
FT                   /locus_tag="SPBC36.03c"
FT                   /product="spermidine family transporter (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.03c.1"
FT                   /db_xref="GOA:O59700"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="PomBase:SPBC36.03c"
FT                   /db_xref="PomBase:SPBC36.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59700"
FT                   /protein_id="CAA19051.1"
FT                   /translation="MYNNNSSTSSDSSNSEEKANAQHASSTDSTSEHTDPAVADEGFPA
FT                   EQYQSADLEKQQLLIEEGPGGFPYITNPERFYVSLEPSDPRLAVNWPTHVKILHVALLA
FT                   FTTLTASWGSSVFSAAATIFAAKYHIGLTVALLGMSLYVCGFASGPILWAPISELVGRK
FT                   IPLIVGMFMFSIFSIAVAVAKDVQTVMICRFFSGFCASSPLSVVAAAFADMFDNKTRGP
FT                   AVCIFACITFAGPLIGPIAGGFLAKSYLGWRWTEYITSFMGFFSTLCLLFMKECYSRTI
FT                   TEQEAARLRVEYNNNFIRAKSEEEYIDFKALAKRYLAVPFVLLFCEPIVFLLTLYMSFV
FT                   YGILYLLLEAYPIIFAEKRHFSLGVDALPYIGLLVGVILGAALIAYFQGYYNRKLDANG
FT                   GKPVPEARLPPMMIGSVLFPAGIFWLAWSGYYTHVHWIVPTLSGLLTGCGILTIFMQSL
FT                   IYLIDAYLFRAASVIAANTIMRSLVAAGFPLFAVQMFHNMGIGWAGSLLGFIATALIPI
FT                   PTLFFIFGKRIRLMSKNTVNL"
FT   5'UTR           complement(845125..845684)
FT                   /locus_tag="SPBC36.03c"
FT   misc_RNA        845324..846320
FT                   /locus_tag="SPNCRNA.1391"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(845622..845806)
FT                   /locus_tag="SPBC36.13"
FT   CDS_pept        complement(845807..846079)
FT                   /transl_table=1
FT                   /locus_tag="SPBC36.13"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.13.1"
FT                   /db_xref="GOA:G2TRS4"
FT                   /db_xref="PomBase:SPBC36.13"
FT                   /db_xref="PomBase:SPBC36.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS4"
FT                   /protein_id="CCD31355.1"
FT                   /translation="MKRKTKISKMINRITFYFPLPTKKKTEIFFLSFAKQLFEKALLLF
FT                   IPLSSFDSFFFVYFPASIKEITHYVAWRNAIQKRIRVLHHNKVIV"
FT   5'UTR           complement(846080..846322)
FT                   /locus_tag="SPBC36.13"
FT   repeat_region   complement(846705..847051)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           847930..847984
FT                   /gene="cys11"
FT                   /gene_synonym="cys1a"
FT                   /locus_tag="SPBC36.04"
FT   CDS_pept        join(847985..848117,848263..849185)
FT                   /transl_table=1
FT                   /gene="cys11"
FT                   /gene_synonym="cys1a"
FT                   /locus_tag="SPBC36.04"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.04.1"
FT                   /db_xref="GOA:O59701"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="PomBase:SPBC36.04"
FT                   /db_xref="PomBase:SPBC36.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59701"
FT                   /protein_id="CAA19052.1"
FT                   /translation="MATSGIQTKVPGIVSGFIGAIGRTPLIRLNTLSNETGCNILAKAE
FT                   FQNPGGSVKDRAAYYVVRDAEKKGKLSRGGTIVEGTAGNTGIGLAHIARARGYKCVIYM
FT                   PNTQSQAKIDTLKFLGAEVHPVPVAPFSNPLNYNHQARRHAESTPNASWTDQFDNVANL
FT                   LSHYETTGPEIWDQTKGTVDGFTCSTGTGGTFAGVTKYLKEKSDGRVASFVADPPGSVL
FT                   YSHIKTKGKHPDNKGSSFTEGIGQGRITGNVQPVYDLIDDAMKIPDEKSINMFFRLLDQ
FT                   EGLFLGGSSCLNVVAAVEMAKILGPGKTVVTILCDSGHKYATRLFSRSFLESKKLFDVI
FT                   EPQYKKYIVLP"
FT   intron          848118..848262
FT                   /gene="cys11"
FT                   /gene_synonym="cys1a"
FT                   /locus_tag="SPBC36.04"
FT   3'UTR           849186..849485
FT                   /gene="cys11"
FT                   /gene_synonym="cys1a"
FT                   /locus_tag="SPBC36.04"
FT   3'UTR           complement(849345..849508)
FT                   /gene="clr6"
FT                   /locus_tag="SPBC36.05c"
FT   CDS_pept        complement(join(849509..849588,849640..849698,
FT                   849746..849854,849895..850035,850080..850188,
FT                   850234..850326,850373..850607,850663..850708,
FT                   850799..850842,850885..850915,850959..851076,
FT                   851119..851169,851215..851276,851319..851358))
FT                   /transl_table=1
FT                   /gene="clr6"
FT                   /locus_tag="SPBC36.05c"
FT                   /product="histone deacetylase (class I) Clr6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.05c.1"
FT                   /db_xref="GOA:O59702"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="PomBase:SPBC36.05c"
FT                   /db_xref="PomBase:SPBC36.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59702"
FT                   /protein_id="CAA19053.1"
FT                   /translation="MGFGKKKVSYFYDEDVGNYHYGPQHPMKPHRVRMVHNLVVNYNLY
FT                   EKLNVITPVRATRNDMTRCHTDEYIEFLWRVTPDTMEKFQPHQLKFNVGDDCPVFDGLY
FT                   EFCSISAGGSIGAAQELNSGNAEIAINWAGGLHHAKKREASGFCYVNDIALAALELLKY
FT                   HQRVLYIDIDVHHGDGVEEFFYTTDRVMTCSFHKFGEYFPGTGHIKDTGIGTGKNYAVN
FT                   VPLRDGIDDESYESVFKPVISHIMQWFRPEAVILQCGTDSLAGDRLGCFNLSMKGHSMC
FT                   VDFVKSFNLPMICVGGGGYTVRNVARVWTYETGLLAGEELDENLPYNDYLQYYGPDYKL
FT                   NVLSNNMENHNTRQYLDSITSEIIENLRNLSFAPSVQMHKTPGDFTFENAEKQNIAKEE
FT                   IMDERV"
FT   5'UTR           complement(851359..851518)
FT                   /gene="clr6"
FT                   /locus_tag="SPBC36.05c"
FT   3'UTR           complement(851808..852024)
FT                   /gene="spo9"
FT                   /locus_tag="SPBC36.06c"
FT   CDS_pept        complement(join(852025..852606,852647..852847,
FT                   852916..853053,853103..853237))
FT                   /transl_table=1
FT                   /gene="spo9"
FT                   /locus_tag="SPBC36.06c"
FT                   /product="farnesyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.06c.1"
FT                   /db_xref="GOA:O59703"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="InterPro:IPR039702"
FT                   /db_xref="PomBase:SPBC36.06c"
FT                   /db_xref="PomBase:SPBC36.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59703"
FT                   /protein_id="CAA19054.1"
FT                   /translation="MVNDFNEKNGIKKRLLDFFPVVLEGIREILESMQYFPEETEKLLY
FT                   SIKRNTLGGKNNRGLAVLQSLTSLINRELEEAEFRDAALLGWLIEILQGCFLMADDIMD
FT                   QSIKRRGLDCWYLVVGVRRAINESQLLEACIPLLIRKYFRNMPYYVDLLDTFREVTFLT
FT                   ELGQQEDLLSSRDGEASLRSFDLMKYDFIITYKTSFYSFYLPIKCALLLSRNSNQKAYD
FT                   TTIKLSKLLGYYFQVQDDYLDCFGDYTVLGKVGMDIQDNKCTWLVCYAEKFASADQLNL
FT                   LRAHYGKAGSENIAVIKQLYHELQIPELYHKFEDDMVDSISKEIDLIDESTGLKKCIFT
FT                   KFFQLIYKRSR"
FT   intron          complement(852607..852646)
FT                   /gene="spo9"
FT                   /locus_tag="SPBC36.06c"
FT   5'UTR           complement(853238..853592)
FT                   /gene="spo9"
FT                   /locus_tag="SPBC36.06c"
FT   3'UTR           complement(853526..857530)
FT                   /gene="cog2"
FT                   /locus_tag="SPBC36.08c"
FT   5'UTR           853583..853630
FT                   /gene="iki3"
FT                   /locus_tag="SPBC36.07"
FT   CDS_pept        853631..857392
FT                   /transl_table=1
FT                   /gene="iki3"
FT                   /locus_tag="SPBC36.07"
FT                   /product="elongator subunit Iki3 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.07.1"
FT                   /db_xref="GOA:O59704"
FT                   /db_xref="InterPro:IPR006849"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC36.07"
FT                   /db_xref="PomBase:SPBC36.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59704"
FT                   /protein_id="CAA19055.1"
FT                   /translation="MKNLVTHLHHVFPNVNGSIKALAFNSISDKIYVVCGLDNENPGIE
FT                   IYEISENDDVSKLVEFDSPSFVSDNGDIDEIQSMQFLGEPMAICLSLKGGDIVMVKVDP
FT                   SPEEAPWEIIGNVENGIVASCWSTDEQVFCIITGGDTILFMTKNFDIISETSLSDADLN
FT                   EFNKHISVGWGRSETQFRGKRVRAKLRDPTLPEKIDEGKLSDVDDGKTYICWRGDSQYV
FT                   SINRLEKGPRRAIRVYSREGLLDSISEPQDGQQSLLSWKPSGSVLATIKSDSSDNSSKV
FT                   IFFERNGLRHGEFSLRRREDEKYTGLAWNVSSSILAVSTENSVMLWTTGNYHWYLKKEI
FT                   NIPQNALISWHPEHANTLYITGKNHIEKVVFDLKYVTEFSTSPNDFGLIPVIDGSSLLV
FT                   TPLSLCNIPPPMCRYKLSLDYNVQMTSINATSDMLFAADDRRLTAFTFNSQEDIAKFGE
FT                   FDISTYAEGLNFKSLLGLSGNQVLLLADGTNNCSKFFVFQCDEDNESLKLLASESFESC
FT                   ILNASYCSEMLFFQTSSGKLISYNLNVKSIESISLSFPKPCSDFVVVPVHETFVPIGLT
FT                   SYGRLYAEQRLLSTGVLSFFCTERFVLFTTTKNLLKFVHLVSTVDDLQVVEDDAVDRHD
FT                   ERCRVVERGSKIVASMPSKMAVVLQMPRGNLETIYPRIMVLDGVRTYIKALKYGDAFKV
FT                   CRTHRLDLNILFDYDPDLFLKNIPVFVDGLYRVDYLDLFLTSLKPENVTTGMYSDTSKS
FT                   QSQQSVTTIDNKVNLLCKIIREHLTSKYGDTHFQAIITSYLCESPPKIEAALGMISGLI
FT                   KAQSETVDLAIEHMCFLVDVNMLFDHALGLYDLKLALLIAQQSQKDPREYVPFLHEFQK
FT                   QESLRRKFNIDCYLKRYERALGHLKEMENAFDEFKNFTIQHKLYPRALELYKYDKEAQK
FT                   EVLIIFAQYLRENGKSNEAAIAYESVGKISEAIEAYKSAGMWRECLSILQQTTNSEDLI
FT                   RETAEDLASLCIEKREHCDAGSINLLYLSNPREAVIQMCKGSQYSEAIRIARATGDSSI
FT                   YKDLLISVLGESFGEASELVADFRNQIKSQTERILVLREKKKEDPISWMEGTMEDQTPD
FT                   DISLASTSLSTNRSLYTQYTKSSNSSKMTRNTSKNNRRLERKRARGKKGTVFEEEYLVN
FT                   SLRRLIARVEEIRPEVHRLLEALVRCNMTTQASELQRNFANVIGTIGEKVIPILSVPVS
FT                   TFETALGEQPQAPVVPNVKPFEKLSILI"
FT   3'UTR           857393..857560
FT                   /gene="iki3"
FT                   /locus_tag="SPBC36.07"
FT   CDS_pept        complement(join(857531..857710,857762..857842,
FT                   857905..858219))
FT                   /transl_table=1
FT                   /gene="cog2"
FT                   /locus_tag="SPBC36.08c"
FT                   /product="Golgi transport complex subunit Cog2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.08c.1"
FT                   /db_xref="GOA:O59705"
FT                   /db_xref="InterPro:IPR009316"
FT                   /db_xref="InterPro:IPR024602"
FT                   /db_xref="PomBase:SPBC36.08c"
FT                   /db_xref="PomBase:SPBC36.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59705"
FT                   /protein_id="CAA19056.2"
FT                   /translation="MTEKDADSGSDLVDAFLSDAYLNTEELRKDGPFSPDEFLVSKRFL
FT                   GLDGLVNELSRLFEQVNNELMLLVKDNYQDFVHLGSRMKSGNTKVSTLISSIHRSEEQL
FT                   KNSKQSLIGHSTEIQNNLKHKQDVENEKLIASNLLLLDQILKFLKSNDSSHPLWLESLN
FT                   NAQRLCDTYKDHPWVQSISPTLINYIKH"
FT   intron          complement(858015..858069)
FT                   /gene="cog2"
FT                   /locus_tag="SPBC36.08c"
FT   5'UTR           complement(858220..858442)
FT                   /gene="cog2"
FT                   /locus_tag="SPBC36.08c"
FT   5'UTR           858423..858487
FT                   /gene="sap61"
FT                   /locus_tag="SPBC36.09"
FT   CDS_pept        join(858488..858687,858740..859884,859940..860073)
FT                   /transl_table=1
FT                   /gene="sap61"
FT                   /locus_tag="SPBC36.09"
FT                   /product="U2 snRNP-associated protein sap61"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.09.1"
FT                   /db_xref="GOA:O59706"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR021966"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR024598"
FT                   /db_xref="InterPro:IPR031774"
FT                   /db_xref="InterPro:IPR031776"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PomBase:SPBC36.09"
FT                   /db_xref="PomBase:SPBC36.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59706"
FT                   /protein_id="CAA19057.1"
FT                   /translation="MSESVLETERYAHEELERLQQAIVDRQVANPKAPRERLRLEHQSA
FT                   QFLNQFRETSKKLLVSHESSDRLKDQEVARINADDDLTEFYKSLGEIQEFHKKYPDHKV
FT                   EDLSQLYSIKPSQPGIDEIDTLFRGEEMYGRFMDLNECYEEYINLSNVQHISYLEYLKN
FT                   LEDFDQIPKPEKNQTYINYITHLYEYLVSFYRRTHPLSNLDKIIAVFDTEFDAAWEAGL
FT                   PGWYSHNAEAEKDGKDSTEAFYCEVCQKFFGKITVFEAHKKSKAHNKAVKRMQSSSPST
FT                   TSNTNEKQKGPKAIARIEFLIKKLTSLLDDVRKDTRENVVRRQTLTAAERLAEVEAAER
FT                   EAFEQSTPSVSVEGNQDEESDQDDEEKIYNPLKLPLGWDGKPIPFWLWKLHGLGKEFPC
FT                   EICGNYVYMGRKAFDKHFTEQRHIYGLKCLGISPSPLFNQITSIDEALQLWQKYKVDSK
FT                   KRETTMASLNEMEDDEGNVMSEKVYNDLKAQGLL"
FT   3'UTR           860074..860614
FT                   /gene="sap61"
FT                   /locus_tag="SPBC36.09"
FT   5'UTR           860717..861230
FT                   /locus_tag="SPBC36.10"
FT   CDS_pept        861231..861785
FT                   /transl_table=1
FT                   /locus_tag="SPBC36.10"
FT                   /product="mitochondrial intermembrane space protein sorting
FT                   protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.10.1"
FT                   /db_xref="GOA:O59707"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="InterPro:IPR037365"
FT                   /db_xref="PomBase:SPBC36.10"
FT                   /db_xref="PomBase:SPBC36.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59707"
FT                   /protein_id="CAA19058.1"
FT                   /translation="MKIFESCHLFQYPFEQVSAAHWQKYPNEHATHVIAVDTLDRKVLD
FT                   NGVLYTERLITCHQALPRWILKLIDGAQDCYIRETSYVDLKARTLTLLTSNLTFSDRLR
FT                   VDETVTYSPHPELEATVFQQEARIEALACMKRLSNLIEQWSVDGFGKKASRGKEGFESV
FT                   LEKINMSVFQTRPFGSSEATA"
FT   3'UTR           861786..862422
FT                   /locus_tag="SPBC36.10"
FT   5'UTR           join(862494..862834,862893..863273)
FT                   /locus_tag="SPBC36.11"
FT   CDS_pept        863274..864305
FT                   /transl_table=1
FT                   /locus_tag="SPBC36.11"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.11.1"
FT                   /db_xref="GOA:O59708"
FT                   /db_xref="PomBase:SPBC36.11"
FT                   /db_xref="PomBase:SPBC36.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59708"
FT                   /protein_id="CAA19059.1"
FT                   /translation="MSISNDSLASTVPGDELPSSYPVFSSDFSYIKPSHVLDVVTVTST
FT                   AGPEATDDPSYSGFYSTVISTQNPEPTSASTPPSASASSLPNGAQKHNHTGVIAGPIVG
FT                   VLGGLIVLVIIFYCLRHFKRKKFLAEQQEFERQFEEEKSRLAAVRKNTEQEKMGYRGGY
FT                   QMHSTPWASSPRNSTIPQRSQSFYNDTRRSSDLGANAADFVTPPGNVANSDNIRILKRN
FT                   SIATIGNYRSPSALEKRRSISYGAVQSVQGRPLAPIPGRRPLSISSDLYNDSNSGSHSN
FT                   DDSDETKLKQSSTESSSELLDEKDKFDKNSLNDPFVTIRKSSYEHEISEEHKKHSKKRS
FT                   EHF"
FT   3'UTR           864306..864710
FT                   /locus_tag="SPBC36.11"
FT   3'UTR           complement(864655..864755)
FT                   /gene="git7"
FT                   /locus_tag="SPBC36.12c"
FT   CDS_pept        complement(join(864756..865244,865288..865681,
FT                   865738..865994))
FT                   /transl_table=1
FT                   /gene="git7"
FT                   /locus_tag="SPBC36.12c"
FT                   /product="SGT1-like protein Git7"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC36.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC36.12c.1"
FT                   /db_xref="GOA:O59709"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR007699"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="PomBase:SPBC36.12c"
FT                   /db_xref="PomBase:SPBC36.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59709"
FT                   /protein_id="CAA19060.2"
FT                   /translation="MGVDLSDINDSLFKLSDKLSNDLAKQRNLCIVKEPSFSIEEHIKC
FT                   FTTCINTYKPFSCLKHANWALLLAKKKSDTGLIGYCQSLRGLAYYLLEQYQSSAICFGF
FT                   ALKHLKKEDLTKWQVQLDSMLTIVHEQQNQDTSSLIPDECPNIPELEAAKIEGDEEFLN
FT                   MSLKAPEGQIEKNEEKLSNRIRYDWSQTSFSLNIDIYAKKVKDEDVSLLMEKNTLKIEI
FT                   KLEDGSIFSLVLDPLYEEIVPEKSSFKLFSSKVEITLIKKVSEIKWEALVKSPANNSVN
FT                   VYAKDSNHSSASGNTKNKAKDWDSLAKLADLEEDEPTGEAALANLFQNLYKNADDDTRR
FT                   AMMKSYTESNGTALSTNWKDVKSKTFETKPPQGMEPKKF"
FT   intron          complement(865245..865287)
FT                   /gene="git7"
FT                   /locus_tag="SPBC36.12c"
FT   intron          complement(865682..865737)
FT                   /gene="git7"
FT                   /locus_tag="SPBC36.12c"
FT   5'UTR           complement(865995..866083)
FT                   /gene="git7"
FT                   /locus_tag="SPBC36.12c"
FT   3'UTR           complement(866271..866539)
FT                   /gene="ubp15"
FT                   /gene_synonym="ubpD"
FT                   /gene_synonym="ubp21"
FT                   /locus_tag="SPBC713.02c"
FT   CDS_pept        complement(join(866540..869835,869940..870030,
FT                   870080..870082))
FT                   /transl_table=1
FT                   /gene="ubp15"
FT                   /gene_synonym="ubpD"
FT                   /gene_synonym="ubp21"
FT                   /locus_tag="SPBC713.02c"
FT                   /product="ubiquitin C-terminal hydrolase Ubp15"
FT                   /EC_number="3.1.2.15"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.02c.1"
FT                   /db_xref="GOA:Q9UTT1"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR024729"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PomBase:SPBC713.02c"
FT                   /db_xref="PomBase:SPBC713.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UTT1"
FT                   /protein_id="CAC22603.1"
FT                   /translation="MVLSNVDAEEVNMDSSMELEESSQEPLRADNYEEIYNSLVHHEPD
FT                   LEEAAHASYSWVVKNFSTLEDKTYSPLFKAGHTTWRIVLFPKGCNQTEYASVFLEYLPQ
FT                   CKVEAIRKYEAELAAGKTPTIDPEIVNDETYSCCAQFALSLSNVQDPTVMQINTSHHRF
FT                   RSEVKDWGFTRFVDLRKIAVPTPEFPVPFLENDEICISVTVRVLQDPTGVLWHSFVNYN
FT                   SKKETGYVGLKNQGATCYMNSLLQSLFFTNIFRKTVYKIPTDNDDSRDSVAYALQRVFY
FT                   NLEKQREPVSTTELTRSFGWNSFDSFMQHDIQEFNRVLQDNLEKKMKGTEVENALNDIF
FT                   VGKMKSYVKCIDVNYESSRVEDFWDIQLNVKGMDTLEDSFRDAIQVETLTGDNKYYAEG
FT                   HGLQDAHKGIIFESLPNVLQLQLKRFDYDMLRDMMVKINDRHEFPLEIDLEPYLSETAD
FT                   KSESHVYVLHGVLVHGGDLHGGHYYALIKPEKDSNWFKFDDDRVTRATIKEVLEDNYGG
FT                   EPAGRAKGYNGNPFKRFMNAYMLVYFRKSRLDHILSPVTAEDVPFHVRNTLDEEHRVVE
FT                   RKLLEREEQQIYRRVRVLTTDGFKKYHGFDMTDFSASDDDPVLITTKIKRNANIWDLQK
FT                   HLAGLLNRDTSGIRIWLMTNRQNRTVRVDLPLDKKTILVDQICDMHIRKDMDMRVYVEF
FT                   LSEHNQLLADFGATDDNDFDTYIFLKIFDYETQQISGLADLHVSKNSPISSLSEWIREH
FT                   LKWSSDVPITYYEEIKTGMVDVLDPNASFEKSEIQVGDIICFEKKLVHDSSSDTSHPYK
FT                   SALDLYDFMAHRVVITFEPRYSDDTNNGVFDLVLTTHTNYTDMARAVANKLNVDPNYLQ
FT                   FTMAHLPSRTPRSVIRNPSKFTLQNAIPSTYSHNQNVVMFYEVLDITLSELERKQLIRV
FT                   HFLSNGISHETQMEFYVDKEGTVEDILRQVTQKVPLNAEDASRLRLYEVYNHRILKSHL
FT                   PTDGIYDLNEFSTAYVEVTPKEEQMQLKTDDAVSIVVQHFFKDLSRLHDIPFYFVLLRG
FT                   ETLKDLKKRLQKRLGYNDTQFSKVKLAVLQAQSFGKPYYLTDDDEVLYGELEPQSHILG
FT                   LDHPPANGSAQYHGMDQAIRMK"
FT   5'UTR           complement(870083..870314)
FT                   /gene="ubp15"
FT                   /gene_synonym="ubpD"
FT                   /gene_synonym="ubp21"
FT                   /locus_tag="SPBC713.02c"
FT   misc_RNA        870338..871227
FT                   /locus_tag="SPNCRNA.1392"
FT                   /product="intergenic RNA (predicted), possible alternative
FT                   UTR"
FT   misc_RNA        complement(870993..872235)
FT                   /locus_tag="SPNCRNA.1393"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           871169..871545
FT                   /locus_tag="SPBC713.03"
FT   CDS_pept        join(871546..873109,873157..873173)
FT                   /transl_table=1
FT                   /locus_tag="SPBC713.03"
FT                   /product="mitochondrial D-lactate dehydrogenase, cytochrome
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.03.1"
FT                   /db_xref="GOA:Q9C1X2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="PomBase:SPBC713.03"
FT                   /db_xref="PomBase:SPBC713.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1X2"
FT                   /protein_id="CAC22604.1"
FT                   /translation="MHSLQCRRVIPFGKLSLSLHAPRNALRFVHKPAFTFESYKSLHRD
FT                   PKYAKLSEQDVQVFKSIIGKDGSLIDGLDKSTDPADLDAFNIDWMNKYRGKTQLALKPK
FT                   TTQQVSEILKYCNQKKLAVVPQGGNTGLVGGSVPVFDEIVLNLGLMNQIHTFDEISGVI
FT                   TLDSGVILENADNFLAEKGYMFPLDLGAKGSCQVGGCAATAAGGLRLLRYGSLHGSILG
FT                   MEAVLPDGTILDNLVTLRKDNTGLDIKQLFIGSEGYLGVITKLSVICPKRPSSTNVAFF
FT                   GVPSYENVLKAFSETRSHLTEILSAFELMDNTSQTLVDKYSGTQRPLEDEHPFYVLVET
FT                   QGSNKEHDEQKITALVEDLLEKEIISDGVLAQDESQLRVLWERREGITECLAKAGSGVY
FT                   KYDVSLPLPVLYDLVNDTKKRLIEFNLLDDTPEHPVIDVVGFGHMGDGNLHLNIAVRQF
FT                   DKRVEKCLEPWVYEWVSRHRGSISAEHGLGLLKKPFVGYSKSKEMIHLMKTLKNVFDPN
FT                   GIMLPYKYV"
FT   3'UTR           873174..873408
FT                   /locus_tag="SPBC713.03"
FT   3'UTR           complement(873265..873357)
FT                   /locus_tag="SPBC713.04c"
FT   CDS_pept        complement(873358..875922)
FT                   /transl_table=1
FT                   /locus_tag="SPBC713.04c"
FT                   /product="U3 snoRNP-associated protein Utp1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.04c.1"
FT                   /db_xref="GOA:Q9C1X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027145"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC713.04c"
FT                   /db_xref="PomBase:SPBC713.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1X1"
FT                   /protein_id="CAC22605.1"
FT                   /translation="MKTEFGFSNLVGTIFSKGNLVFTPDGFSILSPVGNRVSVYNLKDN
FT                   TSYTFPFENHKNISHIALSPTSTLLLSVDEEGRCILCNFLRRSVLHYFNFKSPVGAIEF
FT                   SPNGKFFAVSLGKLIQVWRTPNSLEEREFAPFVLHREYTGHFDDIVSISWSADSRFFIS
FT                   TSKDLTARLHSVDPIEGFHPCALTGHKNTVVSGFFSKDQQTIYTVSKDGALFVWKYSPL
FT                   FQAGEVIDEEAEENKTRTHIWLIKERHYFNQNSKLRCAAFHPTSNLLVVGFSSGLFGIY
FT                   ELPSFTMLYQLSITQSNIDTLTVNSTGDWIAIGSSKLGQLLVWEWQSESYVLKQQSHYD
FT                   ALSTLQYSSDGQRIITGADDGKIKVWDMNSGFCIVTFTQHTSAVSGLCFSKRGNVLFSS
FT                   SLDGSVRAWDLIRYRNFRTFTAPSRVQFSCIAVDPSGEIVCAGSQDSFEIFMWSVQTGQ
FT                   LLETLAGHEGPVSSLSFNSSGSLLASGSWDKTVRIWDIFSRSGIVEPLPIPSDVLSLAF
FT                   HPDGKEVCVASLDGQLTFWNVQEGKQTSLIDGRKDLSGGRRFDDARTAENSSLNKTFTS
FT                   ICYSADGSCVLSAGTSKYVCLYDIITGVLIKKFQLSKNESLQGVQEMLNSRKMTEAGSI
FT                   ELIDTQGEESDLEDRIDRTLPGARRGDLSARKTRPEIICHGVQFSPSGGAFAAATTEGL
FT                   MIYSLYNDFLFDPINLDMDITPSTTLTMCAEGEFLISLVMALRLNEYKVVQKVYESIPI
FT                   TDVEHVVQELPVSYLANFMGYLSSFAAETPHIEFHLRWMKSVLTYHGEYLRRKNFEFAS
FT                   QLTSLQKSIVVLSKRLSQLSSNNEFQLSFLLDKMHLRLENTA"
FT   5'UTR           complement(875923..876158)
FT                   /locus_tag="SPBC713.04c"
FT   5'UTR           876116..876349
FT                   /locus_tag="SPBC713.05"
FT   CDS_pept        join(876350..876695,876741..876777,876821..876978,
FT                   877019..877371)
FT                   /transl_table=1
FT                   /locus_tag="SPBC713.05"
FT                   /product="WD repeat protein, human MAPK organizer 1 (MORG1)
FT                   family (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.05.1"
FT                   /db_xref="GOA:Q9C1X0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC713.05"
FT                   /db_xref="PomBase:SPBC713.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1X0"
FT                   /protein_id="CAC22606.1"
FT                   /translation="MRLEAKTKLSSKAKEPINVVKYNRTGKYVLAAGNERVVRLWNVKS
FT                   GACIHEYAGHGHEILDLDLVYDSTKFASCGGDKFIQVWDVNTGKVDRRLGGHLAQINTI
FT                   RYNEDSSILASGSFDSKVRLWDCRSNSFSPIQVLADAKDSVSSIDIAEHLIVTGSTDGT
FT                   LRTYDIRKGTLSSDYFSHPITSVKTSKSASFSLISSLNSSIHLLDQETGKILKSYIGLK
FT                   NMEYRVRSSFNQSETIVFSGSEDGKVYLWDLENETQITSTSVVGTPIVTDISCHPTMDD
FT                   FIIATVHGDLFIYQYN"
FT   3'UTR           877372..877468
FT                   /locus_tag="SPBC713.05"
FT   5'UTR           877402..877503
FT                   /gene="adl1"
FT                   /gene_synonym="lig3"
FT                   /locus_tag="SPBC713.06"
FT   CDS_pept        877504..879828
FT                   /transl_table=1
FT                   /gene="adl1"
FT                   /gene_synonym="lig3"
FT                   /locus_tag="SPBC713.06"
FT                   /product="DNA ligase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.06.1"
FT                   /db_xref="GOA:Q9C1W9"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="PomBase:SPBC713.06"
FT                   /db_xref="PomBase:SPBC713.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1W9"
FT                   /protein_id="CAC22607.1"
FT                   /translation="MPPKKRMKNGSSLKSTSKKGEKSRNIITIQDLFSKREAQLTDTPN
FT                   KLLTDHDQSASDYAYALKLQQLFDSENQATAPEKLPKDVIIPEEEYHTDTFNVVKESND
FT                   KPKENLVTSEECKASFFSTDSVNKDSTIDYDALQKDPLTYVKSCRARFVSKDTKSFSYS
FT                   SLANTFSLISSTKSRIRIVTLLTNFLLTLLYADPDSLIATVWLCTNSIAPNFYGKNLGV
FT                   GPAMYSKALKEVCGITASALKNLWNKYGDPGDVAFEAKVSVRTLSRPEPLTIKKVYSTL
FT                   LKIADSNGNGAQNRKLELTKFLLISSNAEEVRYIGRSIMQNLRIGAVQNTMLASLSKAF
FT                   FIFDNQNEIFNFNSDSLQQQFRQGEEIVKQSFFQVPDYNILVATLLREGIENLKDNMSI
FT                   RPGIPVKPMLGSITKNLQHMLERLTDHNFSCEFKYDGQRAQIHCDRLGNIKIFSRHLEE
FT                   ITGRFPDVIEVAQLALKHSCDFIIEGELVAIDKSNGQILDFQKLSTRERKKVTVADITI
FT                   DVCVFVFDIMFCDGKSCLQMPLIERRRMFFEHFNLIPNRFQFVSSLETNEEQSIQEFFS
FT                   LAITNKCEGLMVKVLNGTNSKFPSTYEPDKRGEGWIKVKQDYDDEFESLDLVPIGAWYG
FT                   NGRKAGWFSPILLAVYNPDTGAYEAVCKCMSGFSDQFYKELTQKYSLESGNSSLKPIYN
FT                   FCETGKVTPQIYFAPQEVWEIKGAQITSSPAYKAALGLIQDDRGLSIRFPRFIRVRSDK
FT                   GPEDASTNSILADMYMKQLNT"
FT   3'UTR           complement(878397..879918)
FT                   /locus_tag="SPBC713.07c"
FT   3'UTR           879829..882319
FT                   /gene="adl1"
FT                   /gene_synonym="lig3"
FT                   /locus_tag="SPBC713.06"
FT   CDS_pept        complement(879919..881652)
FT                   /transl_table=1
FT                   /locus_tag="SPBC713.07c"
FT                   /product="vacuolar polyphosphatase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.07c.1"
FT                   /db_xref="GOA:Q9C1W8"
FT                   /db_xref="InterPro:IPR012358"
FT                   /db_xref="InterPro:IPR041805"
FT                   /db_xref="PomBase:SPBC713.07c"
FT                   /db_xref="PomBase:SPBC713.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1W8"
FT                   /protein_id="CAC22608.1"
FT                   /translation="MRPSVITVAVLFVQSTWASFAFGNPMSMRNKAHTNDLVNSKGKPL
FT                   VGRFLHITDMHPDIYYEKGSTVDHYCHSYDHNSDDTPLGKSKVGYLSPGPGYECDSSPA
FT                   LIDKTLEWLKEHQDDVLGGIDFILWTGDNSRHDNDNHFPRTQSEILASNEDLVNKMIEA
FT                   FPDVPIVSAIGNNDIYPHNIMEAGPSSMTRQLAGAWDALIPYEERHTFEKGSYYLCDVI
FT                   PDKLAAISINTLYLSNKNAAVDGCPDDNLDEPGSLFMRWFKIQLEAYRLKGMKVWLLGH
FT                   IPPTRGQWYEDCYTSFTDLLYEFRDIIVGQLYGHMNINHFVFLEFDKLPVDTESYGIKS
FT                   AQPKYVKSLIDAQYAELPTFPENLTEEFLNGTVGNYSLATVGGSIIPEMFPTFRVYEYN
FT                   ISDIANQLDDREELTEITSFNWETLEEQSQSDYEIDKKKKKKKKNNKKKKKNKRKNIKP
FT                   GPLGPAYVPSLFTPISFKQYFLNTSNYMDATKDTEISYELLYTSKDSPYNMPDLTVPEY
FT                   MRLAKRIATCDKPEDPHQFKLQSGDQNTFRISKKKKPSICPIAYTYLWHAYIGSISDFE
FT                   D"
FT   5'UTR           complement(881653..882180)
FT                   /locus_tag="SPBC713.07c"
FT   5'UTR           882253..882459
FT                   /gene="mim1"
FT                   /gene_synonym="tom13"
FT                   /locus_tag="SPBC713.08"
FT   CDS_pept        882460..882675
FT                   /transl_table=1
FT                   /gene="mim1"
FT                   /gene_synonym="tom13"
FT                   /locus_tag="SPBC713.08"
FT                   /product="mitochondrial TOM complex assembly protein Mim1
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.08.1"
FT                   /db_xref="GOA:Q9C1W7"
FT                   /db_xref="InterPro:IPR013262"
FT                   /db_xref="PomBase:SPBC713.08"
FT                   /db_xref="PomBase:SPBC713.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1W7"
FT                   /protein_id="CAC22609.1"
FT                   /translation="MEKNTVTVPKTLFSQVIHIFKYAAINLGLPFLNGVMLGFGEIFAH
FT                   AFIHSLGWAPGHTRIYSIQRHQYIQA"
FT   3'UTR           882676..883915
FT                   /gene="mim1"
FT                   /gene_synonym="tom13"
FT                   /locus_tag="SPBC713.08"
FT   misc_RNA        complement(883967..884395)
FT                   /locus_tag="SPNCRNA.1394"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           884900..884958
FT                   /locus_tag="SPBC713.09"
FT   CDS_pept        join(884959..885000,885042..886187)
FT                   /transl_table=1
FT                   /locus_tag="SPBC713.09"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.09.1"
FT                   /db_xref="GOA:Q9C1W6"
FT                   /db_xref="PomBase:SPBC713.09"
FT                   /db_xref="PomBase:SPBC713.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1W6"
FT                   /protein_id="CAC22610.1"
FT                   /translation="MSDREEKLAAAKQRLLEVKKKKRQAKSKNSVAEDNVDRESNDGNN
FT                   QVNEPTGNDNTQVVENTEDISASNVVSAEGAEASTGDASTQSPETSENVVKNSVDESVA
FT                   EKPEKEDLAVIESEDKAAKPDGEIKKNVETEVTSRSTSSQEKDELEKQVKTLHDLNEQK
FT                   DKKIKELKERINDLTYDYETLKANADDSEGKQTLVSKREAALEEFQSKLLIRENEINKR
FT                   ELKMNGKEDDLKKREKDLENRLLKVEEHEKSLNERATKLSEANENFNNRFKEFEEREKS
FT                   AIKQNKEQSSEGSKTANQTHEQKELINSLEKKVSDIALEKQLLEEAVERYKLAMVEFAE
FT                   CQRRLKELEAMHFEQPGSVTEKLFPDPTNFEVIDNVSIDLTLTGFPGAHGIPFSV"
FT   3'UTR           886188..886313
FT                   /locus_tag="SPBC713.09"
FT   5'UTR           886481..886615
FT                   /gene="tim16"
FT                   /locus_tag="SPBC713.10"
FT   CDS_pept        join(886616..886664,886730..887067)
FT                   /transl_table=1
FT                   /gene="tim16"
FT                   /locus_tag="SPBC713.10"
FT                   /product="TIM23 translocase complex subunit Tim16
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.10.1"
FT                   /db_xref="GOA:Q9C1W5"
FT                   /db_xref="InterPro:IPR005341"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="PomBase:SPBC713.10"
FT                   /db_xref="PomBase:SPBC713.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1W5"
FT                   /protein_id="CAC22611.1"
FT                   /translation="MSLPRAVGRFIIVGSQVMSKAFVQAYKQMIANAAQQSTGQAAASK
FT                   SSTAVRRGEMTIQEAGSILNIKPESLEEGELEKRFQKMFEINDPKKGGSFYLQSKVFRA
FT                   HEKLKSELDQKIQEQSPAKPTSSP"
FT   3'UTR           887068..887647
FT                   /gene="tim16"
FT                   /locus_tag="SPBC713.10"
FT   3'UTR           complement(887573..887998)
FT                   /gene="pmp3"
FT                   /locus_tag="SPBC713.11c"
FT   CDS_pept        complement(join(887999..888142,888513..888542))
FT                   /transl_table=1
FT                   /gene="pmp3"
FT                   /locus_tag="SPBC713.11c"
FT                   /product="plasma membrane proteolipid Pmp3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.11c.1"
FT                   /db_xref="GOA:Q9C1W4"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="PomBase:SPBC713.11c"
FT                   /db_xref="PomBase:SPBC713.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1W4"
FT                   /protein_id="CAC22612.2"
FT                   /translation="MALTGSDIFKVIFAIILPPLGVFLERGCGADVIINILLCCLGYVP
FT                   GIIHALYIILKY"
FT   5'UTR           complement(888543..888695)
FT                   /gene="pmp3"
FT                   /locus_tag="SPBC713.11c"
FT   misc_RNA        889339..891607
FT                   /locus_tag="SPNCRNA.1395"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(889557..890219)
FT                   /locus_tag="SPBC713.13"
FT   CDS_pept        complement(890220..890546)
FT                   /transl_table=1
FT                   /locus_tag="SPBC713.13"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.13.1"
FT                   /db_xref="GOA:G2TRS5"
FT                   /db_xref="PomBase:SPBC713.13"
FT                   /db_xref="PomBase:SPBC713.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS5"
FT                   /protein_id="CCD31356.1"
FT                   /translation="MKIMKITNGNNLHYQTIYPYQMIPLSQPIAVFPPCYFVCFASLSI
FT                   SGRKHILFFNFFFFTFSTFFLLKCNFLKDIFLFFFLFFFFFLFTLFLSHPTLTGLPTFL
FT                   CITH"
FT   5'UTR           complement(890547..891152)
FT                   /locus_tag="SPBC713.13"
FT   misc_RNA        890907..892096
FT                   /gene_synonym="SPNG1304"
FT                   /locus_tag="SPNCRNA.332"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           892162..892678
FT                   /gene="erg1"
FT                   /locus_tag="SPBC713.12"
FT   CDS_pept        892679..894052
FT                   /transl_table=1
FT                   /gene="erg1"
FT                   /locus_tag="SPBC713.12"
FT                   /product="squalene monooxygenase Erg1 (predicted)"
FT                   /EC_number="1.14.99.7"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC713.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC713.12.1"
FT                   /db_xref="GOA:Q9C1W3"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040125"
FT                   /db_xref="PomBase:SPBC713.12"
FT                   /db_xref="PomBase:SPBC713.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C1W3"
FT                   /protein_id="CAC22613.1"
FT                   /translation="MATQDADIIIIGAGITGCALGAALGRQGRKVLVLERDMSEPDRIV
FT                   GELLQPGGIEALEKIGIADAVEGIDGQWTSGYQIFYGDSNVSVPYPSKPNGGAYQGIGF
FT                   HYGRFVMNLRKALTSTPNVTVTEATVNELLRDETGEVITGVVTSSKKSESPVEYKAPLT
FT                   IVCDGCFSKFRKAFIDHPIQVTDHFLGLILTNPDYIAPGRGHVILSKVAPMVLYPISST
FT                   EARILINYPGKNLPPMETLKKYVLESCVPNMPEKLRPSLKAAVYNDRLRSMPNQFLPPT
FT                   VNRTKGMILVGDSNNMRHPLTGGGMTVCFHDAYLLSRFISPSAVPDLLDYERILNQMNK
FT                   FHWKRKGYSFVINVLSIALYKLFTPKNRYMKALESGCIDYFKRGGNCVEGPIRLLGGLD
FT                   HSPSHLIGHFYAVCLYGIYQYVLSGPALLMPVRIIESLLIFLQASLVIIPYILSEMSS"
FT   3'UTR           894053..894361
FT                   /gene="erg1"
FT                   /locus_tag="SPBC713.12"
FT   3'UTR           complement(894372..894564)
FT                   /gene_synonym="SPBC713.13c"
FT                   /locus_tag="SPBC216.01c"
FT   CDS_pept        complement(join(894565..896363,896422..897133))
FT                   /transl_table=1
FT                   /gene_synonym="SPBC713.13c"
FT                   /locus_tag="SPBC216.01c"
FT                   /product="DNA damage response protein (predicted)"
FT                   /db_xref="GOA:Q9Y7J8"
FT                   /db_xref="InterPro:IPR006887"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y7J8"
FT                   /protein_id="CAC22614.2"
FT                   /translation="MDSTKEEEDLNNNIDEISDGENEEEELDEAIAAALQKIEVPSIPR
FT                   RVKVYEMEDENWVDCGTGYCDGKIEGPLAYFIVRSEADNETILLKTQLIAEDIYSRQEE
FT                   TLIVWQELNGTDLALSFQESSGCIDMWMFLANVQKAISSVTRSYSNDDILTDEGALNEN
FT                   YLNTVDLPAPELANLKEIEEAVYGYMQSIQSRDSLVRYVSNENYIDRLIELFPLCEDLE
FT                   NTDDLHRLCSIIKSFVQLNDAPLLESLFSNDEKLMCVAGILEYDPEFPNIKANHREYLM
FT                   DSKKFKQVVPIQDPRILAKIHQTFKLQYLRDVVVSRIVDEPSFSVLNSFIFFNQADIIQ
FT                   YLQTNEKFLHELFSIYVNEGEDDQRKQDGIFFIQQVCNIAKGLQFQSCSALFATFVKFN
FT                   LLKALDYAMSHENNSVRNAGSDILVSIIDHEPAIVWQKFDQDRKDASSSLSNAHVSQHS
FT                   LLSNLINILHKESNPGVLAQISEAFKMLLSLPGSYAYNNPYRNADGNVRNKTDNIIGIN
FT                   FIENFYDNSFNMLAAPLLELENVSSLDVKKLDMYMHLCELFCYFFRIHDYWSRRFDTYK
FT                   TLTSKVALLLYSDRKYVVLSALRFIRSCLAARQSEMSLIMLETDTYGKVLDLMLKVKDQ
FT                   TNLVNSAALEFFEFLRSEGSEDTLDYLNKNYRPQLESLNNLSTFSELLNIIDGLSSDSR
FT                   SPKTVGTHESNSYEFDGASNNNQRVGDDVSKDWEIQQDFSIENDTELSEKVGQRTVLDS
FT                   IAPAELNIEDSCEQPKQPILEDRYFLESAVYDTSAESSGINVSNTRYSKRKSDFQVDDQ
FT                   QADDESPKKRLSIDSSSAQNGYAS"
FT   misc_RNA        896715..897364
FT                   /locus_tag="SPNCRNA.1396"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(897134..897437)
FT                   /gene_synonym="SPBC713.13c"
FT                   /locus_tag="SPBC216.01c"
FT   misc_RNA        complement(897892..901405)
FT                   /locus_tag="SPNCRNA.1397"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           898070..898074
FT                   /gene="mcp5"
FT                   /gene_synonym="num1"
FT                   /gene_synonym="mug21"
FT                   /locus_tag="SPBC216.02"
FT   CDS_pept        898075..900981
FT                   /transl_table=1
FT                   /gene="mcp5"
FT                   /gene_synonym="num1"
FT                   /gene_synonym="mug21"
FT                   /locus_tag="SPBC216.02"
FT                   /product="cortical anchoring factor for dynein Mcp5/Num1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC216.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC216.02.1"
FT                   /db_xref="GOA:Q9Y7J9"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR024774"
FT                   /db_xref="PomBase:SPBC216.02"
FT                   /db_xref="PomBase:SPBC216.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y7J9"
FT                   /protein_id="CAB40162.1"
FT                   /translation="MEKKQDNEVELYSIDLKNRNESAKIKLAYAKALEESILCETRKIE
FT                   QEIKDQVVQKENKTYFNNKFDNRYKLRDLEKNLAEEEVRITEMLTIQRQDIAIERRKNT
FT                   NCFSESSQVDQYSVTETNLQYATNIGLNLLQQLRYLRLQLSEKEDLHKKLSVDNAHLIK
FT                   QLDLLSSNMKTLMKEKTKVQGQRDLLEQRLQGLMKKLTEVESLTVSLNDEKNKLTLELT
FT                   NLRICLHELQLNAEKGETIDESEDSKNTLVTEDENDDSVFLESSSDKYFDSSSFDAEQE
FT                   EKHDFPIDPFLSLESNVQTSVSQSSAVLKSINLAKQELVSVNHLVADDTKTPSPNLSSE
FT                   IIENTKADIKKSIRSLNKAVSPENSIDIEDETDRDDEFICFLLSYQQLQKALKSNLGLF
FT                   QLSCLYPLSLNHLIQSFFQSLTSQISIKDIDSKNKQVIKLFKPTKSSDRQEIFELAQFE
FT                   PRQKFPIDTNSSKCDMSASTEMHLKDTEKFANFKLKENILNHSSIYERDVSYLPALNKG
FT                   GRENYLNNRVSSYRLVKPILNSYGNHVLNRIQHDILENHFCCLKNVKDFVCGANTISMQ
FT                   WNLQKNMEFISSVFSLIKNEVNDTSANSVILRTDALSNVATTRLKRKLTSAIIDCSIPR
FT                   RRLRHYSNPEIAEFKNFRLSTDISHSNVRNSKKLCSNGSMNCMRQGKAVFPRKIPYQEH
FT                   DWEQWEKIAQSSMFKNRSIASRQSLETSDVTLDINMSSRHSNGTSSMLFKDFTKHNNWE
FT                   ASTYPSAPKNTRTYPTAEVEKTRHDSSQSARQLKARSTATTISISLSTVSDVFTLPRNN
FT                   LKSKTNTKKCRDNLNLSGLSSSTCNANSVNKLMKHVMMGNEMMKYPRSESFKMFKKSHW
FT                   RYFWINPHCEMLCWSKTNPFIEKGRKNQVKSVKIKGMTIIKAPDALKNANLHNEVIVMQ
FT                   TTDKPIVLKAKSKKIHNIWVQAIKQINHKAIFDTKPGI"
FT   misc_RNA        complement(900653..901207)
FT                   /gene_synonym="SPNG2AF34"
FT                   /locus_tag="SPNCRNA.566"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           900982..901363
FT                   /gene="mcp5"
FT                   /gene_synonym="num1"
FT                   /gene_synonym="mug21"
FT                   /locus_tag="SPBC216.02"
FT   5'UTR           901669..901941
FT                   /locus_tag="SPBC216.03"
FT   CDS_pept        901942..902685
FT                   /transl_table=1
FT                   /locus_tag="SPBC216.03"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC216.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC216.03.1"
FT                   /db_xref="GOA:Q9Y7K0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC216.03"
FT                   /db_xref="PomBase:SPBC216.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y7K0"
FT                   /protein_id="CAB40163.1"
FT                   /translation="MTVFVVFGGHGKVALLFTKIATEAGHIVYNVVRDYVQNEDIEKVH
FT                   GRTSVCSLEKATPNDIAQFLAEIHPDVVIFAAGAGGKGGPERTRAVDYEGAIKVYDAMR
FT                   IAGIRRLIMISAIDNRDMSQPPPPYYTAADIELSEKIHQSIGTYYHYKYLADQELVRRS
FT                   SDIDWTILRPSGMTDEKGSGKVALGKISINCMMSRENVARTVLLFALDNQSIHLVVDMT
FT                   DGNVPIYKAIAGFVVKGESSYTYSV"
FT   3'UTR           902686..902987
FT                   /locus_tag="SPBC216.03"
FT   3'UTR           complement(902993..903155)
FT                   /locus_tag="SPBC216.04c"
FT   CDS_pept        complement(903156..903572)
FT                   /transl_table=1
FT                   /locus_tag="SPBC216.04c"
FT                   /product="methionine sulfoxide (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC216.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC216.04c.1"
FT                   /db_xref="GOA:Q9Y7K1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="PomBase:SPBC216.04c"
FT                   /db_xref="PomBase:SPBC216.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y7K1"
FT                   /protein_id="CAB40164.1"
FT                   /translation="MGFPLEKSEDEWKKELGPEKYRIMRQKGTEHPGAGRFTHQFPKQG
FT                   VFVCAACKELLYKASTKFESHCGWPAFFDNLPGKVKRIEDNSYGMHRVEAVCANCGGHL
FT                   GHIFKGEGYSNPTDERHCINSASLEFHNEATNDN"
FT   5'UTR           903253..904364
FT                   /gene="rad3"
FT                   /locus_tag="SPBC216.05"
FT   5'UTR           complement(903690..903856)
FT                   /locus_tag="SPBC216.04c"
FT   CDS_pept        904365..911525
FT                   /transl_table=1
FT                   /gene="rad3"
FT                   /locus_tag="SPBC216.05"
FT                   /product="ATR checkpoint kinase Rad3"
FT                   /db_xref="GOA:Q02099"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02099"
FT                   /protein_id="CAB40165.1"
FT                   /translation="MSQHAKRKAGSLDLSPRGLDDRQAFGQLLKEVLALDKEHELGRSN
FT                   SLPSMTSELVEVLIEVGLLAFKHDDSKSEFISPKMLKEAHLSLQALMLILKRSPTVLRE
FT                   IKSSVTLLDWILPRTISLFADIRFIKLFDSLKEFHKLIYQLISEKSFLWDLYASFMRYW
FT                   KYYITNVSSIVLQITNATFPYKMPSPNSQPLQSITPNYPTHREDKFDLLIINIEEACTF
FT                   FFESAHFFAQCSYLKKSNFPSPPLFTAWTWIKPCFFNFVILLKRISIGDSQLFLHLHSR
FT                   IVQTLCCFSLNFIYHGLPICEKSKHILMSSINLTLGSLKKTYTVANTAISLFFLSLFVL
FT                   PKTVAGLFYPFGVSLLSDFKVLEQLEPDSDLKKAIILFKCRYQSSEIDQTTLRAFGEIC
FT                   TGKLENTLFSNSELNLFLLHYLSLDNDLSNILKVDFQNGHNICTFAKWCINNNLDEPSN
FT                   LKHFREMLDYYSSHNVTISEDDLKNFSLVLCTHVAKVNEKTNSIFRTYEVHGCEVCNSF
FT                   CLLFDERSLFKIPYHELFCALLKNPDIISSSVKQSLLLDGFFRWSQHCSNFNKESMLSL
FT                   REFIMKALASTSRCLRVVAAKVLPIFIKGPNNLDIVEFHKESKALIFNTLKILAVENTA
FT                   ILETVILSWISLSRVVEEEELHFVLLEVISSVINSGIFYQGIGLSALQQIASTRHISVW
FT                   QLLSPYWPTVSVAIVQGMGKKPNIASLFAQLMNISEGDFLIRTQAYTLPFLVLTKNKAL
FT                   IVRIAELSQSDVATLCLTNMHKILASLLTTDHPNLEESVMLLLSLATSDFEKVDLTSLL
FT                   RSDPISITVELLQLYQNDVPHEKIENALRKVAMIVSQVVNDEDLSNKELLYDFFNNHIL
FT                   GILAEFSNILNDLKGKTSINEKIKTIVGIEKMLSLCGGAVKLGLPQILSNLQSAFQNEH
FT                   LRFYAIKAWFSLILATKEPEYSSIAGLSLVILPPLFPYLEPQEAELVIQIFDFISSDTH
FT                   KCLQGLKWAIPTSLDSACFSLKAKEIFCSLQNEDFYSELQSIIKCLTNENEPVCYLGLQ
FT                   KLELFFQAKVDELHDTLNLDISNEVLDQLLRCLLDCCVKYASTNMQISYLAAKNLGELG
FT                   AIDPSRAKAQHIIKETVVLDNFENGEESLKFILDFMQSQLIPAFLVTTDTKAQGFLAYA
FT                   LQEFLKLGGFKSAVINKKKGLTVVTEHWMSLPDLSKRVLIPFLTSKYHLTPIPKIDIRY
FT                   PIYKENVTIHTWMQLFSLKLMEYAHSQNAEKIFGICSKVVKDQEVNIPCFLLPFLVLNV
FT                   ILTESELEVNKVIEEFQLVINQPGPDGLNSVGQQRYTSFVDVFFKIVDYLNKWLRMRKK
FT                   RNWDRRSAIARKENRYMSVEDATSRESSISKVESFLSRFPSKTLGIVSLNCGFHARALF
FT                   YWEQHIRNATAPYAALESDYRVLQEIYAGIDDPDEIEAVSLNFHDYSFDQQLLLHENSG
FT                   TWDSALSCYEIIIQKDPENKKAKIGLLNSMLQSGHYESLVLSLDSFIINDNHEYSKMLN
FT                   LGIEASWRSLSIDSLKKCLSKSNLESFEAKLGSIFYQYLRKDSFAELTERLQPLYVDAA
FT                   TAIANTGAHSAYDCYDILSKLHAINDFSRIAETDGIVSDNLDIVLRRRLSQVAPYGKFK
FT                   HQILSTHLVGYEKFENTKKTAEIYLEIARISRKNGQFQRAFNAILKAMDLDKPLATIEH
FT                   AQWWWHQGQHRKAISELNFSLNNNMFDLVDEHEERPKNRKETLGNPLKGKVFLKLTKWL
FT                   GKAGQLGLKDLETYYHKAVEIYSECENTHYYLGHHRVLMYEEEQKLPVNEQSERFLSGE
FT                   LVTRIINEFGRSLYYGTNHIYESMPKLLTLWLDFGAEELRLSKDDGEKYFREHIISSRK
FT                   KSLELMNSNVCRLSMKIPQYFFLVALSQMISRVCHPNNKVYKILEHIIANVVASYPGET
FT                   LWQLMATIKSTSQKRSLRGKSILNVLHSRKLSMSSKVDIKALSQSAILITEKLINLCNT
FT                   RINSKSVKMSLKDHFRLSFDDPVDLVIPAKSFLDITLPAKDANRASHYPFPKTQPTLLK
FT                   FEDEVDIMNSLQKPRKVYVRGTDGNLYPFLCKPKDDLRKDARLMEFNNLICKILRKDQE
FT                   ANRRNLCIRTYVVIPLNEECGFIEWVNHTRPFREILLKSYRQKNIPISYQEIKVDLDFA
FT                   LRSPNPGDIFEKKILPKFPPVFYEWFVESFPEPNNWVTSRQNYCRTLAVMSIVGYVLGL
FT                   GDRHGENILFDEFTGEAIHVDFNCLFDKGLTFEKPEKVPFRLTHNMVDAMGPTGYEGGF
FT                   RKASEITMRLLRSNQDTLMSVLESFLHDPLVEWNRKKSSSKYPNNEANEVLDIIRKKFQ
FT                   GFMPGETIPLSIEGQIQELIKSAVNPKNLVEMYIGWAAYF"
FT   3'UTR           complement(907370..911602)
FT                   /gene="swi1"
FT                   /locus_tag="SPBC216.06c"
FT   3'UTR           911526..913629
FT                   /gene="rad3"
FT                   /locus_tag="SPBC216.05"
FT   CDS_pept        complement(join(911603..913570,913646..914593))
FT                   /transl_table=1
FT                   /gene="swi1"
FT                   /locus_tag="SPBC216.06c"
FT                   /product="replication fork protection complex subunit Swi1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC216.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC216.06c.1"
FT                   /db_xref="GOA:Q9UUM2"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="InterPro:IPR007725"
FT                   /db_xref="PomBase:SPBC216.06c"
FT                   /db_xref="PomBase:SPBC216.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUM2"
FT                   /protein_id="CAB40166.1"
FT                   /translation="MELDEVIQGIVSAIGGFDYSDDEKVYVLGDEALACLKDLKRYLQV
FT                   VDEKYKVWQIRSLLSSLQLVTNDICPILSDWDKDITNYRNWRIALACVELLVPLTWPLE
FT                   TEHETFRENVDVLYNLRQAQSNYKNSILSYKKGSVLSAILAVLLKPLSTPAESRTLRDK
FT                   GIIRIVLLLFRNILQIDELKTKNETIISFAKAHILDLIVTLVSNLDEFEHFDVYILEIV
FT                   YNLIRGCKPSALFSDASLTNSQTELNSLLLKESTQNRYLKRNAHTRHNRFGTMLSVQTE
FT                   DRRFTIASQNIKTDGLDELDSHKRFRKRGTRRKHFDDINKSFFINTEAGTALRNFAVEF
FT                   LEAGFNPLFQSLLKDLEREDPRVLPIHKMQLLYVQSFFLEFMRFSSKPKKTEEIYSNDY
FT                   SFGLAASVFDQRALIMHNRLMVESFEMKQWSTFQASMLSMTQLLFTLRSMTLCSSEIYQ
FT                   RIADNLLSNIFYQEEILLLVYSALKHFKTQSFGYLDAITELTIVLLKELEKFSSAKQYL
FT                   YVKKRRRNQKSVDSNVLESDEDEESSLINANAAVEDRLFDFGRYESRYCDNGCIDSFVL
FT                   FLQCYQDLDSKQIHRAISFFYRIFVKQKCHVYLYRLDFLRVLDKMFNDHVYFSTTNSAR
FT                   QDFEQFFVYYMRKLSDALKDVPALFIELPFPKLTDTFYYLEYGKSPLFSIHGSRKGPLY
FT                   ETVPGLSHLEKVAAVVACLINENKSDLLDELKVQLNCLISERKLITLADENKYINEGGN
FT                   DGERMGKNLKGDTDSFNTALLKDGKFRLLLELCGFEESDNNIDVQALWKLPNSVIIDEL
FT                   VEHAMLLRRFTDDPPTFEGTKPEDLLVRKQRGNVRLPSSSEGETSDEEIEFEADDPITF
FT                   ANRREALNKITDRKRKKMKTNETIIDHTTRKKKENHLRSAKYIVDSDDDSETDIAFFQS
FT                   EAALREKNAQKASALFKRIDDLEMEGKLQEIEQLSENSSSD"
FT   5'UTR           complement(914594..914892)
FT                   /gene="swi1"
FT                   /locus_tag="SPBC216.06c"
FT   3'UTR           complement(915085..915270)
FT                   /gene="tor2"
FT                   /gene_synonym="SPBC646.01c"
FT                   /locus_tag="SPBC216.07c"
FT   CDS_pept        complement(915271..922284)
FT                   /transl_table=1
FT                   /gene="tor2"
FT                   /gene_synonym="SPBC646.01c"
FT                   /locus_tag="SPBC216.07c"
FT                   /product="phosphatidylinositol kinase Tor2"
FT                   /EC_number="2.7.1.137"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC216.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC216.07c.1"
FT                   /db_xref="GOA:Q9Y7K2"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR009076"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR024585"
FT                   /db_xref="InterPro:IPR026683"
FT                   /db_xref="InterPro:IPR036738"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="PomBase:SPBC216.07c"
FT                   /db_xref="PomBase:SPBC216.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y7K2"
FT                   /protein_id="CAB40167.2"
FT                   /translation="MKEFPGLKSRNEEIRNKAANDLYEYVIAYSRELSGEALVQFNNDV
FT                   NKYVYTLIHSTDPLDRLAGVTAINRLIDYEGEDTTRITRFANYLRIILPGTDQKATVLA
FT                   AKALGRLAVPGGALTSEFVNFEVKRALEWLQGERNENRRYAAVLILKELAKNTSTLIYA
FT                   HIDSIFELLWHGLRDPKVTIRIASADALSEFLKIVRQRDSSIRLQWYTSILNEAQRGVA
FT                   QGSSDYIHGSLLVYRQLFLKAGMFMHERYREVSDIILQFRDHKDLLIRKTVTELIATLA
FT                   AYNPDEFVSNYLHVCMLHLLNLLKKENVKMLAFATIGKVAVAITNSIIPYLDPICDSIK
FT                   ESLKIHIRNKSASDAAIFQCISLLSIALGQAFSNYAYDLFDLIFASGLSEASYRALSDL
FT                   AHNIPPLLPVIQERLLDMLSKILSGRPFIPPGCPPQYVARSLKSSKSASLKTGFFPNDV
FT                   YILALKVLGNFDFSGYILNEFVKDCVVVYLENNDPEVRKTASITCSQLFARDPILSQTS
FT                   DHAIQVVAEVLEKLLTVGICDTVPDIRLTVLNSLDSRFNKHLAQADKIRLLFIAINDEN
FT                   FAVRESALRIIGRLNVYNPAYVMPYLRKIMLKTLTILDYSTIIRTKEENAKLLCLLIAA
FT                   APRLIESHVEPILQILLPKAKDSSSIVAASIVNSLGEICQISGEVIVPFIKDLMPLIIE
FT                   ALQDQSSPIRRAAALKALGNLSSSTGYVIDPYIEFPSLLDILIGITKTEQDITIRRETI
FT                   KLIGTLGALDPNRHRVLEKGTEKVVPEQKNIPPDISLLMSGIGPSSDEYYPTVVITALM
FT                   SILKDPSLTIHHTAVIQAVMYIFKTMGLRCAPFLSQIIPEFIAVMRTCPTNILEFYFQQ
FT                   LSILVLIVRQHIRSFLPDLFKLIKDFWNPHSNLQFTILSLIESLARAMQGEFKPYLPSL
FT                   LVMMLQIFDSDVSVDSVSTKKVLHAFIVFGDTLADYFHMLLDPILRLYERNDVSIGIKE
FT                   SIMITIGRLSMVINLSEYASRIIHPVMRMLSCNNASLIRVSMDTVCALIYQLNVDFAIF
FT                   IPMIDKCLKMNGVTHETYSILVEQFLQEQPLPIKLNPYEKYDKPKLDVVASAADITSKK
FT                   LPVNQEILRNAWEASQRSTKDDWQEWIRRLGVALLRESPSHALRACAALAAAYQPLARD
FT                   LFNASFVSCWSELYDHFQEELVKSIEIALTSPHISPEIIQILLNLAEFMEHDDKPLPID
FT                   IRTLGAYAAKCHAFAKALHYKELEFIEEELVTKPSVDTIEALISINNQLQQPDAAIGIL
FT                   KHAQQHDKMNLKETWYEKLQRWEDALSAYEKREAAGAGNFEITMGKLRCLHALGEWDRL
FT                   SQLAQENWIHAGHDARRYIAPLSVAAAWGLGQWEQMDEYISVMKSESPDKAFFNAIVAL
FT                   HRSQFEEAASYITRARDLLDTELTALVGESYNRAYSVAVRVQMLSELEEIITYKKAEDK
FT                   PEVREMIKKTWVRRLKGCQRNVDVWQRMLRIRSLVISPRDNMEMWIKFANLCRKSGRIS
FT                   LAKKSLNLLLEDDENLDNSLVLKKTHPSIVYANLKFLWAVDDKRKALNSMQEFTSQLIS
FT                   DINVDPALFVQSTSVNTQKSQEEIQYYFHLLARCYHKQGQWQQEIENNWSEGSFDGVLQ
FT                   SYMYATQFDSKWYKAWHSWALANFEAVKFLEQSEEQIPSAAYEQYIIPAVKGFFKSIAL
FT                   SKGNLQDTLRLLNLWFKFGNNSNVINTLNVGISTVNIDIWLDVIPQLIARIHASSLSVR
FT                   KSVHQLLSDVGRAHPQALVYPLTVAAKSQSSARQNAALAIMDSLKTHSPRLVEQARLVS
FT                   HELIRAAILWHEQWHEGLEEASRLYFGDHNIEGMFAVLRPLHEMLERGPETLREISFQQ
FT                   AFGRDLVEARDCCIRFEQTGDISDLNQAWDLYYQVFKKIRKQLPQLTTLDLQYVSPKLL
FT                   HVHDLELAVPGTYVSGKPVIRIVKFYPTFNVITSKQRPRRLSIKGSDGKDYQYVLKGHE
FT                   DIRQDERVMQLFGLCNNLLLADPETFKRLLSIQRYPVIPLSPDSGLLGWVLDSDTLHVL
FT                   IRDYRESRKILLNIEHRLIIQMAPDYDRLTLLQKVEVFEYALLSTTGQDLYRVLWLKSR
FT                   SSEAWLNRRTNYSRTLAVMSMVGYILGLGDRHPSNLMLDRYTGNIIHIDFGDCFEVAMH
FT                   REKFPEKIPFRLTRMLVNAMEVSGIEGTFRITCEHVMRVLRTNKESVMAVLEAFVYDPL
FT                   INWRLAPAYSPSIDEKQSNEPNTLLGETIDGLHRKRLNEEGITLEERQKPEILNQRAIT
FT                   VLNRVSNKLTGRDFKPQQQLDVPSQVEKLILQATSIENLCLCYIGWCSFW"
FT   5'UTR           complement(922285..922447)
FT                   /gene="tor2"
FT                   /gene_synonym="SPBC646.01c"
FT                   /locus_tag="SPBC216.07c"
FT   5'UTR           922395..922724
FT                   /gene="cwf11"
FT                   /locus_tag="SPBC646.02"
FT   CDS_pept        922725..926579
FT                   /transl_table=1
FT                   /gene="cwf11"
FT                   /locus_tag="SPBC646.02"
FT                   /product="complexed with Cdc5 protein Cwf11"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.02.1"
FT                   /db_xref="GOA:O94508"
FT                   /db_xref="InterPro:IPR026300"
FT                   /db_xref="InterPro:IPR032174"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="PDB:3JB9"
FT                   /db_xref="PomBase:SPBC646.02"
FT                   /db_xref="PomBase:SPBC646.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94508"
FT                   /protein_id="CAA22806.1"
FT                   /translation="MVLYKNKKKQIINYANSNWGQNEGVEFQETMLQCILEAVIVSKDA
FT                   KQVLSLLHELKLFENFLWQRVNTEMSLNHINLTCMLLLYKSKYEYITWDLIDENRFQLF
FT                   FEKVIEVSLSLNLSEVVYMIQFITLCFQFSNIEKLRKLVYQLTNISILNSLDNLDKVKY
FT                   LLHDSSSLTKAFDSYKEKRPSIVEKFPLHNLLSRWIHSLLIKSISYAQTEKQEAKVTPL
FT                   LAIINMSLVLLSAFPTRRFAHPVIEDSCFYTALRMSLYYDSNELFKKMTDDLNYVLKFP
FT                   FDNTRGNEYEKEQKIRNDELVYYHLQLTLFSDFQKELGDLVFCTQTSLQQRQKLEEITS
FT                   FLSFNSLKSLCSKCYLRTSFPEKYAIKVDFEFLKNVFINTYDRTRLVNDYDEIINFTLK
FT                   DVLGERSVMDQENSLTNYFLLQNTAIQYLSISFFMRQQSKAYKKLLLRSLYAELLNFSE
FT                   QYRRLSIKNATKNLTKDNFFSLNNFKVTSVAPPQIGQVLPQFVKCQMGLSRPGPFHSAL
FT                   RDLKNSIKSPFLCLIYISKDMEYKLLHGNALDPLEGVTDFTIATICNDDVGMFQSDMQS
FT                   DSDNKSINVYLSPFYYHSLAGLGEYRPKQLKFNFALVLSPEANKYWLDLNILVSLLNRA
FT                   KEFPKWFEDLFLGFGTPDICAFPNAGLNSIYARNLFNTVEQLQSVLPNCHVPSNLSTES
FT                   LLIKFYTNQNKISADVTASDRHFLLPSNRLYTYNDKQLESILRGSQPGLTMVNGPTRCG
FT                   KHVLVCKLLEVLQDTSPNDRTVVLSDSNFSMNTLFTLLEKARCFHQGHLLYLSDEGKDE
FT                   TLERYGTLSSWISKLPGLLREIGRLAASIQAPGSHDASPDTALYFRDAYIKRLWEKYLN
FT                   TVDDKDSVDAYNRFPFHSYFGDKSKRPIETYNKDNFFDYATKLYGELEYMFQQLEEIRP
FT                   FGLLRYYEDQELYALCQQSRIIGCTWTSLSTRLGTLKEKGFCFNNLIVMNSQNISESSI
FT                   TSILLSNCEPTGFDRLVLLGNQYLTSGNQDINNTSNGSLFKRLRYLKSRIIDLNTQYNV
FT                   RESISSLCSSIYPLDIKTVDSSPNKRLDYGNSGFAHEVQFINVGAFKGSQETEPVSGYK
FT                   QNLGEAEYAVALFQYMRMLGYPTNEIVICTLYESQVSLLNEIISVRCSHNSFFGQPAFV
FT                   GTVEKLPSDKRVNFVIFTTVESKEASDHWNPKTFYKAFSACSYGLYVLCNRDLFRSTRG
FT                   LEKLWNEIEKTPDKLLLTTGEIYPSSHKIGSSVETFEIENLLHLSNYVVEMTKKRLNTN
FT                   "
FT   3'UTR           926580..926641
FT                   /gene="cwf11"
FT                   /locus_tag="SPBC646.02"
FT   5'UTR           926760..926849
FT                   /locus_tag="SPBC646.03"
FT   CDS_pept        join(926850..927096,927143..927968,928016..928358)
FT                   /transl_table=1
FT                   /locus_tag="SPBC646.03"
FT                   /product="mitochondrial glutamyl-tRNA amidotransferase
FT                   alpha subunit (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.03.1"
FT                   /db_xref="GOA:O94509"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="PomBase:SPBC646.03"
FT                   /db_xref="PomBase:SPBC646.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94509"
FT                   /protein_id="CAA22807.1"
FT                   /translation="MSNKYNNLLKEVAAKYASIILNDAKIKSLTSINSAEYLYDSFVEI
FT                   SKLPLEKKLPLKWKLITVKENICTKTNLTTAASNMLKDYNSPFDASIVESLKKAGGIIL
FT                   GKTNMDEFAMGVKSENNLFGRTVNPVVKDSNYDVGGSSGGAAAAIAADICYASVGSDTG
FT                   GSIRLPAAYVGCVGFKPSFGRISRYGMLAFANSFDTVGIAANNVKGVTKVFNVLDHPDI
FT                   NDSTCLTKEARYFVKEQHKKLSRKPIKIGIPIDWNVSETHPNVLDKWNEFISLLKSNGY
FT                   LVQEIQLPISLYANSVYSTMAYAEATSNLAKYNTIAFGNCLDEKFEEEIISSTARSFFL
FT                   GDEVKKRLLLGAYSLARMNSSDLFSKARYVRRAIQLEFNKNFFLPSFSVDDPRGDIDFI
FT                   VTPSFFNSSQPIETPSSYSHLSDTMLVPANMAGIPSVSIPFGTLNNGLPMGIQIMAQYL
FT                   NDEDLLSFAGQFA"
FT   misc_RNA        complement(926899..928892)
FT                   /locus_tag="SPNCRNA.1398"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           928359..928797
FT                   /locus_tag="SPBC646.03"
FT   5'UTR           928847..928988
FT                   /gene="pla1"
FT                   /locus_tag="SPBC646.04"
FT   CDS_pept        join(928989..930444,930488..930605,930645..930738,
FT                   930780..930812)
FT                   /transl_table=1
FT                   /gene="pla1"
FT                   /locus_tag="SPBC646.04"
FT                   /product="poly(A) polymerase Pla1"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="GOA:Q10295"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10295"
FT                   /protein_id="CAA22808.1"
FT                   /translation="MTTKQWGITPPISTAPATEQENALNTALINELKNQNLFESPAESE
FT                   KRVKVLDELQQITTEFVKKVSLAKHMNEKMANEAGGKIFTYGSYRLGVYGPGSDIDTLV
FT                   VVPKHVSRDNFFQDLEPMLREREEVTDLAAVPDAYVPIIKFKFLGISIDLIFARLSVPR
FT                   VPRDLELSDNNLLKGVEERCVLSLNGTRVTDQILQLVPNRAVFKHALRAIKFWAQRRAI
FT                   YANVVGFPGGVAWAMMVARICQLYPNAVSSVIVAKFFRILHQWNWPQPILLKPIEDGPL
FT                   QVRIWNPKLYPSDKAHRMPIITPAYPSMCATHNITLSTQTIILREMVRAGEIADQIMVK
FT                   ALPWSALFQKHDFFHRYKHYLTITAAAKTAEAQLKWAGLVESKLRHLVTRLELVDAIAL
FT                   AHPFNKGFDKVYNCSSEEEAQQVASGVTLEVAYESTDHEKLANDTVNEEKADNTESKAD
FT                   GSENGEKQIFPVYTTTCYIGLELEKKKGHPIKRLDISWPTQEFYELCKKWDKYDDTLMN
FT                   VFIKNTKNTALPDEVFEPGEERPKATKKRSTADTAHSTEQLKRQKVSTA"
FT   intron          930445..930487
FT                   /gene="pla1"
FT                   /locus_tag="SPBC646.04"
FT   intron          930606..930644
FT                   /gene="pla1"
FT                   /locus_tag="SPBC646.04"
FT   intron          930739..930779
FT                   /gene="pla1"
FT                   /locus_tag="SPBC646.04"
FT   3'UTR           930813..931046
FT                   /gene="pla1"
FT                   /locus_tag="SPBC646.04"
FT   3'UTR           complement(931002..931059)
FT                   /gene="erg9"
FT                   /locus_tag="SPBC646.05c"
FT   CDS_pept        complement(931060..932442)
FT                   /transl_table=1
FT                   /gene="erg9"
FT                   /locus_tag="SPBC646.05c"
FT                   /product="squalene synthase Erg9 (predicted)"
FT                   /EC_number="2.5.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.05c.1"
FT                   /db_xref="GOA:P36596"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR006449"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="PomBase:SPBC646.05c"
FT                   /db_xref="PomBase:SPBC646.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36596"
FT                   /protein_id="CAA22809.1"
FT                   /translation="MSLANRIEEIRCLCQYKLWNDLPSYGEDENVPQNIRRCYQLLDMT
FT                   SRSFAVVIKELPNGIREAVMIFYLVLRGLDTVEDDMTLPLDKKLPILRDFYKTIEVEGW
FT                   TFNESGPNEKDRQLLVEFDVVIKEYLNLSEGYRNVISNITKEMGDGMAYYASLAEKNDG
FT                   FSVETIEDFNKYCHYVAGLVGIGLSRLFAQSKLEDPDLAHSQAISNSLGLFLQKVNIIR
FT                   DYREDFDDNRHFWPREIWSKYTSSFGDLCLPDNSEKALECLSDMTANALTHATDALVYL
FT                   SQLKTQEIFNFCAIPQVMAIATLAAVFRNPDVFQTNVKIRKGQAVQIILHSVNLKNVCD
FT                   LFLRYTRDIHYKNTPKDPNFLKISIECGKIEQVSESLFPRRFREMYEKAYVSKLSEQKK
FT                   GNGTQKAILNDEQKELYRKDLQKLGISILFVFFIILVCLAVIFYVFNIRIHWSDFKELN
FT                   LF"
FT   5'UTR           complement(932443..932484)
FT                   /gene="erg9"
FT                   /locus_tag="SPBC646.05c"
FT   3'UTR           complement(932654..932780)
FT                   /gene="agn2"
FT                   /locus_tag="SPBC646.06c"
FT   CDS_pept        complement(932781..934082)
FT                   /transl_table=1
FT                   /gene="agn2"
FT                   /locus_tag="SPBC646.06c"
FT                   /product="glucan endo-1,3-alpha-glucosidase Agn2"
FT                   /EC_number="3.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.06c.1"
FT                   /db_xref="GOA:O94510"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="PomBase:SPBC646.06c"
FT                   /db_xref="PomBase:SPBC646.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94510"
FT                   /protein_id="CAH58744.1"
FT                   /translation="MASLTTALPNKAVVAHFMMGLTYNYAQSDFQNDIQNAISLGLDGF
FT                   VLNFGNDSWMMSKLTLMYNAADALNLQFLLYLNLDMSEMSTVPASTLVTYVQTFANRGH
FT                   QARINNNVVVGTFLGQDINFGQSSVNQGWQVAFKNALASAGINIFFMPTWPLDASTIYQ
FT                   TYPVADGFCKWNCWPYYTSSPTSDAEDLVYIQNSKATNKKYMATVSPIFYTHFTSKNYS
FT                   FFSEGLWFTRWMQLIKDQPNYVQVLTWNDYGESTYIGPTNYAADFPVIGSNSHEWVDSF
FT                   THAPLSYSLPLFIQMYKQNTTGLPSNFSGISQLYVTYRVHSKNATASSDSIPRPDNYQN
FT                   SSDVISVISFAKSSYTLRVSVNGTVLGTTNVNAGVQSANVSFIVNNTAAAGLPLFQILN
FT                   GTTVIAQGYGPLNILGNNSVVLYNFNFCTTRISW"
FT   5'UTR           complement(934083..934311)
FT                   /gene="agn2"
FT                   /locus_tag="SPBC646.06c"
FT   3'UTR           complement(934372..934715)
FT                   /locus_tag="SPBC646.07c"
FT   CDS_pept        complement(934716..935603)
FT                   /transl_table=1
FT                   /locus_tag="SPBC646.07c"
FT                   /product="enoyl reductase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.07c.1"
FT                   /db_xref="GOA:O94511"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR039357"
FT                   /db_xref="PomBase:SPBC646.07c"
FT                   /db_xref="PomBase:SPBC646.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94511"
FT                   /protein_id="CAA22811.1"
FT                   /translation="MSITLSSRGRKIRKLPKSLEFPLDGSIDKLRDEVSSVTRLPVERL
FT                   RFSTADGTTLLPNTTLRKYGVGPGATIWVKDLGPQIGWRTVFMIEYLGPLVIHLFFILN
FT                   YKWIYRKDYNLCLNQKIAFVLVMLHFMKREYESIFVHRFSLATMPLRNIFKNCAHYHLL
FT                   SGLFLAYFIYGPWHANDYIKPNHLLFLIVGWAFAVLSNFRTHIILRDLRPAGSKKRVIP
FT                   TGYGFNLVSFPNYFFESLGWLFFALLTKSWASWIFLFVGSAQMFVWAKKKHARYLKEFP
FT                   NYPRSRKIMIPFFL"
FT   5'UTR           complement(935604..935686)
FT                   /locus_tag="SPBC646.07c"
FT   3'UTR           complement(936013..936540)
FT                   /locus_tag="SPBC646.08c"
FT   CDS_pept        complement(936541..938091)
FT                   /transl_table=1
FT                   /locus_tag="SPBC646.08c"
FT                   /product="oxysterol binding protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.08c.1"
FT                   /db_xref="GOA:O94512"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="PomBase:SPBC646.08c"
FT                   /db_xref="PomBase:SPBC646.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94512"
FT                   /protein_id="CAA22812.1"
FT                   /translation="MPNPNQAIKKENEPIQVENPTELVRDDGEVEGYQKEEGKFKLVLS
FT                   ILKQCIGVKDIASLRFSLPAQLLEPVGNLEYWNYVDRPDYFAVMGDSDDELERMLGVLR
FT                   WWFTKDLRFVRGRVVKPYNSVLGEFFRCKWVVTDPTVREDHTLDPDSSQLPTYKTEYSE
FT                   TTKFPLGKSYRPKASRTTSSQSVASTMTKSSTKTSKKKSSKKNSKSESNQDSSNDRSST
FT                   APSTAESNNEHLSSSQKSKHSIVFMAEQTSHHPAVSAFYVTCPSKGIEVYGQDQIAVGF
FT                   TGTSFKVCAGDLNKGVYVRFNKRDNEEYLCTHPSASVGGILRGNLHINLLDSTVILCPK
FT                   TRIKTIITYIEERWLGKPRSLVEGVCYRYDPSNDTIDSIKAVPKENILATFKGNWRNCI
FT                   FYSYAGESESRMLVDLNELDLVHKRCPPLDKQFPFESRKIWFPVTHNILAKHYTQATKA
FT                   KQEIEDQQRQASAAREESHTEWKPRFFVPDEKEGRPTLTEEGKKVLEQSLSDEYIHGS"
FT   5'UTR           complement(938092..938201)
FT                   /locus_tag="SPBC646.08c"
FT   3'UTR           complement(938621..938699)
FT                   /gene="int6"
FT                   /gene_synonym="yin6"
FT                   /locus_tag="SPBC646.09c"
FT   CDS_pept        complement(join(938700..940171,940228..940261))
FT                   /transl_table=1
FT                   /gene="int6"
FT                   /gene_synonym="yin6"
FT                   /locus_tag="SPBC646.09c"
FT                   /product="eIF3e subunit Int6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.09c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.09c.1"
FT                   /db_xref="GOA:O94513"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR016650"
FT                   /db_xref="InterPro:IPR019010"
FT                   /db_xref="PomBase:SPBC646.09c"
FT                   /db_xref="PomBase:SPBC646.09c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94513"
FT                   /protein_id="CAA22813.1"
FT                   /translation="MGSELKSTSPLAVKYDLSQKIMQHLDRHLIFPLLEFLSLRQTHDP
FT                   KELLQAKYDLLKDTNMTDYVANLWTNLHGGHTDEDMANAFAEKRRSVLQELSELEEEVQ
FT                   GILGVLENPDLIAALRQDKGQNLQHLQEHYNITPERIAVLYKFAQFQYNCGNYGGASDL
FT                   LYHFRAFSKDPELNASATWGKFASEILTVDWDGAMEELGKLREMVDSKSFKDSAVQLRN
FT                   RTWLLHWSLFPLFNHANGCDTLCDLFFYTPYLNTIQTSCPWLLRYLTVAVVTNQNNANQ
FT                   KPRNPRQSYQRRMRDLVRIISQENYEYSDPVTSFISALYTEVDFEKAQHCLRECEEVLK
FT                   TDFFLVSLCDHFLEGARKLLAEAYCRIHSVISVDVLANKLEMDSAQLIQLVENRNNPSV
FT                   AAASNVAADQSTEDESIESTSTNVVADDLITEAETATEAEEPEPEVQFGFKAKLDGESI
FT                   IIEHPTYSAFQQIIDRTKSLSFESQNLEQSLAKSISELKHATV"
FT   intron          complement(940172..940227)
FT                   /gene="int6"
FT                   /gene_synonym="yin6"
FT                   /locus_tag="SPBC646.09c"
FT   5'UTR           complement(940262..940366)
FT                   /gene="int6"
FT                   /gene_synonym="yin6"
FT                   /locus_tag="SPBC646.09c"
FT   3'UTR           complement(940703..940824)
FT                   /locus_tag="SPBC646.10c"
FT   CDS_pept        complement(940825..942318)
FT                   /transl_table=1
FT                   /locus_tag="SPBC646.10c"
FT                   /product="U3 snoRNP protein Nop56 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.10c.1"
FT                   /db_xref="GOA:O94514"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="PomBase:SPBC646.10c"
FT                   /db_xref="PomBase:SPBC646.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94514"
FT                   /protein_id="CAA22814.1"
FT                   /translation="MADYLLYESATGYSLFDVVGADQIAAKTKEVQLSLQDISKFGKVV
FT                   QLRSFIPFKNAAHALENANDISEGVLNDFLKNFLELNLPKASKKKKVSLGVQDKNLATS
FT                   IKSEIDAIECDTSELTQDLLRGIRFHGDKLLKQLSPGDFERAQLGLGHSYSRAKVKFNV
FT                   NRNDNMIIQAIAILDQLDKDINTFAMRMKEWYSWHFPELSKIVGDNYKYAVIVTLVGDK
FT                   TTINDEMLHDLAAVVDDDKDIAQSIINAGKVSMGQDISEIDLENILSFAERVIKLSNYR
FT                   KQLHNYLVQKMNVVAPNLAELIGEMVGARLISHAGSLTNLSKCPASTVQILGAEKALFR
FT                   ALKTRGNTPKYGIIYHSSFIGKAGAKNKGRISRFLANKCSIASRIDNFSDAPTTAFGQV
FT                   LRRQVEERLNFFDTGVAPTRNSIAMAEAYEKALSSVNIDGDEEVDIDVEETVETISEKP
FT                   SKKEKKDKKEKKKEKSKKKRSADDASEEVKKSKKKKKSH"
FT   5'UTR           complement(942319..942434)
FT                   /locus_tag="SPBC646.10c"
FT   repeat_region   942476..942820
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   3'UTR           complement(join(942688..942779,942820..945101))
FT                   /gene="gap1"
FT                   /gene_synonym="src1"
FT                   /gene_synonym="sar1"
FT                   /locus_tag="SPBC646.12c"
FT   5'UTR           942898..942941
FT                   /gene="cct6"
FT                   /locus_tag="SPBC646.11"
FT   CDS_pept        join(942942..942998,943044..943117,943156..943219,
FT                   943361..944773)
FT                   /transl_table=1
FT                   /gene="cct6"
FT                   /locus_tag="SPBC646.11"
FT                   /product="chaperonin-containing T-complex zeta subunit
FT                   Cct6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.11.1"
FT                   /db_xref="GOA:O94515"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012722"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="PomBase:SPBC646.11"
FT                   /db_xref="PomBase:SPBC646.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94515"
FT                   /protein_id="CAA22815.1"
FT                   /translation="MLSLLNPKAESIQRAQALQVNISAAIGLQDVLKSNLGPTGTTKML
FT                   VDGAGAIKLTKDGKVLLTEMQIQNPTASCIAKAATAQDDATGDGTTSVCLLVGELLKQA
FT                   ELYIREGLHPSLISDGFNLAKNEALTFLDSFKTDFEVDREVLLNVAKTSLSTKISSKVV
FT                   ESLAPAVVDAILTIRRPDEPIDLHMVEIMKMQNRSASDTQLIRGLLLDHGARHPDMPKQ
FT                   VKNAYILILNVSLEYEKSEINSGFFYSTSEQRERLVESERKFVDNKLRKIVELKKEVCE
FT                   RDPTANFVIINQKGIDPLSLDVLAKNGIMALRRAKRRNMERLQLACGGVAQNSVDDLNP
FT                   EVLGWAGSVYERTLGEEKYTFVEDVKDPKSATILIHGPNTYTIQQIQDATRDGLRAVKN
FT                   AVEDNCLIVGAGAFEVACAAHLRNKFAAKEVKGKAKMGVYAYADALLIIPKTLAANSSY
FT                   DTQDAIVALQEEASEGYKVGLDLKTGMPFDPEVEGIYDNYRVIRHMLHSATVIASNLIS
FT                   VDQILRAGRSSLKEGPPQ"
FT   3'UTR           944774..944922
FT                   /gene="cct6"
FT                   /locus_tag="SPBC646.11"
FT   CDS_pept        complement(945102..947402)
FT                   /transl_table=1
FT                   /gene="gap1"
FT                   /gene_synonym="src1"
FT                   /gene_synonym="sar1"
FT                   /locus_tag="SPBC646.12c"
FT                   /product="GTPase activating protein Gap1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.12c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.12c.1"
FT                   /db_xref="GOA:P33277"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="PomBase:SPBC646.12c"
FT                   /db_xref="PomBase:SPBC646.12c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33277"
FT                   /protein_id="CAA22816.1"
FT                   /translation="MTKRHSGTLSSSVLPQTNRLSLLRNRESTSVLYTIDLDMESDVED
FT                   AFFHLDRELHDLKQQISSQSKQNFVLERDVRYLDSKIALLIQNRMAQEEQHEFAKRLND
FT                   NYNAVKGSFPDDRKLQLYGALFFLLQSEPAYIASLVRRVKLFNMDALLQIVMFNIYGNQ
FT                   YESREEHLLLSLFQMVLTTEFEATSDVLSLLRANTPVSRMLTTYTRRGPGQAYLRSILY
FT                   QCINDVAIHPDLQLDIHPLSVYRYLVNTGQLSPSEDDNLLTNEEVSEFPAVKNAIQERS
FT                   AQLLLLTKRFLDAVLNSIDEIPYGIRWVCKLIRNLTNRLFPSISDSTICSLIGGFFFLR
FT                   FVNPAIISPQTSMLLDSCPSDNVRKTLATIAKIIQSVANGTSSTKTHLDVSFQPMLKEY
FT                   EEKVHNLLRKLGNVGDFFEALELDQYIALSKKSLALEMTVNEIYLTHEIILENLDNLYD
FT                   PDSHVHLILQELGEPCKSVPQEDNCLVTLPLYNRWDSSIPDLKQNLKVTREDILYVDAK
FT                   TLFIQLLRLLPSGHPATRVPLDLPLIADSVSSLKSMSLMKKGIRAIELLDELSTLRLVD
FT                   KENRYEPLTSEVEKEFIDLDALYERIRAERDALQDVHRAICDHNEYLQTQLQIYGSYLN
FT                   NARSQIKPSHSDSKGFSRGVGVVGIKPKNIKSSNTVKLSSQQLKKESVLLNCTIPEFNV
FT                   SNTYFTFSSPSTDNFVIAVYQRGHSKVLVEVCICLDDVLQRRYASNPVVDLGFLTFEAN
FT                   KLYHLFEQLFLRK"
FT   5'UTR           complement(947403..948223)
FT                   /gene="gap1"
FT                   /gene_synonym="src1"
FT                   /gene_synonym="sar1"
FT                   /locus_tag="SPBC646.12c"
FT   misc_RNA        948888..950045
FT                   /locus_tag="SPNCRNA.1399"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        948994..949948
FT                   /gene_synonym="SPNG1313"
FT                   /locus_tag="SPNCRNA.334"
FT                   /product="non-coding RNA (predicted)"
FT   misc_RNA        949972..950606
FT                   /gene_synonym="SPNG1314"
FT                   /locus_tag="SPNCRNA.335"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           join(950715..950823,950880)
FT                   /gene="sds23"
FT                   /gene_synonym="psp1"
FT                   /gene_synonym="moc1"
FT                   /locus_tag="SPBC646.13"
FT   CDS_pept        950881..952107
FT                   /transl_table=1
FT                   /gene="sds23"
FT                   /gene_synonym="psp1"
FT                   /gene_synonym="moc1"
FT                   /locus_tag="SPBC646.13"
FT                   /product="inducer of sexual development Sds23/Moc1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.13"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.13.1"
FT                   /db_xref="GOA:Q09826"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR016711"
FT                   /db_xref="PomBase:SPBC646.13"
FT                   /db_xref="PomBase:SPBC646.13.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09826"
FT                   /protein_id="CAA22817.1"
FT                   /translation="MPLSTQSSDSLSSAGRQSFGVNSVSDFLAQFPIPTNLPSNKWQDI
FT                   PVTFLHDNEIALIDPETSMEEASSILIDRDLSALPIVAAKGSNEIATTFDYADLNSFLL
FT                   MVVGFDDFNDGRFKKVAEDIRAGKVITAYEVAKLGKNKDDFITIPHTTSLGRLAEILSS
FT                   GIRRVAVTNEQGELSFMASQRSIIRFLWNNIRAFPDLEPLMSRTIHSLDIGSTDITCIS
FT                   GDQKVAAALRQMNQTGIGSLAVVDAQFRLLGNISLVDVKYVTRSSSVYLLNKSCAHFLS
FT                   VIKSEQGIRAGKDSAPAFNIYESSTFAFTLAKLVATQCHRLWLVQSPSCPPSPKNNAHL
FT                   SPGSMGGVKVNQLLGVVSLTDIISVLYAHMKGTLPPAPHSAPSLRHGRRGSTSSHRSHS
FT                   KASVDTQRR"
FT   3'UTR           952108..952292
FT                   /gene="sds23"
FT                   /gene_synonym="psp1"
FT                   /gene_synonym="moc1"
FT                   /locus_tag="SPBC646.13"
FT   3'UTR           complement(952334..952815)
FT                   /gene="orc5"
FT                   /locus_tag="SPBC646.14c"
FT   CDS_pept        complement(join(952816..953751,953792..953866,
FT                   953920..954276))
FT                   /transl_table=1
FT                   /gene="orc5"
FT                   /locus_tag="SPBC646.14c"
FT                   /product="origin recognition complex subunit Orc5"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.14c.1"
FT                   /db_xref="GOA:O43114"
FT                   /db_xref="InterPro:IPR020796"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PomBase:SPBC646.14c"
FT                   /db_xref="PomBase:SPBC646.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43114"
FT                   /protein_id="CAA22818.1"
FT                   /translation="MHLYQLEDELKKNVFCREDQIKKLSCLLFNKDCRVPSIVLYGVAS
FT                   TAKTFLLRTAFDLSKEENVWINLQDCFTVAHFWYRILIKVGVDKDIALKKGINISGFIY
FT                   LLEQAMSKRDYHTFLVLDQIDDFAEASTILFSQLAQLPIVANIPNLSIIFVLHSHPAQY
FT                   LGTLSIAVIFFPQYTQAEILEICQKTPPNLDFLDRSGDSVFEDEIELSVWMQYCSFLWS
FT                   VFGVQCLNDYRSFRSVLDRYWPKFIQPIVEGDIHPADYAQLHKLAKNFLVSDATVTKRL
FT                   HIINPTEIKNLLDSKSINLSLVSKYLLVSAFLASYNPSRLDAQFFSFSKTSKRRGRKRK
FT                   QIQDEGVLFSKIPRTAGSKGRSAVKISQLTLGPKPFEVERLIAIYYAISSPVEKVLTAD
FT                   VFVQIATLASLKMILSASKGVLRSLDSPRYIVNVSREYVLKIADSLSFPLDSYLAG"
FT   5'UTR           complement(954277..954505)
FT                   /gene="orc5"
FT                   /locus_tag="SPBC646.14c"
FT   3'UTR           complement(954573..955200)
FT                   /locus_tag="SPBC646.15c"
FT   CDS_pept        complement(join(955201..955214,955257..955369,
FT                   955435..955992,956037..956301,956344..956488))
FT                   /transl_table=1
FT                   /locus_tag="SPBC646.15c"
FT                   /product="Pex16 family peroxisome import protein
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.15c.1"
FT                   /db_xref="GOA:O94516"
FT                   /db_xref="InterPro:IPR013919"
FT                   /db_xref="PomBase:SPBC646.15c"
FT                   /db_xref="PomBase:SPBC646.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94516"
FT                   /protein_id="CAA22819.2"
FT                   /translation="MKPLAYYEDQLLKDEKSFLKVTEIERLLSYAAYLLPAEFRDDQLK
FT                   SQTITSILLLLHQFHTGLLFRKIAELPKTEQAILKSERTQYLEYFRKKNPSFEKVSELL
FT                   YFLNISTFPIELVISKYNPSRQYDSVLFLESVKFLLRVHIMWTTGGDLPLSNPVLQRDF
FT                   NVKTFIHLHKKYSNSGSAVVLKNSKKVVPRLNTVNSSLDFLQNRTPRLSSILPDEIFTK
FT                   RLPNLRIFSNFIKVCRPLIYMLFMWHWKRKQKSSSLKVRPWGPWIVAFVFEVISQLIDR
FT                   RCESATSSRQGFGLERRTNQSQFQHFVVWAFTQGRFYDEFTKHWINRSLSWVNSIPVFG
FT                   KYLLLSVEERQKSLENYISSVRNY"
FT   5'UTR           complement(956489..956840)
FT                   /locus_tag="SPBC646.15c"
FT   5'UTR           957614..957657
FT                   /locus_tag="SPBC646.16"
FT   CDS_pept        957658..958392
FT                   /transl_table=1
FT                   /locus_tag="SPBC646.16"
FT                   /product="20S proteasome component alpha 1 (predicted)"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.16.1"
FT                   /db_xref="GOA:O94517"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034642"
FT                   /db_xref="PomBase:SPBC646.16"
FT                   /db_xref="PomBase:SPBC646.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94517"
FT                   /protein_id="CAA22820.1"
FT                   /translation="MSQARGFDRTITVFSPEGRLYQVEYAFKAFNNAGITSVGVTGKNC
FT                   ACVISQKKVPDKLIDASTVKHVFPITKGIGCVMTGSIADARAQVSRARSEAAEFEYKNG
FT                   YPMPCDVLAKRMANIAQVSTQRAAMRPLGVAMTLVAVDDEIGPSLFKLDPAGFYIGYKA
FT                   TSAGPKQTETINWLEKRFKKDGIPSNLTDTVETGIQALMSSLSTDFKSTELQIGVVEDD
FT                   KPFRVLSVEEIEAHLQSIAEKD"
FT   3'UTR           958393..958637
FT                   /locus_tag="SPBC646.16"
FT   CDS_pept        complement(join(958669..959574,959614..960216,
FT                   960264..960389))
FT                   /transl_table=1
FT                   /gene="dic1"
FT                   /gene_synonym="SPBC855.01c"
FT                   /gene_synonym="SPBP35G2.01c"
FT                   /gene_synonym="mug44"
FT                   /locus_tag="SPBC646.17c"
FT                   /product="dynein intermediate chain Dic1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC646.17c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC646.17c.1"
FT                   /db_xref="GOA:O94518"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PomBase:SPBC646.17c"
FT                   /db_xref="PomBase:SPBC646.17c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94518"
FT                   /protein_id="CAA22821.2"
FT                   /translation="MDKNIKREIEIKRAKLLLLKNKENCTDAVSSSNKEGPKQISEDQL
FT                   SNFLCKILKPTNLTPQTYSLESKSSNLVSDCELKISSVYQSYSSTFNVSNHVPSISKTV
FT                   NIRETSKHLKHSTKAPKCSLPTSALEIDHLNNFLHSSAKILDRALCDQSNQLFTDYTVK
FT                   KKSKKNKSQLEENGLNHLFTFQDEKITLNSVVNSISYSSFFEELLITSYAKPKEALRTR
FT                   GLAIVWNQRWKNSPESVLKARSEITVCKPSPFHPQLIAGGAYNGQVFLWDLRQGQYPVS
FT                   FTTIISGGHLEPVTDITYINNPPSNNIVTCSTDGLVHIWEPDMFSRPSETICLSSQVDS
FT                   SSQCIPATCLSFIPENNMEFLVGAEDGKLQRGYRSDYSETKAVQPSNVSYEGHNVFISG
FT                   IDVMTSNSQNVFLEKNKDFALTSSFDWTVRLWQCSPSRNQHELVPSNDLDEQVIINSCK
FT                   TFTHKAMVFDVKWCVSEPCCFASVDALGNLNLWDLQKDVEAPVTSDIPDGKPLNKIAWQ
FT                   PEKRNLACGGLNGNVHIYKHLSPNLAN"
FT   5'UTR           complement(960390..960467)
FT                   /gene="dic1"
FT                   /gene_synonym="SPBC855.01c"
FT                   /gene_synonym="SPBP35G2.01c"
FT                   /gene_synonym="mug44"
FT                   /locus_tag="SPBC646.17c"
FT   tRNA            960729..960800
FT                   /locus_tag="SPBTRNAHIS.02"
FT                   /product="tRNA Histidine"
FT   3'UTR           complement(961007..962260)
FT                   /gene="ecl2"
FT                   /locus_tag="SPBP35G2.16c"
FT   CDS_pept        complement(962261..962515)
FT                   /transl_table=1
FT                   /gene="ecl2"
FT                   /locus_tag="SPBP35G2.16c"
FT                   /product="extender of the chronological lifespan protein
FT                   Ecl2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.16c.1"
FT                   /db_xref="GOA:C6Y4C5"
FT                   /db_xref="PomBase:SPBP35G2.16c"
FT                   /db_xref="PomBase:SPBP35G2.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6Y4C5"
FT                   /protein_id="CBA11508.1"
FT                   /translation="MDLDYCIICGKPTTGNLYCSRECHLQDCPGCGSTSEQCSYSKSAD
FT                   LHMLSSQYLDHFRRRSSMPSPSTSSSLLNGFVASRLAVL"
FT   5'UTR           complement(962516..963780)
FT                   /gene="ecl2"
FT                   /locus_tag="SPBP35G2.16c"
FT   misc_RNA        963076..963774
FT                   /locus_tag="SPNCRNA.1400"
FT                   /product="intergenic RNA (predicted)"
FT   3'UTR           complement(963856..963954)
FT                   /locus_tag="SPBP35G2.17"
FT   5'UTR           963900..966710
FT                   /locus_tag="SPBP35G2.02"
FT   CDS_pept        complement(963955..964275)
FT                   /transl_table=1
FT                   /locus_tag="SPBP35G2.17"
FT                   /product="dubious"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.17"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.17.1"
FT                   /db_xref="PomBase:SPBP35G2.17"
FT                   /db_xref="PomBase:SPBP35G2.17.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS6"
FT                   /protein_id="CCD31357.1"
FT                   /translation="MVREFYVTGRGRKLLPTVFRIKSFHGIVRQCVKQQRDFTSFLASS
FT                   PAMGVAQGQQVKLILMLLIETWETKHQSCHSHFILLEFTHLFVRKFSQIFFEFRLFAHL
FT                   LS"
FT   5'UTR           complement(964276..965899)
FT                   /locus_tag="SPBP35G2.17"
FT   CDS_pept        966711..967334
FT                   /transl_table=1
FT                   /locus_tag="SPBP35G2.02"
FT                   /product="poteasome interacting protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.02.1"
FT                   /db_xref="GOA:Q9P7A1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="PomBase:SPBP35G2.02"
FT                   /db_xref="PomBase:SPBP35G2.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7A1"
FT                   /protein_id="CAB87364.1"
FT                   /translation="MSGPHHCSADCDEHPFESGPNDTLYSCIRKESIVTLNEAVPDSGK
FT                   LVFKPWDLRYDDTDIVESDADDQLLFQVPFAGAATLKSILVRIFPNETAPHSFSLFPNR
FT                   TDLDFDTIGDVQATETFEFPLTFEGSHIFEFPVKTRLYQNLQNLNIFFTKSDGSDDPTQ
FT                   IAYIGLRGSFVPFKGDPVVTIYEATPRPSDHPKVNQEEVFRSYY"
FT   3'UTR           join(967335..967789,967866..968891)
FT                   /locus_tag="SPBP35G2.02"
FT   3'UTR           complement(967736..967745)
FT                   /gene="sgo1"
FT                   /locus_tag="SPBP35G2.03c"
FT   CDS_pept        complement(join(967746..968604,968667..968767))
FT                   /transl_table=1
FT                   /gene="sgo1"
FT                   /locus_tag="SPBP35G2.03c"
FT                   /product="inner centromere protein, shugoshin, Sgo1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.03c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.03c.1"
FT                   /db_xref="GOA:Q9P7A0"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="InterPro:IPR011516"
FT                   /db_xref="InterPro:IPR038889"
FT                   /db_xref="PomBase:SPBP35G2.03c"
FT                   /db_xref="PomBase:SPBP35G2.03c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P7A0"
FT                   /protein_id="CAB87365.1"
FT                   /translation="MNFQFINSNINNEDKLPMESLKKKFLKQNREIIKINTQLSIKIRE
FT                   SENEIQDLIQENFTLKSYLVKLEARFRNQSQTEDLLKNFFPEIQTIHKKISQVQSLLKI
FT                   IEKKCSSDFLEANVKSQFTTCENKDSKEDYQILHNKRLEYVSFNDELKSLETGQPLYCF
FT                   QDFQKKVHGPPALSEKPGKCILKDKTNAHVNKIPQDEVNYSLPQKNITIFSKELKENEF
FT                   ESINEGETEEEKAKTSNVCVCIPCKSAEQITDLKGQATGDSSPCDFEESQPRINGREKL
FT                   RRSVKVINYAIPSLRTKLRRDFDLPSDRKRKRHPRGKA"
FT   CDS_pept        complement(join(969008..969265,969451..969871,
FT                   969964..970034))
FT                   /transl_table=1
FT                   /locus_tag="SPBP35G2.04c"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.04c.1"
FT                   /db_xref="GOA:Q9P799"
FT                   /db_xref="PomBase:SPBP35G2.04c"
FT                   /db_xref="PomBase:SPBP35G2.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P799"
FT                   /protein_id="CAB87366.1"
FT                   /translation="MISNSSIEDRINKNEAYIAKFFEIFSKNDKIRFHGVSLDRKALDS
FT                   FMVRNNFKKRFVSGINLPILIRLHFYKKLFTILWLTVRTVALLSHARNIQCLIQESDGD
FT                   AKDVARSIYITTAEFRNYLLTEKGFYVTTRSISHFRAILDSIRYPFGKDHASKNMELLP
FT                   ITYDLSFCTVFHGYLTSILEAYEFFRGVFKKYKAPLSSNFIAIGKTTDESNFSQLHHYF
FT                   QKFDERIRRILHLISQELDGYCRIAKQ"
FT   5'UTR           complement(970035..970048)
FT                   /locus_tag="SPBP35G2.04c"
FT   3'UTR           complement(970607..970956)
FT                   /gene="cki2"
FT                   /locus_tag="SPBP35G2.05c"
FT   CDS_pept        complement(join(970957..971919,971985..972133,
FT                   972201..972270,972323..972448))
FT                   /transl_table=1
FT                   /gene="cki2"
FT                   /locus_tag="SPBP35G2.05c"
FT                   /product="serine/threonine protein kinase Cki2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.05c.1"
FT                   /db_xref="GOA:P40234"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PomBase:SPBP35G2.05c"
FT                   /db_xref="PomBase:SPBP35G2.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40234"
FT                   /protein_id="CAB87367.1"
FT                   /translation="MNSQTSVVGVHYRVGRKIGEGSFGVIFDGMNLLNNQLIAIKFEPK
FT                   KSEAPQLRDEYRTYKLLVGNAGIPNVYYFGQEGLHNILVIDLLGPSLEDLFEWCGRRFS
FT                   VKTVAMTAKQMLSRVQTIHEKNLVYRDIKPDNFLIGRPSSRNANMVYMVDFGMAKYYRD
FT                   PKTKQHIPYSERKSLSGTARYMSINTHLGREQSRRDDLESLGHVFMYFLRGSLPWQGLK
FT                   AANNKHKYEKISEKKQSTSISELCAGFPNEFSKYMTYVRSLEFDEEPDYAFLQELFDDV
FT                   LRANGDTNDGVYDWMLLNDGKGWESSSSHFSVVAMKRRKNYLGLNVVQNDDSRKKNSTL
FT                   QTQNMRFKSSYGVRGPRNYSSFDALPSKNAPLVRQEQSASKKTIYAHSSRGYDRVRPMY
FT                   VSQPSNNAVGVNHPNDNSDSEAKGGFFDMICCRCFS"
FT   intron          complement(972134..972200)
FT                   /gene="cki2"
FT                   /locus_tag="SPBP35G2.05c"
FT   intron          complement(972271..972322)
FT                   /gene="cki2"
FT                   /locus_tag="SPBP35G2.05c"
FT   5'UTR           complement(972449..972785)
FT                   /gene="cki2"
FT                   /locus_tag="SPBP35G2.05c"
FT   3'UTR           complement(973022..973048)
FT                   /gene="nup131"
FT                   /gene_synonym="Nup133a"
FT                   /locus_tag="SPBP35G2.06c"
FT   CDS_pept        complement(join(973049..974181,974223..974577,
FT                   974617..975002,975044..975137,975172..976632))
FT                   /transl_table=1
FT                   /gene="nup131"
FT                   /gene_synonym="Nup133a"
FT                   /locus_tag="SPBP35G2.06c"
FT                   /product="nucleoporin Nup131"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.06c.1"
FT                   /db_xref="GOA:Q9P797"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR037624"
FT                   /db_xref="PomBase:SPBP35G2.06c"
FT                   /db_xref="PomBase:SPBP35G2.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P797"
FT                   /protein_id="CAB87368.3"
FT                   /translation="MFIVHRRFFQNEKAFTPAGKHEKVADGNKHETLATSEYPKVCASN
FT                   DLYKILQISAPKVGNFTIHDAPVVGLIDSILEYYLYISVKVRKAWIAGYGSQPQNLICF
FT                   DWERFTGILDQQSLNSPPLAGFVKPDPTSAEPGFLLLWPASGDLFYWERTSLMNVEVSA
FT                   PEFPGFLHYRIQLKRYESCKNLVSAEPAGFFLTLSSGRLLHLNLKDSDGNSSIQVRILF
FT                   PGLHIPNCLLSLYNSIFAFTSGRVIPIRCGSIKGPGERLVYSMHSGSTLRIWEIFGTGD
FT                   HHLLRGFDIYDIILDSIQESFSYVNRFLILDFSVSTSDPYTLACLVSWRDNASLFNYAA
FT                   IIISFNHQMIPHVSQFCHVRSYLSAILPSVCRIFLPSPGTVVFCVFDVTFAMFHKVRGK
FT                   EGTFYVEENLVVNNLTSKSRVLDFGMEDAIYEKSTHTLLKTPALILLTEGHGIIRIESS
FT                   ASYLKTSFSATTYLRSRLSQFASQSPLFREQFLLNFDFTYNLSESEVYNTVFNLCDELY
FT                   TTPCKKNMSVLETLHSQQRDLMEIVLVAFKYLHLSPSNRLQLWLKVAYCSALADLYELL
FT                   MCNEKMSNLLRRVLKIMSSNDNIDELFLKKCLNINLLLQHLSSEYSQISGQDASNAQKR
FT                   IEVIVNVNNVYGTIFGNELAYRQEKISKFTDPSSVIRSDLWTVEVDHLDLLRKQIEDSI
FT                   SLHRDVRDSKDAHILKVSNKLRKQILHLVEQNCLLIFDLHNGTDDTIVKSHNFQKFEEE
FT                   FGNSRKEWLQYLASVGYLEKAIDLAEKVKDFQTMVILLDCLDPKDPTIKLQKQKACLNK
FT                   YKEEFADVIFFYLVDTEQYASLLHDFLEYQSLLISFFEANDLLNLLWIFEAQNGNYGRA
FT                   SEILFRDCEPEENRIIGKISQLALAKLYSWTNRIEGENIILSNETEVIENHLAILLIQE
FT                   QYAEMLSSLVDITEDEGEAVEAIVTSNCVNLSENSIRAWLVSSAVERLIQNEYTTLCEM
FT                   VDFFSSFSLRECSFKEVDLALELLERATITKDVYFYLKDLVYRRFLLQVNWAEIIDAHE
FT                   DLESSFFPMVKEIMLESDFLIWLQHMEHNIHDESKHYLKSEKNFLQSVYSSLSESQVED
FT                   YQMELFREKQIFSVLCKDRELYILIPKLLDVATKQ"
FT   5'UTR           complement(976633..976901)
FT                   /gene="nup131"
FT                   /gene_synonym="Nup133a"
FT                   /locus_tag="SPBP35G2.06c"
FT   5'UTR           976926..977108
FT                   /gene="ilv1"
FT                   /locus_tag="SPBP35G2.07"
FT   CDS_pept        977109..979118
FT                   /transl_table=1
FT                   /gene="ilv1"
FT                   /locus_tag="SPBP35G2.07"
FT                   /product="acetolactate synthase catalytic subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.07.1"
FT                   /db_xref="GOA:P36620"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="PomBase:SPBP35G2.07"
FT                   /db_xref="PomBase:SPBP35G2.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36620"
FT                   /protein_id="CAB87369.1"
FT                   /translation="MTVLAPLRRLHTRAAFSSYGREIALQKRFLNLNSCSAVRRYGTGF
FT                   SNNLRIKKLKNAFGVVRANSTKSTSTVTTASPIKYDSSFVGKTGGEIFHDMMLKHNVKH
FT                   VFGYPGGAILPVFDAIYRSPHFEFILPRHEQAAGHAAQAYSRVTKKPGVVLVTSGPGAT
FT                   NVITPIADALADGTPLVVFSGQVATSAIGSDAFQEADMVGISRSCTKWNVMVKDVADLP
FT                   RRIDEAFEIATSGRPGPVLVDLPKDVTASVLKEPIPILSSVPSMNRRMKEVLEEGSKNV
FT                   TAKIDRVANLLKLAKKPVIFCGHGVLANPECPTLLRKFSERLQIPVTTSLLGLGAVDER
FT                   SDLSLHMLGMHGSGYANMAMQEADLILALGVRFDDRVTGNVSLFAPQARLAAAEERGGI
FT                   IHFDISPKNIGKVVQPTEAIEGDVYESLKLLDSATKNIKIPSRFDWLSQIQTWKERFPF
FT                   TFTRSAPGELVKPQEVIQELDKQTSDIKDKVTITTGVGAHQMWAATFYRWTKPSSLVTS
FT                   GGLGTMGFGLPAAIGASVAAPKDIVIDIDGDASFSMTGMELATVRQFDIPVKILILNNE
FT                   EQGMVTQWQNLFYEKRYSHTHQKNPNFVKLADAMGIKALRVEKREDLAKKMKEFLSTKG
FT                   PVLMEVLVAQKEHVYPFVPGGKALHQFILHESLS"
FT   3'UTR           979119..979390
FT                   /gene="ilv1"
FT                   /locus_tag="SPBP35G2.07"
FT   3'UTR           complement(979358..979528)
FT                   /gene="air1"
FT                   /locus_tag="SPBP35G2.08c"
FT   CDS_pept        complement(join(979529..980152,980208..980309,
FT                   980359..980580))
FT                   /transl_table=1
FT                   /gene="air1"
FT                   /locus_tag="SPBP35G2.08c"
FT                   /product="zinc knuckle TRAMP complex subunit Air1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.08c.1"
FT                   /db_xref="GOA:Q9P795"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR016713"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="PomBase:SPBP35G2.08c"
FT                   /db_xref="PomBase:SPBP35G2.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P795"
FT                   /protein_id="CAB87370.2"
FT                   /translation="MDMTVSNQKAESDDGSDIDDAALLQKINSLPIDQSITNSVSLEKH
FT                   DFQGSDDHDSSTDLSDSTLEDVEGSEWADVSRGRYFGSDPSESIVCHNCKGNGHISKDC
FT                   PHVLCTTCGAIDDHISVRCPWTKKCMNCGLLGHIAARCSEPRKRGPRVCRTCHTDTHTS
FT                   STCPLIWRYYVEKEHPVRIDVSEVRKFCYNCASDEHFGDDCTLPSRSNYPESTAFCEAN
FT                   CPSGNDASNKEFFETRRKEFQLERREQNRNQKSSKQRPFHKPGNSLASRLGSKPKSFKR
FT                   KHSPPSEENGNLSFHSSDGRKFTKTSKKNRKRKW"
FT   5'UTR           complement(980581..980870)
FT                   /gene="air1"
FT                   /locus_tag="SPBP35G2.08c"
FT   5'UTR           980867..981239
FT                   /gene="usp103"
FT                   /gene_synonym="yhc1"
FT                   /locus_tag="SPBP35G2.09"
FT   CDS_pept        join(981240..981249,981296..981511,981571..981893)
FT                   /transl_table=1
FT                   /gene="usp103"
FT                   /gene_synonym="yhc1"
FT                   /locus_tag="SPBP35G2.09"
FT                   /product="U1 snRNP-associated protein Usp103 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.09.1"
FT                   /db_xref="GOA:Q9P794"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PomBase:SPBP35G2.09"
FT                   /db_xref="PomBase:SPBP35G2.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P794"
FT                   /protein_id="CAB87371.1"
FT                   /translation="MPRYLCDYCQVWLTHDSQSVRKAHNAGRAHIQNVQDYYTKVAQEE
FT                   AQKQLEERASSGFLKKGNGSLDLPYAYAFPPKYNVFNLGCPPPPYIVSANTYMAPKGMN
FT                   AMNAAAFVPMMPAVNLTNQVAFSAPQTTASSNTQLTQQQQSLPQTNEHQRARTHSNANN
FT                   HFTKTHHQGQRSHQRFVRA"
FT   3'UTR           981894..981978
FT                   /gene="usp103"
FT                   /gene_synonym="yhc1"
FT                   /locus_tag="SPBP35G2.09"
FT   5'UTR           981944..982067
FT                   /gene="mit1"
FT                   /locus_tag="SPBP35G2.10"
FT   misc_RNA        complement(982042..983573)
FT                   /locus_tag="SPNCRNA.1401"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        982068..986324
FT                   /transl_table=1
FT                   /gene="mit1"
FT                   /locus_tag="SPBP35G2.10"
FT                   /product="SHREC complex subunit Mit1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.10"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.10.1"
FT                   /db_xref="GOA:Q9P793"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040934"
FT                   /db_xref="InterPro:IPR041299"
FT                   /db_xref="PDB:5IKF"
FT                   /db_xref="PDB:6FTO"
FT                   /db_xref="PomBase:SPBP35G2.10"
FT                   /db_xref="PomBase:SPBP35G2.10.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P793"
FT                   /protein_id="CAB87372.1"
FT                   /translation="MPKEDDSLCKIVVRREPLDVLLPYYDASETTVQKILHENDSTLSV
FT                   KFLAGVEALIKKDELDKYKNGKACLRVWLKHKSRKRYHGYMTSTDKDEEEKNDYLLKSN
FT                   GSKVLRDSTRTKKFKFGKEFHCALNPSFVSDETASDSATSSSSDTNKKVNRKEHNELSL
FT                   SHLSFNDTSDFGSSDLSSSEIESTENDNKAPYFSLLYSDGFDFIKFLHVCVCVKCHGRE
FT                   HRSSGKNFVYCDHCSNVYHYDCSPLPSLNKETRNYSQQNGFICPLCSKNSKDVLCNTGF
FT                   VSGVSSGQDLVIPPSLADRESLSILVNYCKSIRFRCFRCRRVEYFFYLDSNPLSIQRTI
FT                   THFIKKLVCNECSMHPCDIEEIIAWRTLNSLYPSKATLSNNFVSTSDLSFWSREYFVRS
FT                   KGKSYLHCFWCSASWLAGISLAKKKNFDGLENASYDATKPIIPVSYTIIDKVWDVQYRS
FT                   GKNARTAKYKTKKHQLKAISEVTFAFVSWRGLTYYMSNWEPPPKETDRNRWKAWLKGYS
FT                   DLLECLWIEKAPTASINIDLPFTNLEWHSQPSFIKGGTLMPYQLKGLNWLYLRWYTHHP
FT                   CILADEMGLGKTVQVISFISVLFYRHKCFPVLVIVPHATVANWERELKKWAPFLQINVL
FT                   VGSEKNRSLVRDYRLINQKDPKHVSTHVLVISASNVEREISLLRKFQWKVLIVDEGQRL
FT                   KNDQSSLFYYLSSVKSDFKLLLTGTPLQNNVRELFNLLQFLNPMKINAAELEKRYSIID
FT                   TEKVTELHQILKPFFLRRVKSEVLDNFPTKVEVIIPLSMTPVQKGLYKSILSKNLSLLR
FT                   NITGYANTSSSGGQRTTSLNNILMQLRKTLAHPYIYSPDIEDRNLPYELAMRSLEEASC
FT                   KFLILRLLVPKLITRGHRILLFSQFIQQLDILEDWFEYKNIAYARFDGASSEMERQSAI
FT                   DSFNAPNSELSCFLLSTRAGGVGINLASADTVIILDPDFNPHQDMQAIARAHRYGQKKK
FT                   VLVFVLTTRDSVEEKIIQNAQKKLVLDHLIVESLDQNHNSEKDLESILRHGARALFEEA
FT                   GDEPSIKYNEYSVELLISEAEKQEDTSTDESDIKSNKFGFFRVWDNKHISSNHYEVKEN
FT                   VLVDEEDVWSVILKQREKDAMLEKTDETTSNRRLRAHHKIHYGEDLNIYDNSDDTDYTV
FT                   NDRSSPGSPFPIETETISSITDTLSDKQKLKYDSSVNIENLNDESDSQKSADVHFDSIL
FT                   AKSLLATTPKEDEFNKTLSTINLEVANKLTSSEYINDSEMQLIDDPVFYPPYEIIEKNH
FT                   QLVGRSLSKAVLDNFFLLSSLSDNVRCRCCGIKHLPAHCPLSIVPLEICFLCGTPHFSG
FT                   RDTCPMLRNKEAIYRLKDSLSKSREPFHIKKQAMARLNSFLQKKEEPTVSSSAKTNELS
FT                   SKVIIKESIINEAKTL"
FT   3'UTR           986325..986422
FT                   /gene="mit1"
FT                   /locus_tag="SPBP35G2.10"
FT   3'UTR           complement(986383..986643)
FT                   /locus_tag="SPBP35G2.11c"
FT   CDS_pept        complement(986644..987837)
FT                   /transl_table=1
FT                   /locus_tag="SPBP35G2.11c"
FT                   /product="transcription related zf-ZZ type zinc finger
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.11c.1"
FT                   /db_xref="GOA:Q9P792"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="PomBase:SPBP35G2.11c"
FT                   /db_xref="PomBase:SPBP35G2.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P792"
FT                   /protein_id="CAB87373.1"
FT                   /translation="MLCNRTCPSSDCGILCNHSVPSFPPFHSSVANIHFTKENNLKSNI
FT                   FEHNNNSPTLRSSSVACNTCLKIIRNDSFHCTKCFDFDVCRDCYAKQAFLHPCPKPHFV
FT                   LVRSSIPSVASLTCSVNSMSVSPQSNFMYAICDHCEQPIHNVRYKCSVCDDYDICESCL
FT                   TDNSHSNTHAFVRITKAYPHGLPSFHLFPQFLSAELFESASTVHRSVQCDNCLAHPIVG
FT                   PRFHCLVCEDYDLCSSCVSHVHHDHHSMLRLTREISASPLHLSKPEKPKVLNFDFKLVE
FT                   DSILPLELSPGCPFYKIWHIRNTSCQSWPSPLYVKFNGGDKLFPGDNPYSFPITSSVHP
FT                   GEDVNFTVALKVPEKSNKEIFTAFFNICSDDGSVFHKSLCAFLRVPKSFSRISKSSF"
FT   5'UTR           complement(join(987838..988001,988305..988594))
FT                   /locus_tag="SPBP35G2.11c"
FT   5'UTR           988916..989326
FT                   /locus_tag="SPBP35G2.12"
FT   CDS_pept        989558..990175
FT                   /transl_table=1
FT                   /locus_tag="SPBP35G2.12"
FT                   /product="ADP-ribose diphosphatase, NudF subfamily
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.12.1"
FT                   /db_xref="GOA:Q9P791"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="PomBase:SPBP35G2.12"
FT                   /db_xref="PomBase:SPBP35G2.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P791"
FT                   /protein_id="CAB87374.1"
FT                   /translation="MSQDQKPKVLEVSNLENQDAKWTSLKKIRWQDEKGKIRFWEMAER
FT                   TTRSEANVDAVAILAIVPIDGSPHVLCQKQFRPPIGKFCIEIPAGLVDSKESCEDAAIR
FT                   ELREETGYVGTVMDSTTVMYNDPGLTNANLKIILADIDMSKPENQNPQQQLDDGEYIEN
FT                   FPIKLSSLQEELFSLEKKGFAIDVRLSTFALGLHAGLKYLSS"
FT   3'UTR           990176..990326
FT                   /locus_tag="SPBP35G2.12"
FT   3'UTR           complement(990227..990416)
FT                   /gene="swc2"
FT                   /locus_tag="SPBP35G2.13c"
FT   CDS_pept        complement(990417..991367)
FT                   /transl_table=1
FT                   /gene="swc2"
FT                   /locus_tag="SPBP35G2.13c"
FT                   /product="Swr1 complex complex subunit Swc2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.13c.1"
FT                   /db_xref="GOA:Q9P790"
FT                   /db_xref="InterPro:IPR008895"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="PomBase:SPBP35G2.13c"
FT                   /db_xref="PomBase:SPBP35G2.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P790"
FT                   /protein_id="CAB87375.1"
FT                   /translation="MSATESLVAGRTRRANAGNKMRELLEKEHLRMTQQNAEIEKEDEE
FT                   YNIEEEEEAERDIEISSESSDEEAELKKLEEEGEEVEKILRDEERIKKRKIQKNRAANL
FT                   QRTLQPPKRPTPSAASEVPKKKYKKIKVDPSARRTSSRMHTVLMAQSTETRLQEAKPRR
FT                   KYTVSASANRQKGTMTQQQRFEEAAKTEAQNLSSLRNYVHLEEQRRLRLKRNAAKHRQL
FT                   REPILKFISKTISTEDGREASNYYVAPLEHPLCHSAPPLQMPQHRAVECVITGKPAIYL
FT                   DPVTQLPISNVQAFQQVREVYNQRYSWSAMLNLFH"
FT   5'UTR           complement(991368..991832)
FT                   /gene="swc2"
FT                   /locus_tag="SPBP35G2.13c"
FT   misc_RNA        991484..992571
FT                   /locus_tag="SPNCRNA.1402"
FT                   /product="intergenic RNA (predicted)"
FT   5'UTR           992679..992871
FT                   /locus_tag="SPBP35G2.14"
FT   CDS_pept        992872..996069
FT                   /transl_table=1
FT                   /locus_tag="SPBP35G2.14"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBP35G2.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPBP35G2.14.1"
FT                   /db_xref="GOA:Q9P789"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PomBase:SPBP35G2.14"
FT                   /db_xref="PomBase:SPBP35G2.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P789"
FT                   /protein_id="CAB87376.2"
FT                   /translation="MHQDAMQGSIYEGSRRNTISKPSNNNPPLDMSSLNNDFGQQLDSL
FT                   ATGVGSGSLNGTTNPSSNFNDSNRSNISSSLRSEMEMSNNLLKNTQNDTWTSTVGLSVP
FT                   ENQEAMNFNEGPTGISSIASKNNSSITSKLQNNSNLSVTSSANRGRTSSVSSSYDPSFP
FT                   WGPRMSSVSSGKQHLSSLSLHTHFNPSSSSTVSSDSLESSQQKAPSSSSTATPASAASE
FT                   IISNKDPVVEPTHSASNAANSGSNTIRARQTTRTRSNTLPWSPRVFGPTLGYNTPPFGY
FT                   PPTTSSALPNASGSSSSFFGLPTAVSASAGTSFSDISPAAPKASLENNIASNASSLLNP
FT                   VGLDHFSAASGWSRDFNHLPASSLATARSSLTGNAKSGIDSSVTGMPSDNYARVVESST
FT                   AEFFDPSLASSFGLTNYRTKPLTTGFNHPRPQGHGLNTSLFNTSSGGSLKSPTFEVSNR
FT                   LGDVDTVPDLPPLGSLSSRPKPSSSSRRRSQSLSAMLKTSNPYMPSPSLLSGSLANSSE
FT                   HSSSPRLRGSPIHNQPVSSSKSTASLNTNNNGLRASTPEMANISTRSSSESNNTNSWPT
FT                   VGDATIENLTQHEPTHALWVGNLPSGVSATTVATTFSAYGTVSSIRMLSHKHSAFLNFD
FT                   SVETAKHVLEELNGKRIFFGSDPVCISFAKVASSSSESSHSAVDGLNKAFSNVSFVPSL
FT                   REVYDDLINVVQSFGFKDLSKIYQILNAACELTDFAAQIPSISKAFSSRRLNAPKLRQV
FT                   RKRIDNGLCTQEEVEDIAINWLDEVSDLSSDHLGNTVVQKLFDYCSDPVKEMMLERIAP
FT                   HLAQIGIHKNGTWAAQKIVDVASTEAQMRLIAKHLQPYIPLLFADQFGNYVVQTCLKFG
FT                   APMNDFVFEAILNQFWVIAQSRYGSRAVRACLESPDVTEEQRVLVAAAITVYSVHLAMN
FT                   GNGTLLLTYLVENMNYPHIPILLTRRFVQDIVRVCTHRLAYNSLLKIISISQGDTACGD
FT                   LVVDAILDTQNDLNPNSLEKILFEQTYGPSFICKLLTHENISASHRQQLQSAVRNVLGT
FT                   MEDRGSSELKKLAEVCA"
FT   3'UTR           996070..996435
FT                   /locus_tag="SPBP35G2.14"
FT   5'UTR           996780..996842
FT                   /gene="med15"
FT                   /gene_synonym="SPBP35G2.15"
FT                   /locus_tag="SPBC146.01"
FT   CDS_pept        join(996843..997019,997066..1000080)
FT                   /transl_table=1
FT                   /gene="med15"
FT                   /gene_synonym="SPBP35G2.15"
FT                   /locus_tag="SPBC146.01"
FT                   /product="mediator complex subunit Med15"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.01"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.01.1"
FT                   /db_xref="GOA:Q9Y808"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="InterPro:IPR033789"
FT                   /db_xref="InterPro:IPR036546"
FT                   /db_xref="PomBase:SPBC146.01"
FT                   /db_xref="PomBase:SPBC146.01.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y808"
FT                   /protein_id="CAB87377.2"
FT                   /translation="MRDRALPCKCMPSFFKTLHLTFVFSAQTLRIISPSISEVQLMNMA
FT                   LSFERQAFDGASSKNEYLTTCGKKTAQLRDQIRDTLQATQMKQMPSVYNNAGNVGALPT
FT                   AGPNRLANNPRVMPRLQNQNVPMQAGMQQFARNMKLTPQQRQFLLQQSQIQQQRQQQQQ
FT                   QSQQPQQTQQPQASSPTAPNTEANQQRSGSVPGRIVPALTQQQLNNLCNQITALLARNG
FT                   NPPIPMQKLQSMPPARLISIYQNQIQKFRSLQHMQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQQQKQAPQNAFFPNPQGNVGAQSLQSMSPQDQPSTQQQQPQRTAAPPNNPNVNA
FT                   TNNNRINIEMLNIPVPKQLFDQIPNLPPNVKIWRDVLELGQSQRLPPEQLKLIGMLYRK
FT                   HLQIILQHRQQQLNKIQNARMNSQNAPNTNKLGNPQPDNTGNPQAFSQQAFAQQQQQQQ
FT                   QQLHRTSNPTSASVTSQNGQQPINTKLSANAAKTNYQSYLTNKARNATQPTQPPVSQVD
FT                   YSNNLPPNLDTSSTFRSSASPPSAFTKAGNEALSVPLSGARNTAASRPTNLAAGNSSAS
FT                   IVQQLLECGGTMGQQKMTSRIRELTERVMHSLMRPVPLDLPHDQKVMIASLIKSAYPMF
FT                   SRTNQLICLFYCLTGNEEATIQLIQMRHIFKLQLEGLQQGVFTCAPQTLAKIKEKTSRY
FT                   FAFVKAQLLRLHHEVNNNNMSIQNALAHISSLRTASINQQQQPQPQSQQQQQASQFPQA
FT                   PSVSSNVRPINGSIPNAQPSVPGQAQPAAKANSVGNTSFPVDSKLAFQSLDVSQPDLQA
FT                   KQKIASQVMKHGLKPEDLKLPPSKKKKIENLSTVQKPKDSVVNTPDVIMSSVDEIPSSV
FT                   SPGTIAKEEGMAKAREEAIANPLKYAIDAFVAVDHEEEVSAIKSSQTPSSILKTPQSFF
FT                   IPPSTPDLSFTDNKNSLSPSNILSLDGKFSFNDDSELWADLGNEINSEIGFLKEPDTMN
FT                   LALDADKDKTKMQNKLTQINFDESCFLDPAIDDKDPWNEMLHEKKVLLKQLQVGNEDED
FT                   NIAFPTSTNIWQVVI"
FT   3'UTR           1000081..1000175
FT                   /gene="med15"
FT                   /gene_synonym="SPBP35G2.15"
FT                   /locus_tag="SPBC146.01"
FT   5'UTR           1000714..1001010
FT                   /locus_tag="SPBC146.02"
FT   misc_RNA        complement(1000805..1001832)
FT                   /locus_tag="SPNCRNA.1403"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        1001011..1001802
FT                   /transl_table=1
FT                   /locus_tag="SPBC146.02"
FT                   /product="sequence orphan"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.02"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.02.1"
FT                   /db_xref="GOA:Q9Y807"
FT                   /db_xref="PomBase:SPBC146.02"
FT                   /db_xref="PomBase:SPBC146.02.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y807"
FT                   /protein_id="CAB46755.1"
FT                   /translation="MNGIRKKPATLQLHNIKTSCFIDGSDDQSDRTRSSSGDSTSNSLK
FT                   LSHHISDELINAIYKELKSPVSPWDKNISQHSPWLLEAASNSIGDSSPLLSPISPLKLR
FT                   FHKYSVSKQLNSVGKQGFGLSSNHSRYASPSSPARLARGALGEELSNSQYRLECAAIQK
FT                   LVAQKRANRRSSKSTLKNSANDIEFFDIEEVSSRKGLIDRTPSKRNVTSRVSDAYSRLK
FT                   SAVKGESSLSFKRNRSKSKRKIQHLGLTEFNGWEHHQCDWL"
FT   3'UTR           1001803..1002162
FT                   /locus_tag="SPBC146.02"
FT   3'UTR           complement(1002263..1002488)
FT                   /gene="cut3"
FT                   /gene_synonym="smc4"
FT                   /locus_tag="SPBC146.03c"
FT   CDS_pept        complement(1002489..1006463)
FT                   /transl_table=1
FT                   /gene="cut3"
FT                   /gene_synonym="smc4"
FT                   /locus_tag="SPBC146.03c"
FT                   /product="condensin complex subunit Cut3"
FT                   /db_xref="GOA:P41004"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="InterPro:IPR041738"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41004"
FT                   /protein_id="CAB46756.1"
FT                   /translation="MSDKGIFRTSSTPSIVDVTPDRGERPRKLVRSVLESPSQKDVASI
FT                   VKIEQTPSRPFFNDFLKKRITDSLNERPNLLNKFMSAQDGTPSKSTGFNERSSQLVSEF
FT                   TTTEDIENCEETTQVLPPRLVVYELRLTNFKSYAGTQIVGPFHPSFSSIVGPNGSGKSN
FT                   VIDALLFVFGFRASKLRQSKASALIHKSATHPSLDSCDVEITFKEVNSDFTYVDGSELT
FT                   VRRTAYKNNTSKYFVNGVESSFSAVSNLLKEKGIDLNHKRFLILQGEVESIAQMKPRAI
FT                   SEGDDGLLEYLEDIIGTSKYKPIIEENMQELSNSDDICAEKESRLKLVLSEKAKLEDSK
FT                   NSVLSFLKDENELFMKQNQLYRTILYETRNKKTLVQNLLNSLEGKLQAHLEKFEQTERD
FT                   ISEKNEEVKSLREKAAKVKNDCTSEKKTRQSYEQQTVKIEEQLKFLLNKEKKLKKSIEA
FT                   LSFEKSEAENSLSSHDIDSQKLNSEIADLSLRLQQEELSLDDIRKSLQGKTEGISNAIE
FT                   EKQKAMAPALEKINQLTSEKQILQVELDMLLNKENDLINDVESSQSSLDKLRNDAEENR
FT                   NILSSKLKVLSDLKGEKKDVSKNIERKKETVHNTYRNLMSNRTKLEEMKASLSSSRSRG
FT                   NVLESLQRLHESDNLNGFFGRLGDLATIDEAYDVAISTACPALNHIVVDNIETGQKCVA
FT                   FLRSNNLGRASFIILKELAQKNLARIQTPENVPRLFDLLRFNDQKFAPAFYNVLQNTLV
FT                   AKNLEQANRIAYGKTRWRVVTLSGQLIDKSGTMTGGGTRVKKGGMSSAITSDVSPASVE
FT                   TCDKQVQLEDTRYRQHLSELESLNQRFTEISERIPSAELEISKLQLDVSACDRLVAGEE
FT                   RRILQLKSDLKSIRNNNERKRNLQNKISNMDKEVEAININNEGLVTEIKTLQDKIMEIG
FT                   GIRYRIQKSKVDDLHEQLKFVKDKLNKMSFKKKKNEQRSQSFQVELSNLTSEYDTTTES
FT                   IATLKTELQSLNKYVDEHKSRLREFENALWDINSSIDELVKFIEFESKQMNSVKAERIE
FT                   LENQIQEQRTALSEVGNNENKYLKLMSNLKLHNLTEFCDQTTMDSTFPEYSEDELSSVD
FT                   KSELVSNISVLKKKTEDREVDINVLSEYRRCNKEAEKRDSDYQSELQKRTDLKKVVTDL
FT                   QSQRLDEFMYGFGIISMKLKEMYQIITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWK
FT                   NISNLSGGEKTLSSLALVFALHNYKPTPLYVMDEIDAALDFKNVSIVANYIKERTKNAQ
FT                   FIVISLRSNMFELSSRLVGIYKTANMTKSVTINNKEILTD"
FT   5'UTR           complement(1006464..1006688)
FT                   /gene="cut3"
FT                   /gene_synonym="smc4"
FT                   /locus_tag="SPBC146.03c"
FT   5'UTR           1007901..1008017
FT                   /locus_tag="SPBC146.04"
FT   CDS_pept        1008018..1008596
FT                   /transl_table=1
FT                   /locus_tag="SPBC146.04"
FT                   /product="sulfhydryl oxidase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.04.1"
FT                   /db_xref="GOA:Q9Y806"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR036774"
FT                   /db_xref="InterPro:IPR039799"
FT                   /db_xref="PomBase:SPBC146.04"
FT                   /db_xref="PomBase:SPBC146.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y806"
FT                   /protein_id="CAB46757.1"
FT                   /translation="MILNRRIQVILPTLLILSFIIWIFHSVMVDKDWRLFMPEIKSLPD
FT                   REGQGRKPIEMMSTKHDNNTNNLMVNAYWKLIHTVVSNYPNRPTLDERDILRHYLFSSA
FT                   ITMPCGEYSVELQKILDVHPPQTSSRKAATTWACKVHNQLNEKMNQPKTSCDGFNERYV
FT                   IGSPTYRESEAENVPERVQVINEDHDYSG"
FT   3'UTR           1008597..1008710
FT                   /locus_tag="SPBC146.04"
FT   3'UTR           complement(1008690..1008798)
FT                   /gene="cwf25"
FT                   /locus_tag="SPBC146.05c"
FT   CDS_pept        complement(join(1008799..1009894,1009957..1009991))
FT                   /transl_table=1
FT                   /gene="cwf25"
FT                   /locus_tag="SPBC146.05c"
FT                   /product="complexed with Cdc5 protein Cwf25"
FT                   /db_xref="GOA:Q9Y805"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="InterPro:IPR022209"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y805"
FT                   /protein_id="CAB46758.1"
FT                   /translation="MGGGDLNMKKSWHPLLMRNQEKVWKDEQAHKEEMKRVEQLRREIE
FT                   EERQLLELHRLQEAAGGKKRKDRVEWMYAVPNTNGPNRDSSEMEEYLLGRRRLDDLLKD
FT                   KIEDQNNSLEKTEFIALQNANSLQDTQAKLRLDPLLAIKQQEQKQLQTLMEKRKYSLDS
FT                   DRKSKERRHRDRHHRSNQDRSRERSDNEQHSSDKREHSRRSYRNDRNNWRERTHNDRYR
FT                   HRDKYDSGYFKKHYDDDMRFDQGHFQDERDLKKYVRTSRQYSRSPSPDFRTRNHQFHSR
FT                   DSQPITQRHTDIESRLQKMQDNAKELDESRRKKIELLEKKERDEEQFLEKERRDTARKW
FT                   DNQGDFIRNMRKEIYSGDSVSLADRVNSSRHNMLRP"
FT   5'UTR           complement(1009992..1010162)
FT                   /gene="cwf25"
FT                   /locus_tag="SPBC146.05c"
FT   misc_RNA        1010239..1011278
FT                   /locus_tag="SPNCRNA.1404"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           complement(1010348..1010600)
FT                   /locus_tag="SPBC146.06c"
FT   CDS_pept        complement(1010601..1012712)
FT                   /transl_table=1
FT                   /locus_tag="SPBC146.06c"
FT                   /product="VRR-NUC nuclease associated domain, human MTMR15
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.06c.1"
FT                   /db_xref="GOA:Q9Y804"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR033315"
FT                   /db_xref="PomBase:SPBC146.06c"
FT                   /db_xref="PomBase:SPBC146.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y804"
FT                   /protein_id="CAB46759.1"
FT                   /translation="MKRFFNEACDINTPDKSGVNENKLCFPPLKVVCQAPETTVKGQVA
FT                   NTNKHNVYSTKNSMYLLGFEEILNTVLDCEPHIFTDDELRVIENFKALDSDERYLFVRL
FT                   FMRKRNKWFRVGHLTYPDCKDVIACCKQLVLKNFFEDESLMSTEEIIEILSLDELRSLA
FT                   RQTKVCGKSRSEISKEIIFLSKRQSVLHCNGQQFLSFDAFGVMHKQESFLRKQLLYQCK
FT                   SCVKPKKILVDLFHRINIVYFRSSIYDEQSLTSLILARLNKFSYPNYVLSRTSNVFNCR
FT                   AQCLEYVEVLELSKNLVPIFENTAASDKEALEQALNSFFEIYPIWSTYLNEDIREFWVE
FT                   ENRKVDTRLVRFSFSFRPGAVYTYLIHKSLNILAKSRLVEVEHEILDTLLSQNIYLVGK
FT                   RGHWYNRKALLEYNFKTEDTNVLRYWKTLALSTCENGIEDKYTHLRYYFSLQRRLVRLR
FT                   KCLKVSNTTELKSMKLINNNPSRLFLHGERIHNGDLSNRTVWRSKTNNAITVEELALQH
FT                   YQSIGWEGIHAESSILLTLFALTFWDILFEDVPGVFQSPFQSAPLDLHTDSFYISREST
FT                   IMKRLEEIRNGKAGLIIKDNYIREHQRKTFCVGLNWSYTCEMLLEIVDCINDNGLAQIF
FT                   LALTQDYKNSSSGIPDLCLWNPSKKKFMFSEVKSDNDRLSEAQKFWISLLISSEVDVEV
FT                   CHVSMHKKK"
FT   5'UTR           complement(1012713..1013231)
FT                   /locus_tag="SPBC146.06c"
FT   5'UTR           1013254..1013554
FT                   /gene="prp2"
FT                   /gene_synonym="mis11"
FT                   /locus_tag="SPBC146.07"
FT   misc_RNA        complement(1013315..1014054)
FT                   /locus_tag="SPNCRNA.1405"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        1013555..1015108
FT                   /transl_table=1
FT                   /gene="prp2"
FT                   /gene_synonym="mis11"
FT                   /locus_tag="SPBC146.07"
FT                   /product="U2AF large subunit (U2AF-59)"
FT                   /db_xref="GOA:P36629"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006529"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PDB:4YH8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36629"
FT                   /protein_id="CAB46760.1"
FT                   /translation="MDLSSRLSSGSSRIPKRHRDYRDEEPRRERGSGGIGREDPRGHYG
FT                   SERPRRRRRDESDFRRHRESRERSYREDERPRRERRYDDYEPRSLRYSSVGRSRSPPPS
FT                   RERSVRSIEQELEQLRDVTPINQWKRKRSLWDIKPPGYELVTADQAKMSGVFPLPGAPR
FT                   AAVTDPEKLLEFARSAEGSIIAPPPPLQPGASRQARRLVVTGIPNEFVEDAFVSFIEDL
FT                   FISTTYHKPETKHFSSVNVCKEENFAILEVATPEDATFLWGLQSESYSNDVFLKFQRIQ
FT                   NYIVPQITPEVSQKRSDDYAKNDVLDSKDKIYISNLPLNLGEDQVVELLKPFGDLLSFQ
FT                   LIKNIADGSSKGFCFCEFKNPSDAEVAISGLDGKDTYGNKLHAQFACVGLNQAMIDKSN
FT                   GMAILTELAKASSQSIPTRVLQLHNLITGDEIMDVQEYEDIYESVKTQFSNYGPLIDIK
FT                   IPRSIGTRNSGLGTGKVFVRYSDIRSAEVAMEEMKGCKFNDRTIVIAFYGEDCYKANAW
FT                   "
FT   3'UTR           complement(1014863..1015331)
FT                   /locus_tag="SPBC146.08c"
FT   3'UTR           1015109..1015179
FT                   /gene="prp2"
FT                   /gene_synonym="mis11"
FT                   /locus_tag="SPBC146.07"
FT   CDS_pept        complement(join(1015332..1015416,1015469..1015767))
FT                   /transl_table=1
FT                   /locus_tag="SPBC146.08c"
FT                   /product="translation initiation factor eIF1A-like
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.08c.1"
FT                   /db_xref="GOA:Q9Y803"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR039294"
FT                   /db_xref="PomBase:SPBC146.08c"
FT                   /db_xref="PomBase:SPBC146.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y803"
FT                   /protein_id="CAB46761.1"
FT                   /translation="MSKKYGGQISFDPPARLEKDQVVAKVVQLKGSALFMVVENNGQEL
FT                   LVEMPPKYRNKIWVRRNGFVIVDKSEFLEKDNKIDGTILYVVQSPLKNWKKQIYWPKEF
FT                   ADESLNQNDSEESSSSEEEYDSD"
FT   5'UTR           complement(1015768..1015825)
FT                   /locus_tag="SPBC146.08c"
FT   3'UTR           complement(1015936..1015999)
FT                   /gene="lsd1"
FT                   /gene_synonym="swm1"
FT                   /gene_synonym="saf110"
FT                   /locus_tag="SPBC146.09c"
FT   CDS_pept        complement(1016000..1019002)
FT                   /transl_table=1
FT                   /gene="lsd1"
FT                   /gene_synonym="swm1"
FT                   /gene_synonym="saf110"
FT                   /locus_tag="SPBC146.09c"
FT                   /product="histone demethylase SWIRM1"
FT                   /db_xref="GOA:Q9Y802"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y802"
FT                   /protein_id="CAB46762.1"
FT                   /translation="MMDLSSKDALSDVLKDTHAQSSDPSLWAIFGHQSSDNVHEGGNES
FT                   VSVEQEIFDLSQLSERPVSETVSKASIPTNINGLSQVKPSALEKSQEVLSLQKLPIKGR
FT                   RPAGRRGRPALNTSNSLERNGTRYVSAEAPISVKSSIPAIPRVTFERLCYESAIASNLP
FT                   PNALSPLEAEMLSEILENPTWLSLYLSIRNGICYLWHRNPTLYVSFNEALGIVREKKAF
FT                   PLASLAFEFLSRNGHINYGCIYIISSLKLDESLSQKTVAIIGAGMAGISCARQLTNLFA
FT                   QYEQDFLSRGEKPPRIVIYEASERLGGHIYTHMVPLSDNEVSEKSSLATTVNATNECMV
FT                   NLLTDSLIGMPTLDSDPLYIISSQQLSLDAVHTRNREFILHDIENGRIDTEHVQRIFRL
FT                   FDALLFYFNASASKQPLHSLITPPEQEFIQKLDQIGWYISIEAFPLQIKDTLSEFLGNS
FT                   ANTLTSLLHLTVLDLKIFEWFKEYLSQSLSVSLENVYPGSIPNLNLLLGENVASYSFKH
FT                   GMADMLNSLASTPSPLPILFDQCVHTVKLEDNTVNLSFVNETTVSVDKVVICIPMDKLN
FT                   THLITFEPPLEEKKLKAIDRCHFTNVKKVILIFKTQFWEPNISIFGSLPQDSGRNFIFN
FT                   DCTRFYEHPTLSVFVKVEGIDFMKDDDIVNGIVSQLKKVYKPKSEAINPIRTIISNWEN
FT                   NSYTNHSSYQISNLFLEEDYAILSEPIDNTVFFASEAISQKNSGSIRGAFDSGILAARD
FT                   VLASLIGNVVLPNTLVIEENLEQPRKTYGTKRNAQQALGKEGERENKEKRISYHTEYLR
FT                   LRQKRLDKEQQECDLLIAELLGPSPVPPSRPSANPYLLYQKTQWHVCKTLADQDKQRVT
FT                   GDPEARATKNEIRAKLGKTWRALDSLGKQPWVDEINARRANYSTRLEEYQRQINSYNVR
FT                   VAQIKSEHQRRCESQPIPEDEAKLKLLAEQEDEHLHPEKEGMSVENSDDDYHDDLDYED
FT                   SISEVFPDNFS"
FT   5'UTR           complement(1019003..1019224)
FT                   /gene="lsd1"
FT                   /gene_synonym="swm1"
FT                   /gene_synonym="saf110"
FT                   /locus_tag="SPBC146.09c"
FT   5'UTR           1019517..1019752
FT                   /gene="mug57"
FT                   /locus_tag="SPBC146.10"
FT   CDS_pept        1019753..1020322
FT                   /transl_table=1
FT                   /gene="mug57"
FT                   /locus_tag="SPBC146.10"
FT                   /product="meiotically upregulated gene Mug57"
FT                   /db_xref="GOA:Q9Y801"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y801"
FT                   /protein_id="CAB46763.2"
FT                   /translation="MMKLFCLNIFRFLYTTSFISAVLSFNQRPINMQEVREPRLFELLA
FT                   ETRDCNIFSELIMQFPDYVHLFQQKDQHITVLVPNDAAFQQCKVKPWAIEYKNGVAVKS
FT                   TDIVHITEQQAQDNILKFVERHIITSSPIEWNNEYKTIDGTDVHVIKKEEEIYINESIH
FT                   VLCRKKASNGEMWVLNATLSTPSIRE"
FT   3'UTR           complement(1020184..1020295)
FT                   /gene="mug97"
FT                   /gene_synonym="meu33"
FT                   /locus_tag="SPBC146.11c"
FT   CDS_pept        complement(1020296..1021333)
FT                   /transl_table=1
FT                   /gene="mug97"
FT                   /gene_synonym="meu33"
FT                   /locus_tag="SPBC146.11c"
FT                   /product="meiotically upregulated gene Mug97"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.11c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.11c.1"
FT                   /db_xref="GOA:Q9Y800"
FT                   /db_xref="PomBase:SPBC146.11c"
FT                   /db_xref="PomBase:SPBC146.11c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y800"
FT                   /protein_id="CAB46764.2"
FT                   /translation="MSILNSGSCMMTDTNQNMECKVDFKKGEFDLQPLQINQFGFTKTQ
FT                   LHKPLTRNLSNKEDTHVPKRQKVSEPYFRGETERNVKSHQDRAASIYHEAMNGASGIHK
FT                   QMSLPEYSPQMGNSWEIQVPMTTRHSISETPTKPFTATTAIAGSAGSLPRNTTIGLPGP
FT                   SALLKHESGKNENQVRVCLYHKHYSRWYLPFDKDDDNQLVEAYAKYFSSENRPSIFYVL
FT                   QGISFGPECEYVLRRKHWWNPWAEKVMRREIVERKIDTHPGCRTVAERYEQIEASGSEE
FT                   LLIIPIYKINMWVLSLLLFSAGGSVLIGLWMRLSDPSFAHGMLLNLGIGSIGSFLYLLS
FT                   NTWCR"
FT   3'UTR           1020323..1021681
FT                   /gene="mug57"
FT                   /locus_tag="SPBC146.10"
FT   5'UTR           complement(1021334..1021749)
FT                   /gene="mug97"
FT                   /gene_synonym="meu33"
FT                   /locus_tag="SPBC146.11c"
FT   5'UTR           1021973..1022415
FT                   /gene="coq6"
FT                   /locus_tag="SPBC146.12"
FT   CDS_pept        1022416..1023855
FT                   /transl_table=1
FT                   /gene="coq6"
FT                   /locus_tag="SPBC146.12"
FT                   /product="monooxygenase Coq6 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.12.1"
FT                   /db_xref="GOA:Q9Y7Z9"
FT                   /db_xref="InterPro:IPR000689"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PomBase:SPBC146.12"
FT                   /db_xref="PomBase:SPBC146.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y7Z9"
FT                   /protein_id="CAB46765.2"
FT                   /translation="MSSLVLRGVSRVEMPTISPTLGIYTRKFASQKILQRQFDVVIVGS
FT                   GPVGLALAAGLQSNPVTQSLKVGLLDIQDTMKLKDWKFETYSNRCSSLTNHTRMFFDKI
FT                   GAWDFARKDRIQPFQHILASDGLTNSSIHLDQKPGSEPMAFMSENVNLQYALLNSIIDK
FT                   MNNNIKKPNLEFLMPCTITKLSKGENIYRTHIHTTTHGELTTKLLIGADGRNSIVRKYA
FT                   NISMPGWNYLTHAVVGTLKIDPLKGPAVAFQRFLPTGPLAYLPLPDNNATFVWSTRPHI
FT                   ASKLLRLPEETFVKFLNASFRLDYPDLSYLYQMDFSEPSKVNEQLDWRLQVKRNSNMQV
FT                   PPVITEIVSGSRAAFPLRLAHVDEYVKEGIALCGDAAHNTHPLAGQGLNTGIQDVESLI
FT                   SALSFAIKHGQDIGSVFSLQPYFRDRYFKNHVYLGVVDKFHKLYAMENPVVTSVRTLGL
FT                   SLFDRSASLKNFILSTVANGI"
FT   3'UTR           1023856..1024021
FT                   /gene="coq6"
FT                   /locus_tag="SPBC146.12"
FT   3'UTR           complement(1023963..1024232)
FT                   /gene="myo1"
FT                   /locus_tag="SPBC146.13c"
FT   CDS_pept        complement(join(1024233..1027883,1027928..1027930))
FT                   /transl_table=1
FT                   /gene="myo1"
FT                   /locus_tag="SPBC146.13c"
FT                   /product="myosin type I"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.13c.1"
FT                   /db_xref="GOA:Q9Y7Z8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035535"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036072"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="PomBase:SPBC146.13c"
FT                   /db_xref="PomBase:SPBC146.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y7Z8"
FT                   /protein_id="CAB46766.1"
FT                   /translation="MAILKRTNRAKAATAAAPNSTGKSNGIKKAVYTSTRKKTVGVDDL
FT                   TLLSKITDEEINKNLELRFRNGEIYTYIGHVLISVNPFRDLGIYTMDILKSYQGKNRLE
FT                   TSPHVYAIAENAYYQMKSYHENQCIIISGESGAGKTEAAKRIMQYITHVSKSVGTEIER
FT                   VSEIILATNPLLESFGCAKTLRNNNSSRHGKYLEMIFNSGGVPVGAKITNYLLEKNRIV
FT                   NQVRNERNFHIFYQFTKSAPQKYRDTYGIQGPENYVYTSACQCLSVDGISDEKDFQGTM
FT                   NAMKVIGITEPEQDEIFRMLSIILWLGNIQFQEGQDGGSVISDKSITEFLGYLIGVPVA
FT                   AIERALTIRIMQTQHGARRGSVYEVPLNPTQALAVRDALSMAIYNCLFDWIVERVNKAL
FT                   VTSDNSVSNSIGILDIYGFEIFENNSFEQLCINYVNEKLQQIFIELTLKTEQEEYVREQ
FT                   IAWTPIKYFNNKVVCDLIESKRPPGLFAAMNDAIATAHADSAAADSAFAQRLNFLSSNP
FT                   HFEQRQNQFIVKHYAGDVTYSITGMTDKNKDQLATDILNLIHSSNNEFMKSIFPVAEES
FT                   NSRRRPPTAGDRIKTSANDLVETLMKCQPSYIRTIKPNQTKSPNDYDQQMVLHQIKYLG
FT                   LQENIRIRRAGFAYRQAFDTFAQRFAVLSGKTSYAGEYTWQGDDKSACEQILKDTNIPS
FT                   SEYQMGTSKVFIKNPETLFALEDMRDKFWDTMATRIQRAWRSYVRRRSEAAACIQKLWN
FT                   RNKVNMELERVRNEGTKLLQGKKQRRRYSILGSRKFYGDYLSASKPNGTLWNTCGLSQN
FT                   DHVIFSMRCEVLVHKLGRTSKPSPRQLVLTKKNLYLVITKIVDQKLTQQVEKKFAVSSI
FT                   DSVGLTNLQDDWVAIRNKSSQNGDMFLRCFFKTEFITTLKRINRNIQVIVGPTIQYCRK
FT                   PGKVQTVKTAKDETTKDYDYYKSGTIHVGTGLPPTSKSKPFPRLATGGSTAAARGPRPV
FT                   VQNKPAATKPVSMPAAKSKPAPMANPVSTAQQTQNRPPAPAMQARPNTTQAAAPVTSTT
FT                   TTIKQATTVSASKPAPSTVTSAASSPSNISKPSAPVANNVSKPSAVPPPPPPPPAEVEK
FT                   KDLYLALYDFAGRSPNEMTIKKDEIIEIVQKEPSGWWLALKNGAEGWVPATYVTEYKGS
FT                   TPQTTASSTNVAAQANNNASPAEVNNLAGSLADALRMRASAVRGSDEEEDW"
FT   5'UTR           complement(1027931..1028192)
FT                   /gene="myo1"
FT                   /locus_tag="SPBC146.13c"
FT   3'UTR           complement(1028878..1029115)
FT                   /gene="sec26"
FT                   /gene_synonym="SPBC337.01c"
FT                   /locus_tag="SPBC146.14c"
FT   CDS_pept        complement(1029116..1031938)
FT                   /transl_table=1
FT                   /gene="sec26"
FT                   /gene_synonym="SPBC337.01c"
FT                   /locus_tag="SPBC146.14c"
FT                   /product="coatomer beta subunit (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC146.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC146.14c.1"
FT                   /db_xref="GOA:Q9UUF7"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011710"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016460"
FT                   /db_xref="InterPro:IPR029446"
FT                   /db_xref="PomBase:SPBC146.14c"
FT                   /db_xref="PomBase:SPBC146.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UUF7"
FT                   /protein_id="CAB46767.1"
FT                   /translation="MSCWTLVQQDFLEAPSVDALKTSLESKNDYVKISAMKTILRVVIN
FT                   GDSLPSILMHVIRFVMPSRNKELKKLLYYYWEVCPKYNNDGTMKQEMILACNSFRNDLQ
FT                   HPNEFIRGATLRFLCKLKEPELLDPLIPTVRQCLEHRHAYVRKNAILAVFSIYQVSNHL
FT                   IPDAASLAEDFLAAESEGTCKRNALIVLFTIDPEKAKAWLLANFEQIPSLNASSLLVII
FT                   EFIRKVVLTKADGLEKLRFQSLLVSLTATNNSSVVFEAATSVINVFPDAESLKLAASRL
FT                   LALADREADNNAKLIMLDRISQLAARDKSILEDLITDVIPFLSSSDFDVCEKAISIIMG
FT                   LVSSRNVEDILNHFQKELTKSNGETEKDDGRRRALTKAIHSCAINFPHTAATAIQYLLS
FT                   HISDFQSKSASSVLSFIKEVMEKFPDLRSSNITKLLLSLKELRAGKIFRGVIWIAGEYC
FT                   LTEDDIRVAWKSIRASLGEVPILASEEQLLKDVSNVPEDDLLIDISAPASTSRKVLPDG
FT                   TYATESAVTSEALSAARLEAVKASKKPPLRTQILSGDYYLAAVLASALTKLVMRFARLS
FT                   FDKERLNALKAEACLIMTSIIRVGQSKFVKYTIDDDSVERIMNCIRAIYSFEELPEFQT
FT                   VFLDDMRKAFSSLVAQSDKRQKEADLLVNGSDAVQADELLNIRQFQRVIEEKQDLNFES
FT                   DIIQATNDGMVVEDLASKLDHIVQLAGFTDPVYCEAYVKIQQFDIILDILLVNRTDTTL
FT                   QNLSVDLATLGDLKVVERPPPMNLGPHAFKSVQATVKVSSTESAVIFGNIVYGGKASDE
FT                   DKIVVLNGIPVNIIDYIKPAFIPESQFRSMWTEFEWENKVDISSNEDISLYDFLHKIMK
FT                   KTNMNCLTPDASLRGDCGFLSANLYACSIFGEDALMSLSVEKSVSGPISGHVRIRSKTQ
FT                   GIALSLGAFV"
FT   5'UTR           complement(1031939..1032159)
FT                   /gene="sec26"
FT                   /gene_synonym="SPBC337.01c"
FT                   /locus_tag="SPBC146.14c"
FT   misc_RNA        1032324..1032771
FT                   /gene="prl42"
FT                   /locus_tag="SPNCRNA.42"
FT                   /product="non-coding RNA, poly(A)-bearing (predicted)"
FT   3'UTR           complement(1032557..1032856)
FT                   /locus_tag="SPBC337.02c"
FT   CDS_pept        complement(join(1032857..1033607,1033610..1033776))
FT                   /transl_table=1
FT                   /locus_tag="SPBC337.02c"
FT                   /product="cell surface glycoprotein (predicted), DUF1773
FT                   family protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.02c.1"
FT                   /db_xref="GOA:G2TRS9"
FT                   /db_xref="InterPro:IPR013902"
FT                   /db_xref="PomBase:SPBC337.02c"
FT                   /db_xref="PomBase:SPBC337.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:G2TRS9"
FT                   /protein_id="CAO77661.2"
FT                   /translation="MMSNENFDNDYNLPPPNDSAEDLKIFIERYERSVDSTLLEIDENK
FT                   REALEKNILRKDRKMKYEIECNERLQGWKKLAIEREISEEQSGEVQFPRWIDEWANTKL
FT                   GGIFERIFSKMDSMQNDMNSRFDAMQNEMTSMKGEMAEMKVEMVEMKRETIRLNTRIDL
FT                   LEQKTEARFQSIEQRFNSIDQRFDSMEQRLDSMDQKMETIDARSCRSIMLTRKLENATR
FT                   SDQGYLASPVPFLNGNEPVSSGLPPIERVEDIDELSKEQCVQYLKGYGITFSPAETIKL
FT                   KKRLRDTVGLWSKASTEYEFHQFH"
FT   repeat_region   complement(1034420..1034731)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        complement(1034934..1036091)
FT                   /locus_tag="SPNCRNA.1406"
FT                   /product="antisense RNA (predicted)"
FT   CDS_pept        join(1035538..1035685,1035734..1035834,1035903..1036097,
FT                   1036145..1036864)
FT                   /transl_table=1
FT                   /locus_tag="SPBC337.03"
FT                   /product="RNA polymerase II transcription termination
FT                   factor (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.03.1"
FT                   /db_xref="GOA:O74814"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR006903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="PomBase:SPBC337.03"
FT                   /db_xref="PomBase:SPBC337.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74814"
FT                   /protein_id="CAA21273.1"
FT                   /translation="MALTPDTVSSKLATLNETQESITGIAHWVMFHKRYADEIVQIWLE
FT                   ALYESSSNKKLLLLYLLNEVVQQSRVKKISEYIDAVSPYVVNSVADAYASVPASIKTKI
FT                   KYVFDVWCQRGIFSKEILLSLQERFNNAENSGHSNYYPVGPPEWAPYTRLMTQTSLYAK
FT                   SAHSTKTVVDALYKSYLEKQSDYSELLDNYKKQLNKASESCKGNYQACIESRSTLITSL
FT                   ESLIEEQKKLLSEEEESLKSVESIISNLENKESTTATSTLTDAGFGDKSSTAGKHNVET
FT                   TSPPSSSPNSDDAYSPQVDSYSPSINSVPYTSNIVENPSEDNLSPLPPPASGPYSQEEE
FT                   ETSLFKSQRKEENEEESKELPEDSDIYGKDSSPSSDDSSAAGLYGDS"
FT   CDS_pept        join(1037077..1037782,1037850..1038385)
FT                   /transl_table=1
FT                   /gene="ppk27"
FT                   /locus_tag="SPBC337.04"
FT                   /product="serine/threonine protein kinase Ppk27
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.04"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.04.1"
FT                   /db_xref="GOA:O74815"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PomBase:SPBC337.04"
FT                   /db_xref="PomBase:SPBC337.04.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74815"
FT                   /protein_id="CAA21274.1"
FT                   /translation="MSEKKHSCEEKSLQLYPLSNKIRHVNPNISALPSETDISESLTND
FT                   LTKLEISNYAPFNRDLETFSDLIFGLTNIQKKSLYSLQLGRSRGYALYSDENEKYLWSI
FT                   NTKITSTEQREVLLVKSNNKKFDTSIVLKHTHLSSKSQNEKKARVKVFRQEIWALKTLS
FT                   HPCVVQLLNYYVSSAELILVENYCMGGDLYHYTKKHHSDFSLEFVGRIFSELVHTVAYL
FT                   HSKCLIHRDLKLENILLTQPYNVIKTIDNWKNYPNALIQISDFELSIFVDSKNHLVQSS
FT                   CGSQEYAPPEVYMGIAHDGFRADAWSLGIVLFALLEGRLPFDSYPTLDPENVRIKRYVQ
FT                   RLVRCDYTWHLCKSPFKRSTGNTNDNDDPSWRFRLFVKKLLKNRDQRSTPTELLKDFNK
FT                   HGNFTLPLLENVTI"
FT   3'UTR           complement(1038462..1038546)
FT                   /gene="cct8"
FT                   /locus_tag="SPBC337.05c"
FT   CDS_pept        complement(join(1038547..1039902,1040189..1040310,
FT                   1040363..1040402,1040456..1040578))
FT                   /transl_table=1
FT                   /gene="cct8"
FT                   /locus_tag="SPBC337.05c"
FT                   /product="chaperonin-containing T-complex theta subunit
FT                   Cct8"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.05c.1"
FT                   /db_xref="GOA:P78921"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="PomBase:SPBC337.05c"
FT                   /db_xref="PomBase:SPBC337.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78921"
FT                   /protein_id="CAA21275.1"
FT                   /translation="MALRVPKASGPQLFREGYRIMQGVEDAVIRNCNAIRELSEITRTS
FT                   LGPNGKNKIVVNHLQQTFLTNDAATIIRELEVIHPAAKLVVDATQQQENELGDAANFVV
FT                   VFTGELLAKAENMIRMGLTPLEIAKGYEMALSHTMEVLEEICADKIETVESEKELIKAI
FT                   RTCISSKQYGNEDFLSDLVAKAILTVLPKDPSKFNVDNIRVVKIMGSSLYNSQVVKGMV
FT                   FPREPEGTVTRSKEAKVAVFSCPLDISQTETKGTVLLHNAQEMLDFSKGEENLIESHIK
FT                   EIYDAGVRVVVTSGNVNDLVLHYLNRFEILVIRVPSKFELRRLCRVVGATPLARMGVPM
FT                   PEEMGSVDVVETIEIGGDRVTVFRQVEDITRTATIVLRGATKTYLDDLERAIDDGVNIV
FT                   KALVKDNRLIFGAGASDMQLCIRLISVGEKTPGIYQHAIKQYGEAFEVVPRTISENAGL
FT                   DPTDVISKLYAAHHKENGESIGVDVECENDGTLDAKEAGIFDVLLAKKSAIRLATETVL
FT                   TVLNVDQVVMSKPAGGPKPPGPNPHWDDD"
FT   intron          complement(1039903..1040188)
FT                   /gene="cct8"
FT                   /locus_tag="SPBC337.05c"
FT   intron          complement(1040311..1040362)
FT                   /gene="cct8"
FT                   /locus_tag="SPBC337.05c"
FT   intron          complement(1040403..1040455)
FT                   /gene="cct8"
FT                   /locus_tag="SPBC337.05c"
FT   5'UTR           complement(1040579..1040613)
FT                   /gene="cct8"
FT                   /locus_tag="SPBC337.05c"
FT   3'UTR           complement(1040988..1041116)
FT                   /gene="cwf15"
FT                   /locus_tag="SPBC337.06c"
FT   CDS_pept        complement(join(1041117..1041899,1041959..1041973))
FT                   /transl_table=1
FT                   /gene="cwf15"
FT                   /locus_tag="SPBC337.06c"
FT                   /product="complexed with Cdc5 protein Cwf15"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.06c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.06c.1"
FT                   /db_xref="GOA:P78794"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="PDB:3JB9"
FT                   /db_xref="PomBase:SPBC337.06c"
FT                   /db_xref="PomBase:SPBC337.06c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78794"
FT                   /protein_id="CAA21276.1"
FT                   /translation="MTTAHRPQFDPARGHSEMAPTRITSSRALPAHLKLKYRQESQGTE
FT                   EEVRKQDLREALLRAEAAHFATQEHGASSEEVSQNSKLIEGFTSPSTDDKPNNDVEVDY
FT                   QELLRQTLEADEDASDSDDSVDSSNKNSEVSIKRRKTESNSQESVDSSNSESSDEESDS
FT                   EDETQQLLRELENIKQERKREQMLQEEKNRALEQEKREREIAFGNELLNKASSGSFQVK
FT                   RRWDEDVVFRNTHKGVDDTPRPGFVNDMLRSEFHKKFLARFVD"
FT   intron          complement(1041900..1041958)
FT                   /gene="cwf15"
FT                   /locus_tag="SPBC337.06c"
FT   5'UTR           complement(1041974..1042032)
FT                   /gene="cwf15"
FT                   /locus_tag="SPBC337.06c"
FT   3'UTR           complement(1042110..1042294)
FT                   /locus_tag="SPBC337.07c"
FT   CDS_pept        complement(join(1042295..1042393,1042434..1042681,
FT                   1042723..1042851,1042901..1043006,1043048..1043959))
FT                   /transl_table=1
FT                   /locus_tag="SPBC337.07c"
FT                   /product="carboxypeptidase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.07c.1"
FT                   /db_xref="GOA:O74818"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="PomBase:SPBC337.07c"
FT                   /db_xref="PomBase:SPBC337.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74818"
FT                   /protein_id="CAA21277.1"
FT                   /translation="MAYNKSLKSLVFILLASQIVFVLFLCYGKSSRELGVKWNSDIRSW
FT                   MTSYVGFNGETAAISEEQLIWAEKIPDYNEEIVVRLHLEEENNLSDILQKAQSQNLDIW
FT                   DYNFDHVDLRLKEENFDFWKSQYRSDILINNLTETLFESIVPDTTNSPFSTEAFLQAVE
FT                   NGHLNHEMFTSFTDIFFKSYQNLESINSWLRLMASLYKDLSELVPVGITAEGRTILGLK
FT                   LNGRHPSDNGEKIRNKKVIIIQGGSHAREWIGIPSVCYAAWQLLAKYDSDGHVRKLLDK
FT                   FEWIFIPVLNVDGYEYTWSNDRLWSKNRQPLNNSECFGINLDANWAFGFNGNIDPCSNE
FT                   YGGLSPFQANETMALFNLITESLSQEQKKVVGFLDVHSYSQSVLWPYAYTCDLFPPDTE
FT                   NFEELAIGLVKELHRVNSRYYTYQQACIPYDGFHKHYLPGTAIDWVYFAADVAWPFNIR
FT                   LRDMGDYGYLLPAKQIVPTAKEFFAMILYYGEFIAEYAF"
FT   5'UTR           complement(1043960..1044142)
FT                   /locus_tag="SPBC337.07c"
FT   3'UTR           complement(1044271..1044417)
FT                   /gene="ubi4"
FT                   /locus_tag="SPBC337.08c"
FT   CDS_pept        complement(1044418..1045566)
FT                   /transl_table=1
FT                   /gene="ubi4"
FT                   /locus_tag="SPBC337.08c"
FT                   /product="ubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.08c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.08c.1"
FT                   /db_xref="GOA:P0CG72"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PomBase:SPBC337.08c"
FT                   /db_xref="PomBase:SPBC337.08c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG72"
FT                   /protein_id="CAA21278.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGLF"
FT   5'UTR           complement(1045567..1046642)
FT                   /gene="ubi4"
FT                   /locus_tag="SPBC337.08c"
FT   5'UTR           1047238..1047534
FT                   /gene="erg28"
FT                   /locus_tag="SPBC337.09"
FT   CDS_pept        join(1047535..1047676,1047788..1047878,1047943..1048120)
FT                   /transl_table=1
FT                   /gene="erg28"
FT                   /locus_tag="SPBC337.09"
FT                   /product="Erg28 protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.09.1"
FT                   /db_xref="GOA:O74820"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="PomBase:SPBC337.09"
FT                   /db_xref="PomBase:SPBC337.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74820"
FT                   /protein_id="CAA21279.1"
FT                   /translation="MSQILAMLPDSLVAKWNVVVSVAALFNTVQSFLTPKLTKRVYSNT
FT                   NEVNGLQGRTFGIWTLLSAIVRFYCAYHITNPDVYFLCQCTYYLACFHFLSEWLLFRTT
FT                   NLGPGLLSPIVVSTVSIWFMAKEKASILGIAA"
FT   3'UTR           complement(1047833..1048563)
FT                   /locus_tag="SPBC337.10c"
FT   intron          1047879..1047942
FT                   /gene="erg28"
FT                   /locus_tag="SPBC337.09"
FT   3'UTR           1048121..1048402
FT                   /gene="erg28"
FT                   /locus_tag="SPBC337.09"
FT   misc_RNA        1048425..1049492
FT                   /locus_tag="SPNCRNA.1407"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   CDS_pept        complement(1048564..1049430)
FT                   /transl_table=1
FT                   /locus_tag="SPBC337.10c"
FT                   /product="anamorsin family protein, involved in iron-sulfur
FT                   cluster assembly (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.10c.1"
FT                   /db_xref="GOA:O74821"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="InterPro:IPR031838"
FT                   /db_xref="PomBase:SPBC337.10c"
FT                   /db_xref="PomBase:SPBC337.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74821"
FT                   /protein_id="CAA21280.1"
FT                   /translation="MSSSVLVLTSPGFASKEESLKKVFDLIDNGASRELQMIDRVQSQL
FT                   VNLPINRYDSVIAAIDDGAWSSTLGPILSQAFASVHPGGTLRVYSTADEADESFEMTAL
FT                   LSGWLIESKSPWILSRPNQVEAVPIKLSNKNGQSASKNKILDFLKSDKENLISGDDDQE
FT                   LIDEDELLDESAHDNVLKVPECKPEPGKKKRACKNCTCGLREMEEHESSKTSAQLEAVK
FT                   LTDTTEVDFTEKLKSKNAVSSCGNCYLGDAFRCSGCPYIGMPAFNPGDTVILAENRDKM
FT                   SWMADDI"
FT   5'UTR           complement(1049431..1049923)
FT                   /locus_tag="SPBC337.10c"
FT   5'UTR           1049981..1050314
FT                   /locus_tag="SPBC337.11"
FT   CDS_pept        1050315..1051292
FT                   /transl_table=1
FT                   /locus_tag="SPBC337.11"
FT                   /product="mitochondrial peptidase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.11.1"
FT                   /db_xref="GOA:O74822"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC337.11"
FT                   /db_xref="PomBase:SPBC337.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74822"
FT                   /protein_id="CAA21281.1"
FT                   /translation="MQYYQMMKALRMLKKPKPGCLGIEIQSVPIPQPKNGELLVKIEAA
FT                   AINPSDLMNATGGFPYTVYPRIVGRDYAGTVISGASHLVGTRVFGTSGSELSFTKDGTH
FT                   AEYCIIPEKAAVRMPSNLSFTEAASVGVPFTTAYLALSRGETKGSDIVLVVGALGAVGS
FT                   AVCQIAEDWGCKVITVSRSGSTDINTVVDPELKRVHELVEKVDVVIDTVGDPLLMKSAL
FT                   NQLGIGGRLSYISAPKQGSIEFSYDMKQIYRKNLKIIGCNSLLLSLVESNSLLKNMVAK
FT                   FEAGKYKVLNKKIAETSLTDECINSYRKLMNECSTKFVITMSTN"
FT   3'UTR           1051293..1051446
FT                   /locus_tag="SPBC337.11"
FT   5'UTR           1051557..1052079
FT                   /locus_tag="SPBC337.12"
FT   CDS_pept        join(1052080..1052122,1052339..1052368,1052414..1053471)
FT                   /transl_table=1
FT                   /locus_tag="SPBC337.12"
FT                   /product="human ZC3H3 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.12"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.12.1"
FT                   /db_xref="GOA:O74823"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="PomBase:SPBC337.12"
FT                   /db_xref="PomBase:SPBC337.12.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74823"
FT                   /protein_id="CAA21282.3"
FT                   /translation="MNEQQLLENIASLAGAINQYKNEKEPTQVLDAAKANKNTRSYPYS
FT                   VSRNYSFILNKSNRSKSTAASPPYVIPSTSSNADDANKEPEKQSTSDYVSRKNRHMQLI
FT                   KKNILEHDLQARKANLESYRAKLEKEYKTLAENKIQQRLSDGTKQLVTIDGLQYITGVS
FT                   DTKWLEFVSAKGQCPKYLYWNNKSYLLKKKRFLKEVGNSPSAVYCRYYNANGICGKGAA
FT                   CRFVHEPTRKTICPKFLNGRCNKAEDCNLSHELDPRRIPACRYFLLGKCNNPNCRYVHI
FT                   HYSENAPICFEFAKYGFCELGTSCKNQHILQCTDYAMFGSCNNPQCSLYHGAVSADVPE
FT                   QTEAPISKTAGSINPEDSGSEIGSNSLESNLDFISV"
FT   3'UTR           1053472..1053615
FT                   /locus_tag="SPBC337.12"
FT   3'UTR           complement(1053622..1053777)
FT                   /gene="gtr1"
FT                   /locus_tag="SPBC337.13c"
FT   CDS_pept        complement(1053778..1054704)
FT                   /transl_table=1
FT                   /gene="gtr1"
FT                   /locus_tag="SPBC337.13c"
FT                   /product="Gtr1/RagA G protein Gtr1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.13c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.13c.1"
FT                   /db_xref="GOA:O74824"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039397"
FT                   /db_xref="PomBase:SPBC337.13c"
FT                   /db_xref="PomBase:SPBC337.13c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74824"
FT                   /protein_id="CAA21283.1"
FT                   /translation="MRKKVLLMGRSGSGKSSMRSIVFSNYVAKDTRRLGATIDIEHSHV
FT                   RFLGNLVLNLWDCGGQEAFMENYLSAQRDHIFRNVQVLIYVFDVESREFERDLVTFRNC
FT                   LEATVANSPQARVFCLIHKMDLVQEDLRDLVFEERKAILLETSKDLETTCLATSIWDET
FT                   LFKAWSAIVYTLIPNTPTLESHLREFAKAAEAAEVILFERTTFLVISSYSSESNPATDA
FT                   HRFEKISNIVKQFKLSCSKMQAQFTTFELRGGNFSAFIVPYTEDTYILVVIADPEIESA
FT                   VTLMNIQSARRFIEASKSASDGIQLQP"
FT   5'UTR           complement(1054705..1054973)
FT                   /gene="gtr1"
FT                   /locus_tag="SPBC337.13c"
FT   5'UTR           1055529..1055661
FT                   /gene="rpb4"
FT                   /locus_tag="SPBC337.14"
FT   CDS_pept        join(1055662..1055713,1055752..1055857,1055903..1055980,
FT                   1056055..1056226)
FT                   /transl_table=1
FT                   /gene="rpb4"
FT                   /locus_tag="SPBC337.14"
FT                   /product="DNA-directed RNA polymerase II complex subunit
FT                   Rpb4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.14"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.14.1"
FT                   /db_xref="GOA:O74825"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="PDB:3H0G"
FT                   /db_xref="PDB:5U0S"
FT                   /db_xref="PomBase:SPBC337.14"
FT                   /db_xref="PomBase:SPBC337.14.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74825"
FT                   /protein_id="CAA21284.1"
FT                   /translation="MPRAIFEEDAAQLKLGPEFENEDMLTVSEAKILIETVLAQRARET
FT                   NGEIPMTDVMKKTVAYFNVFARFKTAEATYACERILGNRFHKFERAQLGTLCCEDAEEA
FT                   RTLIPSLANKIDDQNLQGILDELSTLRKFQD"
FT   intron          1055714..1055751
FT                   /gene="rpb4"
FT                   /locus_tag="SPBC337.14"
FT   intron          1055858..1055902
FT                   /gene="rpb4"
FT                   /locus_tag="SPBC337.14"
FT   intron          1055981..1056054
FT                   /gene="rpb4"
FT                   /locus_tag="SPBC337.14"
FT   3'UTR           1056227..1056502
FT                   /gene="rpb4"
FT                   /locus_tag="SPBC337.14"
FT   3'UTR           complement(1056491..1056624)
FT                   /gene="coq7"
FT                   /locus_tag="SPBC337.15c"
FT   CDS_pept        complement(1056625..1057275)
FT                   /transl_table=1
FT                   /gene="coq7"
FT                   /locus_tag="SPBC337.15c"
FT                   /product="ubiquinone biosynthesis protein Coq7"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.15c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.15c.1"
FT                   /db_xref="GOA:O74826"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="PomBase:SPBC337.15c"
FT                   /db_xref="PomBase:SPBC337.15c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74826"
FT                   /protein_id="CAA21285.1"
FT                   /translation="MLSRRQLIPIATKSVSPFLRSSITCRRISMGRKELSEKDSNILDS
FT                   VIRVDQAGELGANQIYKGQHFILQFTDPKVAPTIQHMWDQEKYHLATFDNYVLKNRVRP
FT                   TFLRPFWDIAGFALGAGTALLGTKAAMACTEAVETVIGGHYNDQLRETAHLENKAPEFK
FT                   EIRSHLAEFRDDELEHLNTAVEGWNAKEAPAHALLTNAIQMGCKAAIWMCKRF"
FT   5'UTR           complement(1057276..1057512)
FT                   /gene="coq7"
FT                   /locus_tag="SPBC337.15c"
FT   CDS_pept        join(1058347..1058951,1059007..1059067)
FT                   /transl_table=1
FT                   /gene="cho1"
FT                   /locus_tag="SPBC337.16"
FT                   /product="phosphatidyl-N-methylethanolamine
FT                   N-methyltransferase (predicted)"
FT                   /EC_number="2.1.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC337.16"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC337.16.1"
FT                   /db_xref="GOA:O74827"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR024960"
FT                   /db_xref="PomBase:SPBC337.16"
FT                   /db_xref="PomBase:SPBC337.16.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74827"
FT                   /protein_id="CAA21286.1"
FT                   /translation="MSLILYPKPTSYLYQPFIKAYFSLNMAIFEINNSFLICAVSIALN
FT                   PLLWNIAARSEYNHKTLTKLANGDSKKACYMLAACIFVAGIVRDLIYQNALKQQPTLGI
FT                   FMNPLVQGIAKLIFCFGSVLVLSSMYKLGLVGTYLGDYFGFLLPERVSGFPFNVNDNPM
FT                   YNGSTLCFLSTALRYGKVAGLLLTLEVFFVYRIALKFEEPFTAKIYAARDSKQAKKSE"
FT   intron          1058952..1059006
FT                   /gene="cho1"
FT                   /locus_tag="SPBC337.16"
FT   3'UTR           1059068..1059126
FT                   /gene="cho1"
FT                   /locus_tag="SPBC337.16"
FT   3'UTR           complement(1059368..1059521)
FT                   /gene="esf1"
FT                   /gene_synonym="SPBC337.17c"
FT                   /locus_tag="SPBC1734.01c"
FT   CDS_pept        complement(1059522..1061570)
FT                   /transl_table=1
FT                   /gene="esf1"
FT                   /gene_synonym="SPBC337.17c"
FT                   /locus_tag="SPBC1734.01c"
FT                   /product="pre-rRNA processing protein Esf1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.01c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.01c.1"
FT                   /db_xref="GOA:O74828"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR039754"
FT                   /db_xref="PomBase:SPBC1734.01c"
FT                   /db_xref="PomBase:SPBC1734.01c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74828"
FT                   /protein_id="CAA21287.1"
FT                   /translation="MGKKQTKPINAKSRSESNVVADPRFQSVHSDPRFSRLKRGNFKVK
FT                   VDERFKSLKEDKDFKTTASVDRYGRPLNQDKATKEIDRLYELENEGSSSSSESSEITDN
FT                   EEVASASSKSTKSEELTDEESEDEEVYDPARGEGIISTSESSDESDAESETEAQPEISE
FT                   LAGIEPEENIPRGSETNRLAVVNMDWDNLQAVDLFVALSSFCPPGGKLLKVSIYPSEFG
FT                   KSRMAAEHVQGPPRDIFTPADNQPSSAELHEAQKFGFDNNESDQDEEDALIEEDLGNEF
FT                   DMVKLRQYQLERLRYYYAVVECDSVRTAKVIYETCDGAEYETSANIYDLRFIPDDVTFD
FT                   DDESREVCTKAPEKYEPRDFVTDALQHSKVKLSWDAEDPHRKDLIKKAFTSQDIEDLDF
FT                   SAYIASSESEDEDVDVIRSRYQKLLSGDADDFQANSNPFEDDDKLEGANGEMEVTFTSG
FT                   FDVDNNANSSEKDETTIEKYKRKAAERKQRRKELRQLKKTKDDEGEGSDVDLGFDDPFF
FT                   KDKDASRNNKKNKKGKHTQIEDPTAASKEELENLVREDENDSEQLDHFDMKSILKAEKF
FT                   KKNRKLKKKASNLEGLQEGFEADVSDPRFAALYTNHNFALDPTNPHFKRTKTVEKIMDE
FT                   SRKRRSNQLEQTQDGKPELKIKKRKAEKGDQRQELDRIVKSIKRSGK"
FT   5'UTR           complement(1061571..1061635)
FT                   /gene="esf1"
FT                   /gene_synonym="SPBC337.17c"
FT                   /locus_tag="SPBC1734.01c"
FT   3'UTR           complement(1061718..1061969)
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT   CDS_pept        complement(join(1061970..1062635,1062710..1062817,
FT                   1062874..1062941,1062996..1063162,1063219..1063274,
FT                   1063324..1063377))
FT                   /transl_table=1
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT                   /product="DNA polymerase delta subunit Cdc27"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.02c.1"
FT                   /db_xref="GOA:P30261"
FT                   /db_xref="InterPro:IPR019038"
FT                   /db_xref="InterPro:IPR041913"
FT                   /db_xref="PomBase:SPBC1734.02c"
FT                   /db_xref="PomBase:SPBC1734.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30261"
FT                   /protein_id="CAA21288.1"
FT                   /translation="MEEWRNFLDIKVINESSLVTVDNLSLQLDISSEKAQEYLNMFYQG
FT                   NDFLYPIYLIHGQPIDDEINLEIDEESQPISNFPVLQYILCDKSSLQEKQSRLKSGYKT
FT                   VIFALSSAPLSDFDELLPAVYEIREKDVLYKKEDADKYGFIFNENSVPRVLKKAPSTHS
FT                   PQLSVPSKTSTIDKTDTRSTEKTKGKDIFSNARNQKGNSSRKNKKAPLENHKEKEPLLP
FT                   KEEKLSEQAKRERDDLKNIMQLEDESVSTTSVHDSEDDNLDSNNFQLEIGTEAKSAAPD
FT                   EPQEIIKSVSGGKRRGKRKVKKYATTKDEEGFLVTKEEEVWESFSEDENISTGTSNVVR
FT                   NKPTTVNIATKKKNTAQSKPQQKSIMSFFGKK"
FT   intron          complement(1062636..1062709)
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT   intron          complement(1062818..1062873)
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT   intron          complement(1062942..1062995)
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT   intron          complement(1063163..1063218)
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT   intron          complement(1063275..1063323)
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT   5'UTR           complement(1063378..1063538)
FT                   /gene="cdc27"
FT                   /gene_synonym="SPBC337.18c"
FT                   /locus_tag="SPBC1734.02c"
FT   misc_RNA        complement(1063805..1066718)
FT                   /locus_tag="SPNCRNA.1408"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           1063950..1064199
FT                   /gene_synonym="SPBC337.19"
FT                   /locus_tag="SPBC1734.03"
FT   CDS_pept        1064200..1066401
FT                   /transl_table=1
FT                   /gene_synonym="SPBC337.19"
FT                   /locus_tag="SPBC1734.03"
FT                   /product="dihydropteroatesynthase/2-amino-4-hydroxy-6-hydro
FT                   xymethyldihydropteridinediphosphokinase/dihydroneopterin
FT                   aldolase (predicted)"
FT                   /EC_number="2.5.1.15"
FT                   /EC_number="2.7.6.3"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.03.1"
FT                   /db_xref="GOA:Q4LB35"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016261"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="PomBase:SPBC1734.03"
FT                   /db_xref="PomBase:SPBC1734.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4LB35"
FT                   /protein_id="CAA21289.2"
FT                   /translation="MKSLVNLWGIYPFIRNNSLHGFAKIPRIVSTIPRQLRFSSLRHPT
FT                   RQMDLIHDTVVVENLNTFAVVGQDQWKRKEPQPVQIDVYMRNNVQLAGEKDELKSTIHY
FT                   GIASKLLRKEIEGSFFTTPKDLVNKIASLCFEDVIDTSHVSIKLTLPKCVLRSKNGLHY
FT                   YAERERNSTSNFVDRIEFSDLELATILGIHAFERQEKQRVCLNISFANTEVEALEIARA
FT                   IAEYVEQSAFLTIEALVVNLSKYLCFTKNLDDISIKAEKPSAITFANASAVQIYRTRSY
FT                   FLQESLHKYESTKNKIAYLSFGSNIGDKFEQIQTALSMLHKIEGIRVLDVSPLYETEPM
FT                   YYKDQPSFLNGVCKIETRMSPINLLRACQSIEQEMGRIKTILKGPRCIDLDIVLYEDCV
FT                   YESEVLTIPHLGLQEREFVLRPLLALSPDLVHPYTHQPLQEALDKLPSQGIRLYSSFDN
FT                   KKIINGALTMGILNVTPDSFSDGGKVSQNNILEKAKSMVGDGASILDIGGQSTKPGADP
FT                   VSVEEELRRVIPMISLLRSSGITVPISIDTYYSKVAKLAIEAGANIINDVTGGMGDEKM
FT                   LPLAASLQVPICIMHMRGTPETMKALSIYEKDIVEEVAVELSSRVEAAVQSGVHRYNII
FT                   LDPGFGFAKTPKQSAGLLGRLHELMKKPQFKDMHWLSGPSRKGFTGYFTGDASPKDRIW
FT                   GTSACVTASVLQGVSIVRVHDTKEMSKVVGMANAIRYVP"
FT   3'UTR           1066402..1066654
FT                   /gene_synonym="SPBC337.19"
FT                   /locus_tag="SPBC1734.03"
FT   5'UTR           1066787..1067091
FT                   /gene="anp1"
FT                   /gene_synonym="SPBC337.20"
FT                   /locus_tag="SPBC1734.04"
FT   CDS_pept        1067092..1068384
FT                   /transl_table=1
FT                   /gene="anp1"
FT                   /gene_synonym="SPBC337.20"
FT                   /locus_tag="SPBC1734.04"
FT                   /product="mannosyltransferase complex subunit, Anp family
FT                   (predicted)"
FT                   /db_xref="GOA:O74745"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74745"
FT                   /protein_id="CAA21290.2"
FT                   /translation="MKANRDFGRDGGPFSITPNRFQPKSSGNPIFRQKTIRTVGIIALT
FT                   LVLFLFFHRSFFSSFGEFPSFSSTANAPNSDVQEYDLRKVMNAKFTGDYSPKEKVLICA
FT                   PLRNAAEHLNMFFGHMNNLTYPHELIDLAFLISDTDDNTLEVLKQHLDAIQNDEDESKH
FT                   FNNVLIMLKDFGAIFGQEFSDRHGFAAQGPRRKLMARARNWLLSAAIQPYHSWVYWRDV
FT                   DVETAPNTILEDLMRHDKDIIVPNVYRPLPDWLGNEQPYDLNSWAESETALQLADTLGE
FT                   DDVIVEGYAEYATWRPHLAYLRDPNGDPSVEMPLDGIGGVSIMSKAKVHLEGCEFPAFS
FT                   FEKHAETEGFGKMAKRMGFSVYGLPHYVIWHIYEPSDDDKRIMAEMERERKEREAAELE
FT                   EAKKYQTAGFTQPDDQGAEEGPLAHADDHVD"
FT   3'UTR           1068385..1069768
FT                   /gene="anp1"
FT                   /gene_synonym="SPBC337.20"
FT                   /locus_tag="SPBC1734.04"
FT   3'UTR           complement(1068961..1069109)
FT                   /gene="spf31"
FT                   /locus_tag="SPBC1734.05c"
FT   CDS_pept        complement(join(1069110..1069688,1069892..1069942))
FT                   /transl_table=1
FT                   /gene="spf31"
FT                   /locus_tag="SPBC1734.05c"
FT                   /product="DNAJ protein Spf31 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.05c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.05c.1"
FT                   /db_xref="GOA:O74746"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="PomBase:SPBC1734.05c"
FT                   /db_xref="PomBase:SPBC1734.05c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74746"
FT                   /protein_id="CAA21299.1"
FT                   /translation="MADVAKFLDRVEGSLNRGREIDRILSSFKLNAYDVLDILPGMSVD
FT                   DIRNLYRKKSLMIHPDKNRDNPKAADAFDILKKAESDLVNDKIRESLDSAYTAARNQLL
FT                   KEKKLSPNSEDVHSDQFLFDLKVRWREILIADEVARRRARQLDLANQQREQARQDEIAR
FT                   ERKRRVESEKVWEETRDNRVGNWQDFLHKTKKNNLKKKNKKPRVLG"
FT   intron          complement(1069689..1069891)
FT                   /gene="spf31"
FT                   /locus_tag="SPBC1734.05c"
FT   5'UTR           1069887..1070257
FT                   /gene="rhp18"
FT                   /locus_tag="SPBC1734.06"
FT   5'UTR           complement(1069943..1070077)
FT                   /gene="spf31"
FT                   /locus_tag="SPBC1734.05c"
FT   3'UTR           complement(join(1070188..1071344,1071385..1071570))
FT                   /locus_tag="SPBC1734.07c"
FT   CDS_pept        1070258..1071421
FT                   /transl_table=1
FT                   /gene="rhp18"
FT                   /locus_tag="SPBC1734.06"
FT                   /product="Rad18 homolog Rhp18"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.06.1"
FT                   /db_xref="GOA:O74747"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004580"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR039577"
FT                   /db_xref="PomBase:SPBC1734.06"
FT                   /db_xref="PomBase:SPBC1734.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74747"
FT                   /protein_id="CAA21300.1"
FT                   /translation="MNELDATDPSDWNQTKIPSLKGLDSSLRCLICHEYFRAPLITSCS
FT                   HTFCSFCIRDYLREHPMCPACRAPEQESRLRKNTILEEILESFKVIRPTLFEFLKVENV
FT                   PKPVLQAPETVIAQDSASGDEEWEDDLASNSSPASIAKKTSRDSKKRKREDLVHCPACS
FT                   NLVPHNQINQHLDSCLNSPSSPSSSSSPYKNKDNSKSNSLLSFKTDDDSITKRRLRSFN
FT                   SADELPLKDRVRLPKLTYALLSESKIRSKLSEMGLPTDGHKQLLQRRHAKWVTLYNSNL
FT                   DQKQPVSKRNLIRQLIDWERVQSKSIGVEKEKLGGGDWEKAYAEDFADLINRAKQSTTN
FT                   KNDSLRNTAVESSTEPSTSNGFPATSVSPPLTIDLTNSQTGSDGPQS"
FT   3'UTR           1071422..1072065
FT                   /gene="rhp18"
FT                   /locus_tag="SPBC1734.06"
FT   CDS_pept        complement(1071571..1073427)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1734.07c"
FT                   /product="TRAPP complex subunit Trs85 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.07c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.07c.1"
FT                   /db_xref="GOA:O74748"
FT                   /db_xref="InterPro:IPR024420"
FT                   /db_xref="PomBase:SPBC1734.07c"
FT                   /db_xref="PomBase:SPBC1734.07c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74748"
FT                   /protein_id="CAA21301.1"
FT                   /translation="MESNLSAKGIFQHASANASGELFQEPVTEDLEKVMQSKGLYSMEE
FT                   LCSIIQEAYAPRVSVLCSRDADEFAMRKGYPKGFWELLYPFGDRIRGKVNRRGMNGEML
FT                   TLENLNLHFVPIDALESHLSEASFPSLRSVLCERYPGLVSPEPPSDYSFGVHYKNVERW
FT                   AWTLAHEGNYQMPLPVYVRQLLTGIPITPFETFSHPVAHLVVVTSHNPSPFESLRSLIN
FT                   SIPYLSLPAFVFNDINYLFVYVHDEDQHDLELSMAIFDTMKQTFGDCGYFLRLHSQKAT
FT                   LDYEHTVPFPTSSWLSAEERLHLLSNTDTEIRLLFESDNESLRRLSSHIAFNGIVSYLD
FT                   KCVRAWDDQYASPRRGITGKLLFASRKYLSSSNASTNSNYFPSSNAYRPFSPEAYLRKL
FT                   ADYSFMLRDYSHANQIYEIASRQYENDGACLYSAASLEMIVITEHILHLKMPYMSLTNT
FT                   LRINEYMQSAMLNYLNKSFNSYYHAARCFLLLGQFLSCLPAPKVDDAANWNAGLLYSKR
FT                   LGPVGRAMIFQQTHTLFKSLSYLKTESTDPFSNKRTRKAALWCVLTADAWLRCRIPFRA
FT                   KPFVEEAKLFYGKIDWKDLKECVAALDEVEVSKQPASNIPSS"
FT   5'UTR           complement(1073428..1073608)
FT                   /locus_tag="SPBC1734.07c"
FT   repeat_region   1073869..1074074
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   5'UTR           1074057..1074398
FT                   /gene="hse1"
FT                   /locus_tag="SPBC1734.08"
FT   CDS_pept        join(1074399..1074526,1074571..1074646,1074820..1075039,
FT                   1075098..1075795)
FT                   /transl_table=1
FT                   /gene="hse1"
FT                   /locus_tag="SPBC1734.08"
FT                   /product="STAM like protein Hse1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.08.1"
FT                   /db_xref="GOA:O74749"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="PomBase:SPBC1734.08"
FT                   /db_xref="PomBase:SPBC1734.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74749"
FT                   /protein_id="CAA21302.1"
FT                   /translation="MFRGKPNSIETLILQATDEKNTKEKWDVIMDACDQLSSTSGDVGR
FT                   NSIKFLNKRLDTANANIQLLALTLTDAIVKNCKTSIVREISSRTFTDSLLKIASDSTTH
FT                   NRVRSRIAVLVNEWAEIMKKDPNMSLMQDICEKIRKLDIVDLRAPKKPEKEAMNELELK
FT                   REEEELQYALALSLSESTAQSNKVENPQSTKDEPLQKTNQRQESNLATSPASTVSRVRA
FT                   LYDFAATEQGELSFKKGDIILVLESVYKDWWKGSCKNAVGIFPVNYVQRVVEPTIEQQR
FT                   QSAHMEQQVFDALPQIDELLDTLSTTSPDAADDDALQGKYHAMIALRPKLVRLIEKYAS
FT                   QKEELMDLNERLLVARRDYEKLYEQSMSEMRNF"
FT   3'UTR           1075796..1075953
FT                   /gene="hse1"
FT                   /locus_tag="SPBC1734.08"
FT   5'UTR           1076073..1076346
FT                   /locus_tag="SPBC1734.09"
FT   3'UTR           complement(1076179..1077438)
FT                   /locus_tag="SPBC1734.10c"
FT   CDS_pept        1076347..1077297
FT                   /transl_table=1
FT                   /locus_tag="SPBC1734.09"
FT                   /product="NST UDP-N-acetylglucosamine transporter
FT                   (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.09"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.09.1"
FT                   /db_xref="GOA:O74750"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="PomBase:SPBC1734.09"
FT                   /db_xref="PomBase:SPBC1734.09.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74750"
FT                   /protein_id="CAA21303.1"
FT                   /translation="MIASALSFIFGGCCSNAYALEALVREFPSSGILITFSQFILITIE
FT                   GLIYFLLNDVQSLKHPKVPRKRWFVVVVMFFAINVLNNVALGFDISVPVHIILRSSGPL
FT                   TTMAVGRILAGKRYSSLQIGSVFILTIGVIIATLGNAKDLHLHVESMTRFGIGFTILVI
FT                   TQILGAIMGLVLENTYRIYGSDWRESLFYTHALSLPFFLFLLRPIRSQWNDLFAIHTKG
FT                   FLNLPSGVWYLCFNTLAQYFCVRGVNALGAETSALTVSVVLNVRKFVSLCLSLILFENE
FT                   MGPAVKFGALLVFGSSAVYASARSKPKTNGLKKND"
FT   3'UTR           1077298..1079446
FT                   /locus_tag="SPBC1734.09"
FT   CDS_pept        complement(join(1077439..1077966,1078448..1078918))
FT                   /transl_table=1
FT                   /locus_tag="SPBC1734.10c"
FT                   /product="mRNA processing protein (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.10c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.10c.1"
FT                   /db_xref="GOA:O74751"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="PomBase:SPBC1734.10c"
FT                   /db_xref="PomBase:SPBC1734.10c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74751"
FT                   /protein_id="CAA21304.1"
FT                   /translation="MLAEYLVHVGRVNVFLDPETKDIPKCVADLKFPLPLTLSRSTPIN
FT                   PIIRSDTIQLVISCPPVTYSDEIQVPWKAIDLNKDDAVKSTIKCKQCQSFLTSISSWKD
FT                   LPSANWMEMLDCWSCHTDYPTVLSKRGGPSMFQPTDDCAYLGTSYVLIRLQSLEGKVAY
FT                   GPNFKLHCSFCNAELGLPNNKDSSNGVRLDKSSICIDDQKIHPSFIVASEILTLRDMYA
FT                   THKFVIVDGERSIWTWCFVPHLPISFQKSPFSSIEFANSPISTIKLLYQLEVPPDFTKS
FT                   SEDWMDIPVSSHAFDEISHVLEKGNLSFPVSAQKFGPWKVGLLPKFHKQMI"
FT   misc_RNA        complement(1078083..1078182)
FT                   /locus_tag="SPNCRNA.498"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           complement(1078919..1079027)
FT                   /locus_tag="SPBC1734.10c"
FT   repeat_region   1079189..1079526
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   misc_RNA        complement(1079941..1081342)
FT                   /locus_tag="SPNCRNA.1409"
FT                   /product="intergenic RNA (predicted)"
FT   misc_RNA        1080092..1080445
FT                   /gene_synonym="SPNG1328"
FT                   /locus_tag="SPNCRNA.337"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           1080922..1081718
FT                   /gene="mas5"
FT                   /locus_tag="SPBC1734.11"
FT   CDS_pept        1081719..1082942
FT                   /transl_table=1
FT                   /gene="mas5"
FT                   /locus_tag="SPBC1734.11"
FT                   /product="DNAJ domain protein Mas5 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.11"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.11.1"
FT                   /db_xref="GOA:O74752"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="PomBase:SPBC1734.11"
FT                   /db_xref="PomBase:SPBC1734.11.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74752"
FT                   /protein_id="CAA21305.1"
FT                   /translation="MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKF
FT                   KEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGP
FT                   RKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKF
FT                   ITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQ
FT                   KIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEH
FT                   LDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQL
FT                   ALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGH
FT                   PGVQCAQQ"
FT   3'UTR           1082943..1083347
FT                   /gene="mas5"
FT                   /locus_tag="SPBC1734.11"
FT   3'UTR           complement(1083316..1083584)
FT                   /gene="alg12"
FT                   /locus_tag="SPBC1734.12c"
FT   CDS_pept        complement(join(1083585..1084081,1084127..1085111,
FT                   1085160..1085318))
FT                   /transl_table=1
FT                   /gene="alg12"
FT                   /locus_tag="SPBC1734.12c"
FT                   /product="alpha-1,6-mannosyltransferase for the addition of
FT                   the mannose to dolichol-linked Man7GlcNAc2, Alg12
FT                   (predicted)"
FT                   /db_xref="GOA:Q9USD4"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9USD4"
FT                   /protein_id="CAA21306.2"
FT                   /translation="MTSKESICWYLANILLVTCIGYYSYKTPFTKVEESFAMQAIHDIQ
FT                   TYRWDLSKYDHLEFPGAVKRSFIPSLFIAVLSYIPSWFVNPLLAARWTIGYLSWESMNS
FT                   VSCSISKRFGTLSGALFILFSCAQFHLVYYMSRPLSNIFGLIATNHSLSLLLKNNYYGS
FT                   ISILVFAAAIVRSEIALLLMCLILPLLLQRRITLSKLLLVGISSSLAAVGASFLIDSYF
FT                   WGAWCWPELEAFLFNVVEGKSSDWGTSPFYYYFVRLPWLFLNPTTLLFLLISFVYIKPA
FT                   RLLIYVPLFFIFVYSFLGHKEWRFIIYSIPWFNAASAIGASLCFNASKFGKKIFEILRL
FT                   MFFSGIIFGFIGSSFLLYVFQYAYPGGLALTRLYEIENHPQVSVHMDVYPCMTGITRFS
FT                   QLPSWYYDKTEDPKMLSNSLFISQFDYLITEDPESYNDTFDVIESVNSNTKIPILPKWL
FT                   SNHIPREISIRNPAQPVYILANKKARATKPAAVDDYSSFIGHKVDEIKLWPPIYRVVSP
FT                   DTLLTRDYREDRLNFFIDKDRILTHITQG"
FT   intron          complement(1085112..1085159)
FT                   /gene="alg12"
FT                   /locus_tag="SPBC1734.12c"
FT   5'UTR           complement(1085319..1085370)
FT                   /gene="alg12"
FT                   /locus_tag="SPBC1734.12c"
FT   5'UTR           1085836..1085935
FT                   /gene="atp3"
FT                   /locus_tag="SPBC1734.13"
FT   CDS_pept        join(1085936..1086015,1086095..1086920)
FT                   /transl_table=1
FT                   /gene="atp3"
FT                   /locus_tag="SPBC1734.13"
FT                   /product="F1-ATPase gamma subunit (predicted)"
FT                   /db_xref="GOA:O74754"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74754"
FT                   /protein_id="CAA21307.1"
FT                   /translation="MLRQTLTQASRMRPCISVVGFRGFHASSPCEATLKEIEQRLKSIK
FT                   NIEKITKTIKTVAQTKLTRAQRAMEASNKYYRVSDEVFKEAGTKAPEEGKTLMVACSSD
FT                   KGLCGGIHSSISRLIRRELHDPKTFENTSLCILGEKVRTQLLRFCPESFYLTFAHIGGA
FT                   SPSFEEALQISSNILEHAKDYDRIVLVYNKFASAVSFETVMKNLYTTKAINESPNLSAY
FT                   EVSDEVHQPLMEFAFANAIFSAMAEAHCSEMSSRRNAMENASKSAGDMINKFSIQYNRQ
FT                   RQASITNELIDIVTGANSLA"
FT   misc_RNA        complement(1086637..1087413)
FT                   /gene_synonym="SPNG2AF35"
FT                   /locus_tag="SPNCRNA.567"
FT                   /product="antisense RNA (predicted)"
FT   3'UTR           1086921..1087137
FT                   /gene="atp3"
FT                   /locus_tag="SPBC1734.13"
FT   3'UTR           complement(1087538..1088270)
FT                   /gene="suc1"
FT                   /locus_tag="SPBC1734.14c"
FT   CDS_pept        complement(join(1088271..1088378,1088430..1088574,
FT                   1088690..1088778))
FT                   /transl_table=1
FT                   /gene="suc1"
FT                   /locus_tag="SPBC1734.14c"
FT                   /product="cyclin-dependent protein kinase regulatory
FT                   subunit Suc1"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.14c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.14c.1"
FT                   /db_xref="GOA:P08463"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="InterPro:IPR036858"
FT                   /db_xref="PDB:1PUC"
FT                   /db_xref="PDB:1SCE"
FT                   /db_xref="PomBase:SPBC1734.14c"
FT                   /db_xref="PomBase:SPBC1734.14c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08463"
FT                   /protein_id="CAA21308.1"
FT                   /translation="MSKSGVPRLLTASERERLEPFIDQIHYSPRYADDEYEYRHVMLPK
FT                   AMLKAIPTDYFNPETGTLRILQEEEWRGLGITQSLGWEMYEVHVPEPHILLFKREKDYQ
FT                   MKFSQQRGG"
FT   5'UTR           complement(1088779..1088852)
FT                   /gene="suc1"
FT                   /locus_tag="SPBC1734.14c"
FT   5'UTR           1088957..1089187
FT                   /gene="rsc4"
FT                   /gene_synonym="brd1"
FT                   /locus_tag="SPBC1734.15"
FT   3'UTR           complement(1089163..1091097)
FT                   /gene="pst3"
FT                   /locus_tag="SPBC1734.16c"
FT   CDS_pept        join(1089188..1089190,1089239..1089321,1089382..1090924)
FT                   /transl_table=1
FT                   /gene="rsc4"
FT                   /gene_synonym="brd1"
FT                   /locus_tag="SPBC1734.15"
FT                   /product="RSC complex subunit Rsc4"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.15"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.15.1"
FT                   /db_xref="GOA:Q09948"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR027180"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037382"
FT                   /db_xref="PomBase:SPBC1734.15"
FT                   /db_xref="PomBase:SPBC1734.15.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q09948"
FT                   /protein_id="CAA21309.1"
FT                   /translation="MVDDSHNAPFDKTKFDEVLEALVGLKDNEGNPFDDIFEELPSKRY
FT                   FPDYYQIIQKPICYKMMRNKAKTGKYLSMGDFYDDIRLMVSNAQTYNMPGSLVYECSVL
FT                   IANTANSLESKDGTLNEEENEEMESSINEEHKPGTNEIDVPKVIQNILDALHEEKDEQG
FT                   RFLIDIFIDLPSKRLYPDYYEIIKSPMTIKMLEKRFKKGEYTTLESFVKDLNQMFINAK
FT                   TYNAPGSFVYEDAEKLSQLSSSLISSFSEQPKEHSPATSKHEPEETPASPTPSVSASTS
FT                   RERSTSVAPSFITSDQAATPDVLKSEEAHVESFSKESEKDQTPIPEDVPSPMDTLSQAN
FT                   YGAFALIKSFPSTPVPDFLNFSHKSVMGRSTFNMPNFPEPKFFEDIPNTERCILSAFIC
FT                   SPPQLPLPNPLRMYLPCPSLNSTEVSVITLAPQHSFLNIVINLNPALALKSYTIITLLN
FT                   GKRLGAGVSTPPSTLYALEGIKHTEEPIRTVYEAKLSVGLNCLEFVLGSTEPVEPPSIE
FT                   PGLPASAYSRTVERERFVLMAYVQP"
FT   3'UTR           1090925..1091034
FT                   /gene="rsc4"
FT                   /gene_synonym="brd1"
FT                   /locus_tag="SPBC1734.15"
FT   CDS_pept        complement(join(1091098..1094516,1094608..1094653))
FT                   /transl_table=1
FT                   /gene="pst3"
FT                   /locus_tag="SPBC1734.16c"
FT                   /product="SIN3 family co-repressor Pst3"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1734.16c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1734.16c.1"
FT                   /db_xref="GOA:O74755"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="InterPro:IPR031693"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="PomBase:SPBC1734.16c"
FT                   /db_xref="PomBase:SPBC1734.16c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74755"
FT                   /protein_id="CAA21310.1"
FT                   /translation="MDVMNVPVDSERDNPGDKVETQSDKNHLPKASPSQSQSPVNTSLH
FT                   NGDGKDNGVATEPVENKQILSERSVTRDDYEKGKTIVSSLALSSISGKDGSISSQNAEG
FT                   LSSSSNRPLDVNDALSYLELVKYYFSERREIYNRFLEIMRDFKSQALDTLGVINRVSEL
FT                   FNGYPQLIEGFNTFLPSGYKIEVQLDSSNTSVVRVGTPMHPLPQQGVQSTLPVAPSNED
FT                   QRTMESTSPTDSQPQPSAPNLVSSTENEKPRVDFNYAIAYMNKVKARYPPNSDTYMEFL
FT                   GVLRTYQKAQKSIFEVRARVAEIFKDSPDLLEEFKLFLPDNVDSTEPSTPNVQKSPNRL
FT                   PPVGNFSLPPSAPVREKRNRPAHSAQISRSISKTSRMYRQTAEEPLNSYSLHVYPQKIT
FT                   APTSPYAATQEELLAFTTIRQHLPDTLAFHKFLELLHLYREKLLDKTELLNSFSKLVRN
FT                   DNLTLWFSEFIRWSDNPILVKNEPVDERVYLPETFECISLTYRKLPDSWKQDKCSGRDD
FT                   LDNSVLNDDYISVAPKPSHVKNIMHHENQYLQALQLVEDERYDYDRVLNTTESAIKILA
FT                   NFCEPTIHEHLETALQELERSKRIIKNALIIVYGKEHANLALDTLFKKLPTAAPVLLKR
FT                   IKTKDQEWRRSKREWSKIWRQIEKKNAQAAFDDRYCRIEGRDRRGLSYSRILRDIDDIY
FT                   QRQKHRIDGAKLGFQFTQVLCDSLIFLNILRLSDAQLTNSSFYSYADKGRISAVLKALL
FT                   SQFFGIPLPREALETNLASENIESVKKHRDGLSKIFIRPESADNSNNTNVSFQTDETQT
FT                   EDETMSDIHPDDVENHSKSKFLGEESKNIIGYNFFGNATMYVLFRLICVCYSRLEHIKL
FT                   FVESSTIYASSTGGYENILNICEKYLKGSCSRLEFRKYLQKFNNETCYMICSIERLLKV
FT                   IFYRIHEILLDPKLGQLLLLFESDGANSVTTPREQMVYRNHVESILAPESKIFNMRWYP
FT                   LEKRLCIQQLLPADLTMHDFENPAKAFMYYVDSYAISHITEGVDLMQVKMPFLRRSLQR
FT                   ISQQGYLAGRGSGRLHSLFNEHFCKSNLQLFFSTDTYVIFFEPNTENVYINSYNLWVDQ
FT                   SSQSKKQNRTTNWRRWLESDEGWRKSKANTDIKFFSETTLDQCIEAM"
FT   5'UTR           complement(1094654..1094818)
FT                   /gene="pst3"
FT                   /locus_tag="SPBC1734.16c"
FT   misc_RNA        complement(1094760..1096264)
FT                   /locus_tag="SPNCRNA.1410"
FT                   /product="antisense RNA (predicted), possible alternative
FT                   UTR"
FT   5'UTR           1095163..1095357
FT                   /gene="chs2"
FT                   /gene_synonym="SPBC1734.17"
FT                   /locus_tag="SPBC1709.01"
FT   CDS_pept        join(1095358..1097357,1097405..1098185)
FT                   /transl_table=1
FT                   /gene="chs2"
FT                   /gene_synonym="SPBC1734.17"
FT                   /locus_tag="SPBC1709.01"
FT                   /product="chitin synthase homolog Chs2"
FT                   /db_xref="GOA:O74756"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74756"
FT                   /protein_id="CAA21311.1"
FT                   /translation="MSFQNPSYINAKHRSFLQPKDTQDSQDLRNWVSHSSVDEETAYSS
FT                   STLSSSSSKSFPCYDEYDEIKSPDDQKVEYMKTLRTLEEDAFSYTDSVYDFEERSFDEH
FT                   EPPIPPLHKTGVFSVPLQPTHTVNSNSDDGYENSSKNEYLDFNSEISASPVNEPMTHSQ
FT                   SYTSIDRLNSSSSHYSKDVPLLCGSLTIDCPTPIDLRGMLGPFMQKNPDEASFLRYSAI
FT                   TCQPEDMNNNGLQLRTWSTGRDIQIAVCLTLSDEDLASFAISLSSIMNNLKHLCSRSKS
FT                   RVWGNESWEKVLVCVVIDGRNTVHQNVLDLLASIGVYQPHIAKGRVNGKRTLSHMYEFT
FT                   STINVDEKLNLTTATGDGNVPMQMLLCVKDRRLGTYNSHRWFLNGIASLARPKVCLFVR
FT                   NGARLGPTSIYHAWKAFDVDSTIGGMCGKTSIDTGKFGFRLLNPFIASQHFDQMIHNNL
FT                   RLPYDSCMGYISNALNAIYGFRYVALQDSYPNPGPLADYFEQDQYEIPRRGILQSNAFL
FT                   AQEQLLFWKVITRKDAKWHLQYVPEACATIEAPNSMAGILESKKSEINSSFSLAVYVIV
FT                   DFFSLWTTRHKFFRFLLLTVQSLVFAIEKLVNFFSMANFFLAFYFVCNATSYSSLNPYG
FT                   NWARPLFLVFEYILICLIFSQFMLAMGNRPRSCRVLLFISTALFSIIMIYFVFCVFYIS
FT                   LIPLHNSDNSEIVLGNNYFTTLIFSSLLILACYAFVSLICMDPFFIFTCIVQYILLMPT
FT                   RIYTEQIYALCHLDDASISKDDNQQEFNFDTGITHCSMNDEGYTTISIPKANVLNSVYN
FT                   SSLKNFSSSNDTSVYHDVQDHCYRKPQSYEDHYQDIRTRYVLVWAVSNLILAIVLIQVF
FT                   DGMRFINNGYMKYIFWSIVAFTAWKTMGAVTFIATKIISRIANCVKSKLYIFNDP"
FT   3'UTR           1098186..1098228
FT                   /gene="chs2"
FT                   /gene_synonym="SPBC1734.17"
FT                   /locus_tag="SPBC1709.01"
FT   3'UTR           complement(1098188..1098299)
FT                   /gene="vrs1"
FT                   /gene_synonym="vas1"
FT                   /gene_synonym="SPBC1734.18c"
FT                   /gene_synonym="ValRS1"
FT                   /locus_tag="SPBC1709.02c"
FT   CDS_pept        complement(join(1098300..1101080,1101212..1101285,
FT                   1101345..1101396,1101437..1101472))
FT                   /transl_table=1
FT                   /gene="vrs1"
FT                   /gene_synonym="vas1"
FT                   /gene_synonym="SPBC1734.18c"
FT                   /gene_synonym="ValRS1"
FT                   /locus_tag="SPBC1709.02c"
FT                   /product="cytoplasmic valine-tRNA ligase Vrs1/Vas1"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.02c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.02c.1"
FT                   /db_xref="GOA:O75005"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="PomBase:SPBC1709.02c"
FT                   /db_xref="PomBase:SPBC1709.02c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75005"
FT                   /protein_id="CAA21312.1"
FT                   /translation="MADKGCEAAQSKDSSAPGSGEPRPKTEKELERERQKAAKLEKYHA
FT                   KLAAKKAKEEARKPKLDKKAKIASPVAEYVEKTTPGEKKVLQDLDSPALKSYNPKAVES
FT                   AWYDWWVKSGFFEPEFGPDGKPKKEGVFVITSPPPNVTGALHIGHALTIAIQDSLARWN
FT                   RMLGKTVLFLGGFDHAGLSTQSVVEKKLWYTQKKTRHDYPRDKFVDIVWEWKEEYHNRI
FT                   KNQMSRLGGSFDWTREAFTMDENLSRAVVETFVRLHEENIIYRANRLVNWCTALQTTLS
FT                   NLEVENVDVPGRTLLKVPGYDEPVEVGVLTSIAYAVEGSDERIVIATTRPETLLGDTAV
FT                   AVHPQDPRYKHLHGKFVKHPFCNRSIPIICDDIIVDMEFGTGAVKITPAHDPNDYEVGK
FT                   RHNLEFINIFTDDGLLNENCGEFAGMKRFTARVKVVERLKELGLFVGTKENPMVIPLCG
FT                   KTSDIIEPVMKPQWWVNQKEMAAAAAEVVKSGEIEIAPDMSRREFIRWMENIQDWCISR
FT                   QLWWGHRIPAYFVNLADEPSQDRSEGRYWVTGRTLEQAEEKAKAAFPGKSFTLEQDEDV
FT                   LDTWFSSGLWPFSTLGWPKDTSDYENFYPTTLMETGWDILFFWIARMVMLGLKLTGKIP
FT                   FKRVFCHALVRDAQGRKMSKSLGNVVDPIDVIEGISLQALHDKLLVGNLDSREVEKAKK
FT                   GQRLSYPKGIPQCGTDALRFTLCSLTTGGRDLNLDILRVEGYRKFCNKLYNATKFALGR
FT                   LGSNFVPNKTADLTGNESLVEKWIFHRLNIAAAAMNKNMEEMNFLQATSAVHQFWLYEL
FT                   CDVYIENSKYLLSDGTEVQQESAKQTLYTVLDNALRLMHPFMPYVTEEMWQRLPRRPGD
FT                   KTQTIVKAAFPVERVDYSNEIAAKYYESIITVVHSTRSMMAENGIKSDAVVYIHPDEEH
FT                   SKLITSESASIQSLIKKCKTLSIVDNTFDSDKCVKNEVLEGSTIFLERNN"
FT   5'UTR           complement(1101473..1101503)
FT                   /gene="vrs1"
FT                   /gene_synonym="vas1"
FT                   /gene_synonym="SPBC1734.18c"
FT                   /gene_synonym="ValRS1"
FT                   /locus_tag="SPBC1709.02c"
FT   5'UTR           1102238..1102313
FT                   /locus_tag="SPBC1709.03"
FT   CDS_pept        join(1102314..1102374,1102420..1103075,1103114..1103683)
FT                   /transl_table=1
FT                   /locus_tag="SPBC1709.03"
FT                   /product="conserved fungal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.03"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.03.1"
FT                   /db_xref="GOA:O74728"
FT                   /db_xref="InterPro:IPR024382"
FT                   /db_xref="PomBase:SPBC1709.03"
FT                   /db_xref="PomBase:SPBC1709.03.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74728"
FT                   /protein_id="CAA21242.2"
FT                   /translation="MSLLRYFIFFIGGCTLALASGVSYTEASVYMSGLSGNENEVPSIS
FT                   PSDSRLVFAHKLGVSRFHKLKSHSGARKIINEMLHSHSELSSFFYAEKSNTFLTIAGLA
FT                   ESELFDTLNPAFRISSCPSSNAFASLMCRYERQLDSLDNGKTTDIYLNDIGGVISIHDS
FT                   TGVYSQITTTPYKSLEDYEQLFGEDKASMFDISVKQDRVFLSEIYALKILVEFLSSKSQ
FT                   QERSDTSIVIGQLVGLEALYEKYGKDSKIYQVARENMMTLLSMIKQVSSTYTFILLPPI
FT                   DSSETSTRYHKRQVDMEAFGEEIEEVVASYEKNYNGRCYISEEACSKATNDCSGHGRCS
FT                   KYGQLDSCYVCQCSNSVVSNAAGQNKTIRWAGESCSKQDISVEFQFFFWFTIIGFGLLI
FT                   FSIMLLFSIGQEELANVLTSTATVIKKTT"
FT   3'UTR           complement(1103600..1103769)
FT                   /gene="cyp3"
FT                   /locus_tag="SPBC1709.04c"
FT   3'UTR           1103684..1103802
FT                   /locus_tag="SPBC1709.03"
FT   CDS_pept        complement(join(1103770..1104063,1104141..1104208,
FT                   1104260..1104306,1104359..1104376,1104461..1104525,
FT                   1104578..1104607))
FT                   /transl_table=1
FT                   /gene="cyp3"
FT                   /locus_tag="SPBC1709.04c"
FT                   /product="cyclophilin family peptidyl-prolyl cis-trans
FT                   isomerase Cyp3"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.04c"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.04c.1"
FT                   /db_xref="GOA:O74729"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PomBase:SPBC1709.04c"
FT                   /db_xref="PomBase:SPBC1709.04c.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74729"
FT                   /protein_id="CAA21243.1"
FT                   /translation="MSTEPVVFMDIAIDGRLLGRIKIRLFSSIVPKTAENFRQFCTGET
FT                   LGVNQKPIGYKNSTFHRIIQGFMIQGGDFVSGDGTGSATIFNSRTFPDENFTLKHDRPG
FT                   LLSMANAGKDSNGCQFFITTVPCDFLDGKHVVFGEVIEGYDIVKEIESTPVGANSRPKS
FT                   NVAIVECGEM"
FT   misc_RNA        1104134..1104949
FT                   /locus_tag="SPNCRNA.1411"
FT                   /product="antisense RNA (predicted)"
FT   5'UTR           complement(1104608..1105088)
FT                   /gene="cyp3"
FT                   /locus_tag="SPBC1709.04c"
FT   misc_RNA        1104933..1105933
FT                   /gene_synonym="SPNG1332"
FT                   /locus_tag="SPNCRNA.338"
FT                   /product="non-coding RNA (predicted)"
FT   5'UTR           1106347..1106455
FT                   /gene="sks2"
FT                   /gene_synonym="hsc1"
FT                   /locus_tag="SPBC1709.05"
FT   CDS_pept        1106456..1108297
FT                   /transl_table=1
FT                   /gene="sks2"
FT                   /gene_synonym="hsc1"
FT                   /locus_tag="SPBC1709.05"
FT                   /product="heat shock protein, ribosome associated molecular
FT                   chaperone Sks2"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.05"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.05.1"
FT                   /db_xref="GOA:Q10284"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="PomBase:SPBC1709.05"
FT                   /db_xref="PomBase:SPBC1709.05.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10284"
FT                   /protein_id="CAA21244.1"
FT                   /translation="MSEVYEGAIGIDLGTTYSCVAVWETANVEIIPNDQGARTTPSFVA
FT                   FTETERLVGDAAKNQAAMNPRNTVFDAKRLIGRRYEDPETQKDIKHWPFKVIDNNGIPT
FT                   IEVNYLGEKKQFTAQEISAMVLTKMKEISEAKLNKRVEKAVITVPAYFSDSQRAATKDA
FT                   GAIAGLNVLRIINEPTAAAIAYGLDAKSDKPKNVLIFDLGGGTFDVSLLKIQGGVFEVL
FT                   ATAGDTHLGGEDFDNALVEHFIQEFKRKQKIDISDDPRALRRLRSACERAKRALSSVTQ
FT                   TTVEVDSLSNGIDFSSSITRARFEDINATTFKATIDPVAKVLKDSKVPKADVHDIVLVG
FT                   GSTRIPKVQRLVSDFFDGRALNKSINPDEAVAYGAAVQAAVLTNKADSDKTQDLLLLDV
FT                   VPLSLGVAMEGNVFGVVCPRNTPIPTIKKRTFTTVADNQTTVTFPVYQGERVNCAENEP
FT                   LGEFQLTGIPPMPRGQAELEATFELDANGILKVTAVEKTTGRSAHIEITNSVGHLSSTK
FT                   IQEMIENADKFKQQDKDFAKKLEAKSQLESYISNIETTISEPNVMMKLKRGDKSKIEAQ
FT                   LAECMSQLELEDTNTDALRKAELRLKRTVQKAFASLR"
FT   3'UTR           1108298..1108511
FT                   /gene="sks2"
FT                   /gene_synonym="hsc1"
FT                   /locus_tag="SPBC1709.05"
FT   5'UTR           1108615..1108727
FT                   /gene="dus2"
FT                   /locus_tag="SPBC1709.06"
FT   CDS_pept        join(1108728..1108896,1109135..1109784,1109826..1110446)
FT                   /transl_table=1
FT                   /gene="dus2"
FT                   /locus_tag="SPBC1709.06"
FT                   /product="tRNA dihydrouridine synthase Dus2 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.06"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.06.1"
FT                   /db_xref="GOA:O74731"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="PomBase:SPBC1709.06"
FT                   /db_xref="PomBase:SPBC1709.06.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74731"
FT                   /protein_id="CAA21245.1"
FT                   /translation="MGLLNYSNKVCLAPMVRIGELPMRLLALRYGANLVWGPEIVDKAL
FT                   LSGTPVERVVNDRINCIDFVKPPSNKVLFRVHPLEANRLIFQLGSASPELAVEAAKLVA
FT                   NDVAGIDLNCGCPKHFSVHAGMGAGLLKNQDRLVSILDALVNEIGKPYKISISCKIRLL
FT                   ETKEDTLKLVERICDTGVRAITVHCRTTPMRNTEPADRSYLSEIVGVCRNKDVSILVNG
FT                   DVLSYNDGLDVIEKYGVDGVLIARAAERNVSCFRIEGPLSSFKVAEEFLKMALEVDNNF
FT                   GNTKYCLNQIMQGSFRKNVRQLAQTAKTYEDLKKAFEIEYKHSDASSVCPTLEKEKSLV
FT                   ISFVDLPSFLESLLASNILKQLSRLHFTKIFAVSEEEDICKQLDDIHEKFLCHGIALSL
FT                   ISADNLASAIASAHLVICMEKDESIMNEAVCDQKITIRLPINSNTNEAVVECENKSMQS
FT                   KHALDIIQERIKDLEEKAQVV"
FT   3'UTR           1110447..1110598
FT                   /gene="dus2"
FT                   /locus_tag="SPBC1709.06"
FT   5'UTR           1110817..1110889
FT                   /gene="erg27"
FT                   /locus_tag="SPBC1709.07"
FT   CDS_pept        join(1110890..1110930,1110978..1111416,1111465..1112001)
FT                   /transl_table=1
FT                   /gene="erg27"
FT                   /locus_tag="SPBC1709.07"
FT                   /product="3-keto sterol reductase (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.07"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.07.1"
FT                   /db_xref="GOA:O74732"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PomBase:SPBC1709.07"
FT                   /db_xref="PomBase:SPBC1709.07.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74732"
FT                   /protein_id="CAA21246.1"
FT                   /translation="MSFRKYALITGSNSGLGFGIATRLLQFYQPRLQDEPEVFTVILTC
FT                   RSREKAEDACRRLKEFFPDRKIRLEYVLLDLSNMASVEAAVQDIATRFPKLDFVYLNAG
FT                   AWDLEGIQWLKAIFSTLINPIQALTHPTFYKETAGRVSNDSLGYIFESNVFGHFYLKNR
FT                   LAELKVLRSSTKVVLTSSLVAEKKSLDFEDLQCFHGEQPYQSSKRLLDVLHYAELEKGL
FT                   PFEQYLVHPGLCTTNMYETFLGPILVMCAKLGFYICRLLGSPWHTISPYVAAFAFLWTA
FT                   LHATKEDQSIKWGAAVTRFGHERVLSTPVELILPSEQEKALEYMTKLYQEWKKKLVS"
FT   misc_RNA        complement(1110897..1112356)
FT                   /locus_tag="SPNCRNA.1412"
FT                   /product="antisense RNA (predicted)"
FT   intron          1110931..1110977
FT                   /gene="erg27"
FT                   /locus_tag="SPBC1709.07"
FT   intron          1111417..1111465
FT                   /gene="erg27"
FT                   /locus_tag="SPBC1709.07"
FT   3'UTR           1112002..1112435
FT                   /gene="erg27"
FT                   /locus_tag="SPBC1709.07"
FT   CDS_pept        join(1112735..1112787,1112829..1112987,1113045..1113159)
FT                   /transl_table=1
FT                   /gene="pop8"
FT                   /locus_tag="SPBC1709.20"
FT                   /product="RNase P and RNase MRP subunit Pop8 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.20"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.20.1"
FT                   /db_xref="GOA:Q7Z996"
FT                   /db_xref="InterPro:IPR020347"
FT                   /db_xref="InterPro:IPR038085"
FT                   /db_xref="PomBase:SPBC1709.20"
FT                   /db_xref="PomBase:SPBC1709.20.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Z996"
FT                   /protein_id="CAD99064.1"
FT                   /translation="MVLHQRLKSEWSYIILEVVGGTTPIDEIDDISLRHLITLALNQSF
FT                   GIFGSAIPIDFLHRQSKFLYLRCHKEDKKKVLVALGSYVREPEQIRLMVLHASDFPCQA
FT                   VPFS"
FT   5'UTR           1113294..1113338
FT                   /gene="cft1"
FT                   /locus_tag="SPBC1709.08"
FT   CDS_pept        1113339..1117664
FT                   /transl_table=1
FT                   /gene="cft1"
FT                   /locus_tag="SPBC1709.08"
FT                   /product="cleavage factor one Cft1 (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:SPBC1709.08"
FT                   /db_xref="EnsemblGenomes-Tr:SPBC1709.08.1"
FT                   /db_xref="GOA:O74733"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="PomBase:SPBC1709.08"
FT                   /db_xref="PomBase:SPBC1709.08.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74733"
FT                   /protein_id="CAA21247.1"
FT                   /translation="MSTIFQDLVDSTVIKNAVQGQFTSLVSNNLVVSKVNSLHLFEIEK
FT                   IQKDESSFPLDDSLQNEFSTSIIDESQAFMETNMHLIRTNEQTTYVLRLVSQVKVFGTI
FT                   TEISALKGKGSNGCDLLIMLTDYAKVSTLEWDMQSQSFVTNSLHYYEDVKSSNICSSHT
FT                   PTQLLVDPDSDCCLLRFLTDMMAIIPYPANEDLDMEEAAIENSKISSSYAYKPSFVLAS
FT                   SQLDASISRILDVKFLYGYREPTLAILYSPEQTSTVTLPLRKDTVLFSLVTLDLEQRAS
FT                   AVITTIQSLPYDIYASVSIPTPLGGSLLLGGNELIYVDSAGRTVGIGVNSYYSKCTDFP
FT                   LQDQSDFNLELEGTIAIPLTSSKTETPFVVLVHTSGQFFYLDFLLDGKSVKGLSLQALD
FT                   LEINDDFLKSGITCAVPAGENLVFLGSQTTDSYLLRWSRRTTNEEVRLDEGDDTLYGTN
FT                   DAEMDDMLDIYETDESVGSKRKIAYENGPLRLEICDVLTNIGPITDFAVGKAGSYSYFP
FT                   QDNHGPLELVGTAGADGAGGLVVFRRNIFPLIAGEFQFDGCEALWTVSISGKLRNMKSR
FT                   IQAQYSNPELETYLVLSKEKESFIFLAGETFDEVQHSDFSKDSKTLNVGSLLSGMRMVQ
FT                   ICPTSLRVYDSNLRLTQLFNFSKKQIVVSTSICDPCIIVVFLGGGIALYKMDLKSQRLI
FT                   KTDLQNRLSDVKTASLVSPDSSALFAKLFTYNETLNAKGQIANGMNDSASETDLDIQPN
FT                   HKTSNNDQMGYDQSVSADDVPEVDNTIVTEKNVSNLDQESLEKHPILFALTDEGKLKVY
FT                   NLADFSLLMECDVFDLPPTLFNGMESERTYFNKESSQELVELLVADLGDDFKEPHLFLR
FT                   SRLNEITVYKAFLYSNTDKHKNLLAFAKVPQETMTREFQANVGTPRDAESTMEKKASSS
FT                   VDHLKMTALEVVGNHSAVFVTGRKPFLILSTLHSNAKFFPISSNIPILSVAPFHAHHAP
FT                   QGYIYVDENSFIRICKFQEDFEYDNKWPYKKVSLGKQINGIAYHPTKMVYAVGSAVPIE
FT                   FKVTDEDGNEPYAITDDNDYLPMANTGSLDLVSPLTWTVIDSYEFQQFEIPLSVALVNL
FT                   EVSETTKLRKPYIAVGTSITKGEDIAVRGSTYLFEIIDVVPQPGRPETRHKLKLVTREE
FT                   IKGTVAVVCEVDGYLLSGQGQKVIVRALEDEDHLVGVSFIDLGSYTLSAKCLRNLLLFG
FT                   DVRQNVTFVGFAEEPYRMTLFSKGQEALNVSAADFLVQGENLYFVVADTSGNLRLLAYD
FT                   PENPESHSGERLVTRGDFHIGNVITAMTILPKEKKHQNAEYGYDTGDDFSCVMVNSDGG
FT                   LQMLVPISDRVYRRLNIIQNYLANRVNTIGGLNPKSYRLITSPSNLTNPTRRILDGMLI
FT                   DYFTYMSVAHRHEMAHKCGVPVSTIMNDLVELDEALSYM"
FT   3'UTR           1117665..1118