(data stored in ACNUC7421 zone)

EMBL: CU459138

ID   CU459138; SV 1; circular; genomic DNA; STD; PRO; 9661 BP.
XX
AC   CU459138;
XX
PR   Project:PRJNA28921;
XX
DT   26-FEB-2008 (Rel. 94, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Acinetobacter baumannii str. AYE plasmid p2ABAYE, complete genome.
XX
KW   .
XX
OS   Acinetobacter baumannii
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter;
OC   Acinetobacter calcoaceticus/baumannii complex.
OG   Plasmid p2ABAYE
XX
RN   [1]
RP   1-9661
RA   Genoscope - CEA;
RT   ;
RL   Submitted (25-FEB-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-9661
RX   DOI; 10.1371/journal.pone.0001805.
RX   PUBMED; 18350144.
RA   Vallenet D., Nordmann P., Barbe V., Poirel L., Mangenot S., Bataille E.,
RA   Dossat C., Gas S., Kreimeyer A., Lenoble P., Oztas S., Poulain J.,
RA   Segurens B., Robert C., Abergel C., Claverie J.-M., Raoult D., Medigue C.,
RA   Weissenbach J., Cruveiller S.;
RT   "Comparative analysis of Acinetobacters: three genomes for three
RT   lifestyles";
RL   PLoS One 3(3):e1805-e1805(2008).
XX
DR   MD5; 6479bab6f069691f0fb2becfec7580da.
DR   BioSample; SAMEA3138279.
DR   EuropePMC; PMC2876395; 20385865.
XX
CC   Annotation data relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny results (Syntonizer software) are available in
CC   BaumannoScope database via the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage/baumannoscope.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9661
FT                   /organism="Acinetobacter baumannii"
FT                   /plasmid="p2ABAYE"
FT                   /strain="AYE"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:470"
FT   gene            662..1612
FT                   /locus_tag="p2ABAYE0001"
FT   CDS_pept        662..1612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0001"
FT                   /product="putative replication initiation protein"
FT                   /function="2.1.1 : DNA replication"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84615"
FT                   /db_xref="GOA:B0V3X0"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84615.1"
FT                   /translation="MRDLVVKDNALINASYNLDLVEQRLILLAIVEARESGKGINANDP
FT                   LEVHADSYINQFGVHRNTAYQALKDACKDLFARQFSYQEKKANGNIRNVMSRWVSQIAY
FT                   NDNEATVDLIFAPAVVPFITRLEEQFTKYELQQVSSLSSAYAIRLYELLIQWRSTGKTP
FT                   TIELQEFRKKLGVLDNEYLRMAHLKERVLELSIKQINEHTDITVKYEQHKRGRSISGFS
FT                   FTFKQKKKDSPSIERDPNTLELFSKMTDAQRHMFANKLSELPEMGRYSQGTESYQQFAV
FT                   RIAEMLQDPAQFKELYPYLKKVGYMPSNKKDTVNG"
FT   gene            1605..2180
FT                   /locus_tag="p2ABAYE0002"
FT   CDS_pept        1605..2180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84616"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84616.1"
FT                   /translation="MAKLSLSEVSKKFHVDRSTIYRAVRNGRLSRSSDGQFDLAEVIRC
FT                   FGEPEQTSQKIESSKQEGDESTKKLIAHLENEVKKYQEREERLMQQIDRMQTLIELKSV
FT                   APATAAPHQDATACDTKMPQHATTQQDTDNKKNNELNIAENVAVPQQETTAYHTQTLQH
FT                   ATLQSVAVPQHKKRGLFGRVLNAVFDND"
FT   gene            2200..2343
FT                   /locus_tag="p2ABAYE0003"
FT   CDS_pept        2200..2343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0003"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84617"
FT                   /db_xref="GOA:B0V3X2"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84617.1"
FT                   /translation="MPKLKDIALGIIVAPLLIPIMLIASYQDKKALKKELDECQKEKDQ
FT                   AS"
FT   gene            complement(2822..3904)
FT                   /locus_tag="p2ABAYE0004"
FT   CDS_pept        complement(2822..3904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0004"
FT                   /product="putative alcohol dehydrogenase, zinc-containing"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84618"
FT                   /db_xref="GOA:B0V3X3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84618.1"
FT                   /translation="MENIMKAMVYYGDHDIRFEERKKPELIDPTDAIIKMTKTTICGTD
FT                   LGIYKGKNPEIEQKEQEKNGSFNGRILGHEGIGIVEQIGSSVKNIKVGDKVIVSCVSRC
FT                   GTCENCAKQLYSHCRNDGGWIMGYMIDGTQAEYVRTPFADTSLYVLPEGLNEDVAVLLS
FT                   DALPTAHEIGVQNGDIKPGDTVAIVGAGPVGMSALLTAQFYSPSQIIMIDMDENRLAMA
FT                   KELGATDTINSGTEDAIARVMELTNQRGVDCAIEAVGIEPTWDICQNIVKEGGHLANVG
FT                   VHGKSVNFSLEKLWIKNLTITTGLVNANTTGMLLKSCCSGKLPMEKLATHHFKFNEIEK
FT                   AYDVFINAAKEKAMKVIIDF"
FT   gene            4343..4639
FT                   /locus_tag="p2ABAYE0006"
FT   CDS_pept        4343..4639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84619"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84619.1"
FT                   /translation="MFFMEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRH
FT                   TNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIISARQVTKAERNKYEHG"
FT   gene            4632..4940
FT                   /locus_tag="p2ABAYE0007"
FT   CDS_pept        4632..4940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0007"
FT                   /product="conserved hypothetical protein; putative
FT                   transcriptional regulator"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84620"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84620.1"
FT                   /translation="MVRYSHKELNEKFGEKQDAEIQRLLAKGTVPDDQLDLSDIPEITD
FT                   WSNAVRQNQFYRPVKQQTSIRLDADVLAWFKAQGKGYQTRMNEILRDAMLKELKNHQ"
FT   gene            5068..7479
FT                   /locus_tag="p2ABAYE0008"
FT   CDS_pept        5068..7479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0008"
FT                   /product="putative TonB-dependent receptor protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84621"
FT                   /db_xref="GOA:B0V3X6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84621.1"
FT                   /translation="MLNKSKLFLALITLGASKILLAAEGPVTTLNTIVLTAQSDELGSE
FT                   LLGKSLNVSNQFIDTSKLKQRSTTLGDALGTELGIHSNQYGGGASTPIIRGQEGKRIKV
FT                   LQNNADVLDMSNMSPDHAVTVEPSLAKSIEIIRGASTLLYSSNSAAGVVNVIDYKIPTQ
FT                   MPQDGLEGNTTLRFNTGSNEKLTTAGVTVGLSPHVALRAEGLYRNAGNYKTPHYQSSSY
FT                   NSLEDLENQNSIYKNLKYLPESWAESRVGTLGLSWIDDNTYLGVSYTHRHDEYGLPAHS
FT                   HLYEGCGASAIGIDSRISGLKNYLLYYPQLMDEQDINYINPRPDCHQHNHIHETNFSHN
FT                   APYIDLNTRRYDVRGEFTQPFTGIDKIRTSLSYIDYFHNELEGDKITNFFKNTGKVGRI
FT                   ELSHQPLGELTGILGLQYLEQDNSALSPVHSQEGHTTYLDNQQLLNRNVTKNFSVFGLE
FT                   KYNWNDFTFELGARIEKQKVSMDYDIEKIKDSMKPWPNKYNSPYVEKNNKIRAQNLKSI
FT                   LEAVQPNKETAFSYAGTVHWRFAPNYILSLTGTHQERLPNAQEMYTHGMHLATNSFEIG
FT                   NRFLRKEKSNNLEISLAYKDDLLDYQISTYYYDFDNYIYLQTLNEVLGTTKVRDQHTLR
FT                   INHYSQSAANFYGLEGNIGYQFNSVYHGSLFGDYVKGRLTNLPDAVIAYDIWNREPTLA
FT                   PQKDRYTPRLPPARLGTRLKADFDESLKGEIEYYRVFKQDNISKFEQVTSGYNMLNMTL
FT                   AYKNKLSHTEYDLFFKANNLLDQKVYAHETFLPYIPQIGRNFSLGLNLNF"
FT   gene            7784..8245
FT                   /locus_tag="p2ABAYE0009"
FT   CDS_pept        7784..8245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84622"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84622.1"
FT                   /translation="MKLAEALLLRSDQQKKIISLKQRINANVLVQDGDQPSEDPNELLK
FT                   QVFSLIQEFQKLSYAIHETNALTKLNDGRSLLALLTLRDEFVEQHKTLTAAISNTSRES
FT                   DRYSTREIKWHKVIPVSSLQKQADDISLKLRDLNVLIQSTNWKIDLIEA"
FT   gene            complement(8568..8741)
FT                   /locus_tag="p2ABAYE0010"
FT   CDS_pept        complement(8568..8741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0010"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84623"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84623.1"
FT                   /translation="MSDNIIQLSKPCTLCENRQNVQLFAGLMLCGSCQENIRLTNPSMF
FT                   SANDEIEQKAQN"
FT   gene            complement(8741..9112)
FT                   /locus_tag="p2ABAYE0011"
FT   CDS_pept        complement(8741..9112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0011"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84624"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84624.1"
FT                   /translation="MGEKVKTYAVRLDPQVAEFYDQLANSEGIRTSKLFSKILTNDFQS
FT                   IAVKQQADRIEDLVNRLEKRIDDFEEDNNFSEKYYEDFSGLYFMMLWLLMKNGASKDEV
FT                   RMIQAKGYSYADDNYKRVK"
FT   gene            complement(9384..9656)
FT                   /locus_tag="p2ABAYE0012"
FT   CDS_pept        complement(9384..9656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="p2ABAYE0012"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:p2ABAYE0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84625"
FT                   /db_xref="UniProtKB/TrEMBL:B0V3Y0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84625.1"
FT                   /translation="MKFLTWMNGQKIDFLRFSKQGNKYFFPCKTKHRPYVTLANFPIQD
FT                   PAHAGIFLSHTTHLTMTPLKALQDKDFSDFLGSQKRVQKNGLFLE"
XX
SQ   Sequence 9661 BP; 3355 A; 1672 C; 1651 G; 2983 T; 0 other;
     aactttaatt atgaaaagct tcatagaacg cgttcaaatg cgatttaaga gcctttacct        60
     agaaaacata gatctcatag tgaaaaacac aaaacagctc aaaaaacgca aatgagagcg       120
     aaataaagag gtattttgac tttagataga tgcatagagc gagtgtctac gagcgaacta       180
     tcaaaatttg cgcctagacc ctctgaaaaa catttttttg tcctctttag cctaagaaag       240
     cgtaagtttc gtgcagaaat ttgctcctgg atcgagcgta gcgagtaaaa aagttttatg       300
     agcgaagcga attccaagtt tcttttgctt ttttttaaag tcacgccagt attaaccaaa       360
     aaattgcccc aacgaactga gcgaaagcga agttcaatag agtttgagcg aagcgaaaac       420
     caagggcaat ttttcattcc ctgggctttt aattatttta aagtttttaa atacttttaa       480
     atggcttgaa agccttatga ataaagggtt ttagctctta tatgtccacg tttaccttgc       540
     aatatgtcca cgtttacctt gcaatatgtc cacgtttacc ttgcaatatg tccacgttta       600
     cctttgcatt agtacacaaa taatattaac gtgtacttat acacaataaa aaatagtggc       660
     tatgagagat ttagttgtaa aggacaatgc cttaatcaac gcaagctata acttagactt       720
     agtagaacaa cgtttaattt tattggctat tgttgaagca agggaaagtg ggaaagggat       780
     taatgcaaat gatccattag aagttcatgc agatagttat atcaatcaat ttggtgtaca       840
     ccgtaataca gcttatcaag ccttaaaaga tgcttgtaag gatttattcg cgcgtcaatt       900
     tagctatcaa gagaaaaaag ctaatgggaa tatccgaaat gttatgagtc gttgggtatc       960
     tcaaattgct tataacgaca atgaagcaac tgtagactta atatttgcac ctgctgttgt      1020
     tcccttcata acccgactgg aagaacaatt tactaaatat gaattacagc aagttagtag      1080
     tcttagtagc gcttatgcca ttcgcttata tgagcttcta attcagtggc gaagcactgg      1140
     taaaacccca accatagaac tacaagaatt tagaaagaag ttaggcgttc ttgataatga      1200
     atatttacgg atggctcatt taaaagagcg tgttttagag ctttcaatta aacaaataaa      1260
     tgagcatacg gatataactg taaaatatga acagcataaa agaggacgtt ctatttcagg      1320
     attttctttt acctttaaac agaagaagaa ggatagccca tcaatagaaa gagatccgaa      1380
     cactttggag cttttttcaa agatgaccga tgctcaacgg catatgtttg caaataaact      1440
     ttcagaactc cctgaaatgg gtcgctattc acaaggaaca gaaagctacc aacagtttgc      1500
     tgtacgtatt gctgagatgc tacaagatcc cgctcaattc aaagagctat acccatacct      1560
     aaaaaaagtg ggatacatgc catcaaataa aaaggacacc gtaaatggct aagttatcac      1620
     taagtgaagt atctaaaaaa tttcatgtgg atagatcaac catttacaga gctgtacgta      1680
     atggacgttt atcacgctcc agtgatggac aattcgatct agcagaggtc atacgatgct      1740
     ttggagaacc tgagcaaaca tctcaaaaaa ttgaatcatc taagcaagaa ggtgatgaat      1800
     ctacaaaaaa acttattgcc catttagaaa atgaagtcaa aaaataccaa gaacgtgaag      1860
     aacggttaat gcaacaaatt gaccgtatgc aaacactcat tgagctgaaa agtgttgcac      1920
     ctgccacagc agcaccacac caagatgcta cggcatgcga caccaagatg ccacagcatg      1980
     cgacaacaca acaagacact gataacaaaa agaataatga attaaatatt gcagaaaatg      2040
     tagcagtgcc acagcaagaa actacggcat accacaccca aacgctacag catgccacgt      2100
     tgcaaagtgt ggcagtgcca caacacaaaa aacgtggttt atttggccgt gtgctgaatg      2160
     ccgtctttga taatgactga gcaataaggg tgaaagatca tgccgaaact gaaagacatt      2220
     gccctgggaa ttattgtagc tccgctgctg atcccgatca tgctgattgc atcgtaccag      2280
     gataaaaagg cgctgaagaa agagctggat gaatgccaaa aagaaaaaga ccaggcatcc      2340
     tgattattca attgagctaa tcaaaagtgt ggaacattga tgaaataata gcgtggaacg      2400
     tgaaaagtca taaaaaaagc ccgaacaggg atgctcgggc tataaactag aaactacagc      2460
     gttgaattat aaggataatt atacagcatt tcgtataagg tgtattatgt taagtttaga      2520
     aatacttata aagacgagtg aattttctac ttttaaacta gcttaatttt tgggagcatt      2580
     acctacggat aaaaaagata aaataaataa agtttatagt tctcaaaagt ggtggaagaa      2640
     gaagagtcta aaaagagaag tttttggagt cgtttttttc ttcctaatgg atagagtgaa      2700
     tatcataaaa taagttacag gttctgggag caagtaagat tactatcatc aaagtatatt      2760
     aattcagaac agtcgctaaa aaaaatcgag gcatgtgccc cgatttttta ttctttgatt      2820
     attaaaaatc aataattact ttcattgctt tttcttttgc tgcattaatg aatacatcat      2880
     atgctttttc aatttcatta aatttaaaat gatgcgttgc taacttttcc attggaagtt      2940
     ttccagaaca acaagatttt aatagcattc ctgtagtatt tgcattcact aagccagtag      3000
     tgattgttaa atttttaatc cataattttt caagagaaaa gttcacagac ttaccatgca      3060
     caccaacgtt agctaaatgt ccgccttctt tgacaatgtt ttgacaaata tcccaagtag      3120
     gctcaattcc tacagcttca atagcacaat caacaccacg ttgattagtt aactccatta      3180
     cgcgtgcaat agcatcttct gttcccgaat taattgtatc cgttgctcct aactcttttg      3240
     ccatagctaa gcggttttca tccatatcaa tcataatgat ttgacttgga gagtaaaatt      3300
     gagctgttaa tagtgcactc ataccaacag ggccggcacc aacaatagcc actgtatcac      3360
     caggcttaat atccccattt tgaacaccaa tttcatgagc tgtaggtaga gcatcagaaa      3420
     gtaaaacagc tacatcttca tttaagcctt caggtagcac atataatgaa gtatcagcaa      3480
     aaggagtacg tacatactca gcttgagttc catcgatcat gtatcccatg atccaaccac      3540
     catcattgcg acaatgagaa tataactgtt ttgcacagtt ttcacatgta ccacaacgac      3600
     ttacgcatga aacaattact ttatcgccaa ctttgatatt ttttactgat gaaccaattt      3660
     gttcaacaat accaatacct tcatgaccta aaatacgacc attgaatgaa ccattttttt      3720
     cttgttcttt ttgttcaatt tcaggatttt tacctttata aataccaaga tccgttccac      3780
     aaattgtcgt ttttgtcatt ttaataatgg catctgtcgg atcaattagt tctggttttt      3840
     tgcgttcctc gaatctaata tcatgatcac cataataaac cattgctttc attatatttt      3900
     ccataatata tcctgttcaa ttaagttggt ggactcaagc cacaagagca aacgtataaa      3960
     aactttccaa acaatgtcga tgttacccaa caagggaagc agcaatatta attcgtattc      4020
     tagacacata tcctagtttt atctaaaaaa attgtattaa aaatggtagg ggaatactcc      4080
     ctcaaattaa ccgattttaa agctataaaa tgattgattt aacataatgg cgattatacg      4140
     aagtacactt gtatattaat ataaatatca actacttaat aaaaatagaa aaatcccaaa      4200
     atgcccaaaa agccgacttt gaaacaagtc ggctttttta tgagcagttt tgatacttct      4260
     tgccaataat tttgactaaa aattacacga atctggttga gtgatacaat tttgtgatac      4320
     attattgtat atacaaattt gaatgttttt tatggaacag tattttgaat gggatgaggc      4380
     taagaatcga aagaatcaga aaaagcatga tatctctttc gaaactgcaa gccttgtttt      4440
     tgaagatcca ttacggatct caatccaaga cagacatacc aatggtgaag aacgttggca      4500
     aaccattgga cgagttaaag gcgtactaat gttattggtg gctcacacca tttttgatga      4560
     agatgactgt gaaatcatcc gaatcattag tgcaaggcaa gtcactaaag cggagcgaaa      4620
     caaatatgag catggttaga tactcacaca aagagctgaa tgagaaattt ggtgagaagc      4680
     aagatgctga aattcaacgc ttgcttgcta aaggcacggt tcctgatgat cagctagatc      4740
     tatcagatat tcctgaaatt acagactgga gcaatgctgt acgccaaaat caattttacc      4800
     gcccagtaaa gcaacaaact tcaattcggt tagatgctga tgtacttgct tggttcaaag      4860
     cacaaggcaa aggttatcaa acacgtatga atgaaatttt acgagatgct atgctaaaag      4920
     aattaaaaaa tcatcaataa gaatgggagc ttaggctccc atttttgact tcatttttag      4980
     gggggattac cattcaaaaa tttaaatagt agattttata aatttttaag tgttatatta      5040
     taatataaca ttaaatttgg ttgttttatg ctaaataaaa gtaaactatt tttagcttta      5100
     attactttag gggcctcgaa aattttattg gcagctgaag ggcctgttac taccttaaat      5160
     acaatagtat taactgcaca atctgatgag ttagggtctg agctgttagg caaaagtcta      5220
     aatgttagta atcagtttat tgatactagt aaacttaaac agcgttcgac aactctaggg      5280
     gatgccttgg gtacggaatt aggaattcat tctaatcaat atggaggtgg agcatctact      5340
     cctattattc gtgggcagga aggaaaacgt attaaagttt tacagaataa tgctgacgtg      5400
     ttggatatgt ctaatatgtc cccagatcac gctgtcacag ttgaaccaag tttagctaag      5460
     tctattgaaa ttatacgtgg tgcaagtacc cttttgtata gttcaaatag tgcggcaggg      5520
     gtagtcaatg tcattgacta taaaattcca acccaaatgc ctcaagacgg attagagggt      5580
     aatactacat tacgttttaa tactggcagt aatgagaagt tgaccacagc aggtgtaaca      5640
     gttggcttaa gcccacatgt agctttacgg gcagaagggt tatatcgtaa tgctggtaac      5700
     tataaaactc ctcattacca gtctagctct tataattctt tagaagatct tgaaaaccaa      5760
     aacagtattt ataaaaattt aaaatattta ccagaaagct gggcagagtc gagagtaggt      5820
     acgcttggat tatcctggat agacgataat acttatttag gagtttctta tacacatcgt      5880
     catgatgaat atggtttacc agcccatagc catttatatg aaggttgtgg tgcctctgca      5940
     atcggtatcg attcacgaat tagtggatta aaaaattatc ttttatatta tcctcaattg      6000
     atggatgagc aagatattaa ttacataaat ccacgtcctg attgtcatca gcataatcat      6060
     attcatgaaa ctaatttctc tcataatgct ccttatattg atttaaatac tcgacgttat      6120
     gatgtgcgtg gagaattcac tcaaccattt accggtattg acaaaattcg tacctcattg      6180
     agttatatag attattttca caatgaactc gagggagata agattactaa cttttttaaa      6240
     aatacaggaa aagtaggccg catagagtta tcacatcagc cattagggga attaaccggt      6300
     atcttggggc tacaatattt ggaacaggat aatagtgctt tatcaccagt ccattctcaa      6360
     gaaggccata ccacctatct agataatcag cagctattaa atcgaaatgt cactaaaaac      6420
     tttagtgtat ttggcctaga aaaatataac tggaacgact ttactttcga actaggtgct      6480
     cgtatagaaa agcagaaagt tagtatggat tatgatatag aaaaaattaa agattcaatg      6540
     aaaccttggc ctaataaata taacagtcct tatgtagaaa aaaataataa aatcagggct      6600
     caaaatttaa aatctatttt agaagctgtt caacctaaca aagaaacagc tttttcttat      6660
     gcaggtacag tccactggag atttgctcca aattatatct tatcattaac aggtacacat      6720
     caagaaagat tacctaatgc acaagaaatg tatactcatg gtatgcatct cgctactaat      6780
     tcttttgaaa taggtaaccg ctttctaaga aaagagaaat ccaataattt agaaatcagt      6840
     ctggcctata aggatgattt acttgattat caaatcagta cttactatta tgattttgat      6900
     aactatatat atttacagac actcaatgaa gttttaggaa ctacaaaagt tagagatcag      6960
     catacactac gtattaatca ttatagccag tctgctgcta atttttatgg attagagggc      7020
     aacatagggt atcaatttaa ttctgtttat cacggctctc tttttggaga ttatgtgaaa      7080
     ggccgtttaa caaatttacc tgatgctgta attgcatacg atatctggaa tagagaaccg      7140
     actttagctc cccaaaagga tcgttacact cctagattac ctcctgctcg tttgggtaca      7200
     cgactaaaag ctgattttga tgaatcgctt aaaggtgaaa tagaatatta tcgagtcttt      7260
     aaacaagata atatttctaa atttgagcag gttacatcag gttataatat gcttaatatg      7320
     actttagcat ataaaaataa gctatctcac acagaatatg atttattctt taaagcgaat      7380
     aatttacttg atcagaaagt ctatgcccat gaaacatttt tgccatatat tccccaaatt      7440
     ggaagaaatt ttagtttagg cttaaatctt aatttctaga taagatactg taatcttcta      7500
     agaaaatttc ttagaagatt tttcttataa aatgattaga ttaataatta aggtaagcgt      7560
     ccgctgaatc ccatacctat tttttaattc gatttaggtt tccagcagtg tggcagtaac      7620
     tcttcaatct gggtcacttt atgtgtcggc agccttttca gcactgaata gccaccgatt      7680
     ttgtagacac cttttagcta gataaaaagc aatttttttg atctttaaag aatgaggata      7740
     taagctgttt aaaacttaat tctaattggt taataggtga aaaatgaaat tagcagaagc      7800
     tctcttactt cgaagtgatc aacaaaaaaa aattatttca ctaaaacaac gtatcaatgc      7860
     aaatgtattg gtacaagatg gtgatcaacc atctgaagat ccaaatgaac tactaaaaca      7920
     agtattttct ttaattcaag aatttcaaaa attaagttat gcaattcatg aaactaatgc      7980
     tttaacaaaa ttaaatgatg gccgttctct acttgcttta ttgactttgc gtgatgaatt      8040
     tgtagaacag cacaaaaccc taactgcagc aataagtaat acatctcgtg aatctgatcg      8100
     ttatagtacg cgggaaataa agtggcataa agttattcca gtttcatcat tacaaaaaca      8160
     agctgatgat attagtctta aattacgtga tttaaacgtg ttaattcagt cgactaattg      8220
     gaaaattgat ttgattgaag cctaatagtc ctttagatat aatcaagttg aacatactgg      8280
     gcgagtacaa gatcccttac ttccacaaca taggattgta aataaagtgt agtggcttgc      8340
     aaagcaagtg gataagctta aaattttaag tacaaatcaa tccatcactt ggcataactc      8400
     aaatctttgt gcaaacaaag ttacacgtta cttataacta ccatgtactg acagtatgtt      8460
     cacctcaatt actaaaaata aagaaatgaa caagcatcag ctcaactaca tttctatttt      8520
     taattcagtt cggcatttaa cataaaatct cttatacgaa gcccaggtta attctgggct      8580
     ttttgttcaa tctcatcatt ggccgagaac atacttggat tcgtaagcct gatattttcc      8640
     tgacaacttc cacacagcat caatcctgca aaaagttgta cattttgtct attttcacaa      8700
     agcgtacatg gctttgaaag ctgaataata ttatctgaca ctactttacc ctcttatagt      8760
     tatcatctgc atatgaataa cctttagctt gtatcattct aacctcatct ttagaagcgc      8820
     catttttcat taagagccac aacatcatga aatatagtcc agaaaagtct tcatagtatt      8880
     tttcagaaaa attgttatct tcctcaaaat catctattcg cttttctaat cgattcacca      8940
     gatcctcaat acgatcggct tgctgtttaa cagcaataga ttgaaaatca ttggtcaaaa      9000
     ttttactgaa taatttactg gttctgattc cttctgaatt agccaattga tcgtagaatt      9060
     ctgctacttg tggatctaac ctgactgcat aagttttgac tttttcgccc ataaattaca      9120
     cctcttatta aaattagatt ttgtacaaaa ttaaatatat ataattcaac taattaaata      9180
     aaaaataata attagattac gtacaaactt atttgtacag aattaattta ttctaaaaca      9240
     aaaacttatt taaatataat gcttttttta tgtacaatca tgagtacata ttttttctta      9300
     aatttatcaa tatcttatct aaaaaaagtg ttgttttgat gtacaaccat gagcacagca      9360
     taaaaaatag ataattcaat cacttattct aaaaaaagac catttttctg tacacgtttc      9420
     tgagacccta aaaaatcgct gaaatcctta tcctgtaagg ctttgagggg tgtcatcgtt      9480
     agatgcgtgg tgtgtgacaa aaaaatcccg gcatgtgccg gatcttggat tggaaaattg      9540
     gctaaagtga cgtagggccg gtgcttggtt ttgcatggaa aaaagtattt atttccttgt      9600
     ttagaaaaac gtaaaaaatc aattttttgt ccattcatcc aggttaaaaa tttcaaccca      9660
     a                                                                      9661
//

If you have problems or comments...

PBIL Back to PBIL home page