(data stored in ACNUC7421 zone)

EMBL: CU458745

ID   CU458745; SV 1; circular; genomic DNA; STD; PRO; 23319 BP.
XX
AC   CU458745;
XX
PR   Project:PRJNA15691;
XX
DT   01-MAR-2008 (Rel. 95, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Mycobacterium abscessus ATCC 19977 plasmid pMAB23, complete sequence.
XX
KW   .
XX
OS   Mycobacteroides abscessus ATCC 19977
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacteroides; Mycobacteroides abscessus.
OG   Plasmid pMAB23
XX
RN   [1]
RP   1-23319
RA   Genoscope;
RT   ;
RL   Submitted (22-MAR-2007) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -FRANCE
RL   (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-23319
RX   DOI; 10.1371/journal.pone.0005660.
RX   PUBMED; 19543527.
RA   Ripoll F., Pasek S., Schenowitz C., Dossat C., Barbe V., Rottman M.,
RA   Macheras E., Heym B., Herrmann J.L., Daffe M., Brosch R., Risler J.L.,
RA   Gaillard J.L.;
RT   "Non mycobacterial virulence genes in the genome of the emerging pathogen
RT   Mycobacterium abscessus";
RL   PLoS One 4(6):e5660-e5660(2009).
XX
DR   MD5; 50fb1308107908948f8ff6f76b909704.
DR   BioSample; SAMEA3138276.
DR   EuropePMC; PMC2694998; 19543527.
DR   StrainInfo; 152939; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23319
FT                   /organism="Mycobacteroides abscessus ATCC 19977"
FT                   /plasmid="pMAB23"
FT                   /mol_type="genomic DNA"
FT                   /note="Genoscope sequence ID :
FT                   MYCOBACTERIUM_ABSCESSUS_PLASMIDE"
FT                   /db_xref="taxon:561007"
FT                   /culture_collection="ATCC:19977"
FT   CDS_pept        144..965
FT                   /transl_table=11
FT                   /locus_tag="MAB_p01"
FT                   /product="Putative transcriptional rgulator"
FT                   /note="Identical to B2I429_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p01"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59628"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD4"
FT                   /protein_id="CAM59628.1"
FT                   /translation="MDRPARRPGPPVDAARLQPDNQGDIQGVDEGLVGTWLDDPDLAAE
FT                   LADELERLRRLQADEELLLTLQLEQFTGRLWERFSRELTRYGLGVLRAWIRHGTIYGKA
FT                   KALTGYGLGRIEGWPDDQTIDDIATDTVVAALIYFRDKVLKTHRWQSSGGASLGTFFIG
FT                   QCLYQFANIYRSALRAEKERIREATTPTDELPEDRFDVIKGIEETIVANDTVAEAMALL
FT                   TTDRARRALFLQEHGFTQREIADKLGLRDAKSVENLLGHQLRQLRNRKRTS"
FT   CDS_pept        962..1402
FT                   /transl_table=11
FT                   /locus_tag="MAB_p02"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I428_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p02"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59629"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD5"
FT                   /protein_id="CAM59629.1"
FT                   /translation="MTTIKHLTALINASSLGTRTGRVARRSVTAAEGDALARRAAESGQ
FT                   GHDDSEKFRGRADERTYRPVSGSTPGRTNRKDKTMAKGHHRSATTGRYVKASTAARNPK
FT                   TTVTERGSNRSSGTHHRSAITGKFVKGSTAARHPNTTVTERG"
FT   CDS_pept        1491..1724
FT                   /transl_table=11
FT                   /locus_tag="MAB_p03"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I427_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p03"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59630"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD6"
FT                   /protein_id="CAM59630.1"
FT                   /translation="MIRTTVEALGGAQAVPSELIPVRELHQRLIDQVTTSGGNVVLADT
FT                   AGKPAAVVMSLQRYEQLLDELNTLRRRTADNA"
FT   CDS_pept        complement(2371..2967)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p04c"
FT                   /product="Putative resolvase/invertase/recombinase"
FT                   /note="97% identical to B2I423_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p04c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59631"
FT                   /db_xref="GOA:B1MAD7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD7"
FT                   /protein_id="CAM59631.1"
FT                   /translation="MTLLGYARVSTLHQSPDMQTKALTEAGAERIWTERMSGARDDDRP
FT                   ELAALLDYARRGDVLMVWRLDRLGRSLPHLLTVASDLQDRGVELRSLTEVIDTSTAGGR
FT                   LIFHVFGAVAEFERAVAAERTAAGVAAARAAGRHPGRPGLTADTIAAVQALDEAGTPRA
FT                   QNRAHPRHIPLQRLPLPRPTAAVSLRQAGDLILRR"
FT   CDS_pept        complement(2964..3398)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p22c"
FT                   /product="Mercuric transporter MerT"
FT                   /note="Identical to B2I422_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p22c"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ39567"
FT                   /db_xref="GOA:C6ELU0"
FT                   /db_xref="UniProtKB/TrEMBL:C6ELU0"
FT                   /protein_id="CAZ39567.1"
FT                   /translation="MATKRTSPSVAGILGLVGIGVLPLLCCAGPALIAGGALGALGGVL
FT                   GNPWLIGATAVLVIAAVGYALRRHRRQDCHTASTDRKSYIMTAVVATSADAPVRCPRIL
FT                   SQTGGNGDTLKDTDGSRPGPQAALVGPEKTVPPERVRTCR"
FT   CDS_pept        complement(3398..3781)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p05c"
FT                   /product="Mercury resistance operon repressor MerR"
FT                   /note="Identical to B2I421_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p05c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59632"
FT                   /db_xref="GOA:B1MAD8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD8"
FT                   /protein_id="CAM59632.1"
FT                   /translation="MTCRTDPRLAFLPETDTGVEMVAKFFRALGDPGRLRLLEFLVSTE
FT                   HTVTECVTHLGLAQSRVSSHLACLSDCGYVQVRREGRFAHYKVADPRVADLVMLARSLA
FT                   ADNAAALADCVRITAAEAPQVPA"
FT   CDS_pept        3920..5338
FT                   /transl_table=11
FT                   /locus_tag="MAB_p06"
FT                   /product="Mercuric reductase MerA"
FT                   /note="Identical to B2I420_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p06"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59633"
FT                   /db_xref="GOA:B1MAD9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD9"
FT                   /protein_id="CAM59633.1"
FT                   /translation="MGYDLAIIGSGGAAFAAAIAATTAGRRVVMIERATIGGTCVNVGC
FT                   VPSKALLAAADALHGASTAARFPGIAASAAPVDGPALMTGKDALVQTLRGEKYVDLAAH
FT                   YGWDVVEGDAQFVGDAGGPCLTVETPGGATLHVEAEHYLIATGSAPWAPPVDGLADTGS
FT                   LTSTTAMDLDRLPESMIVLGGGYVGLEQAQLFARLGTVVTVVTRSPLLSAEEPEVSAVL
FT                   ADVFGDEDIRVHTHTTVTGVRRDEHGYSLTAERGTQRLALHAEQLLVATGRRPVTAGLN
FT                   LDAVGVKTGPRGEVLVDDHLRSTTARIWAAGDVTGGPQFVYVAAAQGTLVADNAFGRAA
FT                   RTLDYTALPRVVFTSPAVASVGMTDAQATAAGIQCDCRTIPLQYVTRAIVNRDTRGLVK
FT                   LVAAADTGRLLGVHVVAENAGDVITAATYALTAGMTVEQLAHTWAPYLTMAESLKLAAQ
FT                   AYTTDVATLSCCAS"
FT   CDS_pept        5458..5883
FT                   /transl_table=11
FT                   /locus_tag="MAB_p07"
FT                   /product="Mercuric transporter MerH"
FT                   /note="Identical to B2I419_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p07"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59634"
FT                   /db_xref="GOA:B1MAE0"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE0"
FT                   /protein_id="CAM59634.1"
FT                   /translation="MAGFATLCCLGVTALVSLLTAIGATFLTTDAALRPLLIVSLVITI
FT                   AGSAATWHRHRNPLPLLLTVVAAVIIFLSLNGNALFGHASAGHGGDPMGDGMGGHTAGA
FT                   GMPGGVGVWIGLALLIIAQVWDIWRLRQLKRQNACAA"
FT   CDS_pept        5930..6586
FT                   /transl_table=11
FT                   /locus_tag="MAB_p08"
FT                   /product="Alkylmercury (organomercurial) lyase MerB"
FT                   /note="Identical to B2I418_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p08"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59635"
FT                   /db_xref="GOA:B1MAE1"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="InterPro:IPR024259"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE1"
FT                   /protein_id="CAM59635.1"
FT                   /translation="MNPDIAQLAHRLNDSLGGDNPGSTPWMLRPLLDLLAHGAPVTIDQ
FT                   LADATATTVEQVRHALTAMSDTEYDEHGRIIGSGLTLRPTPHRFDIDGRQLYTWCALDT
FT                   LIFPGILGRTAHVTSPCHSTGQPVHLTIDTHGITNVEPTTAVVSIVIPDHPASIRTAFC
FT                   HHVHFFATREAAEPWLAENPAATVVSVADAYQLGRPLTQSLLKGTSPSRCTQVGR"
FT   CDS_pept        6583..7935
FT                   /transl_table=11
FT                   /locus_tag="MAB_p09"
FT                   /product="Probable FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="Identical to B2I417_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p09"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59636"
FT                   /db_xref="GOA:B1MAE2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE2"
FT                   /protein_id="CAM59636.1"
FT                   /translation="MTARFDVIVIGAGMAGIAAANKCGAQGWRVAIVDSLPYGGTCALR
FT                   GCDPKKILRRGAEIIDASRLMRGKGIDEGQIRINWTDLMRHKRGFTDPAPANMENDLRR
FT                   HGVQTLHGQARFVDAHQISVGDDVHHTERFLVATGARPRPLQFDGHEHLIDSTQFLDLE
FT                   DLPPRIVFVGGGYISFEFAHIAARAGSHPIILDHGPRPLKGFDPDLVDLLIGRGVAAGV
FT                   DVRASTTVTAVRATATGYQVQVNQDGTDATIDADVVVHGAGRLPELADLDLDRAGIAWS
FT                   ERGIRVQPHLQSTTQPGVYAAGDAADTAGPPLTPVAVIEGKVAASNMLKAASTVPDYTG
FT                   IPSAVFTIPELARVGLLEAEARDQGLNIDVRYSDASTWYSSYRIGEGTAAAKILVNKDD
FT                   DRIVGAHLLGPDYTEHANTIAVAIKLGLTTRQLKTTTAAYPTLGSDLGSML"
FT   CDS_pept        8134..8718
FT                   /transl_table=11
FT                   /locus_tag="MAB_p10"
FT                   /product="Putative resolvase/invertase/recombinase"
FT                   /note="Identical to B2I416_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p10"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59637"
FT                   /db_xref="GOA:B1MAE3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE3"
FT                   /protein_id="CAM59637.1"
FT                   /translation="MTAILGYARVSTLGQDLDAQLAALAAQGVESGRIFTDKLSGTVNT
FT                   VRPGLAALLHYAREGDTVVVTAIDRLGRSVAEVTRTIADLGERRILLRALRESVDTGTP
FT                   TGRAVATIMATLAELELELGRERRAASRDSRRARQLPATKPAKLTPERQEQLRRLAGTG
FT                   EPVPELAQAFGISRATAYRYLAKLSSQSGVA"
FT   CDS_pept        8776..9366
FT                   /transl_table=11
FT                   /locus_tag="MAB_p11"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I415_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p11"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59638"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE4"
FT                   /protein_id="CAM59638.1"
FT                   /translation="MTSKIGPWEEAITLAADWIWERSREEDLAPLLVSNAQNAASFGYA
FT                   DLDEIIRAGGHATPQSRSRPDRGPVLTFVPDERSLHFAMGLARGYSLAVVEGSTSLAEW
FT                   AAGAAAINLLTGQVTTSQVDDDVRKDLDSVIFYGGRNGWTGADEKAQVRRFLSDHIGGG
FT                   RLTPDQAAAYALSSQSVSDRGAKRLRELLSRNR"
FT   CDS_pept        9533..10060
FT                   /transl_table=11
FT                   /locus_tag="MAB_p12"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I414_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p12"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59639"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE5"
FT                   /protein_id="CAM59639.2"
FT                   /translation="MTMGYRRPHRTGVAVAATALVIAAGAAVTSGLALVRPIAPAQHTV
FT                   NVVAPPPAAHSSSETQAAKATACAAWDRAARSTALASKSSAEALEQSWTSPKSLAALAT
FT                   EKRTGVAAVSYLRTQLSDATPASTAIPLHEWMSANIDMLHALNMRHWDDADRQLKRGND
FT                   LTDVLTSECGLR"
FT   CDS_pept        10060..12504
FT                   /transl_table=11
FT                   /locus_tag="MAB_p13"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I413_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p13"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59640"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE6"
FT                   /protein_id="CAM59640.1"
FT                   /translation="MAAVGSSAGSYGRLIVTPDMEPPDASHWDAQEQAYRASATAWDGI
FT                   HQKIVTDNAAFRDAADSRGFDEAHRAGAVLAEEAKTIAEWHDKVANKCADIATVLRDTR
FT                   AGQEQLIREADPKIAAAKLPGEAEALVAQYHGMARYQTEAGVTAAMAAHTSFKKSSENV
FT                   RALDLLTKWGDVPAAPPAQPLDNPSPGIEQDEDPRRYTEKPKAGADAPEPVADAPTDKA
FT                   GTSVTQPGVSPGADAGTGKADVGDEGLATSSPVTQPGMTPAPRPAAASPLGGGAPSMSG
FT                   LGSGGGGMGSGGGIPKMPGGLGSGGMPGTGSNPLSGVGQMPGAGSGLPNAGGLPTASNA
FT                   GGASPLSAFNQGAAATAGMGGGIPPAPPPAPASPSPAPSAGGHAAPAAAAPGGGVSPAA
FT                   AQPGVVAPAAPASAPTGVGVGAGGGAPMMLPPGSMGPPAAAIPPPAATVPAGTVGSTNT
FT                   APAAPTSAAAGAAAGPTLIPASVVAAGQTAAAQERRESADAAAARELVSKLQHAAYLAG
FT                   SPMTGWAVGVFRSPSGTEIVITTNDGAGYIPAGVFVPRSVRVLATDPLVDNDFRQLWFG
FT                   WADPAQILVEYAQLRAQWGWRLVAAASTLPTPALRDAGVEHPPACTRETNPLLQPGVQV
FT                   PAPVLDDMHAHRLALLWPEMYPRLLRIMDADPIYQDRIVSAVTAALIRAATSQAQPVDI
FT                   PDAVRHIWEIRGGDREPTTQQWAKYNAEAQIFNGTTAMTRPAFMTGGAGHPRDYSEDLA
FT                   VYRAHWLVARTAEHIGGWAARPLPLPDMCYGAVLSGDTELSDMIVRALVSVEEDLHYEA
FT                   PR"
FT   CDS_pept        12501..13262
FT                   /transl_table=11
FT                   /locus_tag="MAB_p14"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I412_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p14"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59641"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE7"
FT                   /protein_id="CAM59641.1"
FT                   /translation="MTTPEGADGAAWRVELERWHAELANTIYQASLWAREFHVRTGDRL
FT                   RGDSSAPPSYPLLGYAERLETIGATLKMVCANASLNPPIPRWDRATLSAPSPIRVPGRD
FT                   PDWRDADYFEGGRYLLLIRPSAPTSDIVTAQQHWRTALGFAAPSVLESHLGIPQLAVYA
FT                   EQAQGLFDIAHDTIRAAFRDSVAATYGRIWATWPTSEDSERPLLMWLRELAQFGCPVDE
FT                   CEAVLRDIEAVDPQAVARCREAGAWWRLDAG"
FT   CDS_pept        complement(13274..16606)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p15c"
FT                   /product="TraA/ATP-dependent exoDNAse/relaxase"
FT                   /note="Identical to B2I411_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p15c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59642"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE8"
FT                   /protein_id="CAM59642.2"
FT                   /translation="MLTIAKLGAWSVAYYVDTARSAAAAALESRAAGGGLGEYYSESET
FT                   RLPVWFSAGRDTTAARGLTGAGRAGENADLDAVTRWLDDGESPCGASGRAFQKRAGVHG
FT                   YDLTFCAPKSVSLMRGLGNDVTVKAVADAHAFAITEAMEYLAEHGGYTRVHNPRTGEKD
FT                   LVRLPGIVAAGFQHETSRAGDPHLHTHVLVPNRQARADGRLVSLDGTSLYHEAKAAGII
FT                   YQATLRRELTRSIGVEWNDVDPHTGMADIAGADRGDLRSWSTRSTQLREWASGHLRVEC
FT                   DELSAAQLATAQKATRPRKPEGVAWASLRVAWADDTRTFRVDETVQQAARDARRAAGVD
FT                   YAEVVRRAVSHGLRKAAFTRADLIEAIGARMPVDDADGPSPREVIERLADGVALRIGDE
FT                   RAAHQREGSIRYTAADLVAEERAIIEVMGRRHSAAVLPSVDTAGLSPDQARAVTAIATS
FT                   ERLVQPLSAPAGAGKTHSLRALRAAAHDAGKRVLVAAPTGRAVDVAVREQAGDHGATLD
FT                   ALLGRLERGQEVLDADTVVVVDEAGMVGTQHLRRLLERATAAGTKVVLVGDEHQLAPVA
FT                   QRGGTFAQLVTDLPWAQRLSQVWRMHDHDERNASLAVRDGGPAALRRAVGWYRRHDRLH
FT                   IGDQVTMADDAVAAWTADVAAGRDGLLIADRWEMADALNIRIHSERISDDAPTVAAARG
FT                   HRVAAGDVVITRQNTTDIPTRTDRGADADPIRNGQRWEVLAVDPDAGRIAARRLDDRAV
FT                   AVLSGDYLRQYTHLGYAVTVHAAQGVTADTCHTLLSAEAATRSIAYVGLTRGRHTNTVR
FT                   LYDTRAGEADHEHADPIATGVHTARRGTPAQAATALRSVLGRDDRAATITAAAADEDRL
FT                   PDQVADLRRHHRTVTARLRREHRIDRHAAHDRSAHASDRALVEVLAATHRYGTPLPSSQ
FT                   QRSDPVAVALSAPYVVTTLAADRYTPDLADTVRQAAAGTDRRYVQIAAAPSRPDQRRLD
FT                   QFAERLTAHPPSPREVVVVEDAAAADPAHLAAVATALVPARGRLLLIDSGEPGPGRRLL
FT                   DGLALPWSENARPTPDVADPALAALADSHRAAADRSWRILNPPHRDRGRERTRDQGYGL
FT                   ELD"
FT   CDS_pept        complement(16923..17999)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p16c"
FT                   /product="Putative replication protein RepA"
FT                   /note="Identical to B2I410_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p16c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59643"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE9"
FT                   /protein_id="CAM59643.1"
FT                   /translation="MWTSRAGWLDGLSRWVHSPAFGALCAEARVSITTATLLSIAAVMA
FT                   EHADHGTGRHVAVTRATIADRVGCDVRTVTAAWRVLRVSRWAVEAQRGHGSTSTPSVGR
FT                   RPSVYHLVPRREVRPVTPPLVHDFHLPPSGGVGCSSPVGNYSPSGRASAPAIRSCDKTR
FT                   QARPRRATARPLATQKLAAGLVALTHGLDRAHIGAICDALTSVGIDPAVWSARAVNDAL
FT                   NADMRARGTTWPDHIANPGAFLASRLRRLSWTSPDTAPTKAGSIDQTPRPVVLTDAARA
FT                   RITAAREEIRRVLTERAQLSREDQTSSTPAASSRRDIRLAVQTRHGGAMNRLAEDHRAV
FT                   RGDAMERAPLNVPVRRRT"
FT   CDS_pept        18721..19104
FT                   /transl_table=11
FT                   /locus_tag="MAB_p17"
FT                   /product="Conserved hypothetical protein"
FT                   /note="99% identical to B2I437_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p17"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59644"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF0"
FT                   /protein_id="CAM59644.1"
FT                   /translation="MIDSLELEAAIATVYAAQLPIPVWWPAEARAAFIEEYASEAACLV
FT                   LSELDAINDRMSDWTARSQVSGADESTMIASAQQVLLDEACSEVQYDLTEMIASRSAQL
FT                   MAEAVFDHSPPRAQHHVVWPVQR"
FT   CDS_pept        complement(19459..19764)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p18c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="91% identical to B2I435_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p18c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59645"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF1"
FT                   /protein_id="CAM59645.1"
FT                   /translation="MHARSYSGGMDTLGTVQDDVSAVRDFASQVRALCAQLTANPFNTP
FT                   AAEKLLDLLLEDAPAVDLAFQRVLRSVIYEPASTGAPILDMLGGPRCTALVVGAAA"
FT   CDS_pept        complement(20933..21325)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p19c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I432_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p19c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59646"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF2"
FT                   /protein_id="CAM59646.1"
FT                   /translation="MNAASKPAGLQVGSTRPLSRAERRAQAARVTADETAPAAPEPQNT
FT                   DIPPAPVATPPDGEQEARQAEPVRLKARLRKVKSPFATQLHAGTLARLEWIKARGYVIT
FT                   DTVDEAINRYLDNAGIPKPDRNDRMP"
FT   CDS_pept        complement(21322..22128)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p20c"
FT                   /product="Cobyrinic acid a,c-diamine synthase or chromosome
FT                   partitioning protein ParA"
FT                   /note="97% identical to B2I431_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p20c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59647"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF3"
FT                   /protein_id="CAM59647.1"
FT                   /translation="MTVSADKQCEILAVALQKGGVGKTTTTINLGANLAAMGLRILVID
FT                   MDQQAHSTKGLGIELDAEDASMYEVLHPDRAMRVPLAKVIVPTQFGIDVAPGHLALKEL
FT                   ERTGLGSGGQLRLARQLDDIEGYDFVLLDCPPALGELTTAALAAADYVLAVLKAGPDEV
FT                   DGLVELGNSILDVQETLNPDVEIRYVLLADFDGNPKASKDVRRQLRADWGEWSDGGAYL
FT                   GEIPHTVRVVEAKGKRVPVNVHAPTSTAAVAYREVAERIAARRHAA"
FT   CDS_pept        complement(22250..23020)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p21c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="91% identical to B2I430_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p21c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59648"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF4"
FT                   /protein_id="CAM59648.1"
FT                   /translation="MVETPQQAEARRAAALDRAISTPRYASYLNAAGQDADRARKLYVW
FT                   DRDLSTAVLADLAIVEVALRNALHNALTSTYGPEWYQNIALDDRSMKQVERAWGYLRNP
FT                   RQGHPSTPGRVIAQCTFGMWVNLLDAGGYAGREPRRVHADYEQLWRSTLRSAFPGGRIE
FT                   ARNDPSPHASFTRTWVHSVAKTVNVLRNRVAHHEPLHNGFPLPGQRSGQQQPNRLTAAE
FT                   GVEAYMKLTRMIDRNLAEWIVNNTKVTTLLATRP"
XX
SQ   Sequence 23319 BP; 3784 A; 7933 C; 7892 G; 3710 T; 0 other;
     acaatggtga cagcacggcc cgctaccgct tgcctggaaa aaactttctc caggtttcag        60
     gggttcgcgg tacgcgcgga cttaagagga agcgacaacc gtagggatcg gttgtctctt       120
     tctcgcctcc tggagatgta gccatggatc gaccggcacg ccgtcccggc ccgcccgttg       180
     atgccgcgcg cttacaaccg gacaaccagg gcgacatcca gggcgtcgac gagggcttgg       240
     tcggcacctg gctcgatgac cctgacctgg ccgccgaact tgccgacgaa ctggaacgac       300
     tccggcgcct tcaagccgat gaggaactgc tgctgacgct gcagttggag cagttcaccg       360
     gccggctgtg ggagcggttc tcccgcgagc tgacccgcta cggcctcggc gtgctgcgcg       420
     cctggatccg ccacggcacc atctacggca aggccaaggc gctgaccggc tacggtctgg       480
     gccgcatcga gggctggccc gacgaccaga ccatcgacga catcgccacc gacaccgtgg       540
     tcgccgccct gatctacttc cgcgacaagg tgctcaagac ccaccgctgg caatcctcgg       600
     gtggggcgtc actgggcacc ttcttcatcg gccagtgcct ctatcagttc gccaacatct       660
     accgcagcgc actgcgggcc gagaaggagc gcatccggga ggccaccacg ccgacggacg       720
     aactccccga agaccggttc gacgtcatca agggcatcga ggagaccatc gtcgccaacg       780
     acacggtggc cgaagcgatg gcgctgctga ccaccgaccg ggcgcgccga gcactgttcc       840
     tgcaggaaca cggcttcacc cagcgggaga tcgccgacaa gctggggttg cgcgacgcca       900
     agagcgtgga gaacctcctc ggccaccaac tccgccaact ccgaaaccga aagaggacgt       960
     cgtgaccacc atcaagcacc tcaccgcact catcaacgcc agctcgttgg gcacccgcac      1020
     cgggcgagta gcccgccggt cggtgaccgc cgccgaaggc gacgccctgg cccgccgcgc      1080
     cgccgagagc ggccaggggc acgacgattc cgagaaattc aggggtcgag ccgacgagcg      1140
     cacttataga ccggtatccg gctcaacacc gggccggaca aaccgaaagg acaagacaat      1200
     ggccaaggga catcaccgca gcgcgaccac cggtcgctac gtcaaggcgt ccaccgcggc      1260
     gcgcaacccc aagaccacgg tcaccgaacg gggctccaac cgcagcagcg gaacccatca      1320
     ccgcagtgcc atcaccggca agttcgtgaa gggctccacg gccgcacgtc accccaacac      1380
     cacagttacc gaacgcggtt gagcatcaac cggattcggc ggtgtcccct cggctcgaca      1440
     gacgggccga ggggacacca gaccaaatca cttccgaaag gcgaaatccc atgatccgta      1500
     ccaccgttga agccctcggc ggcgcgcagg ccgttcccag tgagctgatc ccggtccgcg      1560
     aactgcatca gcgcctgatc gatcaggtga ccaccagtgg cggcaacgtc gtcctggccg      1620
     acaccgccgg caagcccgcc gccgtggtca tgtcccttca gcgctacgag cagctgctcg      1680
     acgagctgaa cacgctgcgc cgcagaaccg ccgacaacgc ctgatggcgg gggaggggca      1740
     tcacgtgctg accgacgacg acgtgcaagc tctcgaccga cgcgcacgcg aggtgggaga      1800
     cgtcatcggc tgggatctgc agttcgtcgt cgcccccaac gcggagtacg tcggtctggc      1860
     ggccggcggc ggcgctgaac acgctgacga gatcatcgtc ctcggcccca gccggatcac      1920
     cgatctcgcc gtccacgaga tagacctcgc actcgacgca ctccagcgcg gcgaacggca      1980
     catcatcctc gacgaagacg gcgacccccg gctgatctga acacacggcc ggcgagttct      2040
     tctctacgcc tctccagtcc gacccgcata gcggtcccgc gcagcccgac gttcaacatc      2100
     ggcggtctcg ctgttgaact ccgacgccag ctgggcgtag ccggcatcga ggtcatccgg      2160
     gtcgggctcg gcttccgcgt gaatcacttc gacctcattt ccggggaacg ccgtagcggg      2220
     cgcggatctc gtcttcgccg aacgtacggc cggcggcgat gtcggcttct gcttctcgta      2280
     gcgattcacg aacgtccgcc acgtcgatcg gccagtcgtc gagttcccca ggtgcactgc      2340
     tgcagccctg ggtatcgccg ttttcttccg tcaccttcga aggataaggt cgcctgcctg      2400
     cctcaggctg acggctgcgg ttggtcgagg cagcggtaga cgctggagcg ggatatgtcg      2460
     agggtgcgcg cgattctggg cgcgaggggt cccggcctcg tcgagggctt ggaccgcggc      2520
     gatggtgtca gcggtgaggc cggggcggcc ggggtgtcga ccggccgcgc gggctgccgc      2580
     gactccagcg gcggtgcgtt cggcggcgac ggctcgctcg aactcggcga cggccccgaa      2640
     gacgtggaag atcagccgtc cgccggcagt gctggtgtcg atgacttcgg tgagagagcg      2700
     cagttcgacg ccgcggtcct gcaagtcgct ggccacggtg agcaggtgcg ggagcgagcg      2760
     gccgaggcgg tccagccgcc acaccatgag cacgtcaccg cggcgggcgt agtcgagcag      2820
     cgcggccagc tcggggcgat catcatcgcg agcgccggac atgcgctcgg tccaaatccg      2880
     ttcggccccg gcctccgtca acgccttcgt ctgcatgtcg ggggactggt gcaacgtcga      2940
     gactcgcgcg tatcccagca gcgtcaccgg caggtcctca ctcgttcagg gggcacggtc      3000
     ttctcaggcc caaccagggc cgcttgcgga cctgggcggg agccgtctgt gtctttaagg      3060
     gtgtccccgt tcccgccggt ctgggacagg attctgggac accgcaccgg cgcatcggcg      3120
     ctggtcgcaa ctacagcggt cattatgtag ctttttcggt cggtagaggc cgtatggcag      3180
     tcctggcgac ggtggcggcg cagggcgtag ccaacggcgg cgatcaccag caccgcggtg      3240
     gcaccgatca gccacggatt gcccaggacg ccaccaaggg ctccgagcgc tccgccggcg      3300
     atgagcgccg gtccggcgca gcacagcagc ggcagcaccc cgatgcccac caggccgagg      3360
     atcccggcca cggacgggct cgtgcgcttg gtcgccatca ggccggcacc tgcggggcct      3420
     cggcggcggt gatgcgtacg cagtcggcca gggcggcggc gttgtcggcg gccaacgaac      3480
     gcgccagcat caccagatcg gccacccgcg ggtcggccac cttgtaatga gcgaaccggc      3540
     cctctcggcg gacctggacg tagccgcagt ccgacaggca cgccaggtga ctggaaaccc      3600
     ggctctgcgc cagcccgaga tgggtgacgc actcggtcac ggtgtgctcg gtgctcacca      3660
     ggaactccag aagccgcagt cggccgggat caccgagcgc gcggaagaac ttggccacca      3720
     tctccacccc ggtgtcggtt tcgggcagga acgccagccg gggatcggtg cggcaggtca      3780
     cgcggtctcc cttcacatcc tagaaaatta gcgtatccgt attagcggat atgaggaagt      3840
     atagtcacat tcgactaccc gagagcaacg gtcggcgggg cccgtcccgc aggaccgccg      3900
     acgaaaggcg agacgcccca tgggctatga cttggcgatc atcggctccg gcggtgcggc      3960
     gttcgccgcc gccatcgccg ccaccacggc cggacgccgt gtggtgatga tcgaacgggc      4020
     caccatcggc ggcacgtgcg tcaacgtcgg atgcgtgccg tcgaaggcgc tgctcgccgc      4080
     cgccgacgcc ctccacggcg cgtcgaccgc ggcccggttt ccaggcatcg ccgccagcgc      4140
     cgcacccgtc gacggcccgg ccttgatgac cggaaaggac gcactggtcc agaccctgcg      4200
     cggcgagaag tacgtcgacc tcgccgccca ctacggctgg gacgtcgtcg agggcgacgc      4260
     ccagttcgtc ggcgatgccg gcggaccgtg cctcaccgtc gaaacgcccg gcggcgcaac      4320
     gctgcacgtc gaggccgagc attatttgat cgccaccggt tcggcgccct gggcgccacc      4380
     cgtcgacgga ttggccgaca ccggctctct gacgtcgacc accgcgatgg acctagaccg      4440
     gctgcccgaa tccatgatcg tgctcggcgg cggctacgtg ggcctggaac aggcgcagct      4500
     cttcgcccgc ctgggcaccg tggtcaccgt ggtgacgcga tcaccgctgc tgtccgccga      4560
     agaacccgag gtctccgcgg tgctggcgga cgtcttcggt gacgaggaca tccgggtgca      4620
     cacccacacc accgtgaccg gtgtgcgccg cgacgaacac ggctacagcc tcaccgccga      4680
     acgcggaacg caacggttgg cgctgcatgc cgaacagctg ctggtggcca ccgggcgccg      4740
     cccggtcacc gccggtctga acctcgacgc ggtcggggtc aagaccggtc cgcgcggaga      4800
     agtcctcgtc gacgaccatc tgcgctccac caccgcacgg atctgggctg ccggcgacgt      4860
     gaccggagga ccgcagttcg tctacgtcgc cgcggcccag ggcaccctgg tcgccgacaa      4920
     cgcgttcggc agggccgccc gcaccctgga ctacaccgcc ctgccgcggg tcgtgttcac      4980
     cagccccgcc gtcgcctcag tcggcatgac cgacgcccag gccaccgccg ccggcatcca      5040
     atgcgactgc cgcacaatac ctttgcagta cgtgacgcgg gcaatcgtca accgcgacac      5100
     ccgcgggttg gtcaaactcg tcgccgccgc cgacaccggt cggttactgg gggtgcacgt      5160
     cgtcgccgag aacgccggag acgtcatcac cgccgccacc tacgcgctga ccgcggggat      5220
     gaccgtcgag cagctcgccc acacctgggc cccgtatctg accatggccg aatcactcaa      5280
     actcgccgcc caggcctaca ccaccgacgt cgccaccctg tcctgctgcg ccagctgacc      5340
     aacccccacc cgcaaggaga accctgatga ctgtgccccc ccacccccgc catcgaccac      5400
     gcaactaccg cgttgccgcc caggtggcag cgctggctgc cccgcgccgc cgccctgatg      5460
     gcgggtttcg ccactttgtg ttgcctcggt gtgacggcgc tggtgtcgct gctcaccgcc      5520
     atcggcgcca cgttcctgac taccgacgcc gccctgcggc cgctgctgat cgtcagcttg      5580
     gtgatcacca tcgccggtag cgcggccacc tggcatcggc accgcaaccc gctgccgctg      5640
     ctactgaccg tggtcgccgc ggtgatcatc ttcttgtccc tcaacggcaa cgccctgttc      5700
     ggccacgcca gcgccgggca cggcggcgat cccatgggcg acggcatggg aggccacacc      5760
     gccggcgccg gcatgcccgg cggggtgggg gtgtggatcg ggttggcact gctgatcatc      5820
     gcccaggtgt gggacatctg gcggctacgc caactcaaac gccagaatgc ctgcgccgct      5880
     tgatatcgca tccctagttt ccgctatcga cctggaagga ccaagcgaca tgaaccccga      5940
     catcgcccaa ctcgcccacc ggctcaacga ctcactcggc ggcgacaacc ccggctcgac      6000
     gccctggatg ttgcgcccgc tgctcgacct cctcgcccac ggagcgccgg tcaccatcga      6060
     ccaactcgct gacgccaccg ccaccaccgt cgagcaggtg cgccacgcct tgaccgccat      6120
     gtccgacacc gaatacgacg aacacggccg catcatcggc agcggcctca cactgcgccc      6180
     caccccgcac cgcttcgaca tcgacggacg gcagctctac acctggtgcg cgctggacac      6240
     gctcatcttc cccggcatcc tcggccgaac cgcccacgtc acctcgccat gtcacagcac      6300
     tgggcaaccc gtgcacctca ccatcgacac ccacggaatc accaacgtcg aacccacgac      6360
     cgccgtggtc tcgatcgtca tcccggacca tcccgcctct attcggaccg cgttttgcca      6420
     ccacgtgcac ttcttcgcca cccgggaggc cgctgagcca tggctggccg agaaccccgc      6480
     ggccaccgtc gtttccgtgg ctgacgctta ccaactcggc cgccccctga cccagtccct      6540
     cctgaaaggc acctccccgt cacgctgcac ccaggtggga cgatgactgc ccggttcgat      6600
     gtgatcgtga tcggcgccgg catggccgga atcgctgcgg ccaacaagtg cggagcccag      6660
     ggctggcgcg tggcgatcgt ggattcgttg ccatacggcg gcacctgcgc gttgcgtgga      6720
     tgcgacccga agaagatctt gcgtcgtggt gccgaaatca tcgacgcgtc ccgcttgatg      6780
     cgcggcaagg ggatcgacga aggccagatc cgcatcaact ggactgatct gatgcgccac      6840
     aaacggggct tcaccgatcc cgcaccagcg aacatggaaa acgacctgcg ccgccacggc      6900
     gtccagacac tgcatggtca ggcccggttc gtcgatgccc atcagatcag cgtcggagac      6960
     gacgtccatc acacagagcg gttcttggtg gcgaccggag cgcgaccccg gccgctgcag      7020
     ttcgacggtc acgaacacct catcgacagc acccagttcc tcgatctgga ggacttgcca      7080
     ccgcgaatcg tgttcgtggg cggcggatac atttccttcg agttcgccca catcgccgcc      7140
     cgcgcgggta gccacccgat catcctcgat cacggtccgc gcccactcaa gggattcgac      7200
     cccgatctgg tcgacctgct gatcgggcgc ggcgtggcgg ccggcgtgga cgtgcgcgcc      7260
     tctacgacgg tcaccgccgt acgcgcgacg gccaccggat accaggttca ggtcaaccag      7320
     gacgggaccg acgccaccat cgatgccgac gtggtggttc acggcgccgg gcgacttccc      7380
     gagctggccg acctcgacct cgaccgtgcc ggcatcgcat ggtccgagcg aggaatccgt      7440
     gtgcagccgc acctgcagag caccacccag cccggtgtct acgccgccgg tgacgccgca      7500
     gacaccgccg gcccgccgtt gacgccggtg gccgtgatcg aaggcaaggt ggccgcctcc      7560
     aacatgctca aggctgccag caccgtcccg gactacacgg gtatcccctc cgcggtgttc      7620
     accatccccg aactagcacg cgtcgggttg ctcgaggcag aagcacgtga ccaaggattg      7680
     aacatcgacg tccgctacag cgacgccagc acctggtatt cgagctaccg catcggagaa      7740
     gggaccgccg ctgccaagat cctggtcaac aaggacgacg accgcatcgt gggcgcccac      7800
     ctgctcggac cggactacac cgaacacgcc aacaccattg ccgtggccat caagctcggt      7860
     ctaaccacac gccagctcaa gaccaccacc gcggcctacc ccactttggg atccgatctc      7920
     ggctccatgc tctaaggacg ccacctcgtc gaccccatgc cggaaccgaa gacaacgcgc      7980
     aatacctcag tgcagtctcg attctagaga aacgagacgg ccctacgtgg tccacgctgc      8040
     ggtgggataa cgccaggtcg cggcgtctcc tttcttgtct cacacggcgt gtctcacatc      8100
     ctcgatgtcg gagggcaatg agacggtagc ggtgtgacag cgattctcgg gtacgcgcgg      8160
     gtcagcacgc tgggtcagga cctcgatgcg cagctcgccg cgctcgccgc ccaaggcgtc      8220
     gaatccggcc gaatttttac cgacaagctg tcgggtacgg tgaacaccgt tcggccgggc      8280
     ctggcggccc tgctgcatta cgcccgcgag ggcgacactg tggtggtcac cgccatcgat      8340
     cggctgggtc gatccgtcgc ggaagtaacc cgcaccatcg cggatttggg tgagcgccga      8400
     attctgttgc gcgccttacg tgaaagtgtg gacaccggca caccaacagg gcgtgcggtg      8460
     gccaccatca tggcgacgct ggctgagctc gaactcgaac tggggcgtga gcgccgcgcc      8520
     gcctcgcgcg actcccggcg agcccgccaa ctgccggcta ccaagccggc caaactgacc      8580
     cctgaacgtc aagaacagct gcgccgcctc gccggcacgg gcgaacccgt acccgaactt      8640
     gcccaagcgt tcggaatcag ccgggcgacg gcctaccgct acctggccaa actcagttcc      8700
     cagtcaggag tcgcgtgatg accgccgacg atttgcaccc ctccactcac ctgcgggccg      8760
     cagcgtgggt ccccgatgac gtcgaagatc gggccgtggg aagaagccat caccctggcc      8820
     gccgactgga tttgggaacg cagtcgcgag gaggatctag cgccgctgct ggtgagcaac      8880
     gcgcagaacg cggcgagctt tggttatgcc gacctcgacg agatcatccg agcggggggt      8940
     cacgccacac cgcagagccg tagccgaccc gatcgcggtc cggtactgac gttcgtgcca      9000
     gacgaacggt cgttgcactt cgcgatgggc ttggctcggg gctattcgct tgctgtcgtc      9060
     gagggctcca cgtccttagc cgaatgggct gctggcgcgg ccgcaatcaa cctgctgacc      9120
     ggacaggtca caacgtccca agtcgacgat gatgtccgca aagaccttga ctccgtcatc      9180
     ttctacggcg gtcgtaacgg ctggacaggg gcagatgaaa aggcgcaggt gcgacggttt      9240
     ctgagcgatc acatcggcgg cggccgactg actcccgatc aggccgctgc gtatgccttg      9300
     tcgtcgcagt cggtgtccga ccgcggagcc aagcgcctgc gcgagctgct cagccgcaat      9360
     cggtgatcac catgcttaag tgcgtctaaa accgtcattt tatacacaca ccacgtgacg      9420
     ttcgctgaat tgctcgatgt tgcctatagg cgacatgagc tgcggaaact cgcgggtttg      9480
     aatgtggctg tggctgtggc tggatgtctg tcgatcgcga tacggtcgtt tcatgacgat      9540
     ggggtatcgg cggccccacc gcaccggggt ggccgtcgca gcgaccgcgc tagtgatcgc      9600
     cgctggtgca gcggtgacca gcggcctggc gctggtgcgc cccatcgccc cggctcagca      9660
     cacggtcaac gtggttgcac ccccgccagc cgctcacagc agcagcgaga cgcaagccgc      9720
     gaaggctacg gcatgtgctg cgtgggatcg ggccgcacgg tcgacggcgt tggcgagcaa      9780
     gtccagcgcc gaggcgctgg agcagagctg gacaagccca aagagtctcg ccgcattggc      9840
     cacggagaaa cgcactggtg tggctgcggt ctcgtatctg cgtacgcagc tgtctgacgc      9900
     cacaccagct tcaacggcga taccgctgca tgagtggatg tcggccaaca tcgacatgct      9960
     ccacgcgctg aacatgcggc attgggacga cgccgatcgc caactaaaac gcggcaacga     10020
     tctgacggat gtcctcacgt ctgagtgcgg gttgcgctga tggcggccgt cgggagttct     10080
     gccggttcgt atgggcggct gatcgtcaca ccggacatgg aaccgcccga cgcctcgcac     10140
     tgggacgccc aggagcaggc ctaccgggcc agcgcgacgg catgggacgg catccaccag     10200
     aagatcgtca ccgacaacgc agcgttccga gatgccgctg actctcgggg cttcgacgag     10260
     gcgcaccggg cgggtgcggt gttggccgag gaggccaaga cgatcgccga gtggcacgac     10320
     aaagtggcca acaagtgcgc cgacatcgcc accgtgttgc gtgacacgcg cgccggtcag     10380
     gagcagctga tccgcgaggc cgatcccaag atcgccgccg cgaagctgcc cggcgaagcc     10440
     gaagcgctcg tagctcagta tcacggcatg gccaggtatc agaccgaggc aggcgttacg     10500
     gccgcgatgg ccgcgcacac ctcgttcaag aagagcagcg aaaacgtcag agcgctagac     10560
     cttttgacca agtggggcga tgtacccgct gcacctcccg cgcagcccct cgacaaccca     10620
     tcgcccggta tcgaacagga cgaagaccct cgccgctata ccgagaagcc gaaagccggg     10680
     gccgacgcac ccgagcctgt ggcagacgca ccaacagaca aagccggtac ctccgtcacg     10740
     caaccggggg tgtcccctgg cgccgacgcg gggacgggca aagcggatgt tggcgatgag     10800
     ggactcgcga cgtcgagtcc ggtcactcag ccggggatga ctcctgcgcc gcggccggcg     10860
     gcggcgtcgc cgctcggcgg cggtgcgccg tcgatgagcg gattgggcag tggtggcggt     10920
     gggatgggtt ccggtggcgg gattccgaag atgcccggcg gtctgggaag cggcggcatg     10980
     ccggggacgg gctctaatcc tctgagcggc gtaggccaaa tgcccggcgc gggaagcgga     11040
     ttgccgaatg ctggtggcct ccctacggca tcgaacgcgg ggggcgcgtc gccgttgtcg     11100
     gcattcaatc agggagcagc agcgacggcg ggcatgggcg gcgggatacc acctgcgccg     11160
     ccgccggcac cggcgagccc gtcgccggct ccgtcggccg gtgggcatgc ggcaccggcc     11220
     gcagccgccc ccggcggggg tgtgtcgccg gccgcggcgc agcccggtgt ggtggccccc     11280
     gccgcccctg cctccgcacc taccggtgta ggtgtggggg ccggtggggg tgcgccgatg     11340
     atgctgccgc ccggttcgat gggaccgcca gccgcagcca ttccaccccc tgcggcgacc     11400
     gtgcccgcgg gcacggtcgg ttcgacgaac acagccccgg cggcgcccac gtcggccgca     11460
     gcgggcgcgg ccgccggccc gacactgatc ccggccagcg tggtcgctgc gggccagacc     11520
     gcggccgccc aggagcgccg cgagtccgcc gacgccgcgg cggccaggga gttggtctcg     11580
     aagcttcagc acgccgctta cctggcgggc agccccatga cggggtgggc ggtcggggtg     11640
     ttccgctccc cgagcggcac cgagatcgtg atcaccacca acgacggagc cggttacatc     11700
     ccggcgggcg tgttcgttcc gcgctccgtg cgggtgttgg ccacagatcc tctggtagac     11760
     aacgacttcc ggcagttgtg gttcggttgg gccgatcccg cccagatcct cgtcgagtac     11820
     gcccagctgc gcgcccagtg gggctggcga ctggtcgccg ctgcgagcac gctcccgacg     11880
     cccgcactga gggacgcggg ggtcgagcat ccgcctgcat gcacacggga aaccaacccg     11940
     ctgctgcagc ccggtgtcca ggtacccgcc ccggtgctcg acgacatgca cgcgcatcgg     12000
     ctggcgctgc tgtggcccga gatgtacccg cggctgctgc gcatcatgga cgccgacccg     12060
     atttatcagg accggatcgt ctccgcggtg accgcggcgc tgatccgtgc ggcaacgtcg     12120
     caggcccagc ctgtcgatat tcccgacgcg gtgcgccaca tctgggagat tcgcggcggt     12180
     gaccgcgagc ccaccacgca gcaatgggct aagtacaacg cggaagccca gatcttcaac     12240
     ggcaccactg ccatgacccg gcccgcgttc atgaccggcg gggccggcca tccccgcgat     12300
     tacagcgaag atctggctgt ctaccgggcg cactggctgg ttgcgcgtac cgccgaacac     12360
     atcggcggct gggcggcccg tccgctgccg ctacccgaca tgtgttatgg cgcagttctt     12420
     tccggcgata ctgagttgtc cgacatgatc gtcagggcct tggtgagcgt cgaagaggac     12480
     ctccactacg aggctcctcg gtgaccacac cggagggcgc ggacggcgca gcctggaggg     12540
     tcgagctgga acgctggcac gccgagttgg ccaacaccat ctaccaagcc tccctgtggg     12600
     cgcgggagtt ccacgtgcgt accggggatc gactccgggg cgatagctcg gcaccaccga     12660
     gctatccgct gctcgggtac gccgaacggc tggagacgat cggcgcaacg ctgaagatgg     12720
     tgtgcgcgaa cgcatctttg aaccctccga taccgaggtg ggatcgcgcg acgctgagcg     12780
     caccgtcgcc gatccgggta ccgggccgcg accccgattg gcgagacgcc gactacttcg     12840
     agggcggccg atatcttctc ctcatccgcc caagcgctcc gacttccgat attgttaccg     12900
     cgcaacagca ttggcgcact gcactcggat tcgccgcacc gtcggtgctc gaaagccatc     12960
     tggggatacc gcagctcgcc gtgtacgcgg agcaggcgca gggactgttc gacatcgccc     13020
     atgacacgat tcgtgcggct ttccgggaca gcgtggccgc cacctacggc cggatatggg     13080
     cgacgtggcc cacttcggaa gacagcgagc ggcctctgct gatgtggttg agagagcttg     13140
     cgcagttcgg ctgtccggtc gacgaatgcg aagcggttct ccgcgatatc gaggcggtcg     13200
     atcctcaggc cgtggcgcgc tgccgcgagg ccggcgcatg gtggcgactg gacgcaggct     13260
     gaccgccgcc gcctcagtcg agttcgaggc cgtatccctg gtctctggtt cgttctcgtc     13320
     cacggtcgcg gtggggtggg ttgaggatgc gccagctgcg atcggcggcg gcgcggtgac     13380
     tgtccgcgag tgccgctagt gcggggtcgg cgacatccgg tgtggggcgg gcgttttcag     13440
     accagggtag ggcgagtccg tcgaggagcc ggcggccggg gccgggctcg ccgctgtcga     13500
     tgagcaggag ccggccgcgg gcggggacca gggcggtggc caccgccgcg agatgcgccg     13560
     ggtcggcggc cgcggcgtcc tcgacgacga cgacctccct cggcgatggg ggatgggcgg     13620
     tcaggcgttc ggcgaactgg tcgaggcgac gttggtcggg acgggagggt gcggcggcga     13680
     tctggacgta gcgccggtcg gtgccggcgg cggcctggcg cacggtgtcg gcgaggtcgg     13740
     gggtgtagcg gtcggcggcc agtgtggtca cgacgtaggg agccgagagc gccacggcca     13800
     ccgggtcgct gcgctgctgc gaggagggca ggggggtgcc gtagcggtgg gtggcggcca     13860
     ggacctcgac gagcgcccgg tccgaggcgt gcgcgctgcg gtcgtgggcg gcgtggcggt     13920
     cgatgcggtg ctcgcggcgc agccgcgcgg tcacggtgcg gtggtggcgg cgcaggtcgg     13980
     ccacctggtc gggaagtcgg tcctcgtcgg ccgcggcggc ggtgatggtg gcggcgcggt     14040
     cgtcgcggcc caggacgctg cgcagtgcgg tcgcggcctg cgccggggtg ccgcggcgtg     14100
     cggtgtggac acccgtggcg atggggtcgg cgtgttcgtg gtcggcttcc ccggctcggg     14160
     tgtcgtagag gcgcacggtg ttggtgtgcc ggccgcgggt cagaccgacg taggcgatcg     14220
     agcgggtcgc ggcctcggcc gagagcaggg tgtggcaggt gtcggcggtg acgccctggg     14280
     cggcgtgcac ggtcaccgcg taccccagat gggtgtactg gcgcaggtag tccccggata     14340
     ggaccgcgac cgccctgtcg tcgagacgcc gcgccgcgat ccgccccgcg tcggggtcga     14400
     cggcgaggac ctcccagcgt tggccgttgc gaatcggatc ggcgtcggca ccacggtcgg     14460
     tgcgggtggg gatgtcggtg gtgttctggc gggtgatcac cacgtcgccg gccgcgacgc     14520
     ggtgcccgcg cgcggcggcc acggtgggcg catcgtcgct gatccgttcg gagtggatgc     14580
     ggatgttgag ggcatcggcc atctcccacc gatcggcgat gagcagaccg tcacggccgg     14640
     cggcgacgtc ggccgtccag gccgctacgg cgtcatcggc catggtgacc tgatccccga     14700
     tgtgcagccg atcgtggcgg cggtaccagc ccaccgcgcg gcgcaacgcc gccggcccac     14760
     cgtcgcggac cgccagtgag gcgttgcgct cgtcgtggtc gtgcatccgc cacacctgcg     14820
     acaggcgttg cgcccacggc agatcggtga ccagttgggc gaaggtgccg ccgcgttgcg     14880
     cgaccggtgc gagctggtgc tcgtcaccga ccaacacgac cttcgttccg gcggcggtgg     14940
     ccctctccag caaccggcgc aggtgttggg tgccgaccat gccggcctcg tcgacgacga     15000
     ccacggtgtc ggcgtcgagg acctcttggc cgcgctcgag gcggcccaac aacgcgtcca     15060
     gggtggcccc gtgatcgccc gcctgctcgc gcaccgccac gtcgaccgca cgcccggtgg     15120
     gagcggccac cagaacgcgt ttcccggcgt cgtgtgcggc ggcgcgcagc gctcgcagtg     15180
     agtgggtttt tccggcccct gcgggggcgc tgaggggctg tacgagccgt tctgaggtcg     15240
     cgatggctgt gacggcgcgg gcctgatccg gcgacagccc agcggtgtcc acagacggca     15300
     gaaccgcggc gctgtggcgg cggcccatca cctcgatgat ggcgcgttct tcggcgacca     15360
     gatcggcggc ggtgtagcgg atcgacccct cccgttggtg ggcggcccgc tcgtctccga     15420
     tgcgcagtgc cacaccatcg gcgaggcgct cgatgacctc tcgtggcgac ggtccatcgg     15480
     cgtcgtcgac cggcatccgc gcgccgatcg cctcgatgag atccgcgcgt gtgaacgccg     15540
     cctttctcag gccgtgcgac accgcgcgac gcaccacctc cgcgtagtcc acaccggcag     15600
     cccgacgcgc atctcgcgca gcctgctgga cggtctcgtc gacccgaaat gtgcgggtgt     15660
     catcggccca tgcgacacgc agcgacgccc atgcgacacc ttcgggtttc cgtggccgtg     15720
     tggccttctg cgcggtcgcc agctgcgcag ccgaaagctc gtcgcactcc acccgcagat     15780
     gcccgctggc ccactcgcgc agctgtgtgg agcgtgtcga ccacgaccgc agatccccgc     15840
     gatcggcccc ggcgatgtcg gccatcccgg tgtgcggatc gacgtcgttc cactccacgc     15900
     cgatcgaacg cgtcagctcc cgccgcagtg tggcctgata gatgatcccg gcggccttcg     15960
     cttcgtgata gagactcgtg ccgtccagag acaccagccg cccatccgcg cgggcctgcc     16020
     ggttcgggac caacacgtgg gtgtgcagat gcgggtcccc ggcccgcgag gtttcgtgct     16080
     gaaaacccgc cgccacgatc cccggcaacc gcaccagatc cttctcaccc gtgcgcggat     16140
     tgtgcacacg ggtgtagccc ccgtgttcgg ccagatactc catcgcctcg gtgatcgcga     16200
     aggcgtgcgc atccgcgacc gctttaacgg tcacgtcgtt gcccaaacca cgcatcaacg     16260
     acacgctttt cggggcacag aacgtcaagt catagccgtg cacaccggcc cgcttttgga     16320
     acgcccgacc actggctccg cacggcgatt ccccgtcgtc caaccaacgc gtcacggcgt     16380
     ccaaatcggc gttctcaccg gcgcggccgg cgcccgtcaa acccctcgcc gcggtcgtgt     16440
     cccggccggc ggaaaaccac accggaagcc gcgtctcgga ctcgctgtag tactcgccca     16500
     aacccccacc ggcagcccgc gattcgagtg ccgccgcggc cgccgaacgc gcggtgtcga     16560
     cgtagtacgc caccgaccac gccccgagct tggcgatcgt caacaccgaa ccctcacgcc     16620
     tcccgccaac gcgaccacca ccgacctcgc gggagcgcgc ccacggcgcg ctcccgccca     16680
     gcctcgcaca cattgtgcaa atgtgccata tcgttacggt ggtagagcag tactgagggt     16740
     caggggtggg ttgtgagagc gcagcggaga tgcgatgagc gggcgaagat ggaacagcga     16800
     gagggtgggg agagaagcgg gaggcagtgc ggaagacgtg agtgagaagc gacgaagagg     16860
     gcgctggtgc gggtgctgag agtcgcgtct ggccgcaacg tcagcgcgcc ggttcgcaac     16920
     cactaggtgc gtcgtcgaac cggaacgttc aacggtgcgc gctccatcgc gtctccgcgg     16980
     acggcgcggt ggtcttctgc gagtcggttc atcgcgccgc cgtgccgtgt ctggaccgcc     17040
     agccggatgt cgcgccgcga cgacgcggcg ggcgtgctgc tggtctggtc ctcacggctg     17100
     agttgggcgc gctcggtgag cactcggcgg atctcttctc gggcggcggt gatccgggct     17160
     cgcgctgcgt cggtgagcac cactgggcgc ggcgtctggt cgatgctgcc ggcctttgtc     17220
     ggggccgtgt cgggggatgt ccaggacagc cgtcgcaacc ggctggcgag gaacgcgccg     17280
     gggttggcga tgtggtcggg ccaggtcgtt cctcgggcgc gcatgtcggc gttgagggcg     17340
     tcgttgaccg cacgcgcgga ccacaccgcg gggtcgatgc cgacgctggt gagtgcatcg     17400
     cagatggcac cgatgtgggc gcggtcgaga ccgtgggtga gcgcgaccag tccagcggcc     17460
     agtttctggg tggccagcgg tcgcgcggta gcgcgccgcg gccgtgcttg tcgcgttttg     17520
     tcgcagcttc ggatggcggg cgcgctcgcg cgcccgcttg gtgagtaatt ccctacggga     17580
     gaagaacaac caacaccgcc tgacggcggt aggtggaaat catgcacaag cggtggcgtc     17640
     actggacgta cttcgcgacg cggcaccagg tggtacaccg agggtctgcg gccgacgctg     17700
     ggagtgcttg tcgaaccgtg gccccgctgc gcctccacgg cccatctgga gaccctcagc     17760
     acgcgccacg cggcggtcac ggtgcgcacg tcacacccca ccctgtcggc gattgtcgcg     17820
     cgggtgaccg cgacgtggcg gccggtgccg tgatcggcgt gctcggccat cacagcggcg     17880
     atcgacaaca acgtggccgt ggtgatcgac acccgcgcct cagcgcacag cgcgccgaac     17940
     gccggggagt gcacccaccg cgacaacccg tcgagccagc ccgcgcgact ggtccacatc     18000
     ggcgcagacg gtgcgcaaga gcccgcgcgc gtcacccact cacggcgacg ctcatgcgcc     18060
     agtgcccgca ccacatgagg gctgggagca gcaggggcta cagcagcgcc gagcggcgtc     18120
     ggccaagcac tgtccgcccg acgtacgcgg gcgttcaaaa ggtcacggtt tgcgcaccga     18180
     tcgcgcgccg aatctggtgc agcttcgagg cgtgcgctac cgtgagactt gcctatcaag     18240
     caaagtccct tcggggatat cgggtgcgga cccggaaccg agcgccaact cggttcgaac     18300
     ccccgacagg ggccccgcta acgcggggcc ttcgtcatgt cagcggggta atccgcacac     18360
     cagctattca gatgtcacgt atgccaagac cccctagctc gtccagcaag gtctgaggcc     18420
     tttggcgggt gaatcacatc gccagcggca gaacctcctt gtcgagttcg cgaacagcct     18480
     cgggccgccc gaccgcgata gcgagcaggt cggccgaaag ctggctgacg cttgtgccgc     18540
     gttcggcggc catttcacga agccgggcgt agacggatgc gtcagcgcga accttgatct     18600
     gctcacgcgg acctttgtgc ggttgggcca tggccctgat ccttacgcaa aaaggtccat     18660
     gtacctggta ccgacacgcg cacatcccgt ccctcctttc acacggctac cgttcgagtg     18720
     gtgatcgact cactggaact ggaggcggcc atcgcgacgg tgtacgcggc ccagctgccg     18780
     atcccggtct ggtggccggc cgaagcgcgg gcggcgttca tcgaggagta cgccagcgag     18840
     gcggcgtgcc tggtgctctc agagttggac gcgatcaacg accggatgag cgactggacg     18900
     gcccgatcac aagtcagcgg cgcggacgag tccacgatga tcgcctcggc gcaacaggtt     18960
     ctgctcgatg aggcctgcag cgaagtgcag tacgacctga ccgagatgat cgccagcagg     19020
     agcgcacagt tgatggctga agctgtcttc gaccacagcc cgcctcgcgc gcagcaccac     19080
     gtggtgtggc cggtccagcg ctgaacgagc cagccccaga ccgggcctac ggctcgaagt     19140
     gggagcggaa gccttcgagc cagtccgccc gcgcgtggcc ggtgagatgg cctggaaccc     19200
     atgtctcggc ggcgtcgggg ctgtctgcgt cgccgctggc cacccgttcg tgggcttcga     19260
     ggtagccggc gacgtgcatg tcatcggact gggagaagac ggcttggatg gtgtccaggt     19320
     tcgtcgtgaa gtcccggtag gcggcgcggc gctcggcgtc atcggtgtag tcaccgccgt     19380
     accgctgcag ccatgcctgc cagtgctcgg tggagcctgg cttcggcggc ggcgagggtg     19440
     tgctcatcag ggccgacttt aggccgccgc gccgacgacc agcgcggtac agcgtgggcc     19500
     gccgagcatg tccaggatcg gggcgccggt cgatgcgggc tcgtagatca ccgaccgcaa     19560
     cacccgttgg aaggcgagat ccactgccgg ggcgtcttcc aggagcagat cgaggagctt     19620
     ttctgcggcg ggggtgttga acggattggc tgtcagctgc gcgcacagcg cacggacctg     19680
     ggacgcgaag tcccggaccg cactcacgtc gtcttggacc gtgccgaggg tatccatgcc     19740
     accactgtaa gagcgtgcgt gcatacatgc aagcaacttg catgtaaact acttttagac     19800
     gtgcatgtag gatgcatgca tgcccgattc ggctggggat gcgctcgacg gcggtgcgcc     19860
     cgacgctggc ggtagcgcgc tgcccttgcg taagcgacag cagaaggtgc cgttgaacac     19920
     ctatgtgcgg ccaggcaccc agcagcgcgt ggaggtgttg aaggaccgcg ggtacgcggt     19980
     caccgacatc gtggatgcgg cgctcaacga gttcttggac cgtgccgggg tgcccccgtc     20040
     cgagtagctc gcccccggag cctggccagc acgttccccg cccggcttcc tcgtactggc     20100
     ccgtttgcgc ggtgggtggc ggctgtccag gctcgaccgc aggtcgaccg cgcagcggcg     20160
     gttaccggcc ttgacgacca ccacccaccg tttcgccaca atcgaggccg aggaagcccg     20220
     ctcccctccc cgtatgcggc ggtgggcgct cacggtcgtc gcgcggacgt gatgatcgtg     20280
     gctaccgctt cgatgcccac gccgacgatg gcgccgatcg ctcggccgac ttcgccgatg     20340
     gtgaccttgc agtcgggaat gcgggccagg tagccggcga gcacgcagat cgccagaccc     20400
     agcaccgtga tggccacgac gatgatcgcc actgcgatca ggatggattc gctcattggg     20460
     cgtctcctgg ttcggtggtc aggagatggc tcctggagct ggctgtcgtc ccgctctctt     20520
     cttgtgcgct ggcacagcgt gctttacagg gcactggccg cacctttctc gtcgtggttc     20580
     cggtacacgg gaagtaccgg ccctagagct ggtttccgtc gtgtggcgtg gcggcagttc     20640
     taggtctcgc ctgagcaggt atagacctgc ggggtgcagc ggccgattgc cgaatgcacg     20700
     gcaccgcgag aaacgggttg tcaggggttg gtgtcacggc ctctaatgac cccttggggg     20760
     ccggaatccc gacaactcgt gtggttacgg tcagatcaca acaagaaaaa cgcaggctga     20820
     agcacgttcc cgcgcggggg cgggcctcag cggatgagct ggagcgtcgt cgaacgagag     20880
     aatcaagaca actttgcgtc agcccttaga ggggggcggc gcgcgcccgc cctcaaggca     20940
     tgcggtcgtt gcggtccggc tttggaatgc cggcgttgtc gaggtagcgg ttgatggcct     21000
     cgtcgacggt gtcggtgatg acgtatccgc gggccttgat ccattcgagc cgcgcgaggg     21060
     ttcccgcgtg cagctgtgtg gcgaacggac tcttcacctt gcggagacgg gctttcaacc     21120
     gaaccggctc ggcctgccgg gcctcctgct caccatcggg tggcgtcgcc acgggcgcgg     21180
     gcgggatatc ggtgttctgc ggctccggcg cggccggcgc ggtttcgtcg gcggtgaccc     21240
     gtgcggcttg ggcgcgtcgc tctgcgcgcg acaacggccg ggtggagccg acctgcaatc     21300
     cggcgggttt ggatgcggcg ttcatgctgc gtgccgcctt gccgcgatac gctctgcgac     21360
     ctcgcggtag gccaccgccg ccgtgctggt cggggcgtgc acattgaccg gcacgcgttt     21420
     gcccttggcc tccaccaccc gcaccgtgtg cgggatctcg cccagatagg ccccgccgtc     21480
     agaccactcc ccccagtcgg cacgcagttg acgacgtacg tccttgctcg ccttcgggtt     21540
     gccgtcgaag tcggccagca gcacgtaccg gatctccacg tctgggttga gcgtctcttg     21600
     aacgtcgagg atcgagttgc ccagctccac caggccgtca acctcgtcgg ggccggcctt     21660
     gaggacggcc aacacgtagt cggccgccgc gagcgccgcg gtggtcagct cccccaatgc     21720
     cggcgggcaa tccaggagca cgaagtcgta gccctcgatg tcgtcgagct ggcgcgctag     21780
     ccgcaactgg ccgcccgatc cgagcccggt tcgctcgagc tccttgagcg cgagatgacc     21840
     gggcgcgacg tcgataccga actgcgtcgg aacgatgacc ttggccagcg ggacgcgcat     21900
     cgcccggtcc gggtgcagaa cctcgtacat ggacgcgtcc tcggcgtcga gttcgatgcc     21960
     caaccccttg gtgctgtgcg cctgctgatc catgtcgatc acgaggatgc gcagacccat     22020
     cgcggccagg ttcgcgccga ggttgatcgt ggtggtggtc ttgccgacgc cacccttctg     22080
     cagcgccacg gccaggattt cgcactgctt atctgccgaa acggtcatga caggaagtct     22140
     atcaatctgc atgcaaacat gtctacatgc atacttacat gtaagaaagc atgtatgtat     22200
     gcatgtgctg tggtctcgga acctgcggtg gtgttgcccc aggggagact cacggacgtg     22260
     tggccagcag ggtggtgacc ttggtgttgt tgacgatcca ctctgcgagg ttgcggtcga     22320
     tcatgcgagt gagcttcatg taggcctcga cgccctcggc ggcggtgaga cggttcggct     22380
     gctgttgacc cgaccgttgg ccaggcaacg ggaatccgtt gtgcaggggt tcgtggtggg     22440
     cgacccggtt gcgtaggacg ttgacggtct tggcgacgga gtgaacccac gtcctggtga     22500
     agctcgcatg ggggctcggg tcgtttcgtg cttcgatgcg gccgccgggg aatgcggagc     22560
     gcagcgtcga tcgccatagc tgctcgtagt cggcgtggac gcggcggggc tcccggccgg     22620
     cgtagccgcc ggcatcgaga aggttgaccc acattccgaa ggtgcactgc gcaatcactc     22680
     gtccaggtgt cgatgggtgg ccttgccgag gattacggag gtagccccac gctcgttcga     22740
     cctgcttcat cgagcggtca tcgagggcga tgttctggta ccactcgggt ccataggtgc     22800
     tggtcaacgc gttgtgtagg gcgttgcgta acgccacttc gacgatggcc aggtccgcga     22860
     ggacggctgt cgaaaggtca cggtcccaga cgtagagctt gcgggcacgg tcggcgtctt     22920
     ggccggcggc gttcagatag gacgcgtagc gcggggtcga tatggctcga tcgagcgcag     22980
     cggcgcgacg cgcttctgct tgctgggggg tttctaccac tggactcctt ttcgtggtcc     23040
     gaggtaacat aactggcaga agtccccgga caccgcctct ctggcctgga gccatgacgc     23100
     ggccggggtt tttcattggg gccccccacc cgcgcctcac gcttctgtcg attcacccgc     23160
     gggggctctt tcatgccgga cacgggcgaa ccgacctcat cacgcgaggg gagcgccgca     23220
     cattggcggt ccagcggccc gccaactggg accactcgcg gacccagggg ccgtcaccag     23280
     ccctcttgtg tatgcggggg attgtcggct cgacctggg                            23319
//

If you have problems or comments...

PBIL Back to PBIL home page