(data stored in ACNUC7421 zone)

EMBL: CU459141

ID   CU459141; SV 1; circular; genomic DNA; STD; PRO; 3936291 BP.
XX
AC   CU459141;
XX
PR   Project:PRJNA28921;
XX
DT   26-FEB-2008 (Rel. 94, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Acinetobacter baumannii str. AYE, complete genome.
XX
KW   .
XX
OS   Acinetobacter baumannii
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter;
OC   Acinetobacter calcoaceticus/baumannii complex.
XX
RN   [1]
RP   1-3936291
RA   Genoscope - CEA;
RT   ;
RL   Submitted (25-FEB-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-3936291
RX   DOI; 10.1371/journal.pone.0001805.
RX   PUBMED; 18350144.
RA   Vallenet D., Nordmann P., Barbe V., Poirel L., Mangenot S., Bataille E.,
RA   Dossat C., Gas S., Kreimeyer A., Lenoble P., Oztas S., Poulain J.,
RA   Segurens B., Robert C., Abergel C., Claverie J.-M., Raoult D., Medigue C.,
RA   Weissenbach J., Cruveiller S.;
RT   "Comparative analysis of Acinetobacters: three genomes for three
RT   lifestyles";
RL   PLoS One 3(3):e1805-e1805(2008).
XX
DR   MD5; a298abc6f5c45ef33733649e3f70718a.
DR   BioSample; SAMEA3138279.
DR   EnsemblGenomes-Gn; ABAYE0162.
DR   EnsemblGenomes-Gn; ABAYE0163.
DR   EnsemblGenomes-Gn; ABAYE0508.
DR   EnsemblGenomes-Gn; ABAYE0511.
DR   EnsemblGenomes-Gn; ABAYE1187.
DR   EnsemblGenomes-Gn; ABAYE1189.
DR   EnsemblGenomes-Gn; ABAYE1372.
DR   EnsemblGenomes-Gn; ABAYE1764.
DR   EnsemblGenomes-Gn; ABAYE1767.
DR   EnsemblGenomes-Gn; ABAYE1787.
DR   EnsemblGenomes-Gn; ABAYE1870.
DR   EnsemblGenomes-Gn; ABAYE1871.
DR   EnsemblGenomes-Gn; ABAYE1884.
DR   EnsemblGenomes-Gn; ABAYE1885.
DR   EnsemblGenomes-Gn; ABAYE1905.
DR   EnsemblGenomes-Gn; ABAYE1906.
DR   EnsemblGenomes-Gn; ABAYE1956.
DR   EnsemblGenomes-Gn; ABAYE1957.
DR   EnsemblGenomes-Gn; ABAYE2134.
DR   EnsemblGenomes-Gn; ABAYE2137.
DR   EnsemblGenomes-Gn; ABAYE2201.
DR   EnsemblGenomes-Gn; ABAYE2238.
DR   EnsemblGenomes-Gn; ABAYE2239.
DR   EnsemblGenomes-Gn; ABAYE2265.
DR   EnsemblGenomes-Gn; ABAYE2347.
DR   EnsemblGenomes-Gn; ABAYE2450.
DR   EnsemblGenomes-Gn; ABAYE2453.
DR   EnsemblGenomes-Gn; ABAYE2504.
DR   EnsemblGenomes-Gn; ABAYE2505.
DR   EnsemblGenomes-Gn; ABAYE2565.
DR   EnsemblGenomes-Gn; ABAYE2645.
DR   EnsemblGenomes-Gn; ABAYE2736.
DR   EnsemblGenomes-Gn; ABAYE2959.
DR   EnsemblGenomes-Gn; ABAYE2961.
DR   EnsemblGenomes-Gn; ABAYE3304.
DR   EnsemblGenomes-Gn; ABAYE3305.
DR   EnsemblGenomes-Gn; ABAYE3361.
DR   EnsemblGenomes-Gn; ABAYE3551.
DR   EnsemblGenomes-Gn; ABAYE3561.
DR   EnsemblGenomes-Gn; ABAYE3574.
DR   EnsemblGenomes-Gn; ABAYE3602.
DR   EnsemblGenomes-Gn; ABAYE3603.
DR   EnsemblGenomes-Gn; ABAYE3625.
DR   EnsemblGenomes-Gn; ABAYE3631.
DR   EnsemblGenomes-Gn; ABAYE3641.
DR   EnsemblGenomes-Gn; ABAYE3645.
DR   EnsemblGenomes-Gn; ABAYE3649.
DR   EnsemblGenomes-Gn; ABAYE3668.
DR   EnsemblGenomes-Gn; ABAYE3702.
DR   EnsemblGenomes-Gn; ABAYE3824.
DR   EnsemblGenomes-Gn; ABAYE3893.
DR   EnsemblGenomes-Gn; ABAYE3894.
DR   EnsemblGenomes-Gn; ABAYE_16s_1.
DR   EnsemblGenomes-Gn; ABAYE_16s_2.
DR   EnsemblGenomes-Gn; ABAYE_16s_3.
DR   EnsemblGenomes-Gn; ABAYE_16s_4.
DR   EnsemblGenomes-Gn; ABAYE_16s_5.
DR   EnsemblGenomes-Gn; ABAYE_16s_6.
DR   EnsemblGenomes-Gn; ABAYE_23s_1.
DR   EnsemblGenomes-Gn; ABAYE_23s_2.
DR   EnsemblGenomes-Gn; ABAYE_23s_3.
DR   EnsemblGenomes-Gn; ABAYE_23s_4.
DR   EnsemblGenomes-Gn; ABAYE_23s_5.
DR   EnsemblGenomes-Gn; ABAYE_23s_6.
DR   EnsemblGenomes-Gn; ABAYE_5s_1.
DR   EnsemblGenomes-Gn; ABAYE_5s_2.
DR   EnsemblGenomes-Gn; ABAYE_5s_3.
DR   EnsemblGenomes-Gn; ABAYE_5s_4.
DR   EnsemblGenomes-Gn; ABAYE_5s_5.
DR   EnsemblGenomes-Gn; ABAYE_5s_6.
DR   EnsemblGenomes-Gn; ABAYEmisc_RNA_9.
DR   EnsemblGenomes-Gn; ABAYEtRNA1.
DR   EnsemblGenomes-Gn; ABAYEtRNA10.
DR   EnsemblGenomes-Gn; ABAYEtRNA11.
DR   EnsemblGenomes-Gn; ABAYEtRNA12.
DR   EnsemblGenomes-Gn; ABAYEtRNA13.
DR   EnsemblGenomes-Gn; ABAYEtRNA14.
DR   EnsemblGenomes-Gn; ABAYEtRNA15.
DR   EnsemblGenomes-Gn; ABAYEtRNA16.
DR   EnsemblGenomes-Gn; ABAYEtRNA17.
DR   EnsemblGenomes-Gn; ABAYEtRNA18.
DR   EnsemblGenomes-Gn; ABAYEtRNA19.
DR   EnsemblGenomes-Gn; ABAYEtRNA2.
DR   EnsemblGenomes-Gn; ABAYEtRNA20.
DR   EnsemblGenomes-Gn; ABAYEtRNA21.
DR   EnsemblGenomes-Gn; ABAYEtRNA22.
DR   EnsemblGenomes-Gn; ABAYEtRNA23.
DR   EnsemblGenomes-Gn; ABAYEtRNA24.
DR   EnsemblGenomes-Gn; ABAYEtRNA25.
DR   EnsemblGenomes-Gn; ABAYEtRNA26.
DR   EnsemblGenomes-Gn; ABAYEtRNA27.
DR   EnsemblGenomes-Gn; ABAYEtRNA28.
DR   EnsemblGenomes-Gn; ABAYEtRNA29.
DR   EnsemblGenomes-Gn; ABAYEtRNA3.
DR   EnsemblGenomes-Gn; ABAYEtRNA30.
DR   EnsemblGenomes-Gn; ABAYEtRNA31.
DR   EnsemblGenomes-Gn; ABAYEtRNA32.
DR   EnsemblGenomes-Gn; ABAYEtRNA33.
DR   EnsemblGenomes-Gn; ABAYEtRNA34.
DR   EnsemblGenomes-Gn; ABAYEtRNA35.
DR   EnsemblGenomes-Gn; ABAYEtRNA36.
DR   EnsemblGenomes-Gn; ABAYEtRNA37.
DR   EnsemblGenomes-Gn; ABAYEtRNA38.
DR   EnsemblGenomes-Gn; ABAYEtRNA39.
DR   EnsemblGenomes-Gn; ABAYEtRNA4.
DR   EnsemblGenomes-Gn; ABAYEtRNA40.
DR   EnsemblGenomes-Gn; ABAYEtRNA41.
DR   EnsemblGenomes-Gn; ABAYEtRNA42.
DR   EnsemblGenomes-Gn; ABAYEtRNA43.
DR   EnsemblGenomes-Gn; ABAYEtRNA44.
DR   EnsemblGenomes-Gn; ABAYEtRNA45.
DR   EnsemblGenomes-Gn; ABAYEtRNA46.
DR   EnsemblGenomes-Gn; ABAYEtRNA47.
DR   EnsemblGenomes-Gn; ABAYEtRNA48.
DR   EnsemblGenomes-Gn; ABAYEtRNA49.
DR   EnsemblGenomes-Gn; ABAYEtRNA5.
DR   EnsemblGenomes-Gn; ABAYEtRNA50.
DR   EnsemblGenomes-Gn; ABAYEtRNA51.
DR   EnsemblGenomes-Gn; ABAYEtRNA52.
DR   EnsemblGenomes-Gn; ABAYEtRNA53.
DR   EnsemblGenomes-Gn; ABAYEtRNA54.
DR   EnsemblGenomes-Gn; ABAYEtRNA55.
DR   EnsemblGenomes-Gn; ABAYEtRNA56.
DR   EnsemblGenomes-Gn; ABAYEtRNA57.
DR   EnsemblGenomes-Gn; ABAYEtRNA58.
DR   EnsemblGenomes-Gn; ABAYEtRNA59.
DR   EnsemblGenomes-Gn; ABAYEtRNA6.
DR   EnsemblGenomes-Gn; ABAYEtRNA60.
DR   EnsemblGenomes-Gn; ABAYEtRNA61.
DR   EnsemblGenomes-Gn; ABAYEtRNA62.
DR   EnsemblGenomes-Gn; ABAYEtRNA63.
DR   EnsemblGenomes-Gn; ABAYEtRNA64.
DR   EnsemblGenomes-Gn; ABAYEtRNA65.
DR   EnsemblGenomes-Gn; ABAYEtRNA66.
DR   EnsemblGenomes-Gn; ABAYEtRNA67.
DR   EnsemblGenomes-Gn; ABAYEtRNA68.
DR   EnsemblGenomes-Gn; ABAYEtRNA69.
DR   EnsemblGenomes-Gn; ABAYEtRNA7.
DR   EnsemblGenomes-Gn; ABAYEtRNA70.
DR   EnsemblGenomes-Gn; ABAYEtRNA71.
DR   EnsemblGenomes-Gn; ABAYEtRNA72.
DR   EnsemblGenomes-Gn; ABAYEtRNA8.
DR   EnsemblGenomes-Gn; ABAYEtRNA9.
DR   EnsemblGenomes-Gn; EBG00001175338.
DR   EnsemblGenomes-Gn; EBG00001175339.
DR   EnsemblGenomes-Gn; EBG00001175340.
DR   EnsemblGenomes-Gn; EBG00001175341.
DR   EnsemblGenomes-Gn; EBG00001175342.
DR   EnsemblGenomes-Gn; EBG00001175343.
DR   EnsemblGenomes-Gn; EBG00001175344.
DR   EnsemblGenomes-Gn; EBG00001175345.
DR   EnsemblGenomes-Gn; EBG00001175346.
DR   EnsemblGenomes-Gn; EBG00001175347.
DR   EnsemblGenomes-Gn; EBG00001175348.
DR   EnsemblGenomes-Gn; EBG00001175349.
DR   EnsemblGenomes-Gn; EBG00001175350.
DR   EnsemblGenomes-Gn; EBG00001175351.
DR   EnsemblGenomes-Gn; EBG00001175352.
DR   EnsemblGenomes-Gn; EBG00001175353.
DR   EnsemblGenomes-Gn; EBG00001175354.
DR   EnsemblGenomes-Gn; EBG00001175355.
DR   EnsemblGenomes-Gn; EBG00001175356.
DR   EnsemblGenomes-Gn; EBG00001175357.
DR   EnsemblGenomes-Gn; EBG00001175358.
DR   EnsemblGenomes-Gn; EBG00001175359.
DR   EnsemblGenomes-Gn; EBG00001175360.
DR   EnsemblGenomes-Gn; EBG00001175361.
DR   EnsemblGenomes-Gn; EBG00001175362.
DR   EnsemblGenomes-Gn; EBG00001175363.
DR   EnsemblGenomes-Gn; EBG00001175364.
DR   EnsemblGenomes-Gn; EBG00001175365.
DR   EnsemblGenomes-Gn; EBG00001175366.
DR   EnsemblGenomes-Gn; EBG00001175367.
DR   EnsemblGenomes-Gn; EBG00001175368.
DR   EnsemblGenomes-Gn; EBG00001175369.
DR   EnsemblGenomes-Gn; EBG00001175370.
DR   EnsemblGenomes-Gn; EBG00001175371.
DR   EnsemblGenomes-Gn; EBG00001175372.
DR   EnsemblGenomes-Gn; EBG00001175373.
DR   EnsemblGenomes-Gn; EBG00001175374.
DR   EnsemblGenomes-Gn; EBG00001175375.
DR   EnsemblGenomes-Gn; EBG00001175376.
DR   EnsemblGenomes-Gn; EBG00001175377.
DR   EnsemblGenomes-Gn; EBG00001175378.
DR   EnsemblGenomes-Gn; EBG00001175379.
DR   EnsemblGenomes-Gn; EBG00001175380.
DR   EnsemblGenomes-Gn; EBG00001175381.
DR   EnsemblGenomes-Gn; EBG00001175382.
DR   EnsemblGenomes-Gn; EBG00001175383.
DR   EnsemblGenomes-Gn; EBG00001175384.
DR   EnsemblGenomes-Gn; EBG00001175385.
DR   EnsemblGenomes-Gn; EBG00001175386.
DR   EnsemblGenomes-Gn; EBG00001175387.
DR   EnsemblGenomes-Gn; EBG00001175388.
DR   EnsemblGenomes-Gn; EBG00001175389.
DR   EnsemblGenomes-Gn; EBG00001175390.
DR   EnsemblGenomes-Gn; EBG00001175391.
DR   EnsemblGenomes-Gn; EBG00001175392.
DR   EnsemblGenomes-Gn; EBG00001175393.
DR   EnsemblGenomes-Gn; EBG00001175394.
DR   EnsemblGenomes-Gn; EBG00001175395.
DR   EnsemblGenomes-Gn; EBG00001175396.
DR   EnsemblGenomes-Gn; EBG00001175397.
DR   EnsemblGenomes-Gn; EBG00001175398.
DR   EnsemblGenomes-Gn; EBG00001175399.
DR   EnsemblGenomes-Gn; EBG00001175400.
DR   EnsemblGenomes-Gn; EBG00001175401.
DR   EnsemblGenomes-Gn; EBG00001175402.
DR   EnsemblGenomes-Gn; EBG00001175403.
DR   EnsemblGenomes-Gn; EBG00001175404.
DR   EnsemblGenomes-Gn; EBG00001175405.
DR   EnsemblGenomes-Gn; EBG00001175406.
DR   EnsemblGenomes-Gn; EBG00001175407.
DR   EnsemblGenomes-Gn; EBG00001175408.
DR   EnsemblGenomes-Gn; EBG00001175409.
DR   EnsemblGenomes-Gn; EBG00001175410.
DR   EnsemblGenomes-Gn; EBG00001175411.
DR   EnsemblGenomes-Gn; EBG00001175412.
DR   EnsemblGenomes-Gn; EBG00001175413.
DR   EnsemblGenomes-Gn; EBG00001175414.
DR   EnsemblGenomes-Gn; EBG00001175415.
DR   EnsemblGenomes-Gn; EBG00001175416.
DR   EnsemblGenomes-Gn; EBG00001175417.
DR   EnsemblGenomes-Gn; EBG00001175418.
DR   EnsemblGenomes-Gn; EBG00001175419.
DR   EnsemblGenomes-Gn; EBG00001175420.
DR   EnsemblGenomes-Gn; EBG00001175421.
DR   EnsemblGenomes-Gn; EBG00001175422.
DR   EnsemblGenomes-Gn; EBG00001175423.
DR   EnsemblGenomes-Gn; EBG00001175424.
DR   EnsemblGenomes-Gn; EBG00001175425.
DR   EnsemblGenomes-Gn; EBG00001175426.
DR   EnsemblGenomes-Gn; EBG00001175427.
DR   EnsemblGenomes-Gn; EBG00001175428.
DR   EnsemblGenomes-Gn; EBG00001175429.
DR   EnsemblGenomes-Gn; EBG00001175430.
DR   EnsemblGenomes-Gn; EBG00001175431.
DR   EnsemblGenomes-Gn; EBG00001175432.
DR   EnsemblGenomes-Gn; EBG00001175433.
DR   EnsemblGenomes-Gn; EBG00001175434.
DR   EnsemblGenomes-Gn; EBG00001175435.
DR   EnsemblGenomes-Gn; EBG00001175436.
DR   EnsemblGenomes-Gn; EBG00001175437.
DR   EnsemblGenomes-Gn; EBG00001175438.
DR   EnsemblGenomes-Gn; EBG00001175439.
DR   EnsemblGenomes-Gn; EBG00001175441.
DR   EnsemblGenomes-Gn; EBG00001175443.
DR   EnsemblGenomes-Gn; EBG00001175445.
DR   EnsemblGenomes-Gn; EBG00001175447.
DR   EnsemblGenomes-Gn; EBG00001175449.
DR   EnsemblGenomes-Gn; EBG00001175451.
DR   EnsemblGenomes-Gn; EBG00001175452.
DR   EnsemblGenomes-Gn; EBG00001175453.
DR   EnsemblGenomes-Gn; EBG00001175455.
DR   EnsemblGenomes-Gn; EBG00001175456.
DR   EnsemblGenomes-Gn; EBG00001175457.
DR   EnsemblGenomes-Gn; EBG00001175459.
DR   EnsemblGenomes-Gn; EBG00001175461.
DR   EnsemblGenomes-Gn; EBG00001175463.
DR   EnsemblGenomes-Gn; EBG00001175465.
DR   EnsemblGenomes-Gn; EBG00001175467.
DR   EnsemblGenomes-Gn; EBG00001175468.
DR   EnsemblGenomes-Gn; EBG00001175469.
DR   EnsemblGenomes-Gn; EBG00001175471.
DR   EnsemblGenomes-Gn; EBG00001175472.
DR   EnsemblGenomes-Gn; EBG00001175474.
DR   EnsemblGenomes-Gn; EBG00001175476.
DR   EnsemblGenomes-Gn; EBG00001175479.
DR   EnsemblGenomes-Gn; EBG00001175481.
DR   EnsemblGenomes-Gn; EBG00001175482.
DR   EnsemblGenomes-Gn; EBG00001175484.
DR   EnsemblGenomes-Gn; EBG00001175486.
DR   EnsemblGenomes-Gn; EBG00001175488.
DR   EnsemblGenomes-Tr; ABAYE0162.
DR   EnsemblGenomes-Tr; ABAYE0163.
DR   EnsemblGenomes-Tr; ABAYE0508.
DR   EnsemblGenomes-Tr; ABAYE0511.
DR   EnsemblGenomes-Tr; ABAYE1187.
DR   EnsemblGenomes-Tr; ABAYE1189.
DR   EnsemblGenomes-Tr; ABAYE1372.
DR   EnsemblGenomes-Tr; ABAYE1764.
DR   EnsemblGenomes-Tr; ABAYE1767.
DR   EnsemblGenomes-Tr; ABAYE1787.
DR   EnsemblGenomes-Tr; ABAYE1870.
DR   EnsemblGenomes-Tr; ABAYE1871.
DR   EnsemblGenomes-Tr; ABAYE1884.
DR   EnsemblGenomes-Tr; ABAYE1885.
DR   EnsemblGenomes-Tr; ABAYE1905.
DR   EnsemblGenomes-Tr; ABAYE1906.
DR   EnsemblGenomes-Tr; ABAYE1956.
DR   EnsemblGenomes-Tr; ABAYE1957.
DR   EnsemblGenomes-Tr; ABAYE2134.
DR   EnsemblGenomes-Tr; ABAYE2137.
DR   EnsemblGenomes-Tr; ABAYE2201.
DR   EnsemblGenomes-Tr; ABAYE2238.
DR   EnsemblGenomes-Tr; ABAYE2239.
DR   EnsemblGenomes-Tr; ABAYE2265.
DR   EnsemblGenomes-Tr; ABAYE2347.
DR   EnsemblGenomes-Tr; ABAYE2450.
DR   EnsemblGenomes-Tr; ABAYE2453.
DR   EnsemblGenomes-Tr; ABAYE2504.
DR   EnsemblGenomes-Tr; ABAYE2505.
DR   EnsemblGenomes-Tr; ABAYE2565.
DR   EnsemblGenomes-Tr; ABAYE2645.
DR   EnsemblGenomes-Tr; ABAYE2736.
DR   EnsemblGenomes-Tr; ABAYE2959.
DR   EnsemblGenomes-Tr; ABAYE2961.
DR   EnsemblGenomes-Tr; ABAYE3304.
DR   EnsemblGenomes-Tr; ABAYE3305.
DR   EnsemblGenomes-Tr; ABAYE3361.
DR   EnsemblGenomes-Tr; ABAYE3551.
DR   EnsemblGenomes-Tr; ABAYE3561.
DR   EnsemblGenomes-Tr; ABAYE3574.
DR   EnsemblGenomes-Tr; ABAYE3602.
DR   EnsemblGenomes-Tr; ABAYE3603.
DR   EnsemblGenomes-Tr; ABAYE3625.
DR   EnsemblGenomes-Tr; ABAYE3631.
DR   EnsemblGenomes-Tr; ABAYE3641.
DR   EnsemblGenomes-Tr; ABAYE3645.
DR   EnsemblGenomes-Tr; ABAYE3649.
DR   EnsemblGenomes-Tr; ABAYE3668.
DR   EnsemblGenomes-Tr; ABAYE3702.
DR   EnsemblGenomes-Tr; ABAYE3824.
DR   EnsemblGenomes-Tr; ABAYE3893.
DR   EnsemblGenomes-Tr; ABAYE3894.
DR   EnsemblGenomes-Tr; ABAYE_16s_1-1.
DR   EnsemblGenomes-Tr; ABAYE_16s_2-1.
DR   EnsemblGenomes-Tr; ABAYE_16s_3-1.
DR   EnsemblGenomes-Tr; ABAYE_16s_4-1.
DR   EnsemblGenomes-Tr; ABAYE_16s_5-1.
DR   EnsemblGenomes-Tr; ABAYE_16s_6-1.
DR   EnsemblGenomes-Tr; ABAYE_23s_1-1.
DR   EnsemblGenomes-Tr; ABAYE_23s_2-1.
DR   EnsemblGenomes-Tr; ABAYE_23s_3-1.
DR   EnsemblGenomes-Tr; ABAYE_23s_4-1.
DR   EnsemblGenomes-Tr; ABAYE_23s_5-1.
DR   EnsemblGenomes-Tr; ABAYE_23s_6-1.
DR   EnsemblGenomes-Tr; ABAYE_5s_1-1.
DR   EnsemblGenomes-Tr; ABAYE_5s_2-1.
DR   EnsemblGenomes-Tr; ABAYE_5s_3-1.
DR   EnsemblGenomes-Tr; ABAYE_5s_4-1.
DR   EnsemblGenomes-Tr; ABAYE_5s_5-1.
DR   EnsemblGenomes-Tr; ABAYE_5s_6-1.
DR   EnsemblGenomes-Tr; ABAYEmisc_RNA_9-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA1-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA10-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA11-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA12-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA13-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA14-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA15-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA16-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA17-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA18-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA19-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA2-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA20-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA21-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA22-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA23-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA24-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA25-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA26-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA27-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA28-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA29-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA3-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA30-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA31-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA32-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA33-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA34-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA35-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA36-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA37-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA38-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA39-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA4-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA40-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA41-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA42-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA43-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA44-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA45-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA46-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA47-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA48-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA49-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA5-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA50-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA51-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA52-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA53-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA54-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA55-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA56-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA57-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA58-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA59-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA6-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA60-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA61-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA62-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA63-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA64-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA65-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA66-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA67-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA68-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA69-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA7-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA70-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA71-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA72-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA8-1.
DR   EnsemblGenomes-Tr; ABAYEtRNA9-1.
DR   EnsemblGenomes-Tr; EBT00001753767.
DR   EnsemblGenomes-Tr; EBT00001753768.
DR   EnsemblGenomes-Tr; EBT00001753769.
DR   EnsemblGenomes-Tr; EBT00001753770.
DR   EnsemblGenomes-Tr; EBT00001753771.
DR   EnsemblGenomes-Tr; EBT00001753772.
DR   EnsemblGenomes-Tr; EBT00001753773.
DR   EnsemblGenomes-Tr; EBT00001753774.
DR   EnsemblGenomes-Tr; EBT00001753775.
DR   EnsemblGenomes-Tr; EBT00001753776.
DR   EnsemblGenomes-Tr; EBT00001753777.
DR   EnsemblGenomes-Tr; EBT00001753778.
DR   EnsemblGenomes-Tr; EBT00001753779.
DR   EnsemblGenomes-Tr; EBT00001753780.
DR   EnsemblGenomes-Tr; EBT00001753781.
DR   EnsemblGenomes-Tr; EBT00001753782.
DR   EnsemblGenomes-Tr; EBT00001753783.
DR   EnsemblGenomes-Tr; EBT00001753784.
DR   EnsemblGenomes-Tr; EBT00001753785.
DR   EnsemblGenomes-Tr; EBT00001753786.
DR   EnsemblGenomes-Tr; EBT00001753787.
DR   EnsemblGenomes-Tr; EBT00001753788.
DR   EnsemblGenomes-Tr; EBT00001753789.
DR   EnsemblGenomes-Tr; EBT00001753790.
DR   EnsemblGenomes-Tr; EBT00001753791.
DR   EnsemblGenomes-Tr; EBT00001753792.
DR   EnsemblGenomes-Tr; EBT00001753793.
DR   EnsemblGenomes-Tr; EBT00001753794.
DR   EnsemblGenomes-Tr; EBT00001753795.
DR   EnsemblGenomes-Tr; EBT00001753796.
DR   EnsemblGenomes-Tr; EBT00001753797.
DR   EnsemblGenomes-Tr; EBT00001753798.
DR   EnsemblGenomes-Tr; EBT00001753799.
DR   EnsemblGenomes-Tr; EBT00001753800.
DR   EnsemblGenomes-Tr; EBT00001753801.
DR   EnsemblGenomes-Tr; EBT00001753802.
DR   EnsemblGenomes-Tr; EBT00001753803.
DR   EnsemblGenomes-Tr; EBT00001753804.
DR   EnsemblGenomes-Tr; EBT00001753805.
DR   EnsemblGenomes-Tr; EBT00001753806.
DR   EnsemblGenomes-Tr; EBT00001753807.
DR   EnsemblGenomes-Tr; EBT00001753808.
DR   EnsemblGenomes-Tr; EBT00001753809.
DR   EnsemblGenomes-Tr; EBT00001753810.
DR   EnsemblGenomes-Tr; EBT00001753811.
DR   EnsemblGenomes-Tr; EBT00001753812.
DR   EnsemblGenomes-Tr; EBT00001753813.
DR   EnsemblGenomes-Tr; EBT00001753814.
DR   EnsemblGenomes-Tr; EBT00001753815.
DR   EnsemblGenomes-Tr; EBT00001753816.
DR   EnsemblGenomes-Tr; EBT00001753817.
DR   EnsemblGenomes-Tr; EBT00001753818.
DR   EnsemblGenomes-Tr; EBT00001753819.
DR   EnsemblGenomes-Tr; EBT00001753820.
DR   EnsemblGenomes-Tr; EBT00001753821.
DR   EnsemblGenomes-Tr; EBT00001753822.
DR   EnsemblGenomes-Tr; EBT00001753823.
DR   EnsemblGenomes-Tr; EBT00001753824.
DR   EnsemblGenomes-Tr; EBT00001753825.
DR   EnsemblGenomes-Tr; EBT00001753826.
DR   EnsemblGenomes-Tr; EBT00001753827.
DR   EnsemblGenomes-Tr; EBT00001753828.
DR   EnsemblGenomes-Tr; EBT00001753829.
DR   EnsemblGenomes-Tr; EBT00001753830.
DR   EnsemblGenomes-Tr; EBT00001753831.
DR   EnsemblGenomes-Tr; EBT00001753832.
DR   EnsemblGenomes-Tr; EBT00001753833.
DR   EnsemblGenomes-Tr; EBT00001753834.
DR   EnsemblGenomes-Tr; EBT00001753835.
DR   EnsemblGenomes-Tr; EBT00001753836.
DR   EnsemblGenomes-Tr; EBT00001753837.
DR   EnsemblGenomes-Tr; EBT00001753838.
DR   EnsemblGenomes-Tr; EBT00001753839.
DR   EnsemblGenomes-Tr; EBT00001753840.
DR   EnsemblGenomes-Tr; EBT00001753841.
DR   EnsemblGenomes-Tr; EBT00001753842.
DR   EnsemblGenomes-Tr; EBT00001753843.
DR   EnsemblGenomes-Tr; EBT00001753844.
DR   EnsemblGenomes-Tr; EBT00001753845.
DR   EnsemblGenomes-Tr; EBT00001753846.
DR   EnsemblGenomes-Tr; EBT00001753847.
DR   EnsemblGenomes-Tr; EBT00001753848.
DR   EnsemblGenomes-Tr; EBT00001753849.
DR   EnsemblGenomes-Tr; EBT00001753850.
DR   EnsemblGenomes-Tr; EBT00001753851.
DR   EnsemblGenomes-Tr; EBT00001753852.
DR   EnsemblGenomes-Tr; EBT00001753853.
DR   EnsemblGenomes-Tr; EBT00001753854.
DR   EnsemblGenomes-Tr; EBT00001753855.
DR   EnsemblGenomes-Tr; EBT00001753856.
DR   EnsemblGenomes-Tr; EBT00001753857.
DR   EnsemblGenomes-Tr; EBT00001753858.
DR   EnsemblGenomes-Tr; EBT00001753859.
DR   EnsemblGenomes-Tr; EBT00001753860.
DR   EnsemblGenomes-Tr; EBT00001753861.
DR   EnsemblGenomes-Tr; EBT00001753862.
DR   EnsemblGenomes-Tr; EBT00001753863.
DR   EnsemblGenomes-Tr; EBT00001753864.
DR   EnsemblGenomes-Tr; EBT00001753865.
DR   EnsemblGenomes-Tr; EBT00001753866.
DR   EnsemblGenomes-Tr; EBT00001753867.
DR   EnsemblGenomes-Tr; EBT00001753868.
DR   EnsemblGenomes-Tr; EBT00001753869.
DR   EnsemblGenomes-Tr; EBT00001753870.
DR   EnsemblGenomes-Tr; EBT00001753871.
DR   EnsemblGenomes-Tr; EBT00001753872.
DR   EnsemblGenomes-Tr; EBT00001753873.
DR   EnsemblGenomes-Tr; EBT00001753874.
DR   EnsemblGenomes-Tr; EBT00001753875.
DR   EnsemblGenomes-Tr; EBT00001753876.
DR   EnsemblGenomes-Tr; EBT00001753877.
DR   EnsemblGenomes-Tr; EBT00001753878.
DR   EnsemblGenomes-Tr; EBT00001753879.
DR   EnsemblGenomes-Tr; EBT00001753880.
DR   EnsemblGenomes-Tr; EBT00001753881.
DR   EnsemblGenomes-Tr; EBT00001753882.
DR   EnsemblGenomes-Tr; EBT00001753883.
DR   EnsemblGenomes-Tr; EBT00001753884.
DR   EnsemblGenomes-Tr; EBT00001753885.
DR   EnsemblGenomes-Tr; EBT00001753886.
DR   EnsemblGenomes-Tr; EBT00001753887.
DR   EnsemblGenomes-Tr; EBT00001753888.
DR   EnsemblGenomes-Tr; EBT00001753889.
DR   EnsemblGenomes-Tr; EBT00001753890.
DR   EnsemblGenomes-Tr; EBT00001753891.
DR   EnsemblGenomes-Tr; EBT00001753892.
DR   EnsemblGenomes-Tr; EBT00001753893.
DR   EnsemblGenomes-Tr; EBT00001753894.
DR   EnsemblGenomes-Tr; EBT00001753895.
DR   EnsemblGenomes-Tr; EBT00001753896.
DR   EuropePMC; PMC2687260; 19364869.
DR   EuropePMC; PMC2728857; 19474200.
DR   EuropePMC; PMC2863528; 20194587.
DR   EuropePMC; PMC2976157; 20713680.
DR   EuropePMC; PMC3043498; 21147956.
DR   EuropePMC; PMC3187012; 21788470.
DR   EuropePMC; PMC3535948; 23070160.
DR   EuropePMC; PMC3691203; 23826102.
DR   EuropePMC; PMC3699609; 23843955.
DR   EuropePMC; PMC3886933; 24080502.
DR   EuropePMC; PMC3910750; 24145532.
DR   EuropePMC; PMC4136133; 24899031.
DR   EuropePMC; PMC4136169; 24899022.
DR   EuropePMC; PMC4335886; 25512405.
DR   EuropePMC; PMC4338279; 25706932.
DR   EuropePMC; PMC4367897; 25534766.
DR   EuropePMC; PMC4700137; 26779129.
DR   EuropePMC; PMC4964143; 27471549.
DR   EuropePMC; PMC5075119; 27645248.
DR   EuropePMC; PMC5320584; 28348844.
DR   EuropePMC; PMC5472653; 28670571.
DR   EuropePMC; PMC5711439; 28436748.
DR   EuropePMC; PMC6070778; 30037042.
DR   EuropePMC; PMC6256745; 30275086.
DR   EuropePMC; PMC6365644; 30746493.
DR   EuropePMC; PMC6563999; 31194814.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CU459141.
DR   SILVA-SSU; CU459141.
XX
CC   Annotation data relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny results (Syntonizer software) are available in
CC   BaumannoScope database via the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage/baumannoscope.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3936291
FT                   /organism="Acinetobacter baumannii"
FT                   /strain="AYE"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:470"
FT   gene            170..1567
FT                   /gene="dnaA"
FT                   /locus_tag="ABAYE0001"
FT   CDS_pept        170..1567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ABAYE0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and housekeeping
FT                   genes"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.3.7 : nucleoproteins, basic proteins"
FT                   /function="3.1.2.5 : action unknown"
FT                   /function="3.3.2 : regulon"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84993"
FT                   /db_xref="GOA:B0VAF3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VAF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84993.1"
FT                   /translation="MLWTDCLTRLRQELSDNVFAMWIRPLVAEEVEGILRLYAPNPYWT
FT                   RYIQENHLELISILAEQLSEGRVRQVEILVDSRPGSILSSSEQPATTTAALQTAPIPQP
FT                   AKVKREPEPVANTAVSSKSSKKKLLNPQFTFSLFVEGRSNQMAAETCRKVLTQLGASQH
FT                   NPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKGKVEEFKK
FT                   NCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTELDPRLV
FT                   SRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLPRNCALFIAQQVVANVRELEGALNK
FT                   VVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEYFRIPLKELVGPKRTR
FT                   IYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDPIFDEDYKN
FT                   LLRLLQS"
FT   gene            1665..2813
FT                   /gene="dnaN"
FT                   /locus_tag="ABAYE0002"
FT   CDS_pept        1665..2813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="ABAYE0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="2.1.1 : DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84994"
FT                   /db_xref="GOA:A0A0R4J873"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J873"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84994.1"
FT                   /translation="MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTIT
FT                   GSDLEVELVASTALSEGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCILKS
FT                   GNSRFVLGTLPAEDYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTL
FT                   LEIDENQLRAVTTDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLL
FT                   IGRELLNVTINTPSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQ
FT                   SLQRVAILSNEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQSAPLEMSFNAQYL
FT                   LDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMRV"
FT   gene            2828..3910
FT                   /gene="recF"
FT                   /locus_tag="ABAYE0003"
FT   CDS_pept        2828..3910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="ABAYE0003"
FT                   /product="DNA replication, recombinaison and repair
FT                   protein"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84995"
FT                   /db_xref="GOA:B0VAF5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VAF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84995.1"
FT                   /translation="MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHL
FT                   LATGRSFRTHIPKNYIQYEADDAIVFAQSATEKIGMQKLASGEQLMKVNGDTVATQGQL
FT                   AKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTLLKT
FT                   RRNLSLADLEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQLLPDLEIELEYSPGF
FT                   HTEQGLMQDLLNQHQKDIERRYTEYGPHRADLRLKTPFGHADDVLSRGQKKLLIIALKL
FT                   SQIAMLHASNKETVVLLDDLTAELDLTAQQRLIERLSQLGSQVFMTTLDHASVKKHLHD
FT                   LSISYQLFSVESGQVSLAAP"
FT   gene            3963..6431
FT                   /gene="gyrB"
FT                   /locus_tag="ABAYE0004"
FT   CDS_pept        3963..6431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ABAYE0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.1.1 : DNA bending, supercoiling, inversion"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84996"
FT                   /db_xref="GOA:A0A0R4J8C8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8C8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84996.1"
FT                   /translation="MSSESQSASQTEQTNEKAYDSSSIKVLRGLDAVRKRPGMYIGDTD
FT                   DGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGVSA
FT                   AEVILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYHHGD
FT                   PQYPLRVIGETDNTGTTVRFWPSAETFSQTIFNVEILARRLRELSFLNAGVRIVLRDER
FT                   INLEHVYDYEGGLSEFVKYINEGKNHLNEIFHFTADADNGIAVEVALQWNDSYQENVRC
FT                   FTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKEKVNVTGDDAREGLTAIISVKV
FT                   PDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGKIIDAARARDAAR
FT                   KAREMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILP
FT                   LKGKILNVERARFDKMISSQEVGTLITALGCGIGREEYNPDKLRYHKIIIMTDADVDGS
FT                   HIRTLLLTFFFRQMPELVERGHIYIAQPPLYKLKKGKQEQYIKDNDALETYLISNAIDE
FT                   LALHISADAPAITGEALAKVIQDYQVSQKSLQRLTLRYPASLLDALLEVDAFKADQNHD
FT                   QAYVQQWAYQVREAVQRLQPSLRPEITLETFERENAQGEKSAHYWPRVTVYVHNLPHAY
FT                   LLDAGLLNSAEYARLLKNSKSWFKLIEDGAYLQKGDRRIQVANFHQVWQHILQDSRRGM
FT                   MIQRYKGLGEMNAEQLWETTMDPENRNMLQVTIDDAIEADRMFSCLMGDDVEPRRAFIE
FT                   ENALNADIDA"
FT   gene            6469..6861
FT                   /locus_tag="ABAYE0005"
FT   CDS_pept        6469..6861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0005"
FT                   /product="putative of Cytochrome b(562) (CybC)"
FT                   /function="1.4.3 : Electron carrier"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84997"
FT                   /db_xref="GOA:B0VAF7"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84997.1"
FT                   /translation="MMSQKILASMLISCAALVSHSAFAADLEADMKTLAKSTKAFAEAK
FT                   DIDNAKQQLVIMRQAALSSKLSLPHKLEGLPPENVQVKEYQAGLDQLVAEIDRVTVFVD
FT                   KGQLDQAKTEAINLVNIRNENHKKFR"
FT   gene            complement(6945..7502)
FT                   /locus_tag="ABAYE0006"
FT   CDS_pept        complement(6945..7502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0006"
FT                   /product="putative DedA family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84998"
FT                   /db_xref="GOA:B0VAF8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84998.1"
FT                   /translation="MNFIDFITNFEQFLPILIQEYGAWVYAILFLIIFSETAFVFMFFL
FT                   PGDSLLLTVGALCSVVELMHLGYMITLLTVAATLGYIVNYSIGRHFGNRIFEAKSRFIK
FT                   KEYLNKTNRYFLQHGGKTILLARFIPFARSFAPLAAGSSNMSYGKFLIYNVAGAILWIC
FT                   ILLTAGYLFGHALIQVTDFVEN"
FT   gene            complement(7753..9684)
FT                   /locus_tag="ABAYE0007"
FT   CDS_pept        complement(7753..9684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0007"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /function="4.3.A.1.a : ABC superfamily ATP binding
FT                   cytoplasmic component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAM84999"
FT                   /db_xref="GOA:B0VAE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM84999.1"
FT                   /translation="MIQFDQVSLRRGGRVLFQKASMQLHPGWKIGLTGVNGAGKSTLFA
FT                   ALLGSLGADEGSLTRPSVWTVAHMAQEVKALDMPAIDFVLSGDEEYWDIQNKLAQPEQL
FT                   TDSDLAKLHGRFDEIHGYSAPSKAAQLMAGLGFLEHQLRLNVASFSGGWRMRLNLARTL
FT                   MSRSDLLLLDEPTNHLDLDAILWLEDWLKAYEGTLILISHDRDFLDAITDHILHIENQE
FT                   LTLYTGNYSTFETTRSERLAQQQQAFEKQQEARAHLQKFIDRFKAKATKARQAQSRIKQ
FT                   LERMQQLAPAHVDTPFTFSFREPTKMSSPLLTLENASIGYGDKKIAEKIKLQITPNSRI
FT                   GLLGMNGAGKSTLIKSLVGDLPLLAGERKASELLNIGYFAQHQMDALDGQASPMLQLAR
FT                   IADKQISEATLRSFLGSFGFSGERMDTPCESFSGGERARLALALIVWQRPNVLILDEPT
FT                   NHLDLDMRHALSMALQDFEGAVVLVSHERQLIASVCDELLLVHGGKCTEFEGDLQDYAK
FT                   WLREARQQQINAQTAIEQNNSSSAAPAPAKVDKEAQRKEAARRREQTRPIRKNIEKVES
FT                   QIEKLQPRLAEIEEALADTSLYEANRKDDLLKLMNEQTELKAKLEQYEEQLLELMMELE
FT                   EMEASFEN"
FT   gene            9941..10945
FT                   /locus_tag="ABAYE0008"
FT   CDS_pept        9941..10945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0008"
FT                   /product="putative RND type efflux pump involved in
FT                   aminoglycoside resistance (AdeT)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85000"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85000.1"
FT                   /translation="MKKRLGIVSAVICCAMGTTHAGQNVCVFDLLGKSGESYKMMEEWA
FT                   LAAKSWQADITLIPFQDEALVDRRLREGKCDAAYMTSMRARNYNKFAGSIDAIGGVTSN
FT                   AIAQKAISYVLDQRNKHRMLTTQNGTNYEVVGIVQIGLAYLFVRDRNLNSIEKVRGTKF
FT                   AILQYDAAQKIMVESVGAQPIPSEITDFVKKFNSGQVEAIAAPAYAYKPLEIGKGIGAN
FT                   GAMFTFPVVNVTGDLIARSDKFPANFGMKSREWFIKQLPQNFAMVKRLETGIPPKIKLN
FT                   FSAEDKLKYQKILREGRLGLTKQGVYDATMMSVLKRARCTIERTNFECTLTGE"
FT   gene            11201..12208
FT                   /locus_tag="ABAYE0009"
FT   CDS_pept        11201..12208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0009"
FT                   /product="putative RND type efflux pump involved in
FT                   aminoglycoside resistance (AdeT)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85001"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85001.1"
FT                   /translation="MKKIVLAMAAASVVGFSASAQAASTVCVFDLLGKAGDSYKMMEEW
FT                   ALAAKGWGTEINLVPRQDEAVADNDFKAGKCDAVAMTAMRARQYNKFAGSIDSLGGVPN
FT                   NQIAQRAITYVLDARNAAKMTTNLGGKKYEVAGISPLGSAFIFVRDKNINSVEKAAGKK
FT                   FAVLGYDDAQKIMVQRVGAQAVLSDISNFAAKFNNGQVDMVGAPAYAYKPLELNKGLGA
FT                   NGVMWNFPVLHVTADLVLRADKFPAGFGQKSRDWFVKQLPKSFAMINRLEAQIPGKYKM
FT                   NLSAEDKLKYQKMLRDGRMDLTKRGIYDAGMMSVLKKARCSVDKANFECSMPGE"
FT   gene            12509..13555
FT                   /gene="adeT"
FT                   /locus_tag="ABAYE0010"
FT   CDS_pept        12509..13555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adeT"
FT                   /locus_tag="ABAYE0010"
FT                   /product="RND type efflux pump involved in aminoglycoside
FT                   resistance"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85002"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85002.1"
FT                   /translation="MMPKTKNLQGKEKNMRFSKTLLLAMGLTTISFAAEAKQTICVFDF
FT                   VGKNGDVYALMKDYQLAAKNWGADIELKVNQNEAVIAEDFKAGKCDGISVSGMRGRQFN
FT                   SFTGSLDAIGAIPDLKLAVKVMQGLASQTFSKYMVNGRYEVVGVIPVGDAYLLVNDRSI
FT                   NTVAKAAGKKIAVLDYDEAQKIMVQQVGAQAVSADVTNFGAKFNNHQVDIIGAPAAAFK
FT                   PLELQKGLGTKGAIVNYPILQVTGNIIIRPDKFPAGFGQKSREWVAGQLPRAFTILGKM
FT                   KADIPQKYWMEVPAADKPGYQKLMRESRINLTKRGVYDKRMMKLLWQFRCKQDAKNFEC
FT                   GLQDENYK"
FT   gene            13680..14015
FT                   /locus_tag="ABAYE0011"
FT   CDS_pept        13680..14015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0011"
FT                   /product="putative chaperone involved in Fe-S cluster
FT                   assembly and activation (HesB-like)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85003"
FT                   /db_xref="GOA:B0VAE9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VAE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85003.1"
FT                   /translation="MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYG
FT                   FNFAESVNEDDAEFVNGDVKMLVDSLSYQYLVGSVVDYVEGLEGSRFIVQNPNATTTCG
FT                   CGSSFSI"
FT   gene            complement(14073..14918)
FT                   /locus_tag="ABAYE0012"
FT   CDS_pept        complement(14073..14918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0012"
FT                   /product="conserved hypothetical protein; putative
FT                   Hydrolase, alpha/beta fold family"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85004"
FT                   /db_xref="GOA:B0VAF0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85004.1"
FT                   /translation="MDLTKRIHQYTRGAWTFDVIDSGPIDGPLVVLLHGFPETAHSWEQ
FT                   TSELLHEHQFRTLAIHQRGYSLNARPQSRFHYALSELTEDVAVFIKGLGQPVYLIGHDW
FT                   GSVIASSVAMKYPQYIQHLTLVSVPHQAAFLKACLSSNQLLKSYYFAVFQLPILPELLF
FT                   KKMPKAGRKFLKTSGMTEQQIKIFETEFIKENRLTTALNWYRGFFWDKPENPFKTIDVP
FT                   TLFIWGKHDIAVTEKSAKLNSGYFKNNYKAIFMDASHWIPYQNAPELVQYFLESLHEQA
FT                   "
FT   gene            complement(15046..16173)
FT                   /locus_tag="ABAYE0013"
FT   CDS_pept        complement(15046..16173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85005"
FT                   /db_xref="GOA:B0VAF1"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85005.1"
FT                   /translation="MSAIYIGVMTGTSMDGVDIVAASFEPLQLHATLTVPFEPELRDEL
FT                   MALTLPDDNEIDRMGKADVALAKMIGHGINSLIEKHQLDRRQIKAIGSHGQTIRHRPEH
FT                   GFTLQIGDPNIITEITHIPVVSDFRRRDMAAGGQGAPLVPAFHQALFQHPSIHRVILNL
FT                   GGIANVSMLPANNPDGVFGFDTGPANILMDAWCHRHTGHPYDENGDWAAYGHPIRSLLD
FT                   RLYAHEYFSKEPPKSTGREDFNIDWLDDQLIDWRNDLTYDELEDTPENIQATLLKLTVR
FT                   AIQKAIYRSNMETGEVYVCGGGAYNSYLLEQLRWRLRKHNWSVQTTDVLGLSPTWVEAT
FT                   AFAWLAMRFVDGLSGNLPAVTGASDFRILGTITAV"
FT   gene            16253..17467
FT                   /gene="tyrS"
FT                   /locus_tag="ABAYE0014"
FT   CDS_pept        16253..17467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="ABAYE0014"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85006"
FT                   /db_xref="GOA:A0A0R4J761"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J761"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85006.1"
FT                   /translation="MSNFLPAEEQLALIQRGTHEIISEEDLLKKLKENRPLKIKAGFDP
FT                   TAPDLHLGHTVLINKLKTFQDLGHEVTFLIGDYTAMIGDPTGKSATRPPLSREQVEANA
FT                   KTYQEQVFKILDPNKTKVRFNSEWFNQKSAADLIQLASQQTVSRMLERDDFTKRYNNHQ
FT                   PIAIHEFLYPLVQGYDSIALEADVELGGTDQTFNLLMGRTLQSRYGQESQVCITVPILE
FT                   GLDGVNKMSKSLGNYIGVFDAPGAMYQKVLSMPDSLIERYFDLLSFKSLDEIKALLDEI
FT                   AAGRNPQEVKRILALELVERFHDAEAAANAHKSAGNRITEGEVPADTPEVTISRGEFGG
FT                   EIFIATILRVAGLNPNAAAAKDAVARGAVKVDWNVVDASFSVKENGTFIIQSGKKAIAR
FT                   VTFTD"
FT   gene            18342..19796
FT                   /locus_tag="ABAYE_16s_4"
FT   rRNA            18342..19796
FT                   /locus_tag="ABAYE_16s_4"
FT                   /product="ribosomal RNA 16s"
FT   gene            19911..19987
FT                   /locus_tag="ABAYEtRNA1"
FT   tRNA            19911..19987
FT                   /locus_tag="ABAYEtRNA1"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            20043..20118
FT                   /locus_tag="ABAYEtRNA2"
FT   tRNA            20043..20118
FT                   /locus_tag="ABAYEtRNA2"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            20459..23360
FT                   /locus_tag="ABAYE_23s_4"
FT   rRNA            20459..23360
FT                   /locus_tag="ABAYE_23s_4"
FT                   /product="ribosomal RNA 23s"
FT   gene            23536..23650
FT                   /locus_tag="ABAYE_5s_4"
FT   rRNA            23536..23650
FT                   /locus_tag="ABAYE_5s_4"
FT                   /product="ribosomal RNA 5s"
FT   gene            23789..24388
FT                   /locus_tag="ABAYE0016"
FT   CDS_pept        23789..24388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0016"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85007"
FT                   /db_xref="GOA:B0VA30"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85007.1"
FT                   /translation="MIIYGDVDSGNCYKIKLLLSLLNINHRWIHVDILNKDTQTAEFLS
FT                   LNPNGKIPVLVLDDGRVLSESNAILGYLAEGTELIPADPYMKAKMYQWMFFEQYSHEPF
FT                   IAVARFINKYLGLPPERIEEYHKLQPKGHKALSIMNKALVGHDYLVGNKFTIADIALYA
FT                   YTHVAEEGGFDLKLYPNIQEWCQRIQKYPKYVSMVE"
FT   gene            complement(24446..25144)
FT                   /locus_tag="ABAYE0017"
FT   CDS_pept        complement(24446..25144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0017"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85008"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85008.1"
FT                   /translation="MMMKILKLSFLVLGMGLSGFAQADFIGVKGDVGYWFYDGKANMSS
FT                   QSPEDQDLDRKGSAQLSLAFEHPIPFIPNAKIRYVNLDTQTKSETLGQANYNVDLDHSD
FT                   FILYYELLDNIVSVDAGLGATVLNGDITAYTGKRVDIDKTYPIAYLSGEVKLPFTGLSA
FT                   KGEATYTNFDDAKITDALVEAKYKFADNLLIDLGLTAGYRILNIDLDDYDNNDLKFEFK
FT                   GPYVGLEAHF"
FT   gene            25768..27246
FT                   /locus_tag="ABAYE0019"
FT   CDS_pept        25768..27246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0019"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85009"
FT                   /db_xref="GOA:B0VA32"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85009.1"
FT                   /translation="MTDTRENWTSRSGFIIAAVGSAVGLGNIWRFPYVAYENGGGAFLI
FT                   PYLLALITAGLPLLFLDYAVGHRSTGSPPKAYRALFKGGETLGWWQVCVCIIIGLYYAS
FT                   VLTWAGSYVYFSIGQMWGSDPEGFFFNTYLQTTKATGFDLQFVGHLFWPIVGIWALTLI
FT                   ILYGGVKKGVELSNKIFMPLLFILFTILVIQSLRLPGAVQGLNAFFTPNWSAMMDYKVW
FT                   LAAYGHTFFSLSVGFGIMVTYASYLKPKTNLTGSGLIVGFANASTEILAGIGIFAALGF
FT                   MAHAAGTEVKDVVSGGIGLAFIAFPKIISSLGSGADLFGLLFFSSLFVAGISSMVSILE
FT                   VPIAAMQDKLKWGRKKAVTIIGGGSALVSIILFSSVNAIKLVDIVDHFINNIGIIGGAL
FT                   LSIISVAWFKRSALKELRDHVNRISTIQLGKGWDFTLTVITSLILLTTLCMTVFNLIKN
FT                   GYDTYSMSLQGVFGWGSVIFCAVVAIVLSKMKDR"
FT   gene            27259..27402
FT                   /locus_tag="ABAYE0020"
FT   CDS_pept        27259..27402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0020"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85010"
FT                   /db_xref="GOA:B0VA33"
FT                   /db_xref="InterPro:IPR031596"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85010.1"
FT                   /translation="MNTSAIVMLIISMVFVWGGLALSILHLTKHPEELDEVLEEVKDQH
FT                   TL"
FT   gene            complement(27446..28750)
FT                   /gene="sun"
FT                   /locus_tag="ABAYE0021"
FT   CDS_pept        complement(27446..28750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="ABAYE0021"
FT                   /product="16S rRNA m5C967 SAM-dependent methyltransferase"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85011"
FT                   /db_xref="GOA:B0VAD9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85011.1"
FT                   /translation="MSQVTSNSSRFNLRAQVVQTLLKVQQGQSLASILNTQLNQVAERD
FT                   RALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCLYVGLYQVLCTRIAAHAAISE
FT                   TVDATKQLGFPALSGIVNAILRRATRETEDFEQGLHQAHGLPSWLFKRLKKDWGEQTEA
FT                   LCQSLKQVAPLTLRVNQRHIGRDAYLAKLQSLDIQARACLFSEAAIVLEQSVQITQLPG
FT                   FEQGWFSVQDEHAQLCATLLPDLNNKTVIDACAAPGGKTAHLLEKFKPAQLIAIDQDPS
FT                   RLVRVTENLNRLALDQSHTEILAADATKWNPVQPVDCIVLDAPCSATGVIRRHPDIRLL
FT                   RQSSDIAQTIELQKQILEHMWQQLKVGGTLLYITCSILKSENEQQMINFFTEHPDAKEV
FT                   KIEADWGIEQVHGRQLLPEAQSGDGFYYCKIQKIT"
FT   gene            complement(28747..29709)
FT                   /gene="fmt"
FT                   /locus_tag="ABAYE0022"
FT   CDS_pept        complement(28747..29709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="ABAYE0022"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.5 : tRNA"
FT                   /function="2.3.2 : translation"
FT                   /EC_number="2.1.2.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85012"
FT                   /db_xref="GOA:B0VAE0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VAE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85012.1"
FT                   /translation="MKIIFAGTPEFAATALAALLKTSHEIIAVYTQPDRKAGRGQKLTP
FT                   SPVKQLALEHNIPVYQPLHFKASTEEGLAAQQELAALGADVMVVAAYGLILPQAVLDTP
FT                   KYGCLNIHGSLLPRWRGAAPIQRAIATGDDETGITIMQMAAGLDTGDMMYKTYCPITSE
FT                   DTSATLHDKLAAQGATAICAVLESEETLQKYLAEREVQDESLTVYAHKLVKSEARIDWS
FT                   MNAVQVDRNIRAFNPWPVAFIQLDENNALRVWNSTISSQSKVNAQAGEIIAIDKQGVHV
FT                   ACGENTFICLTSVQWPGGKALNAQQIAQTQKLHVGQILP"
FT   gene            30058..31887
FT                   /gene="ilvD"
FT                   /locus_tag="ABAYE0023"
FT   CDS_pept        30058..31887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="ABAYE0023"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /function="1.5.1.18 : isoleucine/valine"
FT                   /EC_number="4.2.1.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85013"
FT                   /db_xref="GOA:B0VAE1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VAE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85013.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARGLWRATGMKDEDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAAEIQAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVKFRGDEKAID
FT                   LVDAMVVAADDSYTDEEVAEFERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSIV
FT                   ATHANRKKLFLKAGQLIVELAKRYYEQNDASILPRSIATKAAFKNAMTLDIAMGGSTNT
FT                   VLHLLAAANEAEVDFTMDDIDELSRRVPVLSKVAPAKQDVHMEDVHRAGGIMAILGELD
FT                   RANLLDVSVPTVHEKTLKDALDKWDIIRTEDPDVYEFYRSSPGGVPTQVAFSQNRYYST
FT                   LDGDREKGVIRNAEHAFSKDGGLAVLYGNIALDGCIVKTAGVDESILKFTGSARVFESQ
FT                   DAAVEAILGNEIKAGDVVIIRYEGPRGGPGMQEMLYPTSYLKSKGLGKDCALVTDGRFS
FT                   GGSSGLSIGHVSPEAAEGGAIGLVEDGDTIEIDIPNRTIHLNIDDATLAHRRTVQEAKG
FT                   WHPKEERKRKVSKALKVYAMHTTSAAKGAVRVL"
FT   gene            32201..33490
FT                   /locus_tag="ABAYE0024"
FT   CDS_pept        32201..33490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85014"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85014.1"
FT                   /translation="MSLLRRWFDPIRSSWFYQKPSRQAVLPTENGLSIYLRLDDVYSYL
FT                   AVQQLSQLDEILSDELKPLKIIISHTASEPPNSMTHEEWQHYCLNDAKILANQHRFAFD
FT                   EFPEIPSPESLKQAAVILKRTPLQGQNFLHLLEDIFHMLWQQQYGKLRTLHAMAVKHQV
FT                   PQHFPERIFTDEPVRAAYFEFGGRKYHAVDDLLRLTRRLKQQKLLTGNPIFLINHIEWR
FT                   EHLINDAEALNEIQALHPELDVFIALEDPMSWLLLAYIKEELADYYDIQLKVYPLSYRG
FT                   RDWFDWSLATRVSKRTEVAFTPFCRPTEESTLGMAKLFYSVPENQQLDTIFTILQAVWT
FT                   KGKDLSFQKHFQQLQQQLGIEQLTEQDIQSVLAQNDALCQDKHQPDLPVLELRIDGQSY
FT                   VFNSLYRVWMIESIFSNVLEEKYKTASTSN"
FT   gene            33569..34300
FT                   /locus_tag="ABAYE0025"
FT   CDS_pept        33569..34300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0025"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85015"
FT                   /db_xref="GOA:B0VAE3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85015.1"
FT                   /translation="MTFLAIIMMVFAFAGMIKGMIGLGLPAVSMGLLTIAMSPFQAASL
FT                   LIVPSMVTNVWQLFAEGHVWAFIRRFWTLLAGIVVGSIWSFLPTLSQSHGQSSEILLGC
FT                   MLALYGLYGLCVKKLPHLGKHERWLSPIIGYIGGAVTVATGVIIIPIVPYLQSLHLKRD
FT                   ELVQALGLTFTVSTICLAVFLHHNPMSGITLDYRLSFAALLAALIGMWIGKKIRYRLNE
FT                   QIFRRIFFIGLMSLGLYMILH"
FT   gene            complement(34309..35199)
FT                   /locus_tag="ABAYE0026"
FT   CDS_pept        complement(34309..35199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0026"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85016"
FT                   /db_xref="GOA:B0VAE4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VAE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85016.1"
FT                   /translation="MRFDFFDLQLVLHIVSTGSLTKGADRSAISLQAASERIKKLEQYF
FT                   ETPLFIRQTTGVELTTAGHAFVEHARQLLAQKDQLEHEMQRFRQPTTEALTLWCNSSAQ
FT                   SEYLPTLLPQYLVLHPEMNIDLHEAESSEIVDALTQGIASLGLVSSFFNTRHLQTKEFA
FT                   SDPLVLICPVTHELAHYKELNLVDALSYGFIGLKSHHSLQQSIETQAKLLGFNIQYRLR
FT                   LPNFGAIAEVVAKGVGIAIMPARAAQRLQSDYDFHSIQLLGAWANRKLLLATQSFNQLP
FT                   SSYQQFADFLLQHRP"
FT   gene            complement(35279..36574)
FT                   /locus_tag="ABAYE0027"
FT   CDS_pept        complement(35279..36574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0027"
FT                   /product="putative uracil transport protein (NCS2 family)"
FT                   /function="4.2.A.40 : The Nucleobase:Cation Symporter-2
FT                   (NCS2) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85017"
FT                   /db_xref="GOA:B0VA18"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85017.1"
FT                   /translation="MSNWFPKWQPYQGDVDHRPVSTNEYLPPVQSAILGIQHAFAMFGA
FT                   TVLAPLLMGFNPNLAILMSGICTILFFLITGGRVPSYLGSSFAFIGVVAAATGHITGSG
FT                   ANPNLSIALGGIVACGIFYALIGFIVMLTGTRWIEKLMPPVVTGAIVMIIGLNLAPVTI
FT                   KGVAGQPFEMWMALITVLCMGSIAVFTRGLLQRLLLLVGLILAYVIYAIATNGLGLGKP
FT                   IDFSQISQASWFGIPSFSHPTFDTKAILIIAPVALILVAENLGHIKAVGAMTGENLTPQ
FT                   LGKAFVADGLATTLSGSVGAPGMTTYGENIGVMAVTRVYSTIVFVIAGIFAIFLGLSPK
FT                   FGAVISTIPSAVLTGASIVVFGLITIAGAKIWIENKVDFSNNKNLIVASVTIILGAGNF
FT                   ELLFGNFNLGGIGTATFAAIILNWLFSLKDKT"
FT   gene            complement(36875..39559)
FT                   /gene="ppc"
FT                   /locus_tag="ABAYE0028"
FT   CDS_pept        complement(36875..39559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="ABAYE0028"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /function="1.3.4 : tricarboxylic acid cycle"
FT                   /EC_number="4.1.1.31"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85018"
FT                   /db_xref="GOA:A0A0R4J6X5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6X5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85018.1"
FT                   /translation="MVQQIDAPLREDVRLLGNLLGETLKQHAGQELFNQIEQIRALAKG
FT                   ARDGQAEAEKQLEQLFLELPDEELLPLTRAFSHFLNFANIAEQYHVVRSRRQAEFDPDA
FT                   NSPNPLVHLFKKFKDKNISTEKLFQQICDLKIELVLTAHPTEVSRRTLIQKYDDINACL
FT                   SQLDQQKLTPRERQNALANLKQQISSAWQTDEIRQHRPTPVDEAKWGFATIEQTLWNAV
FT                   PKFIRELNELVQDNCQQNLPLHIAPVRFASWMGGDRDGNPNVTHQITQEVLWLSRWQAA
FT                   DLYLRDIENLRWELSIQSCSEEMVEAIGSPHPEPYREYLRATRERLKATRHWLAQRLQG
FT                   LEADDSNVIKSKDELLQPLLLCYRSLIDSNLPEIANGQLLDFIYRVNCFGIELLKLDIR
FT                   QESGRHRQAISAITEYLGLGNFESWTEQARQNFLIQELQSKRPLLPKYINEPEGSLIGH
FT                   PDVQEVFATMRTLADQPPESLGAYIISMAEYPSDVLAVLLLQKEAGIQHPLRVVPLFET
FT                   LKDLDGAATTMNTLFNMHWYKQHIQGKHEVMIGYSDSAKDAGFMSANWAQYRAQEELTA
FT                   IARKHGVQLTLFHGRGGSISRGGAPTQQALFSQPPGSISGAIRVTEQGEMIRFKFGLEG
FT                   IAMQNLEIYTAATLEATLLPPPEPKAEWRELMNRMTDHSVKVYRQTVRENPHFVKYLRT
FT                   VTPELELQMLPLGSRPAKRKVSGGIESLRAIPWVFAWTQIRLMLPAWLGTGAAINEVIA
FT                   DQQKATLDEMLQQWPYFQTLIDMLEMVLSKADANIALYYESHLTEDEDLKVLGNQLRQR
FT                   LKDAVETLLTLKDESKLLSDNEVLDQSMQVRKPYLLPLHLLQAELMKRRRDYLAERQAE
FT                   HTPVDHALMVSIAGIAAGLRNTG"
FT   gene            complement(39730..40353)
FT                   /locus_tag="ABAYE0029"
FT   CDS_pept        complement(39730..40353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0029"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85019"
FT                   /db_xref="GOA:B0VA20"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85019.1"
FT                   /translation="MQTVNQSGRPKDLEKRARILQAAKAIFLKSGYHGTSMNLIAQEAG
FT                   VTKLTVYNHFQDKANLFICAITETCEETLGTKPFELDASADFYQTLYMVCSRALQIIYS
FT                   PEALKLEHVLFELAAEQSPLALQFFNASHTRLQNQLVEFFQKAAQLGFIQADDPLYQTE
FT                   LLLTLLLGVRHHKVLLGIIPVPNTQEIDRFIRDAIDLFLLKYRH"
FT   gene            40503..41603
FT                   /locus_tag="ABAYE0030"
FT   CDS_pept        40503..41603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0030"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /function="4 : transport"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85020"
FT                   /db_xref="GOA:B0VA21"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85020.1"
FT                   /translation="MNLLKPLIMSMMIVCMVTLMGCSKEAPKTEEIPYVMVTQPSTTLH
FT                   EQKSYAGDVQARQQTALAFRVGGQVTARYVDVGDRVRVGQVLAKLDVADAQLQLNAAKA
FT                   QLENAQAAAKTASDELKRFQQLLPINAVSRSQYDTVKNQYDAAQAALQQARSNYEVSAN
FT                   QTGYNQLVSNKNGVITARNIEIGQVVAAGQAAYQLAIDGEREVVIGVPEQAVSEIKVGQ
FT                   AAWITLWSKPNERFAGYVREVSPAADQSRTFTVKVALKEGQSAIQLGQSARVFFSSTQT
FT                   NVMSVPLSSVSATDNQPYVWVVNANQTLRKVPVTIGAYARDSVPVLSGLTPNDWVVIGG
FT                   VHLLRDKQKIHPIDRENRAVKIQGAK"
FT   gene            41606..44731
FT                   /locus_tag="ABAYE0031"
FT   CDS_pept        41606..44731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0031"
FT                   /product="putative efflux transporter causing drug
FT                   resistance (Acr family)"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /function="4 : transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85021"
FT                   /db_xref="GOA:B0VA22"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85021.1"
FT                   /translation="MKFNLSEWALNNKGIVLYFMLLLGIIGAISYSKLSQSEDPPFTFK
FT                   VMVVQTYWPGATAKEVSTLVTDRIEKELMTTGQYDKIMAYSRPGESMVTFVAKDSLTSA
FT                   QIPDVWYNVRKKVNDIRHELPSGVQGPFFNDEFGDTFGNIYVLTGKDFDYALLKEYADR
FT                   LQLQLQRVKDVGKVELIGLQDQKIWIEISNTKAVQLGIPVSAIQEALQKQNSMASAGFF
FT                   ETGTDRIQIRVSGQLQSVEDIKKMPLLVGDKTIQLGDVADVYRGFSQPAQPRMRFMGDN
FT                   GIGIAVSMRKGGDIIALGKNLETEFAQLQKTLPLGMKLQKVSDQPVAVQRSIHEFVKVL
FT                   AEAVIIVLLVSFFSLGFRTGLVVAFSIPLVLAMTFAGMNLFDVGLHKISLGALILALGL
FT                   LVDDAIIAVEMMAIKMEQGYSRIKAAGFAWKTTAFPMLTGTLITAAGFLPIATAQSSTG
FT                   EYTRSIFQVVTIALLVSWVAAVLFVPYLGEKLLPDFTKTGHQAPWYVRLWARVTKKPQP
FT                   QTVAISQDHHYDPYQSSFYLRFRKMVEFCVTYRKTVIATTVGIFVLSVLMFKMVPQQFF
FT                   PPSNRAEILVDLKLEEGASLTATEQAVKKVEQFLSKQKGIDNYVAYVGTGSPRFYLPLD
FT                   QQLPQASFAQFVVLASSLDDRDEIRRSLETQIKQLLPQVRTRVSLLENGPPVGYPLQYR
FT                   VSGEDLNLVRKEAQQVARVISENPNTTNVHLDWGEPSKIISIQIDQDRARQMGVSSLDL
FT                   ANFLNASITGSAIEQYREKRELIEIRLRGDKAERVEVASLASLAVPTANGTTVPLAQIA
FT                   KIEYKFEDGLIWHRNRLPTITVRADIRTNLQPATVVGELAESMDKLRAELPSGYLIEVG
FT                   GTVEESARGQSSVNAGMPLFLAVVMTLLMIQLKSLSRATIVFLTAPLGLIGVVLFLLLF
FT                   NKPFGFVAMLGTIALSGMIMRNSLILIDQIEQDRQAGHPTWEAIIDATVRRFRPIILTA
FT                   LAAVLAMIPLSRSIFFGPMAVAIMGGLIVATLLTLFFLPALYAAWFKVKKTA"
FT   gene            44871..45248
FT                   /locus_tag="ABAYE0032"
FT   CDS_pept        44871..45248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0032"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85022"
FT                   /db_xref="GOA:B0VA23"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85022.1"
FT                   /translation="MGQDHIEQHRRYIVISYAFMFLALFTVIFAAFAYLVARKVAVVDD
FT                   AEVWIHAHALWIMRNGILFLLMSVFAVVWFIPLFFFAWDSNLWVTASTVAGVVFSAIAW
FT                   LFLLNAWLKGLSKYLKNKAVF"
FT   gene            45353..46465
FT                   /gene="dnaJ"
FT                   /locus_tag="ABAYE0033"
FT   CDS_pept        45353..46465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ABAYE0033"
FT                   /product="heat shock protein (Hsp40), co-chaperone with
FT                   DnaK"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85023"
FT                   /db_xref="GOA:B0VA24"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VA24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85023.1"
FT                   /translation="MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEE
FT                   KFKEASEAYEILSDSEKRSMYDRMGHNAFEGGFGGAGGGFGGFSAEDIFSQFGDIFGGA
FT                   FGGGGRQQRQRRGSDLRYVMELTLEEAVKGVKKTITFTAPAPCDVCDGKGSKNPKDVET
FT                   CKTCHGSGQVRMQQGFFSVQQTCGTCRGQGKIIKNPCHACHGSGVADRQQTLEVTIPAG
FT                   VDNGDRVRLSGKGEAIRDGQAGDLYVEVVVREHEIFQRDGADLYMDVPVSIADAALGKE
FT                   IEIPTLEGRVSLKIPEGTQTGKLFRLRGKGVRPVRSSMVGDLLCRIVVETPVNLTSRQR
FT                   ELLKELQASFDGEDSASSPKKKSFFDRLFD"
FT   gene            complement(46580..46930)
FT                   /locus_tag="ABAYE0034"
FT   CDS_pept        complement(46580..46930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0034"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85024"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85024.1"
FT                   /translation="MHSKVIGLIAIMGIISSVAFAEPAIQPGETLESLSKARITTNVNT
FT                   QAATPTAQTSDANAEVKVEDIDPIIEEKTEETLKAAVQPAPQATVEAIVAPVTSSELNV
FT                   SVDDIDVAHPTE"
FT   gene            47115..47936
FT                   /gene="dapB"
FT                   /locus_tag="ABAYE0036"
FT   CDS_pept        47115..47936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ABAYE0036"
FT                   /product="dihydrodipicolinate reductase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.1.3 : amino acids"
FT                   /function="1.5.1.7 : lysine, diaminopimelate"
FT                   /EC_number="1.3.1.26"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85025"
FT                   /db_xref="GOA:B0VA26"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VA26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85025.1"
FT                   /translation="MSAAPRIGILGAGGRMGRILIQAVQQAGYQLGAAVVRPESTLIGA
FT                   DAGELAGIGSIGVKLTGSLAEVLEDCDVVIDFSTPAATSEHLKLCREAGVAIVIGTTGM
FT                   SDEQKAELDETAKHIPVVYAANYSVGVNVSIKLLELAAKVFGDTVDIEVIEAHHRHKVD
FT                   APSGTALMMGEAIADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMF
FT                   IGEGERVEVTHKATNRMNFAAGAVRAAAWVVGREARKYDMKDVLGLNDVQV"
FT   gene            47988..48641
FT                   /locus_tag="ABAYE0037"
FT   CDS_pept        47988..48641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0037"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85026"
FT                   /db_xref="GOA:B0VA27"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR028347"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85026.1"
FT                   /translation="MNKKQIALTTLLCLSSLYTGAASTDKAKLSLDRNHIKVWTYQKAD
FT                   NPVFQYKAETTFDVPLERAVAVILDVDRAAQWVPYMGKVQMLSQDEKKGEFTLYMVLDF
FT                   PFPLKDRDVVVKGKMSKAANGLITIKNTAVNSNYPIQPDVVRLTRYEGDWTFQKLANNK
FT                   VKVTTSGYADPAGAIPLSFVNMFVQQQPYQMLLKMKREVMNPIYEQPKLPEILK"
FT   gene            complement(48682..49941)
FT                   /locus_tag="ABAYE0038"
FT   CDS_pept        complement(48682..49941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0038"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85027"
FT                   /db_xref="GOA:B0VA28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85027.1"
FT                   /translation="MPNSTVTVVKLAQSHGHQFGTKLMNTQSNTAFSLLALAIGAFAIG
FT                   TTEFSPMGLLPNIANDLGISIPTAGMLITGYALGVMLGAPFMTLWFGGFARRNALIFLM
FT                   AIFTVGNLIAAFSPNYMSLLGARLITSLNHGAFFGIGSVVAASIVPAHKQASAVATMFM
FT                   GLTIANIGGVPLATWVGQNIGWRMSFLAISVLGIITMLALWKALPQGMVAQKPNVKAEL
FT                   KVLTRTPVVLALLTTVLGAGAMFTLYTYIAPSLTEFTHASPTFITFMLVLIGVGFSIGN
FT                   HLGGRFADLSINKTLIGFLVLLIVMMVTFPILAQSQIGAAIALVIWGAATFALVPPLQM
FT                   RVMSVAHEAPGLASSVNIGAFNLGNAVGAAAGALVLDLGWGYSAVSFAGALLAGLGLLL
FT                   VLFQIKRESSPAQTLQQCSD"
FT   gene            complement(49877..50764)
FT                   /gene="alrA"
FT                   /locus_tag="ABAYE0039"
FT   CDS_pept        complement(49877..50764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alrA"
FT                   /locus_tag="ABAYE0039"
FT                   /product="aldehyde reductase"
FT                   /function="1.8 : metabolism of other compounds"
FT                   /EC_number="1.1.1.21"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85028"
FT                   /db_xref="GOA:B0VA29"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85028.1"
FT                   /translation="MLIHLFFRNNKKSKMHLKLNNYLISGEYMNIPRFGLGTFRLKEQA
FT                   VIDSVKNALDVGYRAIDTAQIYENEAAIGQAIAESGVSRQDLFLTTKIWVDNFAQEKFI
FT                   PSLKESLQKLRTDHVDLTLIHWPAPDLGVSIPEIMQLLLEAKQQGLTKQIGISNFNIAL
FT                   TQQAIDTIGVEHIATNQIELSPYLQNHKLVNFLQEKNIDVTSYMTLAYGKVLQDPVLAE
FT                   IAAAHKATTAQIALAWALQRGFAVIPSSTKRENLISNLKAQDIELTAAEMQMIAELDRN
FT                   SREVSPEPWAPVWD"
FT   gene            50801..51703
FT                   /locus_tag="ABAYE0040"
FT   CDS_pept        50801..51703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0040"
FT                   /product="putative transcriptional regulator;
FT                   transcriptional activator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85029"
FT                   /db_xref="GOA:B0VA07"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85029.1"
FT                   /translation="MKSTIEELVAFITIVDTGSFVAAAEHLKQTPSGVSRSLTRLEAKL
FT                   DVTLLERTTRKLKLTQEGQQFLIKARKILNELNAAEEELQKSDQGTAGLIRVDSATPFV
FT                   LHVIAPLMHKFRECYPDIEIELNSNDQVIDLLQHKTDVAFRFGELNDSSLHAKLVCKSR
FT                   LYIVASPDYLALKGTPTQPEELEHHDLIGFTRPTYINSWPIKVGDEYFFAQSKIKASSG
FT                   ETVRQLTIRGHGIARLSEFEIWKDMEEGRLIALFEDKIEHQYQSIHAVYYQQEHLPKRI
FT                   RLFIEFLAEQLKDGFKNAL"
FT   gene            complement(51687..52091)
FT                   /locus_tag="ABAYE0041"
FT   CDS_pept        complement(51687..52091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85030"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85030.1"
FT                   /translation="MEINSESSKPMKLKVILLFTIVLAGCQPQPKNEQHRHTVCQSLIE
FT                   GYLKMTNQQDYKMEQRTNDETSAISHYEYKRNSSNEVVMVNSVYSKLYFSCQEQQKSYF
FT                   LSQHSAQGQTTPILEVHIPTDSYTTFRERF"
FT   gene            52152..53576
FT                   /locus_tag="ABAYE0042"
FT   CDS_pept        52152..53576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0042"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85031"
FT                   /db_xref="GOA:B0VA09"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85031.1"
FT                   /translation="MTFQYQVLANQLAHRIYQDELKPHQKLISLRDFARQQGISLSTAK
FT                   SCYELLEARGLIYVKPKSGYFVVARTPSSPIPDSPDFLSLPRHVSNLELHNQIQEAALQ
FT                   SHLVPLGSIQLTPHFIPVEGLRRSIQRALKNCQPQDFLYCNKQGHEQLRKALSDHWRED
FT                   GIYIAPEDIFITNGCMPALSLVIQKLTEVGDSILIPTPTYNGHLQLLASLKRQIVEIPA
FT                   DHRGIDLERLESLMQQGLAKVCLMTANYQNPLGYCFSNAEKQKIAELAAKYQCFIIEDD
FT                   IFGECGYSSERPLPIRYWDREGYVIWCGSVSKSLSSAYRVGWFCLTTKLEYLKLELLVS
FT                   NIGVNTPLQLGLADFIYSRGYREHLEQLRPNLMRQVEEYRSCILKAFEGIPIALSQPEG
FT                   GYALWIQLPKSVDSLALYYTAQAQGITVVPGHVFGEDERYRHFIRLNAGHELTADVRQA
FT                   IMSLADWSRQQMQTVS"
FT   gene            complement(53579..54607)
FT                   /locus_tag="ABAYE0043"
FT   CDS_pept        complement(53579..54607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0043"
FT                   /product="putative alcohol dehydrogenase"
FT                   /function="1.8 : metabolism of other compounds"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85032"
FT                   /db_xref="GOA:B0VA10"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85032.1"
FT                   /translation="MSNNTIQAYAAMQAGEKLVPYQFDAGELQPHQVEVKVEYCGLCHS
FT                   DISVLNNEWRSTVYPVVAGHEIIGRIVALGSEAKGLQIGQRVGIGWTAESCQACDECIG
FT                   GQQVLCTGENVATIVGHAGGFADKVRAGWQWAIPLPEDLDPESAGPLLCGGITVFDPLL
FT                   KHKIQATHHVGVIGIGGLGHIAIKLLKAWGCEITAFSSNPDKTEELKAMGADHVVNSRD
FT                   TEAVKAQKGKFDLLLSTVNVTLNWRAFISTLAPNGSLHFLGLTLEPVPVSVGSLIDGAK
FT                   SVTGSPTGSPAALRQLLKFAARKKIAPQIELFPMSQLNEAIERLHSGQARYRIVLKADF
FT                   AE"
FT   gene            complement(54646..55206)
FT                   /gene="tag"
FT                   /locus_tag="ABAYE0044"
FT   CDS_pept        complement(54646..55206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="ABAYE0044"
FT                   /product="3-methyl-adenine DNA glycosylase I, constitutive"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="3.2.2.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85033"
FT                   /db_xref="GOA:B0VA11"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85033.1"
FT                   /translation="MKTQRCGWCSDDPLYIAYHDEEWGKPEHDEARLFEMLCLEGQQAG
FT                   LSWITVLKKRESYRQHFFNHPIADIAAFTDDFLETKLSDAGLIRHLGKLKAIRDNAIAW
FT                   QALKAQVGDVSKWLWQFVDAAPQNNDVADYRKAPAQTELSLKLSKTLKKNGFKFVGPTT
FT                   CYAFMQAVGMVNDHENDCQFKAS"
FT   gene            complement(55237..55482)
FT                   /locus_tag="ABAYE0045"
FT   CDS_pept        complement(55237..55482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85034"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85034.1"
FT                   /translation="MSEALINRLVEFAESGNQQKIILNGNSYQGWIMEISDDALLISTG
FT                   FSDKVGKDFWLKFEDLTQAELYYWDTRPNEWVPFKL"
FT   gene            complement(55492..56028)
FT                   /locus_tag="ABAYE0046"
FT   CDS_pept        complement(55492..56028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0046"
FT                   /product="putative peptidase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85035"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85035.1"
FT                   /translation="MRRFVSHLSLGFLIILLAACASAPKKPAPLSPAQVSKLKSMQLPS
FT                   RLPVPVKGVDRDELKDTWGAARSQGRSHEGIDILAPRGTKVYSATEGLIADLRNNNLGG
FT                   KVIWILGPAGTWHYYAHLDGHKRGLNVGDYVKKGDLIGYVGNTGNARYTSPHLHYGLYL
FT                   DGKGRGAVNPYSYLR"
FT   gene            complement(56076..57110)
FT                   /gene="mutY"
FT                   /locus_tag="ABAYE0047"
FT   CDS_pept        complement(56076..57110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="ABAYE0047"
FT                   /product="A/G specific adenine glycosylase"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85036"
FT                   /db_xref="GOA:B0VA14"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85036.1"
FT                   /translation="MPEFSFSDALLNWFDQHGRHDLPWQVADDPYKVWVSEIMLQQTQV
FT                   KTVLQYFDRFMERFPTVEALGHATWDEVAPYWAGLGYYARARNLHKAASLVAQQGKFPE
FT                   TLEEWIALPGIGRSTAGALMSLGLRQYGVIMDGNVKRVLARFFAIEDDLSKPQHEREMW
FT                   KLAEELCPTHRNHDYTQAIMDLGATICTPKKPLCLYCPMQAHCQAYQQGLEQELPFKKP
FT                   KKTPPVKTADVLIIQCEDEWFWQQRQAHGLWGGLFCLPILENEHERLKLSQQFKLQPRP
FT                   QTFQISHSFTHFTWLLNAHVFHVEPDQKEHLAIELEGQWLSPEQAIAKGVPTAMKKLIS
FT                   TSRS"
FT   gene            complement(57251..57613)
FT                   /locus_tag="ABAYE0048"
FT   CDS_pept        complement(57251..57613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0048"
FT                   /product="putative histidine triad family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85037"
FT                   /db_xref="GOA:B0VA15"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85037.1"
FT                   /translation="MTDKKCPYCDFDEYDIIDKNEFAVILPDPNPLSKGHCVVTPLRHV
FT                   SSFFDITSKEHQGLLTLLEIARHETQLRHQPDGFHIGFNDGEVFGQTSDHFHIHVIPYY
FT                   KNQPLKLDQRWGVQKD"
FT   gene            complement(57798..58535)
FT                   /locus_tag="ABAYE0049"
FT   CDS_pept        complement(57798..58535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85038"
FT                   /db_xref="GOA:B0VA16"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85038.1"
FT                   /translation="MSTAIKTREIQYTAPDGSHLIGYFAAPESETPVPGVIIGPEWWGR
FT                   NEYTEQRARELAEHGYAALAIDMYGDKKVTTTAAQAYEWMMQTFEDLDTVTDRANAGLQ
FT                   TLAAQPEVNSEKLAAVGFCYGGKVVLDLARSGAPLKATATFHGTLAPKAPAQKGNIQGE
FT                   VLVLHGELDSMVTLEDVANFEKEMQAAEVKHEVVVLKDAKHGFSNPLADERAKANGVDL
FT                   GYNSEAEKQGLAKMYALLERTLK"
FT   gene            complement(58707..58865)
FT                   /locus_tag="ABAYE0050"
FT   CDS_pept        complement(58707..58865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0050"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85039"
FT                   /db_xref="GOA:B0VA17"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VA17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85039.1"
FT                   /translation="MFRWAIIFAVIALIASLLGFGGVAGLSKDFAVILLVIAVILAVIG
FT                   FISRGRT"
FT   gene            59060..59518
FT                   /locus_tag="ABAYE0051"
FT   CDS_pept        59060..59518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85040"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85040.1"
FT                   /translation="MSTETSLRPLFWKNYTLEQLTQAEWEALCDGCGLCCLVKLEDEDT
FT                   HEVAYTKVACKLLDCNTGRCSDYPNRQQQVPDCLQLTPETLKTINWLPSSCAYKRLNEG
FT                   KNLPSWHYLNTGSRQSVVKAKKSVAGRCIPETDVHEDDIEDYVVRWVR"
FT   gene            59628..60800
FT                   /locus_tag="ABAYE0052"
FT   CDS_pept        59628..60800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0052"
FT                   /product="putative PQQ-dependent aldose sugar dehydrogenase
FT                   precursor"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="1.1.5.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85041"
FT                   /db_xref="GOA:B0V9Z6"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85041.1"
FT                   /translation="MMRRLAAPLLCSSFFLLMACGSNNTNSKSPEQNTTAKTEQTNAAK
FT                   QIYQVEAVAHFKEPWAITSLPDQRLLVTERQGKLKIFNPQNKQMLDIQGIPAVSYGGQG
FT                   GLGDVALHPDFAKNHWIYLSYAAKGQGGSGAVISRAKLDLSNPNQPKLTDVKQIWQQVP
FT                   KVSGQGHYGHRMLFGADGKLWVSSGERQKFDPAQNMKSNLGKILRLNDDGSAALGNPFY
FT                   KQGGVTAEIWSLGHRNPLGMAFDRKGQLWVVEMGPKGGDELNIITKGENYGYPIVSNGD
FT                   HYSGQPIPDHHTRPEFKAPEIDWTPVISPSSLIIYRGQQFPAWQNKALIGGLSSEAIIV
FT                   VDLEHKPVKEVQRLEMKQRIRGLHEAQDGSIWVIEDGSKARLLKLSKKLS"
FT   gene            60906..62171
FT                   /locus_tag="ABAYE0053"
FT   CDS_pept        60906..62171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0053"
FT                   /product="putative ATPase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85042"
FT                   /db_xref="GOA:B0V9Z7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85042.1"
FT                   /translation="MSDTHIPLPERLRPRDLSEIIGQDHLLGEHAPLRQMIDQGHLPSI
FT                   IFWGPPGVGKTTIALLLAQAIDRPFVSLSALNTGVKELREVIAESGDLLTPVVFIDEIH
FT                   RFNKSQQDALLGAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNSLDSEAIQMLLN
FT                   NALQNDKFLKERYIHIEEYDALLQFAAGDARKALNLLDLIASTFEPEVENTINNAVVVK
FT                   VAQQNIARYDKSGEQHYDLVSAFIKSIRGSDPDAALYWMARMLKGGEDPVFIARRMLIA
FT                   ASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQTAVYLATSAKSNSTYLAINKAL
FT                   ELAEKTANLPVPLHLRNAPTKLMKQQGYGINYLYPHDYPEHFVLQDYLPPELKGTKLYE
FT                   SARNKREVEGERLQQRRWQQEQ"
FT   gene            complement(62187..63026)
FT                   /locus_tag="ABAYE0054"
FT   CDS_pept        complement(62187..63026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0054"
FT                   /product="putative transporter (formate/nitrite transporter
FT                   family)"
FT                   /function="4 : transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85043"
FT                   /db_xref="GOA:B0V9Z8"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85043.1"
FT                   /translation="MDHELEEEKVDQTLSWREKMAVEEHEKLSPRLVYEIIRRDGAEEL
FT                   DRPTAALIFSGIAAGLVISFSFVFKAIIASYIPTDAIWTDLITNFGYTIGFLIAILGHM
FT                   QLFTENTITTVVPLFKPFTLDKLRAVGRLWGIVILCNIIGTGLASLFFLTTDLFTPNID
FT                   KALDELAHHVASFSATQNLLKGVMSGLLIAALVWMLPSVSNKFLVIFFMTYLIGLGDFT
FT                   HVVVGSTEMSYLVWQGEASLGEYMFNFLIPTTIGNIIGGTGVFTLLIYGQVTEELEQ"
FT   gene            complement(63312..63515)
FT                   /locus_tag="ABAYE0055"
FT   CDS_pept        complement(63312..63515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85044"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85044.1"
FT                   /translation="MELFKPEKRLMNHPIHFGENPLVILSNFSHSALKQGWSQAEVETV
FT                   ISEASQGDYMKLIRTLRAYTLF"
FT   gene            complement(63705..64424)
FT                   /gene="purC"
FT                   /locus_tag="ABAYE0056"
FT   CDS_pept        complement(63705..64424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="ABAYE0056"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="1.1.5 : other compounds"
FT                   /function="1.5.2.1 : purine biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85045"
FT                   /db_xref="GOA:B0VA00"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VA00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85045.1"
FT                   /translation="MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDR
FT                   KGKVNNRFNAFIMEKLAEAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRR
FT                   LGVEEGKELTPPTFELFYKDDGLGDPMVNESQAIALGWATAEQLEQMKVLTYKVNDVLK
FT                   ALFAEGNMILVDFKLEFGVFHDRIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVV
FT                   EAYEEVAARLGVDLSDI"
FT   gene            complement(64461..65066)
FT                   /locus_tag="ABAYE0057"
FT   CDS_pept        complement(64461..65066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0057"
FT                   /product="putative lipoprotein-34 precursor (NlpB)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85046"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85046.1"
FT                   /translation="MMQLRLGLVLAVSALSLAGCGRFALNNHSLDYKNAKQLAPLEYPA
FT                   DATVRPATPLYPAPTVDQLAIDHAPKFENKRGNRFALPRPEPLQTDTTADASAQTGSAL
FT                   GRPQLVTDGNKNPLLKIDGSTAEIWQYTKATLSTLNYNVIAQGNNQATIKVNDNTYVLK
FT                   LTGVGSSHSLALFNPDNTFASPDVAAEVLNQIYQNWPA"
FT   gene            complement(65079..65972)
FT                   /gene="dapA"
FT                   /locus_tag="ABAYE0058"
FT   CDS_pept        complement(65079..65972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="ABAYE0058"
FT                   /product="dihydrodipicolinate synthase"
FT                   /function="1.1.3 : amino acids"
FT                   /function="1.5.1.7 : lysine, diaminopimelate"
FT                   /EC_number="4.2.1.52"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85047"
FT                   /db_xref="GOA:B0VA02"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85047.1"
FT                   /translation="MTQQAQTIQGSIVAIVTPMLKDGGVDWKSLEKLVEWHIEQGTNSI
FT                   VAVGTTGEASTLSMEEHTQVIKEIIRVANKRIPIIAGTGANSTREAIELTKAAKDLGAD
FT                   AALLVTPYYNKPTQEGLYQHYKAIAEAVELPLILYNVPGRTGVDLSNDTAVRLAEIPNI
FT                   VGIKDATGDVPRGKALIDALNGKMAVYSGDDETAWELMLLGADGNISVTANIAPKAMSE
FT                   VCAVAIAKDEQQAKTLNNKIANLHNILFCESNPIPVKWALHEMGLIDTGIRLPLTPLAE
FT                   QYREPLRNALKDAGII"
FT   gene            66302..66946
FT                   /gene="pncA"
FT                   /locus_tag="ABAYE0059"
FT   CDS_pept        66302..66946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="ABAYE0059"
FT                   /product="bifunctional protein [Includes: pyrazinamidase
FT                   (PZAase); nicotinamidase (Nicotine deamidase)]"
FT                   /function="1.5.3.7 : nicotinamide adenine dinucleotide"
FT                   /EC_number="3.5.1.-"
FT                   /EC_number="3.5.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85048"
FT                   /db_xref="GOA:B0VA03"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="PDB:2WT9"
FT                   /db_xref="PDB:2WTA"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85048.1"
FT                   /translation="MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGC
FT                   FENVVLTQDWHPDNHISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLN
FT                   IPTAQLIIRKGFHAHIDSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWT
FT                   ALDAVKQGFKTLVIEDACKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC"
FT   gene            66965..67939
FT                   /locus_tag="ABAYE0060"
FT   CDS_pept        66965..67939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0060"
FT                   /product="putative transporter; sodium/bile acid
FT                   transporter family protein"
FT                   /function="4 : transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85049"
FT                   /db_xref="GOA:B0VA04"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85049.1"
FT                   /translation="MDFNCDLVWMNSMSALLRFTQFVQKTFALWVIIFAALALWQPEFF
FT                   VWLKAYIPWILGIIMLGMGMTMTVDDFKGVLQSPKAVLIGVVAQFVVMPGLAFILCKLF
FT                   NLPPEIAVGVILVGCCPGGTASNVITYMAKGNVALSVACTSVSTLLAPVLTPAIFYLLA
FT                   SQWLKIDAASMFISILQVVLLPIVIGLILRTWLKRQVESYIQVMPLVSVIAIVAIVAAI
FT                   IGGSKAAILQSGLLILAVVILHNGLGYLLGFTAARFFKLPYADSKAIAIEVGMQNSGLG
FT                   VALAAVHFAASPITAVPSAIFSLWHNISGPALATYWASKHKQE"
FT   gene            68114..69460
FT                   /locus_tag="ABAYE0061"
FT   CDS_pept        68114..69460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0061"
FT                   /product="putative multidrug resistance transporter"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85050"
FT                   /db_xref="GOA:B0VA05"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85050.1"
FT                   /translation="MMNQIFKLFIPMLSSNLIVVLSGLIDIAYVGHFSNDHVAALSVTL
FT                   SLYTVVYVIGMGILQGVMLKLSEAYGCHDIPRIRQIFIQGVWLMLCSALVSIALLYLFR
FT                   DLPKLFGASEHVVSTTKNCIWALVFILPAHLLMRLFTALSQVTENAYKVLLSDSLFFIL
FT                   KIILSYLLIYGVALFSIPPLGAIGALLATIIVRWFMLAVYYLFFLEKRYIFIEHPKQSV
FT                   EDSRQSLCMILKIGIPTAIMALMDVVAFCSVAILILPFGSVVSAAYQIVASTGGFMFIF
FT                   PSSIASAYSILVSRTMGSGNMKEADKIARQSIWVIMAVSGSLSLCLWLERGLIVTFYSD
FT                   DLAVQILAASLLLIVCMSHFLDGLMTLLTSLLRCWDVSILPMLIFLVVVLCFGLGGGWW
FT                   MAYKGLHWGSHSISAMGIYGFWSMAAISYLVACVLSAFCFRFRKQLRGF"
FT   gene            complement(69470..69943)
FT                   /locus_tag="ABAYE0062"
FT   CDS_pept        complement(69470..69943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85051"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:B0VA06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85051.1"
FT                   /translation="MLLISACLIGEPVRYDGRSCLHTTLKQLFLNKKAHALCPELLGGF
FT                   TTPRLPAEIVGGTGQDVLDGKAKIMDSSSLDVTELYLKGAYRTLDIAQQIQATCVVLKE
FT                   NSPSCGSQKIYNGTFQGEKITGVGITTALLQRHGFEVISENEIEEWLAAHPLC"
FT   gene            70466..71521
FT                   /gene="hpd"
FT                   /locus_tag="ABAYE0064"
FT   CDS_pept        70466..71521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpd"
FT                   /locus_tag="ABAYE0064"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase
FT                   (4HPPD)(HPPDase)"
FT                   /function="1.1.3.15 : Phenylalanine, tyrosine degradation"
FT                   /EC_number="1.13.11.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1572351, 10467142, 15262943; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85052"
FT                   /db_xref="GOA:B0V9Y4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85052.1"
FT                   /translation="MDILENPLELCGFAFIEFVSKENELDPIFETIGFSKVAKHKSKKA
FT                   YLWRQGNINIILNYQPESYASFFFNEHGPSACAMGFKTRDAAKAFKKAVELGAEPMYSK
FT                   VGPMELNIPAIKGIGGMPIFLVDRDIYENDFVFFDDAQRNPEGAGLKEIDHLTHNVYKG
FT                   RMEYWANFYEKIFNFQEIRYFDIKGEYTGLTSKALTAPDGMIRIPLNEDSDKGNGQIAE
FT                   FLADFNGEGIQHIAFICDDLISTWDKLKGLGLKFMTPPPNTYYEMLEERLPEHGEPTEE
FT                   LKQRGILLDGSTKDGQKKLLLQIFSENMIGPVFFEFIQRKDDDGFGEGNFKALFESIER
FT                   DQIRRGVLEAK"
FT   gene            complement(71586..72365)
FT                   /gene="hmgR"
FT                   /locus_tag="ABAYE0065"
FT   CDS_pept        complement(71586..72365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgR"
FT                   /locus_tag="ABAYE0065"
FT                   /product="Hmg transcriptional repressor"
FT                   /function="3.1.2.3 : Repressor"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15262943; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85053"
FT                   /db_xref="GOA:B0V9Y5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85053.1"
FT                   /translation="MIEEKISGGVQSLEVGLSVLNALLEHNQPIILKDLSSKLEMHPAK
FT                   VHRYLVSLIRMDYAKQLEDGQYALGDQAWRLGLNCIQHSDTLQLVQHLIYDLQSKIGCG
FT                   IQISKWSPKGPVVVQSIESNHPISIVTKVGSIMPLVNSAAGRLFASYLPEHFVRPLLET
FT                   EWQKHQELGLNIAPHNWEEFLELKETIRQQQMSAAKGDLLTGINAVGLPVFNSNQGIEF
FT                   CIVALDSEMFLPVDPQSKIIETLKNEINSINQYIKSR"
FT   gene            complement(72665..73240)
FT                   /locus_tag="ABAYE0066"
FT   CDS_pept        complement(72665..73240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0066"
FT                   /product="putative homogentisate 1,2-dioxygenase"
FT                   /function="1.1.3.15 : Phenylalanine, tyrosine degradation"
FT                   /EC_number="1.13.11.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15262943; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85054"
FT                   /db_xref="GOA:B0V9Y6"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85054.1"
FT                   /translation="MGIVKRSFNMTFAIKKIHHVAYRCKDAKETVEWYKKMLNMDFILA
FT                   FAEDHVPSTKAFDPYMHLFLDAGQGNVLAFFELPTQPEMGRDENTPQWVQHIAFEVEDL
FT                   NALLAAKKHLEDNGVKVLGITNHGIFHSIYFFDPNGHRLELTYNDAHAEEKIAKITEEM
FT                   KTEMLEEWSKTKRAPHHTHFLHEEELGA"
FT   gene            complement(73231..73893)
FT                   /gene="hmgC"
FT                   /locus_tag="ABAYE0067"
FT   CDS_pept        complement(73231..73893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgC"
FT                   /locus_tag="ABAYE0067"
FT                   /product="maleylacetoacetate isomerase (MAAI)"
FT                   /function="1.1.3.15 : Phenylalanine, tyrosine degradation"
FT                   /EC_number="5.2.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15262943; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85055"
FT                   /db_xref="GOA:B0V9Y7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85055.1"
FT                   /translation="MILQKLRSLIMKLYSYFRSSAAYRVRIGLNLKSLAYETVPVHLVK
FT                   NEQQSEDYLKLNRSALVPTFVDGDLTLSQSLSILEYLDEQYPETKLLPNDVKERAKIRA
FT                   FAQAIACDIHPLNNLRVLKYLKNDLNVSDEQKNYWYQHWILEGFQTLEQQLQDSNGQFC
FT                   FGQHATIADCCLIPQVYNAKRFKIDLSAFPKIESIYQHCLSIPAFYNAAPEQQPDWE"
FT   gene            complement(73850..75226)
FT                   /gene="hmgB"
FT                   /locus_tag="ABAYE0068"
FT   CDS_pept        complement(73850..75226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgB"
FT                   /locus_tag="ABAYE0068"
FT                   /product="fumarylacetoacetase (Fumarylacetoacetate
FT                   hydrolase)"
FT                   /function="1.1.3.15 : Phenylalanine, tyrosine degradation"
FT                   /EC_number="3.7.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15262943; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85056"
FT                   /db_xref="GOA:B0V9Y8"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85056.1"
FT                   /translation="MSSSVPRPNFYLYKTRDEDKEAKMEQKLNSFIEVSPQSDFTIHNL
FT                   PYGIFSRTAEGERQVGVAIGDWVIDLAALEKHGLLKLSDQDTYFNQPTLNKFIESGKAN
FT                   WSKVRKTLQSLLSVDNLTLQENEALRQEVLVKQDSVTLHLPIQVPGYTDFYSSKEHATN
FT                   VGCMFRDPKNALLPNWSELPVGYNGRASSVVVSGTHVVRPSGQIKLPNEERPVFSATRK
FT                   LDFELETAFIVGKPTQLGQPIAIEDAWDHIFGMVLLNDWSARDIQQWEYVPLGPFNAKT
FT                   FASSISPWVVTLEALEPFKVEGPKQEPKPLAYLQENIANTYDINLSVEIQSPKSAQPDV
FT                   ICRTNFKYMYWSMAQQLTHHTIGGCNVQVGDLMGSGTISGSTPDSYGSLLELTWNTTKP
FT                   LTLANGETRGFLQDGDTLIMKGHCEKNGIRIGFGEVRNTVLPALTFDFAETSEPNYEAV
FT                   "
FT   gene            75516..76904
FT                   /gene="aroP"
FT                   /locus_tag="ABAYE0069"
FT   CDS_pept        75516..76904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ABAYE0069"
FT                   /product="aromatic amino acid transporter (APC family)"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85057"
FT                   /db_xref="GOA:B0V9Y9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85057.1"
FT                   /translation="MSTQEQGNLKHGLSNRHIQLIALGGAIGTGLFLGISQSIKLAGPS
FT                   VILGYAIAGFIAFLMMRQLGEMVVEEPVSGSFSHFAYKYWGPFAGFMSGWNYWVLNVLV
FT                   CMAELSAIGLYIQYWWPQIPTWASALTFFILINGINLLHVKFFGEMEFWFSIVKILAIL
FT                   AMIGFGSYLLATGTAGPQASISNLWALGGFFPFGIEGLVMAMAVIIFAFGGIELFGITA
FT                   AEARDPDKTLPKAVNQIIYRILIFYIATLFVLFSLFPWNQMAEGGSPFVMVFASLDSQG
FT                   VATLLNFVILTAAVSVYNGTSYCSSRMLLGLAQQGNAPKALARINKRGIPTNAVLVSAF
FT                   VTVLCVLLNYIFPEKAFGLLMMLVVAAIVINWVVISWTHLKFRKFMQRQGQTTKFPSFM
FT                   YPFSNYLCMAFMLGILVVMSLTPDMRVAVMMIPGWILCLMVAYQFKRRKIKAEQPVHAL
FT                   EADM"
FT   gene            77067..77750
FT                   /locus_tag="ABAYE0070"
FT   CDS_pept        77067..77750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0070"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85058"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85058.1"
FT                   /translation="MKRYLGLLVLSLVACSTQTPQPTITHRSPSLPQPSKTVVKIKQQP
FT                   EDYIVWIATADHRQSVQAYKQFLKQKGLADLVPDHELLRSARDWQKCGVEPYAVPPREI
FT                   WSNIVPTLNILKALVDDGVINDFEVTSVYRALALNRCAGGADASRHVFNAALDFRIGPE
FT                   QPSDLDQFNIQQTKTKLCQFWATKGQAFNMGLGVYASGQIHIDSQGFRAWGPDHHYRTS
FT                   ICQGL"
FT   gene            77929..79158
FT                   /locus_tag="ABAYE0071"
FT   CDS_pept        77929..79158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0071"
FT                   /product="putative regulatory protein (nitrile hydratase
FT                   activator like)"
FT                   /function="3 : regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85059"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85059.1"
FT                   /translation="MHTAIANSFAKLPVTVLSGFLGAGKTTLLNHILNNREGRRIAVIV
FT                   NDMSEVNIDAALVREGGAELSRTDEKLVEMSNGCICCTLREDLLVEVRRLADEGRFDQL
FT                   VIESTGISEPLPVAETFTFEDEDGNSLNEFARLDTMVTVVDAFNFLKDYSSVDSLQQRG
FT                   ESLGEQDERTVVDLLIDQIEFCDVIVLNKIDLIDQAQQDQLIAILKTLNPRARIEIAQF
FT                   GKVALDKILNTQLFDFDEAAQAPGWLKELRGEHTPETEEYGISSFVYRARRPFHPERFY
FT                   DLVQAEWPGVVRSKGFFWLAAEPTLAYSWSQAGAMARHGLAGYWWAAVAEEDWPSDLAS
FT                   IEQIKKNWDARTGDARQELVLIGMQMDEQALIQRLDSCLLSDEEIALGPQVWQSWSNPF
FT                   KQDDETMLIA"
FT   gene            complement(79193..80305)
FT                   /locus_tag="ABAYE0072"
FT   CDS_pept        complement(79193..80305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0072"
FT                   /product="putative acyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85060"
FT                   /db_xref="GOA:B0V9Z2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85060.1"
FT                   /translation="MRNYKIDILRGISILLVLLHHFNIPYKLKDTWLGFDFLGEAFSTV
FT                   IARNGNYGVTMFFVISGFLITHHTLKRDKQFSAINLKHFYIRRAARILPCLVLLILGVS
FT                   ILGSFDLKPFMNQAPNGIEVSYPLTIFAALTFWMNILIIKFGWVNYALGVLWSLSVEEV
FT                   FYFVFPLLCLLTRSNKVFIAVLVGVILYGPYFRSLHFGEESGAYLYHYFSSFDGIAVGC
FT                   LMAIFSHKYQPNWTYKKPLSWLIILSMTALYLYAPIKEVSTWGISLFALATGLLILCFQ
FT                   HPSETQAHSLFTKVMVWLGQRSYETYLFHLVVLGLMKVAFIPAQTDSSIKIMLLIGYLV
FT                   LTFIISAAIEKYYSTPLNSYIRKVFIKDKS"
FT   gene            80658..81410
FT                   /gene="hutC"
FT                   /locus_tag="ABAYE0073"
FT   CDS_pept        80658..81410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="ABAYE0073"
FT                   /product="histidine utilization repressor"
FT                   /function="1 : Metabolism"
FT                   /function="2.2.2 : Transcription related"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2203753; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85061"
FT                   /db_xref="GOA:B0V9Z3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85061.1"
FT                   /translation="MPRTSKQEHTELSIEADSPVPLYQRVKQLISQKIYEGSWAVNKKI
FT                   PSESELVNQLGCSRMTVNRALRELTTEGLLVRIQGVGSFVAEGQGRTALFQINNIADEI
FT                   IARNHKHHAEVLVLEQIYANAEQSVLMQTREGQKLFHSIIVHYENDVPVQVEDRLVDAA
FT                   LIPDYLEQDFKTITPNAYLMAKAPVTEGEHIVEAVLASPQECKWLKITKAEPCLLIRRR
FT                   TWSNKQLISSARLIYPGSRYYLEGKFNP"
FT   gene            81407..81982
FT                   /locus_tag="ABAYE0074"
FT   CDS_pept        81407..81982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85062"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Z4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85062.1"
FT                   /translation="MIELIRADQYTKMLWKNGAGFTLEIARSQGEADFEWRISMADVTT
FT                   SGPFSLFPNKQRIISVLDGQGMVLHVDNLPAKKLKQGDIFAFHGESQVQSELVDGAIRD
FT                   LNLIYDPAKFHARFQWLNEAAEQAFISSADLIFIFNQGGETEVNVDDDFVQLAAHETLK
FT                   IEKNASVTSINFPKKQLKSCYIIELIQR"
FT   gene            82234..83910
FT                   /gene="hutU"
FT                   /locus_tag="ABAYE0075"
FT   CDS_pept        82234..83910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="ABAYE0075"
FT                   /product="urocanate hydratase (Urocanase)
FT                   (Imidazolonepropionate hydrolase)"
FT                   /function="1.1.3 : Amino acids"
FT                   /EC_number="4.2.1.49"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1677899; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85063"
FT                   /db_xref="GOA:B0V9X6"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9X6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85063.1"
FT                   /translation="MTTMTTKFRDVEIRAPRGTELTAKSWLTEAPLRMLMNNLDPDVAE
FT                   NPKELVVYGGIGRAARNWECFDKIVDTLKNLETDETLLVQSGKPVGVFKTHKDAPRVLI
FT                   ANSNLVPHWANWEHFNELDAKALAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHYN
FT                   GDLKGRWVLTAGLGGMGGAQPLAATLAGACSLNIECQQASIDFRLRTRYVDEQATDLDD
FT                   ALARIDRYTKEGKAISIALHGNAAEILPELVRRGVRPDMVTDQTSAHDPLNGYLPVGWT
FT                   WDEYRERAKKEPEAVVKAAKQSMAKHVQAMLDFQKMGVPTFDYGNNIRQMAKEEGVANA
FT                   FDFPGFVPAYIRPLFCRGIGPFRWAALSGDPEDIYKTDAKVKELIPDDEHLHHWLDMAR
FT                   ERISFQGLPARICWVGLGLRAKLGLAFNEMVRSGELSAPIVIGRDHLDSGSVASPNRET
FT                   EAMQDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGFSQHSGVVIVCDGTDEAAA
FT                   RIARVLTNDPATGVMRHADAGYEIAINCAKEQGLHLPMITQ"
FT   gene            83998..85536
FT                   /gene="hutH"
FT                   /locus_tag="ABAYE0076"
FT   CDS_pept        83998..85536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="ABAYE0076"
FT                   /product="Histidine ammonia-lyase (Histidase)"
FT                   /function="1.1.3 : Amino acids"
FT                   /EC_number="4.3.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2332400; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85064"
FT                   /db_xref="GOA:A0A0R4J6L2"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6L2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85064.1"
FT                   /translation="MELLIQPGKLTLADLRQAYLNPIKVKLDESASSAINASVACVEQI
FT                   VNEGRTAYGINTGFGLLASTKIAPEDLEKLQRSLVLSHAAGVGEALDDAMVRLIILLKA
FT                   NSLARGFSGIRRKVIDALLALINAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGESKAR
FT                   YKGEWLPAVEALKIAGLEPISLAAKEGLALLNGTQVSTAYALRGLFEAEDLFAAATVCG
FT                   GLSVEAMLGSRAPFDARIHEVRGQRGQIDVAAAYRDLLTDSSEISRSHEECGKVQDPYS
FT                   LRCQPQVMGACLTQIRQAAEVLEIEANAVSDNPLVFAEQGDVISGGNFHAEPVAMAADN
FT                   LALAIAEIGSLSERRISMMMDRHMSQLPPFLVANGGVNSGFMIAQVTAAALASDNKALA
FT                   HPASVDSLPTSANQEDHVSMAPNAGKRLWYMADNVRGILAVEWLGACQGLDFREGLKSS
FT                   PKLEQARKILRDQVPYYSEDRFFAPDIEQASELLASGCLNELLIPKLLPSLSEV"
FT   gene            85601..87013
FT                   /locus_tag="ABAYE0077"
FT   CDS_pept        85601..87013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0077"
FT                   /product="putative histidine transport protein (APC
FT                   family)"
FT                   /function="1.1.3 : Amino acids"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85065"
FT                   /db_xref="GOA:B0V9X8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9X8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85065.1"
FT                   /translation="MSQNSTLQRGLNTRHIRFLALGSAIGTGLFYGSATAIKMAGPSVL
FT                   LAYIVAGIAIYIVMRALGEMAVHNPVSGSFSHYASQYIGPLAGFTTGWTYVFEMVIVAI
FT                   ADVTAFGIYMGFWYPDVPRWIWILSLIMFLGAINLIHVKVFGELEFWLSIVKVSAIVAM
FT                   ILGGLGLMFYGFHADHSSVVPGIQNLWIYEGFMPHGIAGLVACLSVVVFAFGGIEIIGI
FT                   TAGESQDPKTTLPKAINAVPVRILLFYVLTIFVLMSIFPWNQIGSQGSPFVQIFENLGI
FT                   KSAANILNIVVVTAAISAINSDVFGAGRMLYGMANRGQAPRIFQKLSRNSVPWMTVVVM
FT                   AGVLLIGVVLNYLIPENVFVIIASIATFATVWVWLMILLSQVAMRRKLSTAEIKALDFP
FT                   VFGWPYAPAFAIGFMVFILVMMGYFPDSRPAIYVGITWLALLTIAYRIWVKPEQSLGKE
FT                   SEPVQQNIEMES"
FT   gene            87041..88270
FT                   /gene="hutI"
FT                   /locus_tag="ABAYE0078"
FT   CDS_pept        87041..88270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="ABAYE0078"
FT                   /product="Imidazolonepropionase (Imidazolone-5-propionate
FT                   hydrolase)"
FT                   /function="1.1.3 : Amino acids"
FT                   /EC_number="3.5.2.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85066"
FT                   /db_xref="GOA:B0V9X9"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85066.1"
FT                   /translation="MGSFEDRLMKKLWQNCHIATMQNGQYSYIEDAAIVTEGHLIHWIG
FT                   KQQQLPADTYSETVDLNGAWVTPGFIDCHTHSVFGGNRSVEFEKRLQGVSYAEIAASGG
FT                   GIASTVRATREASEEQLLNSALKRIRCMQQDGVTTIEIKSGYGLNYENERKMLRVIRQI
FT                   GEKLPMTVKSTCLAAHALPPEYKDQSDAYIEHICTEMLPKLHAEGLVDAVDAFCEHLAF
FT                   SPAQVERVFKTAQSLGLPVKLHAEQLSSLGGSSLAARYHALSADHLEYMTEDDVKAMAE
FT                   SGTVAVLLPGAFYLLRETQYPPIESLIKHGVRIALSSDLNPGTSPALSLRLMLNMGSTL
FT                   FRLTPEQALAGITIHAAQALGLEQTHGSLEQGKVADFVAWDIEHPSEIVYWLGGDLPKR
FT                   VVQHGQEVIF"
FT   gene            88281..89201
FT                   /gene="hutG"
FT                   /locus_tag="ABAYE0079"
FT   CDS_pept        88281..89201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="ABAYE0079"
FT                   /product="formimidoylglutamase (Formiminoglutamase)
FT                   (Formiminoglutamate hydrolase)"
FT                   /function="1.1.3 : Amino acids"
FT                   /EC_number="3.5.3.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10952301; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85067"
FT                   /db_xref="GOA:A0A0R4J6J0"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6J0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85067.1"
FT                   /translation="MNHTFKWQGRHDGEGEVHQRIHHIVNTTQHAEFALIGFSSDEGVK
FT                   RNKGRVGAADAPDAIRTQLANLPIHRPVSIVDLGTVTCEYGNLEQAQSELAEQVANSLE
FT                   HGLKPVVLGGGHEVAFGSFSGLFQYVQAHAPDKKIGIINFDAHFDLREAEHATSGTPFL
FT                   QAARLSEQHQKQFNYLCIGVANHANTKILFDTADALNCSYLRDHEVNIFNLNNVLAAVD
FT                   AFIEKVDCLYVTIDLDVFAAAVAPGVSAPAVKGIDLATFEAIFKHIQESGKIKLLDIAE
FT                   CNPKFDLDNRTAKLAAYIVYQYLFS"
FT   gene            89456..91282
FT                   /locus_tag="ABAYE0080"
FT   CDS_pept        89456..91282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0080"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85068"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85068.1"
FT                   /translation="MKNRTLHFACISVLFWMSHSSNAATPEINTNTIEKSQSKQKSDIS
FT                   VRVKALNQLLQEQWEYTLKNSPETATVLGDLRYNDRWTEFSKTQIEKDKKSTQNFLKRF
FT                   EAIDSTGFSATDQLNKDLMIYQLKETLKNYDLKLYEMPFNQMWGLHLQFPGFISAIPFD
FT                   NTKQYQDYIARLKQIPLILDQGIQLAKQGQKDGLMPPKYLIEKVAKQINSIATPAGKDS
FT                   VFASPLKQFPKNISKAEQERLSREILQTIDQNVRPAYQKLGAFIQKDYLPHGRQHEGIW
FT                   SLPNGDELYRFYVENNTTTLESPENIHQLGLKEVARIEAEMLKIAKAQGFNDLKSFQQS
FT                   LKTNPAVFPKSREEILEIYRGYIAQMQPELPKLFGLLPKNKVEVLPVEQYREKEAAGAE
FT                   YHQGTPDGSRPGQVYVNTGDFSERSKISMEATAYHEAIPGHHMQIDIAQNLPNLPMFRK
FT                   QPNHTAYIEGWALYAEQLGKDVGFYKDPLSDYGRLSSELFRACRLVVDTGVHYKKWTRQ
FT                   QMIDFMREHSALDEPDIQAETDRYIAIPAQALAYKMGQLKILELRELAKHELGDRFDIK
FT                   AFHDMVLNAGTLPLNILDARIKNWIKEQKVAA"
FT   gene            91382..92020
FT                   /locus_tag="ABAYE0081"
FT   CDS_pept        91382..92020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0081"
FT                   /product="putative hydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85069"
FT                   /db_xref="GOA:B0V9Y2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9Y2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85069.1"
FT                   /translation="MEKNLKEYQAIIFDLDGTLADSFHFFLSVLNQLSAKYKFKSVELH
FT                   EVEQYKHLSPKEIMKEMNVSRWKLPWIAKDFIRLMKERDQEVYMFEGMRDHLMELHKRG
FT                   YTLAIITSNSKENCQSILGKELCELFSHIDGGSSIFGKAKRIKRVLNILNLNKEQAIYV
FT                   GDQTTDGEAAHKAGIDFAAVGWGYTSAEKLKTIQPKVVLTDLATMKEFF"
FT   gene            92044..92844
FT                   /locus_tag="ABAYE0082"
FT   CDS_pept        92044..92844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0082"
FT                   /product="putative glutamate racemase"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /EC_number="5.1.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85070"
FT                   /db_xref="GOA:A0A0R4J7F1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7F1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85070.1"
FT                   /translation="MNNNNNPIGMIDSGLGGLSLFKHIRQALPNEDIIYFADSKYVPYG
FT                   DKESDWIVSRTTHLISNLVTQGKCKAIVVACNTMTAVAIETIRAQISVPLIAIEPAVKP
FT                   AVAITQSKHIAVLATATTVKGKNLKSLIETYAQDIKVSLVPCIGLAEKIETGKAYTAEV
FT                   KDYLENILAPLVEQKVDTIILGCTHYPFVSDTIQEIVGRDIQIIEPSEAVTAQLIRQLN
FT                   QYHLNSESPNEGNHIIWTSSDPLEVADITFSLLGTQLPVKAIEK"
FT   gene            93507..93842
FT                   /locus_tag="ABAYE0083"
FT   CDS_pept        93507..93842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85071"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85071.1"
FT                   /translation="MNYIFILFKDINNYENNMKLHKFILFLNLVFGVYSITNDDANAQQ
FT                   EFKRICLSDEHLQASCNCVCQQLAQVYSPQTVQRLKHTSLQSPDLPQDFAPNLFSSIQR
FT                   CDKNKMG"
FT   gene            94321..95388
FT                   /locus_tag="ABAYE0084"
FT   CDS_pept        94321..95388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0084"
FT                   /product="putative cytosine-specific methyltransferase"
FT                   /function="2.1.2 : DNA restriction/modification"
FT                   /function="3.1.1.2 : Methylation"
FT                   /EC_number="2.1.1.37"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85072"
FT                   /db_xref="GOA:B0V9W5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85072.1"
FT                   /translation="MKVIDFFSGCGGASEGLRQAGLDITIGLDFDIKAAETYQANFPEA
FT                   LFYNVDIRELDEKELAKAFKEKNREKEPLLFVACAPCQPFSTQNKSKSEDDIRRTLLDE
FT                   THRFISKLKPEYILVENVPGLQKIDKEKDGPYKRFITFLESKKYKITEFIAKSEEYGVP
FT                   QKRKRFVLLASKSGKIEIPAKTHGEGLEPIKTVRDFIGEFPAIKAGEIHPDDLWHRSPT
FT                   LNERNLVRIQNTPEGGDRRHWPNHLINECHKAHSGHMDVYGRMSWDKPAPTLTTRCYSY
FT                   SNGRFGHPDTNQHRAISVREASRLQTFPQDFIFKGSVVEASRQIGNAVPCEMAKQFGLS
FT                   ILKHYEEVKNKNGKD"
FT   gene            95375..98368
FT                   /locus_tag="ABAYE0085"
FT   CDS_pept        95375..98368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0085"
FT                   /product="conserved hypothetical protein; putative
FT                   two-component regulatory system"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85073"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85073.1"
FT                   /translation="MAKIKTRARTLDMLGRQQIAGIPTALSELFKNAHDAYADNVEVDY
FT                   IRKKNLLILRDNGLGMTRAEFEDRWLTIGTDSKFEDEDAIEKPAIDINKDKRPVMGEKG
FT                   IGRLAIAAIGPQVLVMTRSKRDNELGELVVSFINWSLFSLAGLDLSDIDIPILTKQHGE
FT                   NATFEDVESLKHQAIENVKHLSNKISASKINKICNEIESFSYDPNFWRNALNKQDENSR
FT                   LIANRDYLQVCDTGCGTHFIISPVDSVITNEIDESDDKEVSKLKKVLLGFSNTIQNDRK
FT                   PRINASFRDHNLAGETIDHIAEQEFFTPDDIELADHYFAGNVNQFGQFSGKGKIFKQLF
FT                   DNVPINWKNIDNSPISCGPFRIVLAAVQGTKKETLLSPELHEYLRGKTIKLGGIYIYRD
FT                   DIRVLPYGGPDVDFFGVEKRRTYRAADSYFSNRNMICYIELTRENNSTLQEKAGREGFI
FT                   ENKAYKQFRSIIENFFISVAKQYFVESGELAETFKFEKERNKKNYDALEKRAKLKNEKK
FT                   KQLVKDLDGFFEHFKDENFTTLILNKKIEIENKVYSFNENLVDYDSFITNIELEKVKFL
FT                   EDLKSKFNIKIPSGVGFNREISNRIDKYNLVKENFLIELEKFNSNLNKLFVDFENKYGN
FT                   KVDLKKRITDSLIQQEESYKQSISQLYSETNSAIKELTEWATKEIRRNKEEGFKALVQL
FT                   QTEVASVDFSSKSNEELIELKSTVEKQFQNLSETVSNSLKDIQTQINTSREQTSENTLS
FT                   SSRLVSILETEYEVLKEQQEENLEMIQLGMAFGVIHHEFNHNILRVRRGIKDLTPWAKA
FT                   NPKLQEIYDNIRTGFDHLDGYLRTFTPLSRRLTRRKSIITGEALSLFLKEIFSERLEKE
FT                   NVEMLFTTEFLNFKIQAFSSTLYPAIVNLVDNAIYWANKSSSLQKKVKLHADNENLFIA
FT                   DTGPGVPLIDRENIFEFGFSRKIGGRGMGLYIARQTLERDGFNLELEEFDPEIGAVFKI
FT                   SHIEVEGD"
FT   gene            98310..100073
FT                   /locus_tag="ABAYE0086"
FT   CDS_pept        98310..100073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85074"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85074.1"
FT                   /translation="MIQKSAQFLKLVILKLRGINQMNTQVQVVSPQNFFDESRSIAEKF
FT                   IQTVVAVDDNISFIERPNSVNNSDLNVQVPDDESGLGTSSVGTHELSLDAPDLNNDLNY
FT                   QELSACFADKSILCSALKAYEGEDGEQKTIEATFNISKKADITILDWQMERDQSNYGNI
FT                   AKGAIKKLLQYDVDGNGRLRLILIYTSESIPTVLRALKDQFTEFQPKIENEKEIQFSFE
FT                   SLSLCKVVVINKQTNIESLVDRSIEEFTHMTCGLLSNATLAAITEIRDKTHHHLYKFNK
FT                   KLDAAYISHVLGLISSPAMRENAHEVAFDYGIDLLAEEIKSDLQISSQVKKSLSKDVLQ
FT                   NWPNFIIEKNPETIFKFKIGDSFEVPVTLERVKRILSVTDKSEFENILEEEPKFLLDSS
FT                   SGTIAKTFSDKYIQFMINDDNLQEHLELSAIQCTRRNMKNRGSYVPTLKQGVIVKRRED
FT                   KKFYVCIQPLCDSVRVKDLTNFTFLRISKVPNAKPMTHVIHGVDVPYLAFDVDPKSKNI
FT                   YMAQFLPDPSEKMVKAELCNQKYIFKAGDEVFEWCGEFKQPIFQGIVNDVSASLARVGF
FT                   DSFEWLRQRKS"
FT   gene            100049..100180
FT                   /locus_tag="ABAYE0087"
FT   CDS_pept        100049..100180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0087"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85075"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85075.1"
FT                   /translation="MVTSTKILKSGFDKCKVIESFYAYMIYKESYSFTHLYKINVRQ"
FT   gene            100307..100444
FT                   /locus_tag="ABAYE0088"
FT   CDS_pept        100307..100444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0088"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85076"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85076.1"
FT                   /translation="MWQQRFDIFHFMCWQPFQHITKIMDVCFEVLIFKLFLIPQKSNLE
FT                   "
FT   gene            complement(100742..102580)
FT                   /gene="glmS"
FT                   /locus_tag="ABAYE0089"
FT   CDS_pept        complement(100742..102580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="ABAYE0089"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /function="1.7.12 : amino sugar conversions"
FT                   /function="1.6.3.3 : lipid A"
FT                   /EC_number="2.6.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85077"
FT                   /db_xref="GOA:A0A0R4J6G5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6G5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85077.1"
FT                   /translation="MCGIVGGVAERCVTEILIEGLKRLEYRGYDSAGVALLNKQQILRE
FT                   RRVGKVINLEDAVADQQLTGTIGIAHTRWATHGKPTENNAHPHMSGKVAVVHNGIIENY
FT                   QELKDDLQALGYVFTSQTDTEVVAHLVAEALKNTDSLLEAVESVVPQLKGAYALGIIHS
FT                   DYPDELITVREGSPLVIGVGIGENFISSDQLALLPVTNRFIYLEEGDIARLTRTSIEVF
FT                   VKGERVERPVKELDATVSSASKGEYKHYMLKEIYEQPEAIKQTISQALDGNNLRDDFLK
FT                   DADADFSKLQSVQIIACGTSYHSGMIAKYWFEQLIGVPCQVEIASEFRYRTPVIVENTL
FT                   YICISQSGETADTLAALRETQKRAKANNIDIQTLTICNVATSSMVRETDHHLLTLAGPE
FT                   IGVASTKAFTTQLAALMLLILKIGQVKQRISNVMIEELARELWHSPKVILDTLKQDAEI
FT                   LRLSELFVEKQHCLFLGRGTHYPIALEGALKLKEISYIHAEGYAAGELKHGPLALVDTE
FT                   MPIVILAPNDEMLDKLKSNMEEVQARGGELFVFADENSGVVEKDRQHVVQIPAVNEWLA
FT                   PIIYSVPVQLLSYHVAVLRGTDVDQPRNLAKSVTVE"
FT   gene            complement(102593..103957)
FT                   /gene="glmU"
FT                   /locus_tag="ABAYE0090"
FT   CDS_pept        complement(102593..103957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="ABAYE0090"
FT                   /product="bifunctional protein [Includes:
FT                   UDP-N-acetylglucosamine pyrophosphorylase
FT                   (N-acetylglucosamine-1-phosphate uridyltransferase);
FT                   Glucosamine-1-phosphate N-acetyltransferase ]"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.57"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85078"
FT                   /db_xref="GOA:B0V9X1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9X1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85078.1"
FT                   /translation="MSTTVIILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLA
FT                   ENIITIYGHGGDHVKKTFAQENIQWVEQAEQLGTGHAVQMTLPVLPKDGISLILYGDVP
FT                   LVRQTTLEQLIEVSNKTGIGMITLHVDNPTGYGRIVRQDGKIQAIVEHKDATEAQRQIQ
FT                   EINTGIYCVSNAKLHEWLPKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEG
FT                   VNDRLQLAALEREFQKQQAKELMQQGVTFADPARFDLRGTVKVGHDVRIDVNVIIEGNC
FT                   ELGDFVEIGAGCILKNTTIAAGTKVQAYSVFDGAVVGENTQIGPFARLRPGAKLANEVH
FT                   IGNFVEVKNTTIGLGSKANHFTYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVF
FT                   IGSNSSLVAPVTIGNGATVGAGSVITKDVAEQSLSFERAQQISKANYQRPQKLKK"
FT   gene            complement(103974..104474)
FT                   /gene="pgpA"
FT                   /locus_tag="ABAYE0091"
FT   CDS_pept        complement(103974..104474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="ABAYE0091"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /EC_number="3.1.3.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85079"
FT                   /db_xref="GOA:B0V9X2"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9X2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85079.1"
FT                   /translation="MHKPPIHFKDMSWFNRCIVFCGVGFGSGLAPKAPGTFGSAFALLF
FT                   VPIWLSLGFTLSLIAILIMSVVGIYICGQTAKVINVHDDGRIVWDEFAGQSITFLPLLY
FT                   LQQINWIWVITGFILFRIFDVWKPWPIRVIDRQVHGGFGIMLDDIIAGVWAALCTLIII
FT                   HLS"
FT   gene            complement(104467..105384)
FT                   /gene="thiL"
FT                   /locus_tag="ABAYE0093"
FT   CDS_pept        complement(104467..105384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ABAYE0093"
FT                   /product="thiamin-monophosphate kinase"
FT                   /function="1.5.3.8 : thiamin"
FT                   /EC_number="2.7.4.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85080"
FT                   /db_xref="GOA:A0A0R4J896"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J896"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85080.1"
FT                   /translation="MAEFSIIDQYFNRQSHPDVALGIGDDSALITPPPNQQLVICADTL
FT                   VAGRHFPLETSPHAIGWKSVAVNLSDIAAMGAKPHSILLAISLPQVDHEWLEGFSQGIY
FT                   DCCNQFGVALIGGDTTQGPHLTITVTAMGWIETGKAVLRSGAKVGDYVCVSGQIGDAAY
FT                   GLQHLGHSLQQRLDYPTPRCKLGEELKGLASSMIDVSDGLAQDLGHILKASKVGARLIL
FT                   EKLPVDPVLQQIEEQQRWQYALAGGDDYELCFTITPQNYEKLLQKQLDVKITMIGQIVE
FT                   QTKLTFEHLGSDYPLQIHGYQHFA"
FT   gene            complement(105400..105849)
FT                   /gene="nusB"
FT                   /locus_tag="ABAYE0094"
FT   CDS_pept        complement(105400..105849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ABAYE0094"
FT                   /product="transcription termination, L factor (N
FT                   utilization substance protein B)"
FT                   /function="1.2.2 : DNA"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2 : RNA related"
FT                   /function="2.3.2 : translation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85081"
FT                   /db_xref="GOA:B0V9X4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9X4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85081.1"
FT                   /translation="MSQTLQAAYAAKRKARRFAVQGIYEWQMSHNPVHEIEARTRAENA
FT                   MHKVDLNYYHELLTQVIAQHEDLDALLIPVLDREIDALDGVELATLRLGAYELRDHLEI
FT                   PYRVVLDEAIELAKHFGGADSHKYINGVLDRLSSTLRSAEKQQAK"
FT   gene            complement(105853..106323)
FT                   /gene="ribH"
FT                   /locus_tag="ABAYE0095"
FT   CDS_pept        complement(105853..106323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="ABAYE0095"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase (Lumazine
FT                   synthase)(riboflavin synthase beta chain)"
FT                   /function="1.5.3.9 : riboflavin (Vitamin B2), FAD, FMN"
FT                   /EC_number="2.5.1.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85082"
FT                   /db_xref="GOA:B0V9X5"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9X5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85082.1"
FT                   /translation="MAIRRIEGLLHLASEGRYAILVGRFNSFVVEHLLEGAIDTLKRHG
FT                   VNEDNITVIHAPGAWELPIVAKKLATSNQFDAIIALGAVIRGSTPHFDFVAGECAKGLG
FT                   VVALESSLPVINGVLTTDSIEQAIERSGTKAGNKGSEAALTAIEMVNLLKAI"
FT   gene            complement(106335..107456)
FT                   /gene="ribB/A"
FT                   /locus_tag="ABAYE0096"
FT   CDS_pept        complement(106335..107456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB/A"
FT                   /locus_tag="ABAYE0096"
FT                   /product="bifunctional protein [Includes:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; GTP
FT                   cyclohydrolase II]"
FT                   /function="1.5.3.9 : riboflavin (Vitamin B2), FAD, FMN"
FT                   /EC_number="3.5.4.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85083"
FT                   /db_xref="GOA:B0V9V3"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85083.1"
FT                   /translation="MPLSRVEELVADIRAGKMVILMDDEDRENEGDLVIAATHVRPEDI
FT                   NFMITHARGLVCLTLSRERCKQLNLPLMVDQNGAQHGTNFTLSIEAAEGITTGISAAER
FT                   AHTIQAAVAAHAKPTDIVQPGHIFPLMAQPGGVLHRAGHTEAGCDLARLAGLEPASVIC
FT                   EIIKEDGTMARRADLEIFAEKHGLKIGTIADLIHYRMTNEQTVERLDQRMIQTEYGSFE
FT                   LYRYREIGNPDIHLALVKGEPKEGVTTVRVHGFSPVRDLLKLNKADGEPAWNLDRALQT
FT                   IAASDRGVLVWIGQDHLQDLGPALDDLTKPKPVKSNAALSHQYQTIGVGAQILRDLGVE
FT                   KMKLLSSPLRFNALSGFNLEVVEYVTADQITTK"
FT   gene            complement(107696..108985)
FT                   /locus_tag="ABAYE0097"
FT   CDS_pept        complement(107696..108985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0097"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85084"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85084.1"
FT                   /translation="MIAPRQGLFASLLIISFALHTFLLVIATTHQLNENRASQGQLMTS
FT                   QLVADSLSELEPANTVSLALIANRYATNPSVASIRILDANKQVLATSGMSKTRQGEIFV
FT                   RDALQNEKKVGSIEITLIQPSIGEILRTQWLAILASLFLHVLLWLAYRAIARPTRSEYL
FT                   ARINEENRLKHEIQELTQALALEKQNTVTLVAQAQQQAKAKPIVRSQPEKSLESTDQNT
FT                   LALNIQFYDPKQLLSSVNQSVSVPYFKLCQLFLNKSIELCTKHYHLKANDIDVVDEFHA
FT                   EGATLAISTSHPHAVECLLMVGTVFQLLSDVLYKRYREDKRFALQTRSAVCNAVEAMQI
FT                   DAKEAAQRLAQHLHAKESALYLDNEQLKAIQDSYQLVAMPNPSNVMTRHAFMINGMNAE
FT                   CAELAQNIRTEILMGKKSIPQNDSPSSAAS"
FT   gene            109063..110286
FT                   /gene="serB"
FT                   /locus_tag="ABAYE0098"
FT   CDS_pept        109063..110286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="ABAYE0098"
FT                   /product="phosphoserine phosphatase"
FT                   /function="1.5.1.11 : serine"
FT                   /EC_number="3.1.3.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85085"
FT                   /db_xref="GOA:B0V9V5"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85085.1"
FT                   /translation="MREIILISFLGPDQPNQFTRLMQVLSVHSLQILDVGQAVIHNQLT
FT                   LGIVVASENETATALAMKEILILAHDIGLTVRFKPISGAEYDQWVSEGGRTRYIVTALA
FT                   PELTAAHLQAVTQIVSSQGFNIETVTRLSGRVDLEKDSTLPRRACVQFGLSSGPTLDAQ
FT                   AMRAACLLLSSELNIDVAVQEDNAYRRNRRLVCFDMDSTLIEQEVIDELALEAGVGEQV
FT                   AEITERAMQGELDFQQSFRARVALLKGLDASVLPKIAERLTITEGAERLISTLKALGYK
FT                   TAILSGGFQYFAEYLQAKLGIDEVHANVLDVQDGVVTGEVKGVIVDGARKAELLRELAN
FT                   KLGISLEQAMAVGDGANDLPMLAIAGLGVAYRAKPLVRQNANQAISSVGLDGVLYLLGM
FT                   HDKDLSRA"
FT   gene            110660..111031
FT                   /locus_tag="ABAYE0099"
FT   CDS_pept        110660..111031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0099"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85086"
FT                   /db_xref="GOA:B0V9V6"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85086.1"
FT                   /translation="MFLDVFIKTEVSMVTANFAAIAGLSLIAVALVAVFFSPYRRWLGF
FT                   MLAGMFFWGLLEVVRFGVQVTFEMPVTYSYLTALSLAMVMVTFVLLREDKQAQKALANR
FT                   QYIEHTPVYEDDQQQCSSR"
FT   gene            111285..111764
FT                   /locus_tag="ABAYE0100"
FT   CDS_pept        111285..111764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85087"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85087.1"
FT                   /translation="MKLSSIPVVKLPLVDVSTDPLDLLVAGLAVRMKQLARTSPKFIEL
FT                   VHDRAFRIQIGTDLGVARQIIINHGHIDTVAGSPEKADFILQFADSEQGVKTLLKGDPT
FT                   AFMTGMQDGSIKMEGDFSLLVWFNQAAKLIPPKLPKPVKDKVRQARAFIKEKTGR"
FT   gene            complement(111804..112247)
FT                   /gene="dtd"
FT                   /locus_tag="ABAYE0101"
FT   CDS_pept        complement(111804..112247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="ABAYE0101"
FT                   /product="D-tyrosyl tRNA(tyr) deacylase"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.5 : tRNA"
FT                   /function="5.6 : protection"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85088"
FT                   /db_xref="GOA:B0V9V8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9V8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85088.1"
FT                   /translation="MRALIQRVLEAKVVVDGETTGEIQHGLLVFLGIGREDTLATGQKL
FT                   IDKILKYRIFDDEQGKMGWNVSQANGGILLVSQFTLMAQTQKGLRPDFGPAMPPSDAKA
FT                   LYEQLVEYTRSQFENVQTGVFAADMKVHLINDGPVTFNLEVEA"
FT   gene            112410..113630
FT                   /gene="pncB"
FT                   /locus_tag="ABAYE0102"
FT   CDS_pept        112410..113630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="ABAYE0102"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85089"
FT                   /db_xref="GOA:B0V9V9"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85089.1"
FT                   /translation="MTMSPIIHSLLDTDLYKFTMLQVVLHKFPQTHSVYHFRCRNLEDT
FT                   VYPLVDILDDLNEQLDHLCNLKYKEDELQYLRKLRFIKSDFVDYLELFQLKRRFIHASI
FT                   DEEGRLDIRIEGPMVQAMMFEIFVLAIVNELYFSRIKTDEVWAEGERRLQAKLELIQQY
FT                   EKAQQPNDPPFLVSDFGTRRRYSFEWQKHVVAAFHNTVPNVFRGTSNVLLAKELNITPI
FT                   GTMAHEFLQAFQALDVRLRDFQKAALETWVQEYRGDLGIALTDVVGMDAFLRDFDLYFA
FT                   KLFDGLRHDSGDPYEWGDKAYAHYRKLKIDTKTKMLTFSDGLNLPKAWELHQYFKDRFQ
FT                   VSFGIGTNLTNDMGQTPLNIVLKLVECNGQSVAKISDSPGKTMTDNDTFLAYLRQVFQI
FT                   EELDEAI"
FT   gene            113775..114629
FT                   /gene="rhdA"
FT                   /locus_tag="ABAYE0103"
FT   CDS_pept        113775..114629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhdA"
FT                   /locus_tag="ABAYE0103"
FT                   /product="thiosulfate sulfurtransferase (Rhodanese-like
FT                   protein)"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /EC_number="2.8.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85090"
FT                   /db_xref="GOA:B0V9W0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85090.1"
FT                   /translation="MTMTLPDFKLDLLIEAEELVPYLGNEYIRIVDLSRASVYEQLHVP
FT                   HAIHLQPKWLVAQHEEATGVLPDEAGLQALIEKLNISPNHHVVVYDDEGGAWAGRLIWN
FT                   LHCLGFTRTSLINGGIHAWLGAGLPTTAEVEELPRVDNLIQIDLSHAAQFRVNYEELRK
FT                   QVEQESVQLWDCRTSDEYSGVRLAARRGGHIPNALHFEWSTALNRQNHLKLHPLERTRQ
FT                   RLEQLGFDLKQPVVVYCQSHHRSGLAYILARLLGWEAKAYDGAWSEWGNRLDSPIITGE
FT                   SPS"
FT   gene            114626..115477
FT                   /gene="psd"
FT                   /locus_tag="ABAYE0104"
FT   CDS_pept        114626..115477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="ABAYE0104"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /function="1.6.1 : phospholipid"
FT                   /EC_number="4.1.1.65"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85091"
FT                   /db_xref="GOA:B0V9W1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9W1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85091.1"
FT                   /translation="MSFTSRLKKELFIKAQNLVPQHQLSRVVGKVAASENPILKAAVIH
FT                   AFKTKYGIDLSIAEQGNALKYKSFNDFFTRALKDGVRLVDENPDSIVSPADGAISQIGK
FT                   ITAGEVFQAKGQSFSVEKLIGDPQLAQPFQEGEFATVYLSPRDYHRVHMPFSGTLTETL
FT                   YVPGELFSVNQVTAENVPGLFARNERMVCLFDTELGRMAVVLVGAMIVAGIETVATGKV
FT                   KPSGRIELQHHELKLEKGAELGRFYLGSTAIILFEKDKIEWEKRFKAESVVVMGERMGH
FT                   TL"
FT   gene            115696..116892
FT                   /locus_tag="ABAYE0105"
FT   CDS_pept        115696..116892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0105"
FT                   /product="conserved hypothetical protein; putative
FT                   secretory lipase precursor"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85092"
FT                   /db_xref="GOA:B0V9W2"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85092.1"
FT                   /translation="MIRKSNSLLKILFSSICLISGSAMAAPITDLSKQIVSEKPGSILS
FT                   IAQQDVTDLFPHADQRLLVNYRSRGVNDEPIVASAFILLPKGTPPKNGWPVLAWAHGTT
FT                   GVADTCAPSGDYAGGPVHSYQEVASKALEGWLARGYAVVAPDYQGLGTLGAHPYMNAKS
FT                   QLHTVVDAVRALHMLKPKDFNKQWLVMGHSQGGAAAITVAAYGQKDAPELDLKGAIALA
FT                   PGGYQYEGIAEYVLSHPNPEPSVAAFFPIVLLGAQAAEPSIIPENLVSPEMGNVLTQAR
FT                   SRCLSELQSDLKKSPSSIFRPNVDLKPLLSYLKQQSIENMVPTVPLMIVQGSKDHLVDP
FT                   RGTYAYYQQLCKSKKPTIYQSIDGGDHRDALRQSHTFATHFLNVIEKKQAKSYCSNFK"
FT   gene            complement(116962..118320)
FT                   /gene="phoR"
FT                   /locus_tag="ABAYE0106"
FT   CDS_pept        complement(116962..118320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ABAYE0106"
FT                   /product="two-component sensor"
FT                   /function="3 : regulation"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /function="1.8.1 : phosphorous metabolism"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85093"
FT                   /db_xref="GOA:B0V9W3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9W3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85093.1"
FT                   /translation="MYEPYPVPEQVREQKLSRYSSLWTFAKQDLRLLLFFLIIAGLVGL
FT                   GIGYFWSCIFIAFVVFFTLQLRSLYLVNDWIANNPYDVPPNLNGIWGALLFNVYRAQRQ
FT                   ERIVQAEMVGLIDRAQSSLVALAEAVVLIDDQHQIEWWNPAAERLLGISPLDRGRNLLT
FT                   ILRQPTFIEYFNNIDQAPDGIKLHSNFDDDRYVQVKLTRFGGESRLLVAYDVTRMHNLE
FT                   QMRKDFVDNISHELRTPLTVLSGYIETFTDQEDINPRWKRAFDQMQSQTKRMNALVNDL
FT                   LLLSNLENNKKIAKNQIIEMPSLMNQLFDDAQAYNADYGHTLNLHIDSHCDLIGSDMEI
FT                   ASAFSNLITNAIKYTPKGGTITIGWHDDGEHAYFSVQDTGIGINPKHLPRLTERFYRVD
FT                   SDRSRQTGGTGLGLAIVKHVLMQHGAYLDVQSKENEGSTFTAVFPKERLYNMT"
FT   gene            complement(118330..119040)
FT                   /gene="phoB"
FT                   /locus_tag="ABAYE0107"
FT   CDS_pept        complement(118330..119040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="ABAYE0107"
FT                   /product="positive response regulator for the pho regulon,
FT                   autophosphorylates and phosphorylates sensor PhoR"
FT                   /function="3 : regulation"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /function="1.8.1 : phosphorous metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85094"
FT                   /db_xref="GOA:B0V9U1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85094.1"
FT                   /translation="MKDDYILIVDDELPIREMIHTSLDMAGFQCLQAEDAKQAHQIIVD
FT                   QRPALILLDWMLPGGVSGVDLCRRLKRDENLAEIPVIMLTARGEEDHKVQGLDAGADDY
FT                   MTKPFSTRELVSRIKAVLRRANALSGEKTIDANGLILDPVSQRVSFGNSILDMGPTEYR
FT                   LLAFFMTHPERAYTRAQLLDQVWGGNVYIEDRTIDVHIRRLRKVLEPFGVDRFVQTVRG
FT                   TGYRFSTRADLAAG"
FT   gene            complement(119296..119967)
FT                   /locus_tag="ABAYE0108"
FT   CDS_pept        complement(119296..119967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0108"
FT                   /product="putative transcriptional regulator (TetR family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85095"
FT                   /db_xref="GOA:B0V9U2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85095.1"
FT                   /translation="MATNDSTSKKKTKTVSKERQFKGLSLSERKEARREKLIEAGIATY
FT                   GTLGFFSVTVKDVCQEAKLTERYFYESFKKSEDLFQTIFLKMIEELQQNLMQAVIKAAP
FT                   DPEQMVDAGLRALLSTLKDDPRLARIVYVDAILVQELHNQATIQETLAQFDRMIQAFVM
FT                   LTMPQIQHNENELSLIATGLNGYVTQIAVRWVMGGFKQSLEQVLAACRIVFLALLAKVS
FT                   K"
FT   gene            120164..120997
FT                   /locus_tag="ABAYE0109"
FT   CDS_pept        120164..120997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0109"
FT                   /product="putative short-chain dehydrogenase"
FT                   /function="1.1.5 : other compounds"
FT                   /function="1.5.3.7 : nicotinamide adenine dinucleotide"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85096"
FT                   /db_xref="GOA:B0V9U3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85096.1"
FT                   /translation="MKNFKNKVAAITGAGSGIGQQLAILLAKQGCHLSLSDINEKGLEK
FT                   TVELLKPYSNITVTTKKLDVSDREAVKQWAQETVQDHGCVNLIFNNAGVALGSTVEGAT
FT                   YEDLEWIVGINFWGVVYGTKEFLPFIKQTQDGHIINISSLFGLTAQPTQSGYNATKFAV
FT                   RGFTESLRQELDIEKCGVSSLCVHPGGIRTNIAKAAKMSDSLSSLGMDPTKSIQNFDKL
FT                   LRTPPEEAARQILDAVLKNKRRLLIGSDAKILDAFQRLFPTGYQRASTIVTKWMK"
FT   gene            complement(121054..122439)
FT                   /locus_tag="ABAYE0110"
FT   CDS_pept        complement(121054..122439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0110"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85097"
FT                   /db_xref="GOA:B0V9U4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85097.1"
FT                   /translation="MGDGEYMPPRQSLIHQQNLWKTFFVFLLPLIATNILQNLSGTINT
FT                   IFVGQMMGVDAIAAVSVYFPILFLLLAFIIGISTGTTVLVGQAWGAQDIEKVQSVVGST
FT                   LFMTIIGGIITAIIGVFFAHDILELLGTDPKVMHLSLPYVQWMLAGSPLLFVYIIYTSI
FT                   LRGVGDSTTPLLALALTSVIGVIITPILLKGYFGFPALGIIAPAIASIISYIAILIFLA
FT                   IYLNKKKHPLRPNRQLLQHIRHNSALSKIILRLGVPTGIQMITTSMAGLVIVGLVNRFG
FT                   AHATAAYGAVNQVLNYIQFPAISISIAASIFAAQAIGAGKSDLLARVTRTALGMNFLFT
FT                   GALIALGYLFSKYLMALFITDPTVVVLGQQLLFIVLWAILFFGAGAIFASIMRASGTVT
FT                   VPMLINISAILFIEMPCAYWFSSMWGLKGIWVAYALAFVSLCIIQGLYYQFIWKKKKIK
FT                   VLI"
FT   gene            complement(122528..123682)
FT                   /locus_tag="ABAYE0111"
FT   CDS_pept        complement(122528..123682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0111"
FT                   /product="putative aminotransferase"
FT                   /function="1.5.3.6 : pyridoxine (vitamin B6)"
FT                   /EC_number="2.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85098"
FT                   /db_xref="GOA:B0V9U5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85098.1"
FT                   /translation="MLQLQSKFPAQGVTIFSTMTAMAQRLGALNLSQGFPDFPAPPALL
FT                   EALSQATLAGHNQYPPGDGILALREQLALQFQQRDQLQLDPVTQITITPGATIAIFCAI
FT                   QACINTGDEVIIFDPSYDSYGPSVELAGGKAVHIALQAPDFKVNWQQVKDRINDKTRMI
FT                   VVNTPHNPTGTIWSEQDWLELIALIQDKNIVVLSDEVYEHLVFDGQQHFSALHFPELRE
FT                   RSFVIGSFGKTFHVTGWKTGYCVASPDLMRLFRQIYQYVNFCGTTPCQIALAQYMQQHP
FT                   EHIQELSQFYQTKRDRFNQAIHNSRFLLKSSQGTYFQNLDYSQIRPDLNDVEMCQFLAE
FT                   QHKIVAIPVSVFYQQAPESLRLIRFCFAKNDETLQKAGEILNQC"
FT   gene            complement(123710..125020)
FT                   /locus_tag="ABAYE0112"
FT   CDS_pept        complement(123710..125020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85099"
FT                   /db_xref="GOA:B0V9U6"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85099.1"
FT                   /translation="MNMAEEVHHAPNLKRSKYFATMALIIVVVLWIGLLIANRFLPEHT
FT                   DLIHILMLGAEAGVVGGLADWYAITVLFRNPFGKLPIPKFLRDHTEIIPRNKARIAESM
FT                   GRFVQENFLSPQVVERSLEKTDLSLAIGQWLASPQNNTQVVQLIQQTVPKVFEFVSQEQ
FT                   IANFVQNNSVQWVRNTQVNKLASEMLRAVLENDFHQDVLQRGLDIAHEWVVQNPDKTRE
FT                   LTRKMFKALGVWSLAKGASWIGIDVQQRTIDSLVEKVESMLADHEHPWRQEIETIAHSL
FT                   MLELANPESIASQRLNSGKDALLDSPQVLNFISGAVTILCDAIKEDLMKEDSGIAMNLR
FT                   AAIQQLGENLVQNVKVREVLNKEMTGLAMNFTDQYSHKIIRYVSERIHEWDSREMIGKI
FT                   ENEVGGDLHMIRVNGVVVGAFIGLTLGVIRAAIESIL"
FT   gene            complement(125034..125618)
FT                   /locus_tag="ABAYE0113"
FT   CDS_pept        complement(125034..125618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0113"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85100"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85100.1"
FT                   /translation="MLSWEFTMKYLSLCLALGTAITLSACSTVPSKPKTFDQLGQFSAY
FT                   PLNAQTFRISFQADPNMSYGAAEEITLVKSAQTTVQKGFRFFKVLNDPSNQSQKPPRQA
FT                   VVYPSAPSFYPYGYYRRYPGFWHDPFYDFPQVVNIDPVQVSYTIECYRDQKQAPQDAFD
FT                   ATLILKSIGQKYGLSPTGELLPPPEPPVKQK"
FT   gene            complement(125657..126196)
FT                   /locus_tag="ABAYE0115"
FT   CDS_pept        complement(125657..126196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85101"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85101.1"
FT                   /translation="MNDQDILNFWFSPEHRSLWFAKSEDFDAKIRDQFADVHRQATRAE
FT                   LWSWRKTPEGRLAEIIVLDQFSRNIYRDQPESFAYDGLALALSQEAISLQLDAQLNPEQ
FT                   RSFLYMPFMHSESKLIHEFALKLFQRLGNEINLSFEKKHKVIIDRFGRYPHRNAILGRV
FT                   STPEETEFLLEPNSSF"
FT   gene            126365..127942
FT                   /gene="gshA"
FT                   /locus_tag="ABAYE0116"
FT   CDS_pept        126365..127942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="ABAYE0116"
FT                   /product="gamma-glutamate-cysteine ligase"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.1 : glutamate"
FT                   /function="1.5.1.12 : cysteine"
FT                   /function="1.5.3.10 : glutathione"
FT                   /EC_number="6.3.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85102"
FT                   /db_xref="GOA:A0A0R4J7Z5"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7Z5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85102.1"
FT                   /translation="MSQPTTPSQSVIPAWVDSSLLQGMLRGIERESLRMQSNGFLSQEL
FT                   HPKALGSALTHPKITTDYSEALMEFITSPQPTIGDALHELTDIHAVVHRHLENGEKLWP
FT                   LSMPCMLDDNEERIRLAQYGTSNIGRFKTLYRRGLGIRYGRRMQTISGVHYNLSFPDSL
FT                   FSALQAHETDEKLKALSLQDYRSHRYFGLIRNFIRLTPLVMFLVGASPSVCRCFLTGHE
FT                   HHLLPLIKGSYYLPYATALRMGRLGYQNSAQKSLGIHYNNLTGYLDGLQKAVHSPYPPF
FT                   SRLGLNDASGEPLQINDHVLQIENEYYSLVRPKQVPQAGETPSQALKNRGVGYVELRAV
FT                   DVNPYSAIGVNETTAGFLEALALYCLLSDSPELLCPEQDLIEKNQTEVVNRGRAPNATI
FT                   TDLNGSYHIEDWARQHISKMQDCARLLDQTYATDLYSSALAVMQERIDEVDETLSAHVI
FT                   DDTLKHGGTWSFGSHMAQLHAETYEKHEISAETLQYFEQLAVQSLQQQEQLEQDSQISF
FT                   DQYLEQYR"
FT   gene            127957..128472
FT                   /gene="dsbB"
FT                   /locus_tag="ABAYE0117"
FT   CDS_pept        127957..128472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="ABAYE0117"
FT                   /product="disulfide bond formation protein (Disulfide
FT                   oxidoreductase)"
FT                   /function="2.3 : protein related"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85103"
FT                   /db_xref="GOA:B0V9V0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85103.1"
FT                   /translation="MRLSYRLVSGLLVLASIVGMSFALYLEHVKGLEPCPLCIFQRVGL
FT                   MAMGFVALIAFLHNPVSNAIKRFYAFLAGVAILWSVGVAGRHVWLQHLPPDQVPSCGPG
FT                   LNYLIDALPMKTVLQEVLSGSGECAAIDWTFLGQSLPVWSLVYFLLLLLVCLWQLFRFY
FT                   PVFKTAKK"
FT   gene            128638..131943
FT                   /locus_tag="ABAYE0118"
FT   CDS_pept        128638..131943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85104"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85104.1"
FT                   /translation="MLFNIFSVLEKIGLNAQKRAIHVQFSNELLNHQVFLQRIEGQHQL
FT                   NGGLMAELICLSTNAQIALKQFIGVQVAVDQVTDSGQLFRTTGIVTEASYGQSDGALTL
FT                   YKLTIEDATNLWHKRRNSRVFMNKSIVEITEVLFKEWQEKSPLFAASLSLDLGGLSQNY
FT                   DIRPFTMQHNESDYDFLTRLWRSEGVSWLIDESELFVPHFTAPIQAQKLRLIDDNNQYQ
FT                   ALARRSIRYHRSSATEYQDSITGFVAVRSLQPTAVHVQRWQPDALAQEEGNGSVVTTHT
FT                   HSDNFDSATLSLEQAWHVSPAWMQDLKGEDQATASSSSQLEKLNQHFTDMHASRAKYFK
FT                   AYSSVRDTQVGYWFNLREHPEIDQHEGADQEFLIIAKNFYNQNNLPKDLHQQVSQLLTQ
FT                   SRWDQHGYDDIERQSNELTLIRRQIKTAPEYNPEQHRPIAYPQRAKVVGPEGETIHVDE
FT                   WGRIKVRFLFTRSDDHGHDGGAGSNDNDTDSAWVDVLTPWAGEGYGARFLPRIGEVVVI
FT                   DFFDGNIDRPFVTGRIHEAQRSPTKFDVKGQLPDTKKLSGIRSQEVNGSGFNQLRFDDT
FT                   TGQISTQLQSSHAATQLNLGNLSHPKEQATSQGRGEGFELRTDAWGAVRAGKGMLISTY
FT                   AQEQAIADHLEAAQAQSLLSQGYESMKMLSEVAAKQQTDALNVINRLPKFIQSLELKTT
FT                   GQALNSTVNLFKEGINNDPIHALKDCGGFIQDIGALGGNAKGVVDEFNSFFSDAKDAVE
FT                   NLKAFIENVEEHGPDIVKGKLASIKDRIHKNPFESIQEVGRVLANVETKDFDLMSTCGT
FT                   FSKGSKLEVSPSKALSSLQGFMEGYTQGLESSSDTKQQEQGKIFRQALMLLASPNGIAL
FT                   TTPENIILQASQDIAESASGSINLSAQKNIIGHAQDKISLFAAQKGLRAYAAKGKLELQ
FT                   AQDDAIEAIAKKVIKLISTEEKIELTSPKEIVLTAGGSQLKINANGVFSTTGGKFESKA
FT                   GQHLFTSGAKVSYEVPELPSSFDYSNRIDLYKIFQWSDFENIKYSAIFENQRVTQGNLD
FT                   ELGRTERFKSSMPDKMKVLVGYSADKWHKETEEFEDFDDYETNNDSNLNNNSN"
FT   gene            131955..133703
FT                   /locus_tag="ABAYE0119"
FT   CDS_pept        131955..133703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0119"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85105"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9V2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85105.1"
FT                   /translation="MNKKGLIQFRFVELFTGNNIPNLYHVIKNEKGTTIASGMTNSNGL
FT                   TVMISRDVGDTLYVYLKNIITGDLKEKVRHTVIYKKEIVRVTSSKILLDNIILAKSTNK
FT                   PGNYRYLTHKVKKGENLSLISHRFNCKISEIVHLNKLKNPDHIDVGQIIKIPYKGGSSD
FT                   SKKSPDNKQSKHENNKSSSTQKVNSHENNNKNTSDKPQKRIESKDITDEYTKESGKPMK
FT                   VATNATSPCICKQYNLAWGSKVSCEFRKRVIKIAQNLWPNDSENMASQLMAVMHLESAG
FT                   TFSPKIGTFISKKLTDDAKGGYVGLIQFGKFASIDLKVKRSDLAKMSAVQQLDYVEKYY
FT                   KLNSAHTKIKNLTGLYLWVNYPKNVKENRLEDEDIVYAAPKDAEVTSKKFLESPYHQNP
FT                   SFMKENEEYKRDGKKVIRQGFKNGSTKVWEVEQEIKKHLTEGIKSQNLEKNYNCAYINH
FT                   TEIKNTQKINLEKFAEILRKRAKEKSQHQCAKYVRIALEAGGADTSGHPVAASDWGPTL
FT                   KKIGYKEIPEEFNKPQLGDIYIITKTDKHQYGHIAGYDGSQWISDFKQKGHRIYSDHVN
FT                   YRYFRM"
FT   gene            133725..134183
FT                   /locus_tag="ABAYE0120"
FT   CDS_pept        133725..134183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0120"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85106"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85106.1"
FT                   /translation="MKLLILEILCLSLLSGCASAKEAECYNTSKALITDLYNKFPINGD
FT                   EVIENKNIKTLSNFFDKNLTNLLIKDQECSARNNGVCNIDFNILIHSQDTPNKYKILQD
FT                   TDNLVTVKVEYHQYSEFINFVINKESSCKKIGNIKYDDGSDLIKMLRK"
FT   gene            134185..134541
FT                   /locus_tag="ABAYE0121"
FT   CDS_pept        134185..134541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0121"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85107"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85107.1"
FT                   /translation="MKYSILFLILLFANYTFANTEIWNGTYHYYSSEELPDGNVATIES
FT                   TLTVAPKKCVYSIVGFQVDKSYVCKVKKKNNELYFFDNKSGNRFGKVVFKKGKYYLYSP
FT                   EVLDSKDNLFIKDE"
FT   gene            134572..135375
FT                   /locus_tag="ABAYE0122"
FT   CDS_pept        134572..135375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0122"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85108"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85108.1"
FT                   /translation="MAFDTNKTNLIYTWCVLSKVYIVRTSFIKFHNFLLIFSVCITSNA
FT                   TDYKPEQLDEKTIYSNSEHELNSVYSDIKGYISDNKNEVKYLVDTQRFWLKNRNLKCNF
FT                   NGKEANSGNYKCLSDFNNSKIKDLKNSYLDLDNLEGKLIKPFRYTNGIMKELETGGCYC
FT                   SESTIKILKDKIYIYQACDQGLKEPRIYNIVGKKKDSFSVEYQIDTNNKVPEFNLAFVT
FT                   NGKNVWNIVPKIFRKEDLINLNFGINYTTDMNIKNKKNDCHDDEE"
FT   gene            135473..136213
FT                   /locus_tag="ABAYE0123"
FT   CDS_pept        135473..136213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0123"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85109"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85109.1"
FT                   /translation="MSLFKMEKHFKFIISTVLMMGPVGSSYADFGFIQDKDGYVNVRGN
FT                   SSLNSKVTSKLNNNEIVSCVMDEGTNNFCLVNASNGVTGFVYKNRVNNFSGYNSIKLSQ
FT                   YSREKSVYNDKNIIVEVYAKKAILDPKLYKTFKGEYKYFNNKKFFGTDGTLPNNNFLQL
FT                   DKIIIKSKDMKIEIGKNDIEQYFFPKNGIDGDKNELADFKIYFLNNNIFILNTFNNGGA
FT                   AAYNIVLNIKNGKLVANKAWKVEI"
FT   gene            complement(136280..137623)
FT                   /locus_tag="ABAYE0124"
FT   CDS_pept        complement(136280..137623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85110"
FT                   /db_xref="GOA:B0V9T4"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85110.1"
FT                   /translation="MPSLTPLHETYCKWDRTPPSQADVLEGLAQLFSTSLNGVHELIQV
FT                   INIEVLKNAFGISAQNAKNFQKRPSVQKAYQFSYGALQKYGSCFLAPGLRRIIEKFPTL
FT                   HEKPLTPTLHFLVGVLNGIFGDYLLKQHSPLALPMVLYDHYGAIQQGELAGRIVILVHG
FT                   LCMNHLTWSNAHYGGIGERLLAQRDHNTMLYLNYNTGRRISANGRSFSNLLEDLVQRNP
FT                   RITSIDLIGHSMGGLVSRSALFYGKQNMYQWIHMVENLVCIGSPHHGAVLERFGFALQD
FT                   RLGAFPFVGLIGQLVNIRSNGILDLRHGSVRDDDWEYMDARIGMMDDNRAPAPLPSHIN
FT                   TFLVAGTLEFEKVRNKALTVIGDYLVSVKSALGEHPNPRFQLKVPDSHKAVFYGLNHFE
FT                   IQYHSSVAEQITRWLYPHVNDYVQDGIQTHIIDMPNYSLEDLEGIVET"
FT   gene            137835..138416
FT                   /locus_tag="ABAYE0125"
FT   CDS_pept        137835..138416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85111"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85111.1"
FT                   /translation="MNIIYLHGFNSSSSSIKGLSLKQYCSELGINVHLPDLNRSPEQVV
FT                   AQVSELIESLQEVALVGSSLGGFFATYFVAKYNIPAVLINPAMQPWKLFDELFQVESMP
FT                   YKVNDQWSIDHIQLRQLEQLELKQPENADKILVLLQQGDEILDYRQAQRYYSAATPSSL
FT                   ILTDAHGNHAMEDFEEKLPLVIEFFAHTIK"
FT   gene            138431..140314
FT                   /gene="parE"
FT                   /locus_tag="ABAYE0126"
FT   CDS_pept        138431..140314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="ABAYE0126"
FT                   /product="topoisomerase IV subunit B"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1 : DNA related"
FT                   /EC_number="5.99.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85112"
FT                   /db_xref="GOA:B0V9T6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:2XKJ"
FT                   /db_xref="PDB:2XKK"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85112.1"
FT                   /translation="MTQYTAQSLEVLSGLDPVRRRPGMYTDTSRPNHLAQEVIDNAVDE
FT                   ALAGHADKICVTVYKDGSLSVEDNGRGMPVDIHPEYGQSGIEIILTKLHAGGKFSTDNY
FT                   QFSGGLHGVGISVVNALSTRVEVEVQRQGNLYQMAFEQGEPVAPLAVLEGKAPKRATGT
FT                   TVRFWPEAKYFDSPKFALKALKHNLKAKAVLAAGLKITYIDQINDEKIEWQFENGLVDY
FT                   LMDELQDREILPNPAFVSSGQADRAACEFAICWNVEGGEQVQESYVNLIPTAQGGTHVN
FT                   GLRSGVTEALREFCELRNLLPRNLKLSAEDVWDGVNYILSLKFQEPQFSGQTKERLSSR
FT                   EAANIVLNIAKDAFALWLNQHAEIAMQLAEMAISKAGRRLKAAKKVERKKIVSGPALPG
FT                   KLADCVGQTREESELFIVEGDSAGGSAKQARDKNFQAIMPIRGKILNTWEVSSDEVLAS
FT                   QEVHDIAIAIGVDPGSDDLSELRYGKICILADADSDGLHIATLLCALFVKHFPALVEEG
FT                   HLYVAMPPLFRIDIGKDVHYALDDEELETILKNVKGNKNPQITRFKGLGEMNAIQLRET
FT                   TMDPNTRRLVQLDLDDAHLTAGLLDKLLAKKRAADRKQWLEQKGNLADITV"
FT   gene            complement(140436..140960)
FT                   /gene="allA"
FT                   /locus_tag="ABAYE0127"
FT   CDS_pept        complement(140436..140960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="ABAYE0127"
FT                   /product="ureidoglycolate amidohydrolase(decarboxylating)"
FT                   /function="1.1 : carbon utilization"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="1.1.5 : other compounds"
FT                   /EC_number="3.5.3.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85113"
FT                   /db_xref="GOA:B0V9T7"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85113.1"
FT                   /translation="MGKNCQVMIMKNIQIQPLTIENFQPFGEVICCDGHDFFHINDAHT
FT                   ERYHALVETEIEGEAKAGISIFRNIKASVLPMEISMLERHPKGSQAFIPLQQQKFLIIV
FT                   APALDENTPDISKLCAFVSDGKQSINYRAGTWHHPLLTFEAPSDFAVVDRIGGGANCDV
FT                   FQFPEAIKITV"
FT   gene            complement(140936..141946)
FT                   /gene="alc"
FT                   /locus_tag="ABAYE0128"
FT   CDS_pept        complement(140936..141946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alc"
FT                   /locus_tag="ABAYE0128"
FT                   /product="allantoicase"
FT                   /function="1.1 : carbon utilization"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="1.1.5 : other compounds"
FT                   /EC_number="3.5.3.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85114"
FT                   /db_xref="GOA:B0V9T8"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9T8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85114.1"
FT                   /translation="MATLHAPAFELPEILNTKTNLADARIGAQVIECSDDFFAEAKRML
FT                   QFEAPIFVEDKFDDHGKWMDGWETRRKRHAGYDWCIVKLGVSGKISALDIDTTFFTGNY
FT                   PASASLEACYAPNGDLTGVTWQSILENTELGPSQHHIFMVNNDAIFTHIRLNIFPDGGV
FT                   ARLRVYGDVHIQVTDHEQTLDLLALENGGRVIAYSDAHFGHPRNLINPGRGVNMGDGWE
FT                   TKRRRAPGYDWCILALGKSGKIEKIEIDTAHFKGNFPAEVSIQAVYLENATDAQLIPQS
FT                   MFWSYLLEAQPMQMDHIHEYVNEILKHEKISHIRINMIPDGGISRVRLWGKIAKS"
FT   gene            142146..143303
FT                   /locus_tag="ABAYE0129"
FT   CDS_pept        142146..143303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0129"
FT                   /product="putative flavoprotein monooxygenase acting on
FT                   aromatic compound"
FT                   /function="1.3.6 : aerobic respiration"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="1.1.5 : other compounds"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85115"
FT                   /db_xref="GOA:B0V9T9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9T9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85115.1"
FT                   /translation="MNVVIIGAGMGGLTTGIALKKFGHQVRIFEQTEKILPVGAAISLW
FT                   SNGVKCLNYLGLTEKIAKLGGQMDDLAYVDGLTGDVMTQFSLRPLIEEVGQRPYPVARA
FT                   DLQNMLMDEFGRDQIYLGKKMVGLEDKADFVEVHFADGSSTQADLLIGADGTHSMTRAY
FT                   VLGQQVQRRYAGYVNWNGLVEISEDLAPAQQWTTYVGEGKRASLMPVADGRFYFFLDVP
FT                   LPAGLENNRDEYKKLLKQYFADWCQPVQQLIERLDPQKTNRVEIHDIEPFTQFYKGRVV
FT                   ILGDAAHSTTPDIGQGGCQAMEDAIYLARSLQINTLGLEDALRRYQNKRNERANELVLR
FT                   ARKRCDVTHMKDETVTQAWYAELRREQGGHIMQGIISNIVGNPLD"
FT   gene            complement(143356..144081)
FT                   /locus_tag="ABAYE0130"
FT   CDS_pept        complement(143356..144081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0130"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85116"
FT                   /db_xref="GOA:B0V9U0"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9U0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85116.1"
FT                   /translation="MQLKQLAATCALLSATAMVQAKPIWQDFSVTGLYGENYEVVDDKE
FT                   TTITLEYAAKVKYADVFFFMDRMRGENDHKSTYFELSPRLSLGEVSGKKLAYGPIKDVL
FT                   ISTTWESNSENGNNFDNFLYGFAVDLDIPYFQYANLNFYRANNEKTDDDYQMTFVYGIP
FT                   FKIASEDFLVDGFLDWSTAEGDHASELNWTTQWKWNVGKHISPDTRLYLGIEHSVWNNK
FT                   FGIKGADENNVSALVKYHF"
FT   gene            complement(144204..145571)
FT                   /locus_tag="ABAYE0131"
FT   CDS_pept        complement(144204..145571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0131"
FT                   /product="putative permease; putative Xanthine/uracil
FT                   permease"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85117"
FT                   /db_xref="GOA:B0V9G1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85117.1"
FT                   /translation="MNHQQKNAISPEHDYLGISKSFAYGLQHVLTMYGGIVAPPLIIGT
FT                   AAGLSAAQVGMLIAAALFVGGLATLIQTIGTKYLGAKLPLVQGVSFAGVATMVAIITTG
FT                   GGLPAVYGAVIAASLIGLCLAPYFSKIIRFFPPVVTGCVITIIGLSLLPVAIRWMMGGN
FT                   NKAPDWGSVENISLALLTLGIVIILNILPQASIRRLSILLAIVAGTTLAYFMGFGDFSQ
FT                   VSSGAWLQFPHLFAFGLPTFELSAILSMLIVTLVIMTETTADIIAVGDIVGTQVDSKRI
FT                   ANGVRADMFSSAIAPIFGSFMQSAFAQNVGLVAITGIKSRFVVAAGGVILIILGLLPVM
FT                   GRLIAAIPMPVLGGAGLVLFGSVAASGIRTLAKIDYNDQKNLIIVATALSAGMIPIINH
FT                   EFYAHFPVWVQTLFHSGISSTCIFAILLNLLFNHLPSFRSSRTPHLSQTINTRNTH"
FT   gene            complement(145596..145919)
FT                   /locus_tag="ABAYE0132"
FT   CDS_pept        complement(145596..145919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85118"
FT                   /db_xref="GOA:B0V9G2"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85118.1"
FT                   /translation="MISTHILDTNLGKPAAQVEVKLFHAATHELIATAITNQDGRVSDF
FT                   GIKNLGKGAYQLEFEVAPYFSSQQIKTFFPRVCIQFFIEDTNQHYHIPLLISPFAYSTY
FT                   RGS"
FT   gene            complement(145916..146473)
FT                   /locus_tag="ABAYE0133"
FT   CDS_pept        complement(145916..146473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85119"
FT                   /db_xref="InterPro:IPR017595"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85119.1"
FT                   /translation="MALLLLKLYITTTSLGITVFLAEFNQAPPDQLKTLLNNCVHIPVW
FT                   AEKIISERPYSSTSVLLGYAEQLSHTWSWQEIQAALATHPKIGERQAKKQLNAKEQNFS
FT                   AQEQAGISLDEQTQQALLQGNIEYEQKFGFIFLIKAAGLSSDEILKKLHQRLQNNLAIE
FT                   KTIVHEQLAAIALLRLSQEVQA"
FT   gene            complement(146519..147538)
FT                   /locus_tag="ABAYE0134"
FT   CDS_pept        complement(146519..147538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0134"
FT                   /product="putative Polysaccharide deacetylase"
FT                   /function="1.2.4 : Polysaccharides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85120"
FT                   /db_xref="GOA:B0V9G4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85120.1"
FT                   /translation="MQADFLNFYEKLNKRRAIVSESYLSGAELIEQIQKSPYSRDLIGY
FT                   HGQPPEVKWPNNAKVAVQFVLNYEEGGEKHIEHGDEGSEQFLSEIIGAASYPAKHMSMD
FT                   SMYEYGARAGFWRIHNEFQRRKLPMTIFGVAMALVRNPYIVEAIKQADYDVVSHGYRWL
FT                   HYQETDLEVEKQHMEQALSVLENLFGNKTIGWYTGRDSPNTRQLLAEFPQIQYDSDYYG
FT                   DDLPFWTTLTDTAGASRPHLIIPYTLECNDMKFCSPGGFNSSEQFFQYLKDSFDVLYAE
FT                   GETAPKMMSIGMHCRILGRPGRFKALQRFLDYIEMHDRVWVCRRQDIAEYWYKNHINQ"
FT   gene            147737..148087
FT                   /locus_tag="ABAYE0135"
FT   CDS_pept        147737..148087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85121"
FT                   /db_xref="GOA:B0V9G5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85121.1"
FT                   /translation="MNIEIRTDKNIHNSERLITYVRAELTQEFQRHSERITHFSVHFSD
FT                   ENGDKGGDKDIHCMIEARPSGLKPVAVHHKAGNIDASIHGAIEKLKRSLEHTFEKKEHP
FT                   RGGQPEFIDDEV"
FT   gene            148240..148791
FT                   /locus_tag="ABAYE0136"
FT   CDS_pept        148240..148791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85122"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85122.1"
FT                   /translation="MVMLTTQQQALIKAIEELELAQVQKLLAEGLDPNFIDPEQGPPVS
FT                   IICDGIFKWWEDVSEAYEAGTPLSQEEKQQALQVYLDILEALIQAKANVHLWDAEEFYG
FT                   PLWDAASSACAPAVQRLLDEKVDPNTRDEEGLTILSSISQLFFDCDFDEIDWSEALQEE
FT                   RETLELLRRHGAKMSKELTT"
FT   gene            148792..149571
FT                   /locus_tag="ABAYE0137"
FT   CDS_pept        148792..149571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0137"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85123"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85123.1"
FT                   /translation="MDNRMRTFQILTFALTTVAAGSTFAAEFSFDRPGSGFGTGITPVG
FT                   KLAWEQGLPSATYTETTVDGVKEKTVTVNEDMLFRTGLADGLELQLGWQGPAWTQTKRA
FT                   GKKTDNSGFGDVSIGLKKAIDLNDENLTMAVLAEAVIATGNDEFTAHDDIYSLSSAVAY
FT                   KYNDLLDTSITMRYEVQNSNWAVTAIPTINYKIAGKLSGYSEFVYRKAESQDYQYGLGT
FT                   GLVYAVNNRTQLDANIGVDLEGQDKSYKGGLGMAFLF"
FT   gene            149597..151414
FT                   /gene="dsbD"
FT                   /locus_tag="ABAYE0138"
FT   CDS_pept        149597..151414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="ABAYE0138"
FT                   /product="thiol:disulfide interchange protein precursor"
FT                   /function="1.4.3 : electron carrier"
FT                   /function="1.6.15.1 : cytochromes"
FT                   /function="1.6.15.2 : thioredoxin, glutaredoxin"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85124"
FT                   /db_xref="GOA:B0V9G8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85124.1"
FT                   /translation="MMKKLISQGIIYFLVAATFVLSQFVFAEDKLLSPEQAFSFSVESP
FT                   QSHTAKLSWQIQPNYYLYQHKFTVQQGNQPLTLNLPKAVSQYDENYGQSQVYYHQVNFQ
FT                   IKTKPSEHYTVTWQGCAKDRICYPPQTIEFQTDANGLVGLQNQAGAAPKRLLDLANTQA
FT                   SSSTESLENQSSATQAEGAAPEIAQDQVWSAKLIEHSLWYGVLLFLGLGMLLAFTPCSL
FT                   PMLPILTSLIIRDHKGLKAWTIALTFVCSMALVYAGLGLIASSAGLNFQRWLQQPATLI
FT                   AFSLLFVVFALNLFGLFELRLPQTWLNRLDRIQSMQQGGTLVGAGVMGVVSALLVGPCM
FT                   TAPLAGTLLFISQTQNQWQGALLLFCLGFGMGIPLLIASVLGAKFLPKAGDWMHQIKVI
FT                   FAFMMLGLSLYFIRPLLPDWGMQALSFVLGLAFIIYALYQFFWKKGQLQWLYALLFLLV
FT                   TPFVVYNQYQHIQNRSLQNSEHMAEWHVATTAADFQKILAAAPADRAIVVDVYADWCVA
FT                   CQPIEHRILKSPEVQTALVPYYLIKLDLSHYDQSHEALLKQWNILGPPTYLFLNKQQQE
FT                   IRSLRLTGAFSQQELLQQLASLSKAKDSN"
FT   gene            complement(151406..152599)
FT                   /locus_tag="ABAYE0139"
FT   CDS_pept        complement(151406..152599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0139"
FT                   /product="putative membrane protein with GGDEF domain"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85125"
FT                   /db_xref="GOA:B0V9G9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85125.1"
FT                   /translation="MKIRLITRPINKIKQVILDFIHHNHIINWTPLQKSALMLTLACAM
FT                   NFSWILWKGYILITPSIWQWANLSLVESQIWLNLLTLFLLAVLIIPCYRYKDQAWAQKI
FT                   VPLISVQAFMLMLCHDGYLIGSISPATMVGYVGTIGVGLVLFERKIVYSAFIPATIILA
FT                   VCTYLSMTGVISYAPLFNFKTMRHAQTNPFWLGSMLFFIMPILVACFILFEILLTQWRQ
FT                   RETYIQRLSQIDPLTNVLNRRSLNTHLEALHEQQFDYAVILLDIDHFKKINDIYGHHQG
FT                   DQVLIEIARCLSENLRNEDIIGRFGGEEFILLLPHTDIIQAEKIAERCRQALQELTIFN
FT                   NQNIQIHVSASFGISSSAFANDPYLVIRQADQALYAVKASGRNQVRTFHQLPQIKSI"
FT   gene            complement(152775..153686)
FT                   /gene="est"
FT                   /locus_tag="ABAYE0140"
FT   CDS_pept        complement(152775..153686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="est"
FT                   /locus_tag="ABAYE0140"
FT                   /product="esterase precursor"
FT                   /function="1.1 : carbon utilization"
FT                   /function="1.1.2 : fatty acids"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85126"
FT                   /db_xref="GOA:B0V9H0"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9H0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85126.1"
FT                   /translation="MNIPNVLKYYFTETFLKTAIRKPSQLNLPPTALRPMLEQLCRAFP
FT                   KQKNVTVRPIRLAGIKGEEIKAQDSATQLIFHIHGGAFFLGSLKTHHAFMTDLAARTQM
FT                   QIIHVDYPLAPEHPYPEATEALYDVYQSLLVQGIQPKDIILSGDSCGANLALALCLRLK
FT                   EQPELMPSGLILLSPFLDLTLTSESLRFNQKHDALLSLEALQIGIQHYIGNHIAADDPR
FT                   VSPIFDNLEGLPPTLVQVGSKEILLDDAKRFREKAEEAGVKVHFKLYTGMWHNFQMFNA
FT                   WFEEAKQAMADIAEFAHELDKT"
FT   gene            153836..154273
FT                   /locus_tag="ABAYE0141"
FT   CDS_pept        153836..154273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0141"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85127"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9H1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85127.1"
FT                   /translation="MKKIALALGLVGMAAFANAADPLNGTVWKTIDDQTNKPKAVVKFT
FT                   EQKDGTLTATIQNILTPGEENACTKCEGPYKNKPLKGVTIVHNLKNVGGNNYENGTILD
FT                   PKSGKTYKLKGELAEGGKKLKLRGYIGVSALGRNQTWIRAN"
FT   gene            complement(154311..154661)
FT                   /locus_tag="ABAYE0142"
FT   CDS_pept        complement(154311..154661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85128"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9H2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85128.1"
FT                   /translation="MLKIYGIKNCNSMKKAFDALQAKGLSYEFHDYKKQGIDADTLKIW
FT                   LKEIGQDTVLNKKGTTWKKLSEEEQTRALSSEDHLIEALIAQPSLIKRPVLQTSKGFLV
FT                   GFDETAYQNLSA"
FT   gene            complement(155117..155959)
FT                   /gene="crc"
FT                   /locus_tag="ABAYE0143"
FT   CDS_pept        complement(155117..155959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crc"
FT                   /locus_tag="ABAYE0143"
FT                   /product="catabolite repression control protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85129"
FT                   /db_xref="GOA:B0V9F0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9F0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85129.1"
FT                   /translation="MRLNFRMIPKDQYPSDVKILRVVSINVNGLRSSVTKGLLEWLEQS
FT                   DADVVCMQESRITHEQWTEKFRPEGWHTHLFPAERAGYAGTAIYSRLPFVSIKDGLGFE
FT                   LADSQGRFISAEFDLGLSHPVHIASLYLPSGSSGEEAQARKDLFLGEYAKILKQWRDEN
FT                   KSIIICGDYNIVHKRIDIKNWSGNQKSSGCLPHERAWLDHIYDELGYVDTFRVVRTEAE
FT                   LYSWWSNRGQARAKNVGWRIDYHACSPDWKARTVNAWVYKDQWFSDHAPVIIDYKIQE"
FT   gene            155917..156630
FT                   /gene="pyrE"
FT                   /locus_tag="ABAYE0144"
FT   CDS_pept        155917..156630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="ABAYE0144"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.2.2 : pyrimidine biosynthesis"
FT                   /function="1.5.2.4 : pyrimidine ribonucleotide
FT                   biosynthesis"
FT                   /EC_number="2.4.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85130"
FT                   /db_xref="GOA:B0V9F1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9F1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85130.1"
FT                   /translation="MDTDPLVSCENLTSIVNLEHLMTTPVSFHPQAFIELALSRGVLKF
FT                   GEFTLKSGRVSPYFFNAGLLNDGEALSLLAQGYADKLTQCENVDVIFGPAYKGIPFVAA
FT                   TAVALSQTHNKSVPWGFNRKEAKDHGEGGILVGAAVEGKKVWIIDDVITAGTAIREVVT
FT                   ILKNAGATIAGVLVALDRQERGQGELSAIQEVQKELEIPVHALITMKDLMDYLEAKGEK
FT                   EALANMQAYREKYGI"
FT   gene            complement(156681..158891)
FT                   /locus_tag="ABAYE0145"
FT   CDS_pept        complement(156681..158891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0145"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85131"
FT                   /db_xref="GOA:B0V9F2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9F2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85131.1"
FT                   /translation="MLIDFIFMLRISISSPQIKGSFPLSLLSLMILNIQGANAEELIDS
FT                   SSKAAATMPTIKIEAMSELDPIKSYIDYDKANVTRNGLDKKDIPQTVDTIDVQKYKIYG
FT                   SNDLSVMLQGTPGVSTSYDMRGDGITIRGFGADTGDIYRDGIRESGQVRRSTANIERIE
FT                   ILKGPASVLYGRSAGGGVVNMVSKFANFDSKSSVGAYAGSYDNYGTTADINQVLNDNLA
FT                   VRLTGEYGEAGSFRSGIENKIEMFSPSFTYKNDDGKLTWTTQYTYDKLGRVPDRGPTRD
FT                   NLPAGTSIKMGFAQDDDYVDDILQVVRTDVNYEYAPDWNFHWAASYRQAEQNFDHFYFG
FT                   NYCGLDGKNSKNEACTKKGYIDQIYYWQQTSNKTTTNTFDIKGKFKTGQLEHQIMVGTD
FT                   WTYEQREPRLANKTQNGSAIYGYVNPITGEREYSRGNGPLKISQHNYNEGTTYGVFIQD
FT                   LIGLNDQLKLMMGLRYDYFDFSTTNKIKNEHRNVKDSTFSPNVGLVWQPVPEHSFYTSY
FT                   SKSFAPFGGQMGVNQVTGSTDVAKMDKEPQYNEQYEVGVKSEWFDNRLNTQFSVFDIRK
FT                   NNIRYKPNPDSEPEVWATAGQHQSRGLEFSFIGRVLDNVFVRGGYGYTDAKVKEDNQNP
FT                   EREGNYLANTSKNTGNLFVRYLPTEQWYTEVGVTYVGSYYPNINNQVKMEGFNRVDAAI
FT                   GYSADPWNVTLAVNNLTNKEYWRSDSMPGTPRNVLLRLNYQF"
FT   gene            complement(159099..159311)
FT                   /locus_tag="ABAYE0146"
FT   CDS_pept        complement(159099..159311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85132"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9F3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85132.1"
FT                   /translation="MKLYRYLTGPDDSAFCARVTKALNHGWELYEAPTMTFNGSQVIVG
FT                   QAICKTIDENYDPEMDILDVLKNNA"
FT   gene            159473..160417
FT                   /gene="gshB"
FT                   /locus_tag="ABAYE0147"
FT   CDS_pept        159473..160417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="ABAYE0147"
FT                   /product="glutathione synthetase"
FT                   /function="1.5.3.10 : glutathione"
FT                   /EC_number="6.3.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85133"
FT                   /db_xref="GOA:A0A0R4J7Q0"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7Q0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85133.1"
FT                   /translation="MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYID
FT                   QGKAYGLISPLKVFEDYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQA
FT                   EREGSWIINKPQSLRDCNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDG
FT                   MGGMGIFRLYQDGVNIGSTLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCL
FT                   ARIPQNGEVRGNLAAGGLGQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEI
FT                   NVTSPTCIREIDAQFGTSIADDLFDVLEAGRPA"
FT   gene            160655..161752
FT                   /gene="murG"
FT                   /locus_tag="ABAYE0148"
FT   CDS_pept        160655..161752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ABAYE0148"
FT                   /product="UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /function="6.1 : membrane"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85134"
FT                   /db_xref="GOA:B0V9F5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9F5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85134.1"
FT                   /translation="MTDSQQSKPKHVMMMAAGTGGHVFPALAVAKQLQQQGCQVSWLAT
FT                   PTGMENRLLKDQNIPIYQIDIQGVRGNGVIRKLAAPFKILKATFSAMRYMKQLKVDAVA
FT                   GFGGYVAGPGGLAARLLGIPVLIHEQNAVAGFTNAQLSRVAKVVCEAFPNTFPASEKVV
FT                   TTGNPVRREITDILSPKWRYDEREQAGKPLNILIVGGSLGAKALNERLPPALKQLEVPL
FT                   NIFHQCGQQQVEATQALYADAPANLTVQVLPFIEDMAKAYSEADLIICRAGALTVTEVA
FT                   TAGVAAVFVPLPIAVDDHQTANAKFLADVGAAKICQQSTMTPEVLNQLFTTLMNRQLLT
FT                   EMAVKARQHAQPNATQHVVDLIQKM"
FT   gene            161764..163212
FT                   /gene="murC"
FT                   /locus_tag="ABAYE0149"
FT   CDS_pept        161764..163212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ABAYE0149"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /function="5.1 : cell division"
FT                   /EC_number="6.3.2.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85135"
FT                   /db_xref="GOA:B0V9F6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9F6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85135.1"
FT                   /translation="MSPTTAANQAKKLIKVPEMRRIKHIHFVGIGGAGMCGIAEVLANQ
FT                   GYKISGSDIKASKTTQQLEENGIKVYIGHEAENIKNANVLVVSTAIDPENPEVKAAIEQ
FT                   RIPIVRRAEMLGELMRYRHGIAVAGTHGKTTTTSLLTTMLAEENLDPTYVIGGLLNSTG
FT                   VNAALGESRFIVAEADESDASFLYLQPMAAIVTNIDADHMDTYEGSFDKLKDTFVQFLH
FT                   NLPFYGLAVVCGDDANIREILPRVGRPVITYGFNEDNDIRAIDVEQDGMRSHFTVLRKG
FT                   REPLRLTINQPGLHNVLNALAAIGVATDEGVSDEAISRALKGFSGVGRRFQVQGEFELG
FT                   EGNVKLVDDYGHHPKEVEATIKAARQSHPDRRLVMLFQPHRYSRTRDCFDDFIEVLSQV
FT                   DQLLLLEVYPAGEKPIVGADSRTLARSIRLRGQVEPILIDPVEGNLQNIMQNVLQPNDL
FT                   LLTQGAGNVGAISVELAQHHLYVK"
FT   gene            163250..164176
FT                   /gene="ddlB"
FT                   /locus_tag="ABAYE0150"
FT   CDS_pept        163250..164176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="ABAYE0150"
FT                   /product="D-alanine-D-alanine ligase B"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /function="5.1 : cell division"
FT                   /EC_number="6.3.2.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85136"
FT                   /db_xref="GOA:B0V9F7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9F7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85136.1"
FT                   /translation="MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAF
FT                   DPQNRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTK
FT                   QIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAI
FT                   EKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRNDVEYG
FT                   IPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLV
FT                   PKAAKAVGYSFDELCVAILDQTLEGTA"
FT   gene            164179..165033
FT                   /gene="ftsQ"
FT                   /locus_tag="ABAYE0151"
FT   CDS_pept        164179..165033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ABAYE0151"
FT                   /product="cell division protein (in growth of wall at
FT                   septum)"
FT                   /function="5.1 : cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85137"
FT                   /db_xref="GOA:B0V9F8"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9F8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85137.1"
FT                   /translation="MAQLPASMRRKRAAITSIHEKPPTRKQKLANAGGWVLLVIAFLVL
FT                   AVGIYGLYKVITDATVAKLEVVGSTTPVETQQVMRYVQPIVKDNYFTSDLEQIRDKALE
FT                   ISWVDRVVVSRAWPNGIRVRVMPRHAIARWGTGRLLSDGGDVFSEAEPRLHPELPLLHG
FT                   PVSQSKMMMRRYNEINQLFHPVNLRLKELYLTERMTWFMQFDSGLRIIVDQDQTMNKLQ
FT                   RLSHLAQSDLKPVWTKISAIDLRYRNGLSIQWKNATPPKIVNGQFVVTSDDTSIAGGTK
FT                   AKP"
FT   gene            165094..166356
FT                   /gene="ftsA"
FT                   /locus_tag="ABAYE0152"
FT   CDS_pept        165094..166356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ABAYE0152"
FT                   /product="cell division protein"
FT                   /function="5.1 : cell division"
FT                   /function="6 : cell structure"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85138"
FT                   /db_xref="GOA:B0V9F9"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9F9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85138.1"
FT                   /translation="MSEAVPSVVAIDIGTHKVSVLIGKIHAPDNIQVIGMATARNRGMN
FT                   KGKIVSLDKVIAAIKNAVAEAENMAECRIHSAWVSIPSTELQSFYASGRTPVANPAHVI
FT                   TTNEVVRALELAKASHVTSDYYLASAVPLGFELGDSSEWVQNPINMTAHSMTGHYQLMM
FT                   MPIATMQNLDRAMKGANIGVEKMVVSCLATAEASLLKDEKEYGVCLVDIGAGITNLAVY
FT                   LDGRLALARTLQRGGEHVTRDIAAVLQTTTEEAERIKILHGCVDLSAVKPDHMIQVQGI
FT                   DGPQTISRIELAEIIIARYEEIFSQIREELEQSGAIHGLYHGVVLTGDACQIEGMVSLA
FT                   RRMLGVSAHLGNPPLQVYADDQHQAALRRSMYATAAGLLMFSQSELQEAVEEPEEGNDR
FT                   SVWERMVNGWNAFNSKLKAIF"
FT   gene            166521..167696
FT                   /gene="ftsZ"
FT                   /locus_tag="ABAYE0153"
FT   CDS_pept        166521..167696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ABAYE0153"
FT                   /product="cell division protein,tubulin-like GTP-binding
FT                   protein and GTPase, forms circumferential ring in cell
FT                   division and participates in the septum formation"
FT                   /function="5.1 : cell division"
FT                   /function="6 : cell structure"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85139"
FT                   /db_xref="GOA:B0V9G0"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9G0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85139.1"
FT                   /translation="MASFEFIEDELNDGNGQARFTVFGVGGGGGNAVQHMVQSDIQGVK
FT                   FVCANTDKQALDCMNAPFKIQLGEQSTRGLGAGANPEVGQVAAEESREIIRQHLEGTDM
FT                   VFVTAGMGGGTGTGAAPVVAEVAKEMGILTVGVVTTPFNFEGRRRQKSAERGIEALEAH
FT                   VDSLIIIPNQRLLSVYGDISMKDAYKKADDVLLNAVRSIFDLVVNRGHINLDFADLKTA
FT                   MSTRGYAMMGAGLGRGEDRARQAAEQAIRSPLLDNVNIINAKGVLINITGGDDITLRET
FT                   EIITDVVNQIVDLDEGEIFYGTVFDPDARDELRVTVIATGLTRNAADAEPRKRNTVSHT
FT                   STQSAQSVDEDDVPAINKRQNAENDVNNAPSSTPRSSPMSIQDYLKNQQRK"
FT   gene            167807..168709
FT                   /gene="lpxC"
FT                   /locus_tag="ABAYE0154"
FT   CDS_pept        167807..168709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ABAYE0154"
FT                   /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
FT                   /function="1.6.3 : lipopolysaccharide"
FT                   /function="1.6.3.3 : lipid A"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85140"
FT                   /db_xref="GOA:B0V9D9"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9D9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85140.1"
FT                   /translation="MVKQRTLNRVVKASGIGLHSGQKVMINFIPHTVDGGIVFRRIDLD
FT                   PPVDIPANALLIQEAFMCSNLVTGDIKVGTIEHVMSAIAGLGIDNLIVEVSASEVPIMD
FT                   GSAGPFIYLLMQGGLREQDAPKKFIKILKPVEALIDDKKAIFSPHNGFQLNFTIDFDHP
FT                   AFAKEYQSATIDFSTETFVYEVSEARTFGFMKDLDYLKANNLALGASLDNAIGVDDTGV
FT                   VNEEGLRFADEFVRHKILDAVGDLYLLGHQIIAKFDGYKSGHALNNQLLRNVQSDPSNY
FT                   EIVTFDDEKDCPIPYVSVT"
FT   gene            complement(168807..169247)
FT                   /locus_tag="ABAYE0155"
FT   CDS_pept        complement(168807..169247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85141"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9E0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85141.1"
FT                   /translation="MSKPDNVFQQTGKHIKTGNLTFLTTQVAQWQRLTKIIQPLLPQPE
FT                   QWQVVCYQNGSLIITGENQAMISQLSYLQSQYVSKLSQLEGLKDLQRIQVRLRNKTIPV
FT                   TTSSEPSKSIPPETQEMLRSAADFVSDPKLSQALLRLASNKK"
FT   gene            169355..170047
FT                   /locus_tag="ABAYE0156"
FT   CDS_pept        169355..170047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0156"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85142"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9E1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85142.1"
FT                   /translation="MHTRRILLAFSLAASAASVAFADYQNINQSTDSDRLEQLSKTLSQ
FT                   GSYTHPDDLDLPASAKVSVTLREKTVELNNDSLAKKYGTTTAKNSFKTSSSNPYSWLVS
FT                   HPLPDTVRVSSNFGGRTMGGRAEHHGGLDMAAPSGTPIYATGPGIVTKSGWGTGYGQYV
FT                   EINHGNGYLTRYAHASRLMVRVGDQVSAGDHIANVGCTGRCTGPHLHYEVVKDGQRKNP
FT                   STYLAMLP"
FT   gene            170298..173015
FT                   /gene="aceE"
FT                   /locus_tag="ABAYE0157"
FT   CDS_pept        170298..173015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ABAYE0157"
FT                   /product="pyruvate decarboxylase, E1 component of the
FT                   pyruvate dehydrogenase complex."
FT                   /function="1.3.3 : pyruvate dehydrogenase"
FT                   /function="1.3.4 : tricarboxylic acid cycle"
FT                   /EC_number="1.2.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85143"
FT                   /db_xref="GOA:A0A0R4J7Y7"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7Y7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85143.1"
FT                   /translation="MAFYGDSDAQETQEWQDAFDSVLQHMGTERAAFLLEKLYQQAIAK
FT                   HVPIQRLNTPYLNTISVEEQPAMPGDQDMERRIRALIRWNALAMVLRANKTGDDLGGHL
FT                   ASFASSATLYDVGFNHFFRANSDNFGGDMIYYQGHCAPGIYARSFLEGRLTEEQLSNFR
FT                   REVGGNGLPSYPHPYLMPDYWQFPTVSMGLGPIMSIYQAHIQKYLMNRGLIKEEDRKVW
FT                   AYLGDGEMDEPESLGAISLAGREKLDNLIWVVNCNLQRLDGPVRGNGKIIQELESIFRG
FT                   AGWRVIKVVWGRHWDPLLAKDTSGALKARMEEAVDGDYQRYQVKGGAYTREKFFGKYPE
FT                   AAELVKDLSDEDIDNLNRGGHDPYKVFAAYAEAMKAKGQPTVILAKTIKGYGLSEEIEA
FT                   VNKTHQIKKMQIDSLRYVRDRFNLPFTDEQLEELPFYRPSENSPEMKYMKARREALGGY
FT                   LPARRRESESLAIPDLSVFDAVLKGSGGKEQSTTMVMVRLIAALLKEKAIKDRVVPIVP
FT                   DEARTFGLEGMFRQLGIYAAHGQKYTPEDQEQLMHYREAKDGHMLQEGINEAGAMSAWA
FT                   ALATSYSTNNLPMIPMYMYYSMFGFQRIGDIAWAAGDAQAQGFLLGATAGRTTLNGEGL
FT                   QHQDGHSHILANTIPNCVSYDPCFGYELAVIVHDGLQRMYVNQERVFYYLTVMNENYEH
FT                   PAMPEGVEEGIKRGMYLFEKDEKATVQLLGSGVILREVIKAAKILRDEYQIHSNVWSVT
FT                   SFNELARDGMACEEYNRLHPLAEEVKESWVSKQLRGTEGIVVSATDHMRAYSEQIRAYL
FT                   PDGRPFVALGTDGYGRSDTRANLRSFFGVDAAHIVVATLKKLADEGEVDARLVKDAISN
FT                   FELDTDRPVAWAPQAHPEVQPVAEYNETQTGEGN"
FT   gene            173018..174997
FT                   /gene="aceF"
FT                   /locus_tag="ABAYE0158"
FT   CDS_pept        173018..174997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="ABAYE0158"
FT                   /product="dihydrolipoamide S-acetyltransferase, E2
FT                   component of the pyruvate dehydrogenase complex"
FT                   /function="1.3.3 : pyruvate dehydrogenase"
FT                   /function="1.3.4 : tricarboxylic acid cycle"
FT                   /EC_number="2.3.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85144"
FT                   /db_xref="GOA:B0V9E3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9E3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85144.1"
FT                   /translation="MQIKTPDIGVDKANVAEILVKVGDRVEVDDSIVVLESDKATVEVP
FT                   STSAGVVKSILINQGDDVTEGVALIEIEAEGAAQAAPEPTPAPAAEKPAAPAPAQQTQA
FT                   SAQPAATSSATVEVTVPDIGVEKALVGEILVKVGDQIDVEQSIVVVESDKATVEVPSSV
FT                   AGTVESIQVKEGDTVKEGVVLIQVKTAAASNAQAEAPATTPAPAAVAEPVAAKQETVAA
FT                   APAQSGSVDINVPDLGVDKAIVAEILVQVGDKVDVDQSLVVVESDKATVEVPSTVAGVV
FT                   KAIHLQAGQQVSQGVLLATIEAEGQAPAAAPAAKAEAAPAPQAAAPKAAAPVATQSAPA
FT                   APASGTDKLTKEQEAENAKVYAGPAVRKLARELGVILSQVKTSGEHGRVVKEDIFAYVK
FT                   SRLTAPQAAPVAQATAAPAGLPSLPDFTAFGGGEVKPMTRLQQVSVPQLSLNNYIPQVT
FT                   QFDLADITELEAWRGELKDGFKKQGVSLTILAFIAKAVAHLLKEEPYFAGHLADDQKSV
FT                   LLRNEIHMGIAVATPDGLTVPVLRNPDQKSIKQIAVELGELSKKARDKKLTPKDLQGAN
FT                   FTITSLGSIGGTAFTPLVNWPQVAILGISPATMQPVWNGKDFDPRLMLPLSLSYDHRVI
FT                   NGADAARFTNKLTKLLKDIRTLLI"
FT   gene            175455..175591
FT                   /locus_tag="ABAYEmisc_RNA_1"
FT   misc_RNA        175455..175591
FT                   /locus_tag="ABAYEmisc_RNA_1"
FT                   /product="yybP-ykoY"
FT                   /inference="profile:Rfam:8.0"
FT   gene            175667..176242
FT                   /locus_tag="ABAYE0161"
FT   CDS_pept        175667..176242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0161"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85145"
FT                   /db_xref="GOA:B0V9E4"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9E4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85145.1"
FT                   /translation="MQEFLISTSIVALAEMGDKTQLLALLLSARFRKPIPILIAILLAT
FT                   LINHGISAVLGQWITTVLSPEILVWVLAVGFIGMAFWMLIPDELDDETASINKWQKFGV
FT                   FGATFILFFLAEIGDKTQIATVALAARYDSIFWVMLGTTLGMMIANAPAVFIGNKLAER
FT                   LSIALIHKIGAAIFFIVGVSTLVQHYFF"
FT   gene            complement(176302..177480)
FT                   /pseudo
FT                   /locus_tag="ABAYE0162"
FT   CDS_pept        complement(176302..177480)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0162"
FT                   /product="fragment of putative ferric siderophore receptor
FT                   protein (part 2)"
FT                   /function="4.1.B.14 : The Outer Membrane Receptor (OMR)
FT                   Family"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="PSEUDO:CAM85146.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(177856..178458)
FT                   /pseudo
FT                   /locus_tag="ABAYE0163"
FT   CDS_pept        complement(177856..178458)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0163"
FT                   /product="fragment of putative ferric siderophore receptor
FT                   protein (part 1)"
FT                   /function="4.1.B.14 : The Outer Membrane Receptor (OMR)
FT                   Family"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="PSEUDO:CAM85147.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            178674..179483
FT                   /locus_tag="ABAYE0164"
FT   CDS_pept        178674..179483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0164"
FT                   /product="conserved hypothetical protein; putative enzyme"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85148"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9E7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85148.1"
FT                   /translation="MGNFMGFEKTTSQILFDNGVHKCISFTSLVKGEGIQANQFLIIDH
FT                   ERAAVIDPGGDLTYVPLTMELNKYTRLKNLDYVMASHQDPDIITSMPRWLVYTDAKVVA
FT                   SKLWARFLPHLNSSFMSERMKGNWEDRLIELPDRGQVIQLGESKLVIIPAHFLHSVGNF
FT                   QFYDPVAKILFSGDMGASIVDDASQPLKDFDSHVMKMKAFHQRYMCSNKVIRLWVNMIR
FT                   QMDIEMIVPQHGSPFIGKEMINQFLDWIETLPCGVDLMTEQIFSCPT"
FT   gene            179575..179940
FT                   /locus_tag="ABAYE0165"
FT   CDS_pept        179575..179940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0165"
FT                   /product="putative ferredoxin"
FT                   /function="1.4.3 : Electron carrier"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85149"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9E8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85149.1"
FT                   /translation="MLSQVATPDECLRCGACCAHFRVSFYWAEAELMEEHLVEPLTPVY
FT                   SCMRGTNQPEPRCQALTGEIGKEVGCSIYAVRSSTCREVQIADEQCNKARLAHQLIPLI
FT                   QVSPADSENDHDYDQVS"
FT   gene            180076..181542
FT                   /gene="guaB"
FT                   /locus_tag="ABAYE0166"
FT   CDS_pept        180076..181542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="ABAYE0166"
FT                   /product="IMP dehydrogenase"
FT                   /function="1.5.2.1 : purine biosynthesis"
FT                   /function="1.5.2.3 : purine ribonucleotide biosynthesis"
FT                   /EC_number="1.1.1.205"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85150"
FT                   /db_xref="GOA:A0A0R4J7F4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7F4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85150.1"
FT                   /translation="MLTIVQEALTFDDVLLLPAYSTVLPKDVSLKTRLTRGIYLNIPLV
FT                   SAAMDTVTESRMAIAMAQNGGIGILHKNMDIAAQAAEVRRVKKFEAGMVKDPITVSPET
FT                   TVRELIAITSANNISGVPVVKDGKVVGIVTGRDTRFETNLEQPVSNIMTGQDRLVTVRE
FT                   GESKENIQALLQKHRIEKVLVVGESNELKGLITVTDFRKAESYPNSCKDDLGRLRVGAA
FT                   VGTGADTPSRVEALVEAGVDVIVVDTAHGHSAGVIERVRWVKQNFPQVQVIGGNIATGD
FT                   AALALLDAGADAVKVGIGPGSICTTRIVAGIGMPQISAIDSVASALKDQIPLIADGGIR
FT                   FSGDMAKAIGAGASTIMVGSLLAGTEEAPGEVEFFQGRYYKAYRGMGSLGAMAGATGSA
FT                   DRYFQDSKAGAEKLVPEGIEGRVPYKGPMGNIVHQMMGGLRSSMGYTGSAVIEDLRQNA
FT                   KFVKITSAGMSESHVHDVTITKEAPNYRVG"
FT   gene            181692..183029
FT                   /gene="glmM"
FT                   /locus_tag="ABAYE0167"
FT   CDS_pept        181692..183029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="ABAYE0167"
FT                   /product="phosphoglucosamine mutase"
FT                   /function="1.6.3 : lipopolysaccharide"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /EC_number="5.4.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85151"
FT                   /db_xref="GOA:B0V9C8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9C8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85151.1"
FT                   /translation="MSYFGTDGIRGKFGQMPITPEFALKLGFAAGKVLKRTSPKNKPLV
FT                   VLGKDTRLSGYILESALQAGLNAAGVYVHLLGPLPTPAIAHLTRALHAHAGIVISASHN
FT                   PYFDNGIKFFSSEGKKLPDSLQEEINKELEKDLFIEDTANLGKSVRVTDANGRYIEFCK
FT                   STFPYHFDLNNLKIVVDCAHGAAYSVGPSVFRELGAKVVALYNEPDGLNINENCGSTHP
FT                   ESLQKAVVEHGADLGIAFDGDADRVVMVDKFGNLIDGDHILYILATQAKNKPAGVVGTV
FT                   MSNMALEVALEKANVGFVRAKVGDRYVLQALEENGWVTGGEPSGHILTLDKSTTGDAII
FT                   AALQVLTVMVEQNKALHELVNGFKLYPQVLVNVRLEQMLDPYSIPALVAEFNKAEEQLK
FT                   GRGRILIRKSGTEPVIRVMVEGDNEQEVKTLAEHLANAVRSQAQVA"
FT   gene            183040..183696
FT                   /gene="pdxH"
FT                   /locus_tag="ABAYE0168"
FT   CDS_pept        183040..183696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="ABAYE0168"
FT                   /product="pyridoxamine 5'-phosphate oxidase (acts also on
FT                   pyridoxine phosphate and pyridoxine)"
FT                   /function="1.5.3.6 : pyridoxine (vitamin B6)"
FT                   /EC_number="1.4.3.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85152"
FT                   /db_xref="GOA:B0V9C9"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V9C9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85152.1"
FT                   /translation="MSDVIKDLSELRLSYEQGELYETQVASNPHEQFLGWFNHALAANL
FT                   HEPYAMSLATASASGRPHVRTVLLRGATEAGYDFYTNYDSQKGIDLAENPYAELLFYWP
FT                   SLERQVRVGGHVVKIPEQESTDYYHKRPRDSQIAAHISTPQSGKIESRELLQQRFQDLQ
FT                   QQVQSREVLDKPEFWGGYRLQPDYYEFWQGRPNRLHDRLSYEKIDGQWTLHRLMP"
FT   gene            183697..185397
FT                   /gene="recJ"
FT                   /locus_tag="ABAYE0169"
FT   CDS_pept        183697..185397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="ABAYE0169"
FT                   /product="ssDNA exonuclease, 5'--> 3' specific , Mg
FT                   dependent"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.5 : DNA degradation"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85153"
FT                   /db_xref="GOA:B0V9D0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85153.1"
FT                   /translation="MTKIQIKQRPLLTRPEQFQGVPPFIAEILARRGVQSEQELELKLK
FT                   NLLAPELKGLDAAVALMDQAIDEQKKIVIVGDYDADGATSTALMMLVLRDMGAQVDYLV
FT                   PDRFKYGYGLTPAIAELAHHTYQPDLLITVDNGISSHAGVDAAHALGMQVIITDHHLTT
FT                   KETPLAEAVVNPNQLGCEFPSKALAGVGVAFYVLANLASLRNRQGKSTSKVTQYLDLVA
FT                   LGTYADVAVLDYNNRILVDAGVKRIQQHQCRVGILALLDIAGREATSIRAQDLGFVLGP
FT                   RINAAGRMESMRIGIECLLADTMETAYPIAQQLNQLNIDRRQIEGEMKQQALSALDSLQ
FT                   LSQQDIPAALVLFEENWHQGVIGIVAGRLKEQFHRPTIVFAPDEDGIHIKGSARSIDGV
FT                   HIRDTIEQVAEQHPELVSHFGGHAAAAGLTIRKENFEAFKTVFNDCVAAMDESIFQATL
FT                   WTDGELPVSALQLDTLNWIEQLGPWGQKFPLPQFEGHFKVIDFRWLKETHLKLRLAIDQ
FT                   YSFDAIAFNAAGRFEFDPMRDHVHLVYEIDRNVFNGNVSLQLRIVHLNQ"
FT   gene            complement(185442..186209)
FT                   /locus_tag="ABAYE0170"
FT   CDS_pept        complement(185442..186209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0170"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85154"
FT                   /db_xref="InterPro:IPR031593"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85154.1"
FT                   /translation="MKKLAIASALLSALAVSGTANAYQAEVGGSYNYLDPDNGSSVSKF
FT                   GVDGTYYFNPVQTRNAPLAEAAFLNRASNVNAHVNYGDNSGTKDTQYGVGVEYFVPNSD
FT                   FYLSGDVGRNEREIDNTNIDSKVTTYAAEVGYLPAPGLLLALGVKGYDEKDGKDGADPT
FT                   VRAKYVTQVGQHDVNLEAYGAFGDLDEYKVRGDYYIDKTLSLGVDYYNNDLTDKDEFGI
FT                   NAKKFLNQQVSVEGRVGFGDNDNTYGVRAAYRF"
FT   gene            186765..187697
FT                   /gene="prfB"
FT                   /locus_tag="ABAYE0171"
FT   CDS_pept        186765..187697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="ABAYE0171"
FT                   /product="peptide chain release factor 2"
FT                   /function="2.3.2 : translation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85155"
FT                   /db_xref="GOA:A0A0R4J8G2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8G2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85155.1"
FT                   /translation="MAKEKGELENVINVLDGLSTQLEDAKAMLDLAVEADDESLLEDVQ
FT                   SELSTAEEELAKLEFRRMFSNPMDPNPCYVEIQAGSGGTEAQDWASMLLRMYMRWIERH
FT                   GFKAELMEVSDGDVAGIKSATIRVEGEYAYGWLRTESGVHRLVRKSPFDSGNRRHTSFS
FT                   AVFISPEVDDNIEIDINPSDVRTDTYRASGAGGQHINKTDSAVRLTHIPTGIVVACQNQ
FT                   RSQHANRDHAWKQLRAKLYELEMQKRNEAAQALEDSKSDIGWGSQIRSYVLDDSRIKDL
FT                   RTGVENSNTGAVLDGDLDRFIEASLKQGL"
FT   gene            187897..188199
FT                   /locus_tag="ABAYE0173"
FT   CDS_pept        187897..188199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0173"
FT                   /product="putative transcriptional regulator (ArsR family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85156"
FT                   /db_xref="GOA:B0V9D3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85156.1"
FT                   /translation="MDIDAISKALANPLRRQILQWLKEPEHYLPVEECGGSFEKGVCAG
FT                   HIERLGKVAQSTMSNHLSVLQQAGLIQVQKYGQWSYFSRNEALIQQYIEHLKQTL"
FT   gene            188228..189286
FT                   /gene="xenB"
FT                   /locus_tag="ABAYE0174"
FT   CDS_pept        188228..189286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xenB"
FT                   /locus_tag="ABAYE0174"
FT                   /product="xenobiotic reductase"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85157"
FT                   /db_xref="GOA:B0V9D4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85157.1"
FT                   /translation="MAELNTPLTVGDFEIKNRLVMAPLTRARSGESRVPNDLMVEYYQQ
FT                   RANAGLILTEATVIGSKTVGYADTPGLWSQEQAQAWNKIIEAVHAQGSKIVVQLWHVGR
FT                   ISHPELLNGDIPVAPSAIQPAGEVSLLRPKRPYVTPRALSIEEIQEIVAQYKHSAELAK
FT                   AAGFDGVELHAANGYLIDQFLQSNTNQRDDEYGGPVENRARLLLEVVDAFIEVWGAGRV
FT                   GVHIAPRGDSHDMGDENPLATFGYVVDQLSQRNVAFIFSREYEAADSISPQLREKFNGV
FT                   WIANENLTPESAKRILREGQADAVSFGKAYIANPDLLQRLEQGLPLNELQPTTLYAKGA
FT                   EGYTDYPALEAS"
FT   gene            189455..190747
FT                   /gene="kdtA"
FT                   /locus_tag="ABAYE0175"
FT   CDS_pept        189455..190747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="ABAYE0175"
FT                   /product="3-deoxy-D-manno-2-octulosonate transferase"
FT                   /function="1.6.3 : lipopolysaccharide"
FT                   /function="1.6.3.3 : lipid A"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85158"
FT                   /db_xref="GOA:B0V9D5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85158.1"
FT                   /translation="MATPFWYNTALHLLKPFYRWRIKRRAESLELYQQECLERFGPFEA
FT                   PKNVKAIWFHAVSVGETNAAQPLIEYYLKLGQPVLVTNTTKTGQARAKSLFLKEPYLDL
FT                   FQAVYLPVDQKPLLKKFFELYQPKLLALVETELWPNLIDQAKLQHVPCLLLNARLSEKS
FT                   AKGYGKVSGLTAGMLKQLDWVLAQDSATRQRYVELGLDEHKSQVVGNIKFDIHAPEAFI
FT                   KQAAQLRQQWYLENRQVVTIASTHAPEEQQILEALAPYLNSDRELVCIVVPRHPERFDE
FT                   VFEICQNLNLITHRRSMGQSIHASTQVYLADSMGELWLWYALSQVCFVGGSLNEPGGGH
FT                   NILEPMVLNVPTVVGPRYFNFQTIVDEFIDENAVLIAQDAQQVVDIWLACLAEPEATEQ
FT                   LVVQAHKVLQRNQGSLQKHIGVINRYLAEKS"
FT   gene            190744..191451
FT                   /locus_tag="ABAYE0176"
FT   CDS_pept        190744..191451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85159"
FT                   /db_xref="GOA:B0V9D6"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85159.1"
FT                   /translation="MNIVLLESEDVQSDTWSIHSKRQLQHLREHLEITVGQNLKVGIRN
FT                   GARYITEIVSMNEHEVRIRPIREELLPAKLPVHLIVALPRPKVLRRLIMDSVTLGVEKI
FT                   SLIHSYRVDKSYWQTPFLQQIDNYATLGLEQAGDTIVPEIQLYKRFKPFVEDVLPSLIT
FT                   QETPAYVAHPYAEQRMPINISHACSVVVGPEGGFIPYEVDLLIKNGCQAMSLGNRILRT
FT                   ETSISYILGRLFS"
FT   gene            complement(191431..192411)
FT                   /locus_tag="ABAYE0177"
FT   CDS_pept        complement(191431..192411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85160"
FT                   /db_xref="GOA:B0V9D7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85160.1"
FT                   /translation="MADEQKSLTDVAKNTGELLQEAGTKTTQTVLAHTEKYHDAYTTID
FT                   KIVDSFWERVPYICIAIVVFLIFWLLTKLFKFFVRKTLENRSYTRQNLVLVLNRVGSTA
FT                   ILFFGFLIALVIMIPGFTPGQLMSALGIGSVAIGFAFKDIFQNLLSGILILLSEPFRIG
FT                   DSIVVNSLEGTVEDIQIRATFLRSPDGRRIVIPNATVYTSALTVNTAYQQRRCEFVVGI
FT                   GYDDDEQKAKQIILDILNNDRNVLSQPAFSVNVTALADFSVNLTVRWWVDTTETDISSS
FT                   ISNIQAQVKQAFNENDIDIPYPIQELKMVSNPPALNPETSAKQTT"
FT   gene            complement(192524..193099)
FT                   /locus_tag="ABAYE0178"
FT   CDS_pept        complement(192524..193099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0178"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85161"
FT                   /db_xref="GOA:B0V9D8"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9D8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85161.1"
FT                   /translation="MFAETPSSRPPQLPFKDSPFSIHGRFNRMSYLGGYGLIYLVTIVG
FT                   YFILASFLGSFQLSSDLFNFEFYSSLSGISALMVWAFWLFLIYLNIILVVRRLHDLNKS
FT                   GWMGLLLFIPVVQFFFMLYLLLASGTAGTNQYGPVRPSTFIEKLMAWLILIAILISLIS
FT                   TAGFFYYFSGTDTIQTPTQILQKGTEYF"
FT   gene            193394..195343
FT                   /gene="acs"
FT                   /locus_tag="ABAYE0179"
FT   CDS_pept        193394..195343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="ABAYE0179"
FT                   /product="acetyl-CoA synthetase"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /function="1.3.4 : tricarboxylic acid cycle"
FT                   /EC_number="6.2.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85162"
FT                   /db_xref="GOA:B0V9B6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85162.1"
FT                   /translation="MNEIYPVPEEFKKTARTVEADYFKRYQHSIENPDEFWAEQAKIVD
FT                   WIKPFTQVKNTSFDKDNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHK
FT                   IVSYKELHDEVCRFANVLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGG
FT                   FSPDSLASRIEDSQAKLVITADSSLRAGKLLPLKENVDLALALPGTECVENVIVVYRNA
FT                   NPIEMKPGRDLWYHLIIMEVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLV
FT                   YVASTFKEVFDLKQDDVYWCTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARL
FT                   GHVVDKHKVSILYTAPTAIRAMMREGDSYVRESNRSSLRLLGSVGEPINPEAWNWYYNV
FT                   VGEGRCPIVDTWWQTETGGILIAPLPGATALKPGSATRPLFGIQPAIVDGEGNELEGAA
FT                   EGNLVIKDSWPGQMRTIWGDPDRFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDV
FT                   LNVSGHRLGTAEIESALVSHESVAEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKE
FT                   LISWVRKVLGPVASPDALHWAPALPKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAV
FT                   VDQLIATVYPDRQK"
FT   gene            complement(195390..195932)
FT                   /locus_tag="ABAYE0180"
FT   CDS_pept        complement(195390..195932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0180"
FT                   /product="putative isochorismatase"
FT                   /function="1.5.3.14 : enterochelin (enterobactin)"
FT                   /function="1.7.19 : incorporation of metal ions"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /EC_number="3.3.2.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85163"
FT                   /db_xref="GOA:B0V9B7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85163.1"
FT                   /translation="MKQALLVIDVQNDYFKNGKMELVGPDQALDKIKQLEQYFNEKGLP
FT                   IIYVQHINPPQASFFQENTEGVLLHPELSAGSNSLIVTKHYPNSFLETNLKELLKAHQI
FT                   EQLVITGMMTHICIDSGTRAAKELGYQPILIGDTTATRDLSHNGKTVKAEDVQTAFLAA
FT                   LGMFASVQNTAEFLAKF"
FT   gene            196038..196451
FT                   /locus_tag="ABAYE0181"
FT   CDS_pept        196038..196451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0181"
FT                   /product="putative transcriptional regulator (Lrp-like)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85164"
FT                   /db_xref="GOA:B0V9B8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85164.1"
FT                   /translation="MNIELDPIDLKIIALLKQDSRLTNKEIGQRVHRTGQAVGARIAQL
FT                   MDAGVIKNYTIAVQYRHKQFIHLHLNEQRSFEEIENLVKQYEQIDECFKVMGNACYMIV
FT                   SHFEPAELNAFIEVLSKWCRYSVETVIREVEKA"
FT   gene            complement(196545..197678)
FT                   /locus_tag="ABAYE0182"
FT   CDS_pept        complement(196545..197678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0182"
FT                   /product="putative sulfonate monooxygenase (MsuD)"
FT                   /function="5.5.3 : starvation response"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85165"
FT                   /db_xref="GOA:B0V9B9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024014"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85165.1"
FT                   /translation="MKLGESTMTQLQQSIKFAYWVPNVSGGLVVSNIEQRTDWSYDYNV
FT                   RLAQAAENNGFEYALTQIRFTAGYGAENQHESVSFSHALLAKTEKLKVIAAILPGPWKP
FT                   ALAAKQLATIDYLTEGRIAINVVSGWFRGEFDAIGEEWPEHDERYVRSEEFIRTLKGIW
FT                   TTDNYSFDGKYYQFQNYTLKPKPLQKPHIEVFQGGSSRAARDMASRVSDWYFTNGNTVE
FT                   EIQKQVEDIRAKAKANNHQVKIGVNAFIIARDTEEEAKAVLQEIIDKANTEAVNAFGDA
FT                   TREAGAASPEQEGNWAKSTFEDLVQYNDGFKTNLIGTPQQIAERIVALKNVGVDLVLSG
FT                   FLHFIEEVEYFGEKVLPLVRQLELQQEKEVEIQAKSA"
FT   gene            complement(197703..198440)
FT                   /gene="msuE"
FT                   /locus_tag="ABAYE0183"
FT   CDS_pept        complement(197703..198440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msuE"
FT                   /locus_tag="ABAYE0183"
FT                   /product="NADH-dependent FMN reductase"
FT                   /function="5.5.3 : starvation response"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /EC_number="1.5.1.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85166"
FT                   /db_xref="GOA:B0V9C0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR019912"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85166.1"
FT                   /translation="MTGITSSKPLNIVAVSGGLNTPSKTESLVQAILDELSEAIDIKVH
FT                   FIKLSEIGPLLGGAFYRNQLPQRVQDDLAAVEAADALIVGTPVYRASFTGLFKHFFDFV
FT                   EQTALVDVPVLLAASGGSDRHALVLEHQLRPLFSFFQAQTLPIGVYATDRDFTPEYTVK
FT                   SEQLSDRITLAVARALPILEWAPAKGKRAEVVKPKSQQANQELGINKQIEQEEVLPSAA
FT                   VPNLDAAESRLHHKSGKSLTHVA"
FT   gene            198817..199467
FT                   /locus_tag="ABAYE0184"
FT   CDS_pept        198817..199467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0184"
FT                   /product="putative two-component response regulator"
FT                   /function="3 : regulation"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85167"
FT                   /db_xref="GOA:B0V9C1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85167.1"
FT                   /translation="MNILIVDDHPLFRHALIQAVRYSLPQAQIHETASVDEFYERLENG
FT                   AEPDLVLLDLNLPGASGFSALVYVRAQYPSIPIIVVSAHEEASIIQRAIAHGAMGYIPK
FT                   SAHPSHIGEAIRQVLDGEIWLPPNLPSNINLDPRAADETALAERIQSLTPQQFRVLMMV
FT                   AEGLLNKQIAYELDVSEATIKAHVTAIFRKLGVQNRTQAVLAISALNIEDKKI"
FT   gene            complement(199510..200277)
FT                   /locus_tag="ABAYE0185"
FT   CDS_pept        complement(199510..200277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85168"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85168.1"
FT                   /translation="MNISDNTPQGQLSSQQFYRQYSANALLPELDWQSIFPHSKLSEAH
FT                   IKALNTIYQCAVPLALNVFHDLNFDVFAPAAYHPQGLGLFDKLAQQEENFLKVLTAESE
FT                   NLDHETRHQIWSMLLRGGAVLVFKAWLGHVKLGENQLDMTQFDELSDLLFIKTPPHQLA
FT                   ERLHVDEKAKLDHIFLMYGNDIFLDRFNSLETAALFVDLGVYDAAFLSLRDDRVAEYLK
FT                   SKGYVTQEQIDDLQCALNPLYCDSLTPKQDCLA"
FT   gene            complement(200672..204169)
FT                   /locus_tag="ABAYE0186"
FT   CDS_pept        complement(200672..204169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0186"
FT                   /product="putative two-component sensor"
FT                   /function="3 : regulation"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /function="3.1.3 : posttranscriptional"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85169"
FT                   /db_xref="GOA:B0V9C3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85169.1"
FT                   /translation="MNSWLIIGVLTLYIALLFVCAFFGEKHASRLSTRGRMFLFSLTLG
FT                   VYCSSWTFYGATGAAVREGVIFLPIYLGPLLFVWFGYDIWRRLGRVRQHHAISSIADFV
FT                   AARYGKSGVLASLVTILAVIAIIPYLALQLRAIALSTSVIMEQSSHIHTTTNSVLLLTS
FT                   VLAILAMIFGTRQIANTEQHGGLMLAVAFESFVKLFALLCVALFFIFESPANLSQMTSD
FT                   VNQTFQEVQLFGVPETFWIQTLLAGLAIICLPRQFHVAVVELRDEKHIRGARKWFAVYL
FT                   ILTILAIIPIASWALHAAPKFLTVPDVAVLSLPLSYNQEWLALLAFLGGFSASTGMLLV
FT                   SSVALSIMLSNDLIMPALWRFKLLSRHDKHLPKVLKFSRRISIVAVMLLGFLFFHFFND
FT                   INQLSVFGLLAFSAVAQFAPALIGGLYWRGGSRQGVYAGLIIGFLMWSYTLLFPTILRS
FT                   LPEAYQETAQSILLFGPFGINALRPESLFGFESFAPLTHGVIWSLGLNIVLYIWISKIY
FT                   RPSVAEQIQAESFFYYETKPLPSPHTSTDLTYLPHDAARLKVGDLFALAKRITGEQPTT
FT                   QAFENFCEQNHLTLNPNSIANGMWWRFTEQYLAGIIGAASARTLLTTAMINNGLALGQV
FT                   ANILDQASQWQRFNQNLLMTMIDHMTQGVSVVDKNMCLVAWNNQYLKLFGYPKDLVYVG
FT                   CPIADLIRYNAERGECGPGSVEEHVRKRLHWMKVGSAHEFERIRKDGRVIQMRGNPIAG
FT                   GGFVTTFADITAFRANEAVLEARVKDRTQQLADALTEQQLAREQADMANMSKSRFIAAA
FT                   SHDLLQPMHAARLFSTVLEQSISTEEDRQTLQQLDRALYGAESMLSALLDIARLEGGTI
FT                   QPKRQPYPLHDLLSDLELQFKSIAAQRNILLKVHDVSFWIDTDPQWIRRIIQNFVSNAL
FT                   RYTAKGRVVVGVLRSAQQSGHIRIGVWDTGPGIAEEQRIKLFQEFERCGHLSPWGEQGL
FT                   GLGLAIVQRMTGLLNYPVHVYSELGKGSCFMIEVPIVEPPKVATPAVQAVPLKTKAYRI
FT                   LCLDNDETILEGMSSLLGRWGYQVFKATEPEQALEIIQKENIQVWLIDQHLNHNQLGVD
FT                   FITQNRQEDVPVALITADSHPELPQQLKELNIVLLKKPLKPASLRAWLSGLKIASTTD"
FT   gene            204353..204685
FT                   /locus_tag="ABAYE0187"
FT   CDS_pept        204353..204685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85170"
FT                   /db_xref="GOA:B0V9C4"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85170.1"
FT                   /translation="MDQSQVEQILRNPKFQKMVKKKSALSWTLTIIMLVLYVGFMLLVG
FT                   YNKEFLMSSFSGGVTTWGIPLGLGIIVLSFLLCGVYSYIANNTLDQLSEEALKEVEAIT
FT                   HEKGLH"
FT   gene            204666..206402
FT                   /locus_tag="ABAYE0188"
FT   CDS_pept        204666..206402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0188"
FT                   /product="putative sodium:solute symporter"
FT                   /function="4 : transport"
FT                   /function="4.2.A : Porters (Uni-, Sym- and Antiporters)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85171"
FT                   /db_xref="GOA:B0V9C5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85171.1"
FT                   /translation="MRKDYTNMKWNSLKAKALLAAASLYSTVAMASPDLGEAEQQATNW
FT                   HAIIMFIIFVGFTLFITKWAAKQTQSAQDFYTAGGGISGFQNGLAIAGDYMSAASFLGI
FT                   SAMVFSSGFDGLLYSLGFMVGWPIVLFLVAERLRNLGKYNLSDVVSFRLEEKPVRTLAA
FT                   FSSLVVVAFYLIAQMVGAGQLIKLLFGLNYNIAVVIVGLLMMAYVIFGGMLATTWVQII
FT                   KAVMLLSGATFMAFMVMKAVGFSFSNMFTQSIEVFSKVHDVSFEDAAKIMGPGKLAANP
FT                   IDALSLGLALMFGTAGLPHILMRFFTVKDAKEARKSVVVATGFIGYFYLLTFIIGFGAI
FT                   LFVSNNPQFLDVAKMAMTGKLELVGGNNMAAVHLSDALGGDLFMGFISAVAFATILAVV
FT                   AGLTLSGASAISHDLYANVFKKGQTTPASELRMSKIATLGLAIFAMILGILFEKQNVAF
FT                   MVGLAFSVACCANFPILVLSMFWKGLTTRGAVIGGVVGLVTAVVLIILSKAVWVDTLKI
FT                   SDTPINPFNGPALFAMPLSFLCCWFFSVTDSSARAKKERASFDAQYVRSMTGIGASGAS
FT                   DH"
FT   gene            206572..207264
FT                   /locus_tag="ABAYE0189"
FT   CDS_pept        206572..207264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0189"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85172"
FT                   /db_xref="GOA:B0V9C6"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85172.1"
FT                   /translation="MRSIIEFWSSFRLLPSAWLLLVQFILLILAMLTFDNEAYRTLTWA
FT                   LGVLALLIIAKVIRQTPMFTFLGLAFVSGAIIASVFILLGYSNLTIQIFAHSCEALAYF
FT                   SAAYGLFRYMFADRYLTRDELFAAAAVFTLLAWGFAFLYNICQLLIPNSFQNPNHIHHL
FT                   QTWLDLLFLSFSLQSATGLSDLMPLSPPARVLAMLQMFCGVMYLALIVTRLIALQYIKH
FT                   TPKKNSDK"
FT   gene            207430..209397
FT                   /locus_tag="ABAYE0190"
FT   CDS_pept        207430..209397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0190"
FT                   /product="putative high affinity choline transport protein
FT                   (Bet-like)"
FT                   /function="4 : transport"
FT                   /function="4.2.A.15 : The Betaine/Carnitine/Choline
FT                   Transporter (BCCT) Family"
FT                   /function="1.7.18 : betaine biosynthesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85173"
FT                   /db_xref="GOA:B0V9C7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9C7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85173.1"
FT                   /translation="MPSKQASWFANVNPNVFLGTVIIIALFLAVVVIAPSSFELLTQQL
FT                   KQWITDSFSWFYVLSVAFFLILLIYIACSAIGRIKLGPDHSQPEYSNGSWFAMLFTAGM
FT                   GIGLMFFGVAEPVMHYVNPPSGEPQTIEAAQQALRVTFFHWGLHAWAIYAVVGLALAYF
FT                   AYRHNLPLKTRSALYPLIGKKIYGPWGDSIDIFATIGTVFGVATSLGFGVTQINSGLHY
FT                   LFGIEQSTTTQVLLIIFVSILASLSVFLGLDKGVKRLSELNLVLALILLVFVFIAGPSI
FT                   YLLQTTIQNTGQYISNLFTMTFNLYAYQPNGWIGGWTILYWAWWISWSPFVGMFIARVS
FT                   RGRTIREFIVGVLLIPTGFTIIWMGFLGNAALFSIIHEHQTTLIQAVQQDSSVALFEFL
FT                   GHLPWSGVMNILATILVVLFFVTSADSGALVTDYLTAKTENSPTWQRLFWTVLMAVLAI
FT                   ILLLVGGLAALQSSIIMSALPFTVVMLLMSWGLIKALHLDVTKMIAIQEARITPRAIHN
FT                   PRSWQQRLGLIMHYPHSEEEVKQYIEKQVSRAFENIQHEFRRRHLEVSISEVEDGMQLR
FT                   VDHHHEINFIYKVVSRETVPPSFLIGRTEAEDGQYFQAEVFLREGGQNYDVMDWTQEDL
FT                   IQDIIDQYERHLHFLNIVRS"
FT   gene            complement(209456..210358)
FT                   /locus_tag="ABAYE0191"
FT   CDS_pept        complement(209456..210358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0191"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85174"
FT                   /db_xref="InterPro:IPR031593"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85174.1"
FT                   /translation="MLMLEMIMKKLGLATAVLLAMTGAHAYQFEVQGQSEYVDTTANDK
FT                   NFTGTAQGTYYFKNVDASKGPLAEAAFLNQASNVSVAYNYIKYDEKDTVNVESHTYGVK
FT                   GEAYLPTPYLPVYASASYNHTINDFKDGVSDDNGDRYALEAGAMLLPNFLVAVGYTSVA
FT                   DQISLDAFGVNKYGIAKAVGESVAIDEKQDAVTARTKYVGNIDGTNMAIGFEAFGVFAE
FT                   DNAYGMKTDLFVTPKLSVGASFADVSAFNSGYDHVWGGHTQYFITPAVAVGADFVKANA
FT                   KDGNPRDTQTIGLNAKFRF"
FT   gene            complement(211203..211649)
FT                   /locus_tag="ABAYE0192"
FT   CDS_pept        complement(211203..211649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0192"
FT                   /product="transposase of ISAba1, IS4 family (ORF 2)"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85175"
FT                   /db_xref="GOA:B0V4A7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0V4A7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85175.1"
FT                   /translation="MVGRVKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETLF
FT                   SCLKGRGFNLENTRLTDPRRVKKLIAVLAISFCWCYLTGEWQHDQKKAIKIKKHGRLSM
FT                   SLFRYGLDYVQMAIQRLIGFGKKEEFKEILAILRRQNPDRIRVL"
FT   gene            complement(211724..212293)
FT                   /locus_tag="ABAYE0193"
FT   CDS_pept        complement(211724..212293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0193"
FT                   /product="transposase of ISAba1, IS4 family (ORF 1)"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85176"
FT                   /db_xref="GOA:B0V4A8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0V4A8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85176.1"
FT                   /translation="MTHLNELYLILNKYLKWNKSHLKCFALIMLVIILKQTCNLSSASK
FT                   ALPIKCLPQSFYRRMQRFFAGQYFDYRQISQLIFNMFSFDQVQLTLDRTNWKWGKRNIN
FT                   ILMLAIVYRGIAIPILWTLLNKRGNSDTKERIALIQRFIAIFGKDRIVNVFADREFIGE
FT                   QWFTWLIEQDINFCIRVKKTSLSPII"
FT   gene            212443..214224
FT                   /locus_tag="ABAYE0194"
FT   CDS_pept        212443..214224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0194"
FT                   /product="putative GGDEF family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85177"
FT                   /db_xref="GOA:B0V9A8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85177.1"
FT                   /translation="MLGCGLITSFYSSDHGRTFTEYQLEMSGLRSEHISNRLFFFMLVI
FT                   ILSLLFMAVPLIVSSYQEYLKTKQALVEIKSLRSIAEVANKVSKKRAPANKLMSSNAAD
FT                   FLKNQKNLKEYRLSVDRQLNETIHILKEEGYTDLANTLDTKFRDDLKQARAVVDYYVAT
FT                   PEQARSSIQFDNAILAMFGAWDSCREVLQNLMLQLKSKDSQINNYFTLIVVLTDMRDQA
FT                   GRTASNVIAPVTFKETIPNDNRARSLQTQQQARYLWALVDTLQSEQAKTPEYHRLYSRV
FT                   KTEFLDKGVPIVGQLLDESQKHQAYHLNGTELTDQIVDKFTTVIDLQKFLLNKSVLIAS
FT                   QENYLAKKKFFLTLLISSISLAAALLTLIYAKRRVFEPLIQARTLILDLSHSTDYPIDE
FT                   LKPKKGEFISLFEAIDRLQRMLKQRDAFEFQLKNIANTDPLTGVSNRLALSEYLKIVES
FT                   YPQKFSQTCLMIIDIDRFKHVNDQYGHIVGDQVIRRIADQLKANVRASDLIVRYGGDEF
FT                   LILLEQVQFLDARLLAEKIRIAISLEEIDLSGTKEKLHVSVSIGFAIGATSWMELLENA
FT                   DRSLLRAKARGRNVVEG"
FT   gene            complement(214258..217104)
FT                   /gene="uvrA"
FT                   /locus_tag="ABAYE0195"
FT   CDS_pept        complement(214258..217104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="ABAYE0195"
FT                   /product="excinuclease ABC subunit A"
FT                   /function="1.2.2 : DNA"
FT                   /function="5.6 : protection"
FT                   /function="5.6.1 : radiation"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85178"
FT                   /db_xref="GOA:B0V9A9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85178.1"
FT                   /translation="MRCFMSQSHIRIRGARTHNLKNVSLDIPRDKFVVITGLSGSGKSS
FT                   LAFDTLYAEGQRRYVESLSAYARQFLSQMEKPEVDSIEGLSPAIAIEQKSTSHNPRSTV
FT                   GTITEIYDYLRLLYARVGTPYCPEHDLPMVAQTVSEMVDAVKNLEEGTALMLLAPVVRE
FT                   RKGEYSNLFEQLQGQGFVRARVDGEIIDIDTPPELDKKKKHTIEVVVDRFKVRDDLGNR
FT                   IAESFETALRLGGDIAVLSWMNGEHPDRVFSAKHSCPECDRAVAELEPRLFSFNNPFGA
FT                   CPVCDGLGTRSHFSPEKLIPNPELAISEGAIRGWDRQRPYYYSMLQKVADHFGFQLDTP
FT                   WNQLDKDTQKKFLQGTGKEKIDLSYIDERGRKHTRVQPFEGILPHLERRYRETESNYVR
FT                   DDLAQYLSNAACDACGGSRLNEISRHVRVKDKTIADITRMSIGDAESYYQGINLEGAKG
FT                   EIADKIFKEIRERLHFLVSVGLNYLSLARSAETLSGGEAQRIRLASQIGAGLMGVMYVL
FT                   DEPSIGLHQRDNDRLLQTLIRLRDLGNTVLVVEHDEDAIRAADHIIDIGPGAGVHGGVV
FT                   IAEGTYDELAKHADSLTGQYLSGKLKIEVPKQRTQPPKPEEKIKLSGAAGHNLKNVDLT
FT                   IPLGIMTCVTGVSGSGKSTLINRTLLPLAATQLNGATTLTAEKFDSIDGLQHLDKVVDI
FT                   DQSPIGRTPRSNPATYTGLFTPIRELFAQTPEAKARGYSAGRFSFNVKGGRCEACEGDG
FT                   MIKVAMHFLPDMYVPCDACHGKRYNRETLEVGYKGKNISDVLEMTVEDAAEFFSAIPVI
FT                   HRRLETLTQVGLGYIRLGQAATTLSGGEAQRVKLARELAKRDTGKTLYILDEPTTGLHF
FT                   HDIAKLLDILHELRNKGNTIVVIEHNLDVIKTADWVVDLGPEGGSGGGMIIAEGTPEQV
FT                   AEVEISHTGRFLKPMLKQ"
FT   gene            217389..217991
FT                   /locus_tag="ABAYE0196"
FT   CDS_pept        217389..217991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0196"
FT                   /product="putative transcriptional regulator (TetR/AcrR
FT                   family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85179"
FT                   /db_xref="GOA:B0V9B0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85179.1"
FT                   /translation="MKRLNKSETTRQHILDTSFELVLHKGFVGVGLQEILKACDVPKGS
FT                   FYHYFASKEAFGCALLEQYMANYKVRMEQLWQHSEQSAHARLMALWQAWIDDPVHGSWA
FT                   ENCLIVKLAAEVSDLSEDMRQILNDGVHKLTQRLALLLKEGQQEGSIPKHIEPLKTAQV
FT                   MYQLWLGAALLTKLSQDKAHLHLALETTQQLLKPIEE"
FT   gene            217995..218972
FT                   /locus_tag="ABAYE0197"
FT   CDS_pept        217995..218972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0197"
FT                   /product="putative NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85180"
FT                   /db_xref="GOA:B0V9B1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85180.1"
FT                   /translation="MRSIIHRNFGEPVDVLEQADMPKPEPKAGEVRIKTIMSPIHNHDV
FT                   WTVRGSYGYKPTLPAIGGSEAVGIVDALGEGVEHVQVGQRIAVAAVHGSWAEYFIAPAQ
FT                   GIIPLNNEIDDETAAQLIGMPISALMLLDFVNVQPGQWLIQNTANGAVGKTVAMIAQAR
FT                   GLPVINLVRRSDAIAEMQALGIQHVVATDQPNWKAQVKQIHGDQPLIAGVDSIGGTASG
FT                   EMLNLLSENSLLVSFGSMTGETMQISSGDLIFKQATVKGFWASVVNKEMPAARKKELIV
FT                   ELLTLATQKKLILPVEGVFSFDEIKTAAKRATQGARQGKVLLKP"
FT   gene            219037..219390
FT                   /locus_tag="ABAYE0198"
FT   CDS_pept        219037..219390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0198"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85181"
FT                   /db_xref="GOA:B0V9B2"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85181.1"
FT                   /translation="MIGQILIALIAILHVYILVLEMFLWDKPYGMKAFGNSTEKAKLTK
FT                   VMAQNQGLYNGFLAAGLFWSLLADAPFATSIANFFLGCVLIAGIYGGLTASKKIIYIQA
FT                   VPALIALVAVNFL"
FT   gene            219443..219784
FT                   /gene="glpM"
FT                   /locus_tag="ABAYE0199"
FT   CDS_pept        219443..219784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpM"
FT                   /locus_tag="ABAYE0199"
FT                   /product="membrane protein required for efficient alginate
FT                   biosynthesis"
FT                   /function="1 : metabolism"
FT                   /function="1.2.4 : polysaccharides"
FT                   /function="1.6.9 : cytoplasmic polysaccharides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85182"
FT                   /db_xref="GOA:B0V9B3"
FT                   /db_xref="InterPro:IPR009707"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85182.1"
FT                   /translation="MWALFLKCMLGAGVVLIISILSKSKAFYIAGLVPLFPTFALIAHV
FT                   IVFQQKGAEALQKTALFGLWSLIPYAIYLAAVYVLATRMSMWSCLGVATLCWVVAAAGL
FT                   IYGWQLFQS"
FT   gene            complement(219834..220508)
FT                   /locus_tag="ABAYE0200"
FT   CDS_pept        complement(219834..220508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0200"
FT                   /product="putative transcriptional activator (TenA family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85183"
FT                   /db_xref="GOA:B0V9B4"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85183.1"
FT                   /translation="MLFSQELWQRNLNLYQKILDLPFNQELANGTLDKEAFCHYVIQDA
FT                   QYLVAYGRVLAVAAAKAFDADDIMQFSDAAKIAIVVERSLHDDFMKNFGVTKEEFKNTP
FT                   LTLAGHHYTSFLTATAWSESYPVVLAALLPCFWIYAEVGKDIVSKSVPNNPYQAWIDTY
FT                   AGEEFHTAVRNVIATVDKVAARCDADTLEKMHAAYTMGAKLEWLFWDSAYHQRQWLGLD
FT                   QI"
FT   gene            220771..221853
FT                   /locus_tag="ABAYE0201"
FT   CDS_pept        220771..221853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0201"
FT                   /product="putative integral membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85184"
FT                   /db_xref="GOA:B0V9B5"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9B5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85184.1"
FT                   /translation="MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILA
FT                   VMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVV
FT                   EVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLAS
FT                   LASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEID
FT                   ENGNAVLQDGSGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAI
FT                   GAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVA
FT                   FIVWAVIASIQYSKREQQSP"
FT   gene            222000..223364
FT                   /locus_tag="ABAYE0202"
FT   CDS_pept        222000..223364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0202"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85185"
FT                   /db_xref="GOA:B0V993"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0V993"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85185.1"
FT                   /translation="MMNALERRSTFALSSIFALRMLGLFMIIPVFSVVGQSYQYATPAL
FT                   IGLAVGIYGLSQAILQIPFSLLADRFSRKPLVVFGLLLFAIGGAIAGLSDTIYGVIIGR
FT                   AIAGAGAVSAVVMALLADVTREEQRTKAMAAMGMSIGLSFVVAFSLGPWLTSLVGISGL
FT                   FFVTTIMGLIAIAMLLLVPKVTRHHRNYQQGYMAQLKQVIQMGDLNRLHVSVFALHLLL
FT                   TAMFIYVPSQLIEFARIPLASHGLVYLPLLVISLFFAFPSIIIAEKYRKMRGIFLTAIT
FT                   GIIAGLLLLIFGYQSKYVLLAGLGIFFIAFNVMEALLPSWLSKSAPIQSKATAMGVNAS
FT                   SQFLGAFFGGTLGGQLLMLHNTAIGWSVLAGIAIIWLLISFGLAQPRYLSSIVLPLPQV
FT                   QQVNEWTTQLLAIRGIEEVVVMPDQQVAYIKVDKQSLDDASRRDLTQLFGKEVAI"
FT   gene            223416..223997
FT                   /gene="ssb"
FT                   /locus_tag="ABAYE0203"
FT   CDS_pept        223416..223997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="ABAYE0203"
FT                   /product="ssDNA-binding protein controls activity of RecBCD
FT                   nuclease"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="5.8 : SOS response"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85186"
FT                   /db_xref="GOA:B0V994"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B0V994"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85186.1"
FT                   /translation="MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSEVWTDKNTG
FT                   ERKEQTEWHRIVLHNRLGEIAQQFLRKGSKVYIEGSLRTRQWTDQNGQERYTTEIRGDQ
FT                   MQMLDARQQGEQGFAGGNDFNQPRFNAPQQGGGYQNNNQGGGYGQNNGGYGGQGGFGNG
FT                   GNSPQGGGFAPKAPQQPASAPADLDDDLPF"
FT   gene            complement(224038..224361)
FT                   /locus_tag="ABAYE0204"
FT   CDS_pept        complement(224038..224361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0204"
FT                   /product="putative membrane protein"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85187"
FT                   /db_xref="GOA:B0V995"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B0V995"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85187.1"
FT                   /translation="MSQQLLIIVGIALLALGTYSIRFAGFHLGAKFSFSEKYQVLLSNG
FT                   ATVLLCAIAVTTTFFEGQHFAGFARIFGVGLALFLVWKKAPLLLVICLAAAGTALVRLL
FT                   GIE"
FT   gene            complement(224358..225083)
FT                   /locus_tag="ABAYE0205"
FT   CDS_pept        complement(224358..225083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0205"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85188"
FT                   /db_xref="GOA:B0V996"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B0V996"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85188.1"
FT                   /translation="MTKQSDLFIIMENRSLYHAMTTYALIKKLSKDTTRSIFFVCLATS
FT                   VVGMSLGSLAASYGLALWIPLCLSIFVLAGTAEFIFIGFLAVGGSPIAAAIAGLLVNLR
FT                   HLPFGIAVNELIRGKFSQYFGSHIMNDESVLFGMAQPDFETKKAAYWLCGIGIMLSWPL
FT                   GVTAGYFIGSAIPDPKTFGLDAIFPAILIALTFSALKNKVTRKAAFAGSTLALITTPFL
FT                   ASGLPILISLFGLIWGRKK"
FT   gene            225122..225670
FT                   /locus_tag="ABAYE0206"
FT   CDS_pept        225122..225670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85189"
FT                   /db_xref="GOA:B0V997"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0V997"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85189.1"
FT                   /translation="MSQPIEIIAKGLTRERQRAGLSLAEVARRAGVAKSTLSQLEAGQG
FT                   NPSIETLWALCVALNIPFARLMEEPSNQVQVIRCGDGPTVSSEIANYKAILLATCPPHA
FT                   RRDVYLLIVEPGEDRLSEPHPVGSVEHIIVVEGRALVGLIDEAVELGVGDYICYPADQK
FT                   HIFRALETGTKALLISEQN"
FT   gene            225976..227418
FT                   /gene="gabP"
FT                   /locus_tag="ABAYE0207"
FT   CDS_pept        225976..227418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="ABAYE0207"
FT                   /product="gamma-aminobutyrate permease"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85190"
FT                   /db_xref="GOA:B0V998"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0V998"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85190.1"
FT                   /translation="MATHQNGSEANHSQSLKHGLKSRHLTMISIAGVIGGSLFVGSGSI
FT                   IYNTGPVVFLTYALGGLLVWFIMRMLGEMAVLNPDSGSFSTYADRAIGRWAGFSIGWLY
FT                   WCTLAMLMGWEAYVAGKILNNWFPFIPIWVYMTVVIVALVVVNLQNVKNYGEFEFWFAL
FT                   IKVIAIVVFLVIGSLAIMHLWPWGNPAASGISNLTSQGFMPNGGSSVITALLGVMFAYI
FT                   GAEIVTVAAAESANPSKEIRKASNSVVWRIILFYVGSMFVAVCLIPHNNELLKDSTWGT
FT                   YSVTLSALGIPGARHIVNFVVLTSVCSCFNSALYTCSRMLFSLSKRGDAPKSFGSVNSK
FT                   SSPWVGVIVSCFFSVIAVILTATESMNVYDFFMLTTGAATLYVYLTIAYSQLRMRKKLE
FT                   AEGVKIDFKMWMFPYLTYVVIFAIIGAILTMLIEGTYFKEVIYTTALFGIIVFFGLLSE
FT                   KLGWGKDRRATHLTHSHEEKLV"
FT   gene            complement(227479..228978)
FT                   /locus_tag="ABAYE0208"
FT   CDS_pept        complement(227479..228978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0208"
FT                   /product="putative transcriptional regulator (GntR family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85191"
FT                   /db_xref="GOA:B0V999"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V999"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85191.1"
FT                   /translation="MRSLLGDHLLQRLQQDTEGKLHQRLFRCLRGAIIDGVIQPKTRLP
FT                   ASRDLASEIHVSRNTVLSAYEQLQAEGYLEARTGHGTWVAEKLPESFLNTQNKKKVVSS
FT                   PNIQSSYALSQRGSNLLGYAAASPHQWGAFVPGAPDVTEFPHHIFSRIQARLSREPDIN
FT                   RLIYSNAGGCIELRSALADYLRVARSVQCDADQIIITEGIHQAIDLVSRALSDMGDKVW
FT                   IEDPAYWGMRNTLRINGLDIQPMPVDAEGIIPEENPAVPPKLIFVTPSHQYPLGSHLSL
FT                   DRRRQLIQIARQHNSWIVEDDYDSEFRFSGQPYPSLQGLENNAPVLYMGTFSKTIYPSL
FT                   RIGYLVVPKPLFSPLRIVAAELYRGGHLLEQKALAEFIREGHYEAHIRRMRLLYGKRRD
FT                   YLVSLIQRYLGPEFIHEYDEAAGLHLVLKLPNSCDDVAIAATALERGVKVRPLSQYYMQ
FT                   SHAHAERGLLMGFACVNEKDMVMAFGVLLQCLREAGVPTLN"
FT   gene            229135..230427
FT                   /gene="gabT"
FT                   /locus_tag="ABAYE0209"
FT   CDS_pept        229135..230427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="ABAYE0209"
FT                   /product="4-aminobutyrate aminotransferase, PLP-dependent"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /function="1.1.3 : Amino acids"
FT                   /function="1.7.31 : Aminobutyrate catabolism"
FT                   /function="1.7.32 : Putrescine catabolism"
FT                   /EC_number="2.6.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85192"
FT                   /db_xref="GOA:B0V9A0"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85192.1"
FT                   /translation="MDNQHSALNVRKQQATPRGVGVMCQWYAEKAENATLWDKEGNQFI
FT                   DFAGGIAVLNTGHRHPKVIAAVTEQLTKFTHTAYQVTPYESYVALAERINERAPIAGPA
FT                   KSAFFTTGAEAVENAVKIARCYTGRHGIITFGNGFHGRSFMTMAMTGKTAPYKRDFGVM
FT                   PAGVFHARYPVPAKGISVDAAIESVEDIFSEDIAPHDVAAIVLEPVQGEGGFNVVPAEF
FT                   LKRLRAICDKHGILLVADEVQSGFARTGKLFAMNHYETKADLITMAKSLGGGFPISGVV
FT                   GRAEVMDAPNPGGLGGTYAGSPIAVAAAHAVIDAIEEENLCDRANELGAELVATLKDIQ
FT                   QATGDVVTDIRALGSMVAVELETAEQAKVVQNYAMENGLLLLTCGKYGNVIRFLYPLTI
FT                   PAEQFRQGLDILKQGFATLKAGSAKAMEQSA"
FT   gene            230424..231872
FT                   /gene="gabD"
FT                   /locus_tag="ABAYE0210"
FT   CDS_pept        230424..231872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="ABAYE0210"
FT                   /product="NADP+-dependent succinate semialdehyde
FT                   dehydrogenase"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /function="1.1.3 : Amino acids"
FT                   /function="1.7.31 : Aminobutyrate catabolism"
FT                   /function="1.7.32 : Putrescine catabolism"
FT                   /EC_number="1.2.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85193"
FT                   /db_xref="GOA:B0V9A1"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85193.1"
FT                   /translation="MIQNNLQYLLKHPDISLEAPASNDYIEVNDAATGETLAWVKTYDR
FT                   AGVEAAINRSAKAQAAWKKQTALARADVLLAWYNLMLEHKENLAQILTAEQGKPLAEAR
FT                   GEIGYAASFIRWFAEQARRIDGEVLTPTLPNQRLLVIKQAIGVTAAITPWNFPAAMITR
FT                   KAGPAIAAGCSMLVKPAEQTPLTAYALEVLALQAGLPADVLINISGDAVEVGKTLCESD
FT                   IVRKLSFTGSTQVGRILMQQCAPTIKKLSLELGGNAPVVVFDDANLEQAVQGIMASKYR
FT                   NSGQTCVCANRIYVQDGIYDVLAERLVEAVSKLKVGDGRQEGSTQGPLIDEDAIAKVQS
FT                   HIADATEKGATVRIGGQRSALGGTFFEPTVLTGVTQDMKVSKEETFGPLAPLFRFKTED
FT                   EAVAMANDTEFGLAAYLFTQSTARQWRVGEALEYGMVGINTGAISNEVAPFGGVKQSGL
FT                   GREGSKFGIEEYVEMKYLCVDLSE"
FT   gene            complement(231977..232951)
FT                   /locus_tag="ABAYE0211"
FT   CDS_pept        complement(231977..232951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0211"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85194"
FT                   /db_xref="GOA:B0V9A2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85194.1"
FT                   /translation="MLKHSNLEFKWVEQTLISSFDDFYYFYLVVKHGGFSAASEAENIS
FT                   KSKLSRRIIDLENKFNVSLIQRTTRHFKVTDLGQEFYEECCKVIAQVECAENVLLKQKS
FT                   EPQGLVKVSCPPLMMHFQIRKILNQFLKTYPKVEISLELTSRRVDILHDDIDLAIRTNF
FT                   EPNEDSNLIVRDVIKTDHCLVASPELLQGRTIKHYSELQDFPSISLGTQKQNYIWHLCN
FT                   IRNGESVDVPYQPRIKSNDLAGVYYAVMDGLGIADLPFLTVESEIRKGTLVHILPDWKS
FT                   NIGMLQLVYVSRKGQRLVVEKLIETLIDELRRLPESHEGYLPT"
FT   gene            complement(232972..233598)
FT                   /locus_tag="ABAYE0212"
FT   CDS_pept        complement(232972..233598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0212"
FT                   /product="putative hydrolase, isochorismatase family"
FT                   /function="1.1.3 : Amino acids"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85195"
FT                   /db_xref="GOA:B0V9A3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85195.1"
FT                   /translation="MAQDYVRLDKDNAAVLLVDHQAGLLSLVRDIDPDKFKNNVLAVAN
FT                   AAKYFNLPTILTTSFETGPNGPLVPELKEIHPDAPFIPRPGQINAWDNEDFVKAVKATG
FT                   KKQLIIAGVVTEVCVAFPALSALAEGFEVFVITDASGTFNELTRDAAWDRMSKAGAQLM
FT                   TWFGMACELHRDWRNDIEGLGTLFSNHIPDYRNLISSYNHNTSQK"
FT   gene            233764..234747
FT                   /locus_tag="ABAYE0213"
FT   CDS_pept        233764..234747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85196"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0V9A4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85196.1"
FT                   /translation="MSHKCNNVLLILIYKLQLLRRKINLSSRKSYIYRRDQMKKFLGAY
FT                   QNNHMHWVGDGFPVYNLFSYDRLGQTLSPFLLLDYAAPYNFSPTTEQQGVGSHPHRGFE
FT                   TVTIAYQGEVTHKDSSGGGGTIKTGDVQWMTAGAGVLHEEFHSPEFAEHGGLFEMVQLW
FT                   VNLPSHSKMTPGKYQAIEAKDIPDIALDEHGSHLRVIAGEYADAKGAASTFSPLNVWDG
FT                   KLVKGQKHTLYVPEGHTTLVVVLEGAVVVNDTNRLEGKTVAILSREGVEFSLNAEEDTK
FT                   FLVLTGQPLNEPIEGYGPFVMNTKAEIMEAINDFNRGKFGSIMQEG"
FT   gene            235148..236485
FT                   /locus_tag="ABAYE0214"
FT   CDS_pept        235148..236485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85197"
FT                   /db_xref="GOA:B0V983"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0V983"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85197.1"
FT                   /translation="MIIKKILEKWDIILDIAIIGSGMAGLAAARILKDAGHTITIFEAL
FT                   PGRGMDSHSIEFDGGIIDAPLRVMNPHLWKNTLSLAAHLGIKTFPVRTYMSCSWLFEDR
FT                   TETWLTTSRSRIGNFPIINNRKGIQQYGWRLVKGMLQLKTAIHQFFKSKNQDITLAEFI
FT                   NQNDIEEVFWHGVVMPVLYTICTCNPKTIGDWPAKNLLEFLRHLTDGDMLLRMKGGTPA
FT                   FVDSLIKGIDIHSGSAIKKVELQGEKVLVENEKGDQGTFDRVIVATPTSKLEEFLNPEQ
FT                   FAEDMNLLKQFRFEQGDLVIHTDATVMPPRRKDWSVLSYMMDRKFTRQQFTVWMNAVEP
FT                   SLVGKNPVFQTWRPVVDIDPKKVISKVTLTRAVVDSQTIALNKELQQRHLEPNRKVFYC
FT                   GSWSCDGLPILESAVTSAMHIAEILGAPLPFVGLKPKVEVAPELGY"
FT   gene            236463..237317
FT                   /locus_tag="ABAYE0215"
FT   CDS_pept        236463..237317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0215"
FT                   /product="putative methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85198"
FT                   /db_xref="GOA:B0V984"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0V984"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85198.1"
FT                   /translation="MPLNSVTKIVKAKVRAALSRFIPHKYAIDASSLGDSEELAWTNLG
FT                   FWKNTQTYREACRQLADHLAQAVNLNSKDHLLDLGCGQGASLLHWLQHYHPKSLSAVEL
FT                   QASCVNKIQKFIPEISQIFCGSFLNLKQFEFKQRFDVVLCIDAAYHSHLNSFLDSVTPV
FT                   LNSKGRLGFHYLMRADSCHNMTMLQEQKHRYLLKAADVTWDALLTEEILRTTLEQQGFT
FT                   DIKIEDLSEQVLLGFSQYIQNQQAQSHNRGLANFKIQMTAKLCQQLYQNGYVRYIQITA
FT                   IKK"
FT   gene            237326..237748
FT                   /locus_tag="ABAYE0216"
FT   CDS_pept        237326..237748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0216"
FT                   /product="conserved hypothetical protein; putative
FT                   glutathione-dependent formaldehyde-activating"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85199"
FT                   /db_xref="GOA:B0V985"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B0V985"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85199.1"
FT                   /translation="MSVKYQGSCLCGAVSYQSDAEPRYSFNCHCRDCQKATGSAYAPIA
FT                   FFHQSELKISGELKYFETLGSSGRPIKRAFCPTCGSQLFGLPELVPEMISIRAGTLDDP
FT                   SLYHPKAEVFVSQTYAWDMLNPNLKHFEKMIEKSKK"
FT   gene            complement(238391..238466)
FT                   /locus_tag="ABAYEtRNA72"
FT   tRNA            complement(238391..238466)
FT                   /locus_tag="ABAYEtRNA72"
FT                   /product="tRNA-Thr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(238591..239913)
FT                   /locus_tag="ABAYE0217"
FT   CDS_pept        complement(238591..239913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0217"
FT                   /product="putative transporter (MFS superfamily)"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85200"
FT                   /db_xref="GOA:B0V986"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0V986"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85200.1"
FT                   /translation="MLILIYRIFSMQHAFKHCSFFCHGHDMNSSSTPSTLSTEATSVLS
FT                   REWIHKGTKAYKHAGFALFLVGFASFSLIYCVQPLLPAFSQSFQISPASSSLALSLTTA
FT                   FLAISIVLSSAFSQALGRRGVIFTSMLCAALLNIVSMLTPNWHSLLIARALEGLLLGGV
FT                   PAVTMAWIAEEIAPEHLGKTMGLYIAGTAFGGMMGRVGMGILVEYFSWRTALGLLGAIC
FT                   FICSIAFLKLLPASRNFVQKKGLNLGFHIQMWRAHLSNTKLLRLFAIGFLLTSVFVTLF
FT                   NYATFRLSGAPYSLSQTQISLIFLSYSFGMVSSSLAGSLADRFGKKTMMMSGFALMILG
FT                   SLMTLLSSLFGIIIGIAFITTGFFITHSLTSSSVGAESKQAKAHASSLYLLFYYMGSSI
FT                   VGSAGGWFWLHGGWSAIVGLTVFLSLIGIFLAVYTSHAKAH"
FT   gene            239974..240894
FT                   /locus_tag="ABAYE0218"
FT   CDS_pept        239974..240894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0218"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85201"
FT                   /db_xref="GOA:B0V987"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:B0V987"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85201.1"
FT                   /translation="MELRHIRYFLAVAEEKNFTKAAQRLNMSQPPLSMQIRDLEEELGA
FT                   DLFIRSPHGVELTEAGLAFLNAIQPVQQRVEDAASLVKQVANGEVGQLRLGFTGTSMLN
FT                   PLIPKCVRYFQQQYPKVNLKLEEANTLLLIDSLLEDRLDVAIIRSPRNMPDSLILQELL
FT                   AEPLIAALPSESFQLDDVSQEIDLTALRELDFIVSPPSVSAGLFDAIKQACHERGFEPK
FT                   IGQNAPQIVSILSLVSANLGVSLVPESTKQLQIQGVAYRSLKAPVPTVGLGLAYKKHAP
FT                   SQMAINFASVVQVACHHANEINEIG"
FT   gene            complement(240891..241778)
FT                   /locus_tag="ABAYE0219"
FT   CDS_pept        complement(240891..241778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0219"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85202"
FT                   /db_xref="GOA:B0V988"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0V988"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85202.1"
FT                   /translation="MNNLIIGTLFALCAAALNASIGVISKLLMHSGLNPQDIAFLKTII
FT                   AFFFLSVFLFKVPVSQKIAFISSTPSKLSVFAQIAICAFLGIFSLFFFETIAYNHGAAA
FT                   NVVVVLMASAAISALFFGRFILKESIYIHSLIGTLLAVAGISIISWKGENSLLMLINAS
FT                   IAGTGYGLFSVLVKKFKLNGGLFLTKYLLLFGSVYLAVPFLVNLHSITFNSDIILGLIG
FT                   LAVLPTILGFFCTTKALSYMSAAKVQVTELSEPIFAALMAWVFIHEQPTLSFLYGAIFI
FT                   ISGIFLMNRAPKSN"
FT   gene            242007..242750
FT                   /locus_tag="ABAYE0220"
FT   CDS_pept        242007..242750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0220"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85203"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0V989"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85203.1"
FT                   /translation="MIKSIITGCAVLTLSALAVTHAEFSYEQELQQGCNKVKQYASLGK
FT                   KFYDQKQYKKALENFQNQASWTAFCKANADETTVKFTDRDIEVANNNVGLAYAKLGQPL
FT                   WARAWFMLDEKSKSSQFNLKQLPQPKASNVLSGEYVRYSGFGEWDHITVSRKQGQYAIS
FT                   YSGVYMGLRSLIYGPNMGEFDTKMPANAKQTIYKDQDCHIQLDFRTNAKLGNYIQVKQS
FT                   EGESGCGFGHNVYADGTYLKVESEK"
FT   gene            242775..243167
FT                   /locus_tag="ABAYE0221"
FT   CDS_pept        242775..243167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0221"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85204"
FT                   /db_xref="UniProtKB/TrEMBL:B0V990"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85204.1"
FT                   /translation="MKNIFAPLLLVSTVIFSAHIYAEPTSTCKEVKFQKADQAWSGHYY
FT                   LHGVMEVGSELLLQPDGKFQWMLAVGALDQYAEGTWWKNGDCIGLKPEAKFKKDLSIFP
FT                   ESLTISDKSLDAIWQGGRQQGTYSKD"
FT   gene            complement(243213..244214)
FT                   /locus_tag="ABAYE0222"
FT   CDS_pept        complement(243213..244214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0222"
FT                   /product="putative oxidoreductase, Aldo/keto reductase
FT                   family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85205"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B0V991"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85205.1"
FT                   /translation="MKYRTLGQTGEKVSALGLGCMGMSFAYGASDDTQSIATLEKALDL
FT                   GINFWDTADMYGNGANEVLLSKVLEKHRDKVFLATKFGFRYKEDNLNPKNSLESYIDGS
FT                   PEWIKVAVENSLRRLNTDVIDLYYAHRIDPNVPVEDTIGAMADLVKQGKVRYLGLSEAS
FT                   AETIRKAHAIHPIAAVQHEYSLLTREFEQTHLQTIRELGISLVPYSPLSRGLITNTLDV
FT                   NNLDENDFRRQLPRYQGDNWKNNQSLAQAFSEFAQSKNATAAQLALAWIFAQGDDIIPI
FT                   PGTRKIERLVENAGAVDLHLTAADLAEIEAIIARYPNMGARYNAQQLAAVNH"
FT   gene            complement(244326..245276)
FT                   /locus_tag="ABAYE0223"
FT   CDS_pept        complement(244326..245276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0223"
FT                   /product="putative transcriptional regulator (AraC-like)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85206"
FT                   /db_xref="GOA:B0V992"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B0V992"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85206.1"
FT                   /translation="MNFITLNKLIMHAGKDMETIHDFYRRFSLTRDSDYSVPSTSFGHF
FT                   NVFQRDACSFLTPYSRRDYYKISLVLGTGELHYANRWIRVDRPALLFSNPMVPYAWEIN
FT                   SPEQAGWFCLFTEEFVNQESRQSFLKDSPLFKVDGDPLYFLNDQQVEEISFIFKKMMNE
FT                   INSDYIHKYNVLRNYLHLIVHEAMKMQPTQQFEKHSNASVRICHLFFELLERQFPIDSP
FT                   HFQLKLKTANDFAYGLSVHVNHLNRAVKEATGKTTSEHISSRITQEAKALLQHTSWNIS
FT                   EIAYSLGFEYSAYFTNFFKKNTGFSPKKFREDCVA"
FT   gene            245757..245969
FT                   /locus_tag="ABAYE0224"
FT   CDS_pept        245757..245969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0224"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85207"
FT                   /db_xref="UniProtKB/TrEMBL:B0V972"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85207.1"
FT                   /translation="MVANSFVPLRSGRAREGRLVRADSCVSVCQPSLVLPPTFDSDRVE
FT                   LLYTQGVRRYAYYFISLIGNLRQNL"
FT   gene            246185..246736
FT                   /locus_tag="ABAYE0225"
FT   CDS_pept        246185..246736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0225"
FT                   /product="putative transcriptional regulator (TetR family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85208"
FT                   /db_xref="GOA:B0V973"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0V973"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85208.1"
FT                   /translation="MKNLDASRRALHVIDTATDLFKQYGFNKVGVDQIIAESQINKGTF
FT                   YSYFHSKERFIERCLVAQKEQLQEKVSVVSELYQNADLSDQLRQIYLLHADLKSAYYLL
FT                   FKAIFEIKKLYPNAYQTALRYRRWLKNEILCLLMETKKTVSYSEAEIFVFMMDGAILGL
FT                   LSSDEERERDALLEYFLERV"
FT   gene            complement(246791..247240)
FT                   /locus_tag="ABAYE0226"
FT   CDS_pept        complement(246791..247240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85209"
FT                   /db_xref="GOA:B0V974"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B0V974"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85209.1"
FT                   /translation="MIFSEQSRIFTVEYKEVSKKTIGHLYSAHSSIRSSDLDPKLIALA
FT                   ELYVSQINGCAYCCAFHSKELRDFGIAQEVIDQIPGYKHSKAFSEKQKVVLEFASAITS
FT                   LNDPKQIEATRESLAQHFSEKEIVDLTASISLMGALNRLRITLGD"
FT   gene            247319..247633
FT                   /locus_tag="ABAYE0227"
FT   CDS_pept        247319..247633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85210"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V975"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85210.1"
FT                   /translation="MKDNISGCTVEEAMTVLGGRWRMLIISFLLERTMRFNELRRAIPN
FT                   ISQRMLTLELRFLEEEGFILREVYAEVPVKVEYSLTEEGRKLEKLVDVLKEIGGWLKSR
FT                   "
FT   gene            complement(247738..248277)
FT                   /locus_tag="ABAYE0228"
FT   CDS_pept        complement(247738..248277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0228"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85211"
FT                   /db_xref="UniProtKB/TrEMBL:B0V976"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85211.1"
FT                   /translation="MILINMKFLTYIFLIVLLCGCGFKPQFRPTKMYSGNENKNESDFS
FT                   LIYIDWMETAQTYKKVGQTEITEINNIKVAERVPTMGSKYMLQVLPGEQNVSIFLFFIK
FT                   EYIGMDMYKTESVTLKLPPFNTQPNKIYVLCPQKSNGLNFKVKIYPYTRQEILEKKGMT
FT                   DFIVRPCRTMDNLSIQ"
FT   gene            complement(248425..248655)
FT                   /locus_tag="ABAYE0229"
FT   CDS_pept        complement(248425..248655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85212"
FT                   /db_xref="UniProtKB/TrEMBL:B0V977"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85212.1"
FT                   /translation="MILNMRHELREIFIKGCDEKIQKKGDNVGLSFYAFFKNKNDNPEL
FT                   LMEAAHWWIMEHKLDHFEKAVKIKQLVLSER"
FT   gene            complement(248671..249006)
FT                   /locus_tag="ABAYE0230"
FT   CDS_pept        complement(248671..249006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0230"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85213"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V978"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85213.1"
FT                   /translation="MTDCLPSNTPLEETGFGYTLSLINGKYKMIIMYWLYGKTVMRFNE
FT                   LQRCIGNISFRTLSNTLKELERDELIIRKEYPQIPPKVEYRLSERGQSLIPLLDMMCQW
FT                   GERNMNS"
FT   gene            249124..249681
FT                   /locus_tag="ABAYE0231"
FT   CDS_pept        249124..249681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0231"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85214"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0V979"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85214.1"
FT                   /translation="MKKTLVIVAHPHIDQSVINKRWVEELEKYPDQFTVHQIYQAYPDG
FT                   VIDVAKEQALVEEHENLVFQFPVYWFNCPPLLKQWLDEVLAYGWAYGSTGDKLKNKKFM
FT                   LAVSAGAQEKVYSEQGEYKLSLEQIFSSFELTALYIGAVYQPLYAFYGLDTNPSPDDAI
FT                   PTHQEIDNSAVQYVQKLLALSE"
FT   gene            complement(249712..250566)
FT                   /locus_tag="ABAYE0232"
FT   CDS_pept        complement(249712..250566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0232"
FT                   /product="putative HTH-type transcriptional regulator (AraC
FT                   family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85215"
FT                   /db_xref="GOA:B0V980"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B0V980"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85215.1"
FT                   /translation="MIGAIRVVQNDLDLLYRKSKSYVWGNSNLSDVLNQPLSLAYCSLI
FT                   FIKQGSADINILFKNYHLKSGDFLFLSEDSLAILQKRSADFSCDYCIFNRDFAAEVASV
FT                   LPNSLFTYLHLFPHFSPEMSYQSLIKTWINQTTFILQSTSEYQRILLCNHLQNFFLVLS
FT                   ETVNREKLLSKNEYSRKEKICWQFWEMISLHCKEHRDVNFYAKALNITPYYLSKLSKQF
FT                   FNDNAKTLIDRQVILKLKELLRTPSNSIQSIADQLNFEDTSYMCRYFKKHTGFTLLQYR
FT                   KSA"
FT   gene            250684..251226
FT                   /locus_tag="ABAYE0233"
FT   CDS_pept        250684..251226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0233"
FT                   /product="putative acetyltransferase (GNAT family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85216"
FT                   /db_xref="GOA:B0V981"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0V981"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85216.1"
FT                   /translation="MILTTERLILRPWQDSDASSLYEYASDDRVGPTAGWPVHESEAQS
FT                   LEYIQTVFAKEEVYAVAKKEDNRAIGMVGLLIGKESNFKIADNEAEVAYWIGVPFWGQG
FT                   LIPEAVKAVMKHAYEDLKLKALWCGYFADNEKSFKAQAKCGFKHHHTEESKFNKFLGDY
FT                   RTEHISYLSYEDWKREI"
FT   gene            complement(251401..251490)
FT                   /locus_tag="ABAYEtRNA71"
FT   tRNA            complement(251401..251490)
FT                   /locus_tag="ABAYEtRNA71"
FT                   /product="tRNA-Ser"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            251609..253486
FT                   /gene="trkD"
FT                   /locus_tag="ABAYE0234"
FT   CDS_pept        251609..253486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkD"
FT                   /locus_tag="ABAYE0234"
FT                   /product="potassium transport system, low affinity (KUP
FT                   family)"
FT                   /function="4 : transport"
FT                   /function="4.2.A.38 : The K+ Transporter (Trk) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85217"
FT                   /db_xref="GOA:B0V982"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V982"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85217.1"
FT                   /translation="MQNTAKKATLPATALAALGVVFGDIGTSPLYALKESFHAAHGLGI
FT                   QPENVLGILSIIFWCLMLIISIKYVAIVMRADNNGEGGIMALLALNLRKAKIADNKKIY
FT                   MIAIGFIGASLFFGDGIITPAISVLSAVEGLSIATDVFDPFIMPIAIAIIVTLFLVQKH
FT                   GTAFVGKFFGPITLVWFLSLGILGIHSVIQTPVVLGMFSPHWAIQFIYHHPIMTFFVMG
FT                   AVVLTVTGGEALYADMGHFGPVPIRLAWFFVVLPCLVLNYAGQGALLLRDPAAIENPFY
FT                   LLVPQWALYPMIIMATMATVIASQAVISGVFSLARQAIQLGYLPRLSIKHTSESEEGQI
FT                   YVPFLNWLLLIAIIILILIFKTSSNLASAYGLAVTLTMLCDTILVAVFIYSAWKWSLPK
FT                   VLLLIIPFFILESVLVGATSLKILSGGWVPLLIGAIAVTILMTWKRGRELTFAKLEHDT
FT                   LSLDLFVKSIGNSVHWVPGDAVFMTGTPNVVPHAMLHNIKHNKVLHQRNILVTVVIEDV
FT                   PFVAPEERITTETLAEHFFRIKIFYGFKDEMNVPKALLQAYEQLGLEYDLMHISFFISR
FT                   DRIVHSVGDGMSPWREKLFISMQRNTSPVSDFYQIPTNRVVELGSQIEI"
FT   gene            complement(253542..254033)
FT                   /locus_tag="ABAYE0235"
FT   CDS_pept        complement(253542..254033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0235"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85218"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85218.1"
FT                   /translation="MVSSTNLDKNIIGVHLMIHSKIIGIGVITGLCSMAALAEPAVQPG
FT                   DTLESLSKVKVTTTVNGQPGSISDLVNSGQVQQVSAAPTSAAPTGAPIPADVPPAPPAG
FT                   GEMAPSAAPTDAVPPAPNQAAPAPQDPNTPPPAANPNQSADPMAKDGALPADAPMPQAQ
FT                   "
FT   gene            254241..255320
FT                   /locus_tag="ABAYE0236"
FT   CDS_pept        254241..255320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0236"
FT                   /product="putative DNA/RNA non-specific endonuclease G
FT                   protein"
FT                   /function="1.2.1 : RNA"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.5 : DNA degradation"
FT                   /function="2.2.4 : RNA degradation"
FT                   /EC_number="3.1.30.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85219"
FT                   /db_xref="GOA:B0V8S6"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85219.1"
FT                   /translation="MASKKRSKGTNSFSLSEHFGKIILACIAAGSFAIAFGSEKISQWF
FT                   SPLSTNSTCLNQFYREVPPALNKESLKKDSYPLCFNGFNVLYSGISKTPLWSAEHLDAE
FT                   RLSVKIKREDNFHEETRVPQKHRALLSDYRGSGYDRGHMAPNGDMPNKESQSDSFSLSN
FT                   MVPQAPKNNQEVWRKLEEATRAIVTKQKQDVYVVTGPVFEGKRLKTIGQGVIVPTAVYK
FT                   AVYMPKTGAIGAYYAPNNNSQQVKVVSVCYIEEKLGINLFPQLTEQQKRNVYRLPLTAS
FT                   QVKPNQKLDYLHWDGESQCEQDLSAEQIQALQDQFKKQKTGSSEPMEAKVPSIDEETRN
FT                   AIVKQLVEALVNYFLQIMK"
FT   gene            255417..256016
FT                   /locus_tag="ABAYE0237"
FT   CDS_pept        255417..256016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0237"
FT                   /product="putative Efflux protein, LysE family"
FT                   /function="4.2.A.75 : The L-lysine exporter (LysE) family"
FT                   /function="4.S.12 : amino acid"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85220"
FT                   /db_xref="GOA:B0V8S7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85220.1"
FT                   /translation="MFASMFLFSFAMSITPGPVNTVILSTSLNHGLKRSLPYISDATIG
FT                   FTLLLIFMAFGLQSVLTQFPVVLKILAVCGTLFVCYIGIKIILSAANISISSAPVGHML
FT                   IPNFKDGFLLQWLNPKAWLACVSGITMFTSIENPQSLPIFIIIYFFTCYACLFFWGLCG
FT                   DKFSVVLNQGNRLKYFNILMGAFLILSALLILIDFF"
FT   gene            256062..256304
FT                   /locus_tag="ABAYE0238"
FT   CDS_pept        256062..256304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85221"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85221.1"
FT                   /translation="MFKPFEKGTESSSIEDLTLENDVDCVSIYGNLQITKDKVGLEQAK
FT                   ALQSFFNDVVAALEKEELPEKIERPAEQEINNPFL"
FT   gene            complement(256513..257202)
FT                   /gene="aqpZ"
FT                   /locus_tag="ABAYE0240"
FT   CDS_pept        complement(256513..257202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="ABAYE0240"
FT                   /product="water channel (aquaporin Z) (MIP family)"
FT                   /function="5.5.1 : Osmotic pressure"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11101683; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85222"
FT                   /db_xref="GOA:B0V8S9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85222.1"
FT                   /translation="MNKYFAEFLGTFWLVFGGCGSAVLAAAFPELGIGFAGVALAFGLT
FT                   VLTGAYALGHISGGHFNPAVSVGLWVGGRFDVKDLIPYIVAQVVGATAAAFVLYIIAQG
FT                   QAGFSGVGGFATNGFGDLSPNKFGLGSAFIIEVVLTAFFLIIILGATDRRAPAGFAPIA
FT                   IGLGLTLIHLISIPVTNTSVNPARSTGVAFFAETAALSQLWLFWIAPILGAVIGAIIYK
FT                   VVAGDKD"
FT   gene            complement(257335..258339)
FT                   /locus_tag="ABAYE0241"
FT   CDS_pept        complement(257335..258339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85223"
FT                   /db_xref="GOA:B0V8T0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8T0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85223.1"
FT                   /translation="MPQLKNYTGSVYGGLGHLLKAYCEANELAIPEQLEQIQNLERFDY
FT                   VVWRDLLEVIYKLDPKPGLGLEIAKYVQPKHLGIIAYLALSCDNLGEALIRYHDFHRLI
FT                   YDGSPLVVELQGRYGSIRWEATELHPTQLTDEIAIALVIQFLRLFMSHEDVQLHEVRFL
FT                   NAAPKNIRVYEQYFQCPVRFSQPRTELLIPITEIHKPLSSADHTLQQLLVQQAQALLEQ
FT                   LPNSTQLDQRLQHSILTGLQKNQYQIEYIAAQLGLSVRQLQRHLQQQNTTFQERVQQVR
FT                   FMLATEYLKDPHLSLQEIALLLCYSEQSAFQRAFKHWTKQTPQQWRDQFLNKE"
FT   gene            258449..259087
FT                   /locus_tag="ABAYE0242"
FT   CDS_pept        258449..259087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85224"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85224.1"
FT                   /translation="MLKGFIAGIAVANAFEWVAHKYILHGVHRAGQPRYSPVPKSMESH
FT                   WAHHREVRKQQFHDDCYVEGVGNWRTKNELISLAVVATVSSAIFYPFSKGMALAAWYSA
FT                   GNYYYIHRRAHLEPEWAKRKIPWHYDHHMNSNQDANWCVTKPWFDYVMGTRVVSSADLK
FT                   EQNPLGIRLPTALARPLSQAVEKIFPAKWVEKKEQPKLVSDVNAIEGAA"
FT   gene            complement(259129..259899)
FT                   /gene="hisF"
FT                   /locus_tag="ABAYE0243"
FT   CDS_pept        complement(259129..259899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="ABAYE0243"
FT                   /product="imidazole glycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="4.1.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85225"
FT                   /db_xref="GOA:B0V8T2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8T2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85225.1"
FT                   /translation="MEKAMLAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNE
FT                   QGADEITFLDITATHHGRDTTYRTVERMAETVFVPLTVGGGVRKVEDIRALLNAGADKV
FT                   SINSAAVFNPEFVQEASQHFGAQCIVVAIDAKKTGDNKWEIFTHGGRKPTGIDAIEWAV
FT                   KMADYGAGELLITSMDADGTKAGYDIALMRAINDRVTIPTIASGGVGNLQHLADGILQG
FT                   GADAVLAASIFHFGQYTIPEAKQYLAEQGIEMRL"
FT   gene            259946..260950
FT                   /locus_tag="ABAYE0244"
FT   CDS_pept        259946..260950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0244"
FT                   /product="putative homoserine kinase (ThrB)"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.8 : threonine"
FT                   /EC_number="2.7.1.39"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85226"
FT                   /db_xref="GOA:B0V969"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0V969"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85226.1"
FT                   /translation="MEGRGILSNFTDVFCRFSMSVYTPLSLDEVRTFAAPYGLEVLELN
FT                   PIQGGIQNTNYFLVDVNRKQYVLTVFEELDAQGAGELIPVLEQLGTHDVPVAVPLKHSG
FT                   QAVHFIAGKPAQIAPRLMGHHPMQTTVAQVAAIADAQAKLHVALQDFPLEREYRRDHQY
FT                   WTGVAEQLKPNMTQDDQTLLEQVYQAFNAKTAQYSNRPTGFIHSDLFRDNTLFEGEQLQ
FT                   GILDFYELNQDELLFDIAITINDFCTEYPAAHLNSDKVDAYLEAYQKVRALTSDELECL
FT                   DVFLAMAACRFWSMRLQVAQKNKEEGRTGDDILQKDPQEMRAMMQDRLSHVKA"
FT   gene            260963..261592
FT                   /locus_tag="ABAYE0245"
FT   CDS_pept        260963..261592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0245"
FT                   /product="putative cold shock protein"
FT                   /function="5.5.2 : temperature extremes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85227"
FT                   /db_xref="GOA:B0V970"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B0V970"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85227.1"
FT                   /translation="MRDQGRLVEWFDEKGYGFIQPDDAEKERVFLHIKDFARPGPRPII
FT                   GCALEYLVILDERGRFRAQQVTYLKASQTRKALKPAKTQSSFQASPWSAMQMGIVFYFV
FT                   LMGIMSFIHILPAYTLLCVLMMNALSYWLYSQDKEAAQLGNRRVPEQTLHIVSFLGGWP
FT                   AAWWAQQKLRHKTQKQPFRKIYFCTIFFHLLLILWLISPLNVLRGS"
FT   gene            261614..262024
FT                   /locus_tag="ABAYE0246"
FT   CDS_pept        261614..262024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0246"
FT                   /product="putative transmembrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85228"
FT                   /db_xref="GOA:B0V971"
FT                   /db_xref="UniProtKB/TrEMBL:B0V971"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85228.1"
FT                   /translation="MRGIKMNSSIDQDPNRTLTLILYVLYIVAIFTGGLLAIIALIINY
FT                   VKRSDVQGSIFASHFTWQIRTFWWYLAWNIIAFLPFIFLFFTGENTDLFAGVAISSTVF
FT                   CVGVIAAAWIWIVYRAIRGLIALNDNRPMYQP"
FT   gene            complement(262058..262966)
FT                   /locus_tag="ABAYE0247"
FT   CDS_pept        complement(262058..262966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0247"
FT                   /product="putative membrane protein"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85229"
FT                   /db_xref="GOA:B0V8R5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85229.1"
FT                   /translation="MSMSPTYLSSSKVPQLALILITVIWGGTFLTVQYALNFSSPMFFV
FT                   GCRFAVAALTLLLISLKSMKGVTLKDLGAGSVIGLVIAAGYGTQTIGLQTIPSSESAFL
FT                   TALYVPLVPILMWLIFRKTPHIMTWVGAALAFTGLVLLTGNGFKQISLSFGQLLTVLGA
FT                   FAIALEIIFISYFAGKVNLRRVTIIQLGVASLLSFAIMPIVGEHTIPAFSWSLVLIAVA
FT                   LGLASALIQFVMNWAQRVVDPSRAAIIYAGEPVWAGIIGRIAGERLPVIALFGGALVVL
FT                   GVLVSELKIKLPIKKNKRVRE"
FT   gene            262978..263610
FT                   /locus_tag="ABAYE0249"
FT   CDS_pept        262978..263610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0249"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85230"
FT                   /db_xref="GOA:B0V8R6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85230.1"
FT                   /translation="MCNILHILRYSSVLCNILLKFSLFIYFMSQSSSVLQHVGTNIRSL
FT                   RDEHSLSQQDLADRAGVSRRTIAALETGQVNISLAKLDAIAAVLGVDFRTIVSAPELKE
FT                   HALVNALAWQGQKEESKATFLASVPSRSQVELWTWSLAVGESYVAEADAEGWQELIYVL
FT                   EGELTIQFTDSSKTIAAGSSFIFASSVTYTYINSGSQVLKFIRNVVY"
FT   gene            complement(263678..264409)
FT                   /gene="hisA"
FT                   /locus_tag="ABAYE0250"
FT   CDS_pept        complement(263678..264409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="ABAYE0250"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide isomerase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="5.3.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85231"
FT                   /db_xref="GOA:B0V8R7"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8R7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85231.1"
FT                   /translation="MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGAR
FT                   RLHLVDLNGAFAGTPIHKPVVEAIAKAQPELPIQIGGGIRSLETIEHYLEAGVTFVIIG
FT                   TKAVQEPEFVEEACKRFAGHIIVGIDAMNGMVATDGWANVTDVKATDLAKRFADAGVSS
FT                   IVYTDIARDGMMQGVNVEQTVNLAQYSGLPVIASGGVTNLDDVRNLKGQPGILGAITGR
FT                   AIYEGTLNLREAQLLLDENRL"
FT   gene            complement(264504..265145)
FT                   /locus_tag="ABAYE0251"
FT   CDS_pept        complement(264504..265145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0251"
FT                   /product="conserved hypothetical protein; putative 3'-5'
FT                   exonuclease"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85232"
FT                   /db_xref="GOA:B0V8R8"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85232.1"
FT                   /translation="MSEASALLDKTSIQQLPPFENLNHQNIVVIENGEQCKTIEEELKA
FT                   ATFLGFDSESKPTFQVGEVSTGPHLIQLATEHKAYLFHVNLSTLKFLQPILSNPKQIKV
FT                   GFGLKNDKHIFHKKGIELESCVDLAKGFSHFGFKQQMGVQKAVALLLGQYLAKSKKVGT
FT                   SNWARKPLTSQQISYAAADAYAALLVFLELKKRKVLPIHISEKIQTALQR"
FT   gene            complement(265232..265798)
FT                   /locus_tag="ABAYE0252"
FT   CDS_pept        complement(265232..265798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0252"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85233"
FT                   /db_xref="GOA:B0V8R9"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85233.1"
FT                   /translation="MIRINTMNSPFENQPISQDSPFKANGRFGRLSYAAWTFLFTLVLV
FT                   TAILLIMFTFGFTNPEGAPDFSTPGLICIAILYIVGIYINFVFTIRRLHDRNNTGWLSL
FT                   LMLVPIVNIGLAIYLFCAKGTEGPNDYGPKRPTPSWERVLGWIYIVLIPLALIFGVIAV
FT                   IMAPTYEGYVEKSESIVIGSPSQSE"
FT   gene            complement(265934..266551)
FT                   /gene="hisH"
FT                   /locus_tag="ABAYE0253"
FT   CDS_pept        complement(265934..266551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="ABAYE0253"
FT                   /product="imidazole glycerol phosphate synthetase,
FT                   glutamine amidotransferase subunit"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85234"
FT                   /db_xref="GOA:A0A0R4J878"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J878"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85234.1"
FT                   /translation="MTRIALLDYGMGNLHSAAKALEYVGATVDVTNDPKLIAQADKIVF
FT                   PGVGAMRDCMQGMREAGIDEVVRKAAFNKPVLAICVGMQALLQSSEENGGVDALGIFDG
FT                   IVKHFPQMEGLKVPHMGWNQVHQMDPSHPMWNNIEQDARFYFVHSYYVEPKDENLVAAT
FT                   CEYGVNFCTAIHKDNLFATQFHPEKSHTAGLQLLKNFVEWNI"
FT   gene            complement(266551..267159)
FT                   /gene="hisB"
FT                   /locus_tag="ABAYE0254"
FT   CDS_pept        complement(266551..267159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="ABAYE0254"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="4.2.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85235"
FT                   /db_xref="GOA:B0V8S1"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8S1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85235.1"
FT                   /translation="MRNVSMTQRISEVVRNTNETKIRVRLNLDGTGQGTLNTGVPFLDH
FT                   MIDQIKRHGLFDIDIHCDGDLEIDDHHTVEDCGITLGQAFAQALGDKKGLRRYGHFYAP
FT                   LDEALSRVVVDLSGRPGLFMDIPFTRARIGTFDVDLFSEFFQGFVNHALMTLHIDNLKG
FT                   KNSHHQIESVFKALARALRMACEIDPRAENTIASTKGSL"
FT   gene            267247..267630
FT                   /locus_tag="ABAYE0255"
FT   CDS_pept        267247..267630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85236"
FT                   /db_xref="GOA:B0V8S2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85236.1"
FT                   /translation="MPITVHAYSSLDNSEIRDQLERLYDTSPEFGDGHDAIEQLEQDLQ
FT                   QYTTLYTAEFNTKIIGAIWCSGQGESKVLEYIVVHPANRGRGVAERLVEEACRIEEAKG
FT                   VKIFEPGCGAIHRCLAHIGKLHS"
FT   gene            267736..267811
FT                   /locus_tag="ABAYEtRNA3"
FT   tRNA            267736..267811
FT                   /locus_tag="ABAYEtRNA3"
FT                   /product="tRNA-Phe"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            267938..268013
FT                   /locus_tag="ABAYEtRNA4"
FT   tRNA            267938..268013
FT                   /locus_tag="ABAYEtRNA4"
FT                   /product="tRNA-Phe"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(268185..268616)
FT                   /locus_tag="ABAYE0256"
FT   CDS_pept        complement(268185..268616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0256"
FT                   /product="putative acyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85237"
FT                   /db_xref="GOA:B0V8S3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85237.1"
FT                   /translation="MFIIRQFTNADLDDVVNLWESCGLTRPWNNPETDIFRKVSQQDDL
FT                   FLVAIKDEQLIGTLMGGYDGHRGWINYLAVHPHQQRLGIATALVQQLEKRLMARGCPKL
FT                   QLLVRKDNLNVLNFYEQLGYDEVEAVCLGKRLISDNPHD"
FT   gene            complement(268747..270261)
FT                   /locus_tag="ABAYE0257"
FT   CDS_pept        complement(268747..270261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0257"
FT                   /product="putative acetyl-CoA hydrolase/transferase"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /function="1.7.1 : unassigned reversible reactions"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85238"
FT                   /db_xref="GOA:B0V8S4"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8S4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85238.1"
FT                   /translation="MSLSRIRLASLHDKVISAEQAAQFIENGMTVGMSGFTRAGEAKAV
FT                   PQALVELAKKNPLKITLITGASLGNDLDKQLTEAGVLSRRMPFQVDNTLRRAINNGEVM
FT                   FIDQHLSETVEQMRNQQLKRPDVAVIEAIAITEDGGIIPTTSVGNSASFAIFAEKVIVE
FT                   INTSLSESFEGLHDIYIPTYRPTRTPIPLTKVDERIGTTAIQIDPSKIVGIVFNDTHDS
FT                   PSTVTPPDDETQGIANHLIAFFEKEVAEGRLPKNLGPLQAGIGSIANAVLTGLKDSNFE
FT                   DLIMYSEVLQDCTFELIDAGKMKFASGSSITLSAKCGEKVFGNIEAYKDKLVLRPQEIS
FT                   NHPELVRRLGIIGINTALEFDIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAIFVTKS
FT                   IAKGGDISSIVPMVSHVDHSEHDVDILVTEQGLADLRGLAPRERARAIIDNCVHPLYRD
FT                   ALNDYFDRACAKGGHTPHLLREALSWHANFEETGQMLQPTPVAKSA"
FT   gene            complement(270453..271910)
FT                   /gene="envZ"
FT                   /locus_tag="ABAYE0258"
FT   CDS_pept        complement(270453..271910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="ABAYE0258"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with OmpR"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /function="3.1.3.2 : covalent modification, demodification,
FT                   maturation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85239"
FT                   /db_xref="GOA:B0V8Q4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85239.1"
FT                   /translation="MSLEPIPPQTFTDYVAYSERKRTRWERFLDKIKPRSAAMRTTILV
FT                   LLVVLFSLFMSLWFFWRTLYLPEIQQHARYLAVELELVNNPNIRIFHRDSEVDVDTWLR
FT                   NRVGIEYVTNPKEYPSVRDKIIAEFFTNQVEQKLANEIGAKDVTVYFQFKPSPRIWIQT
FT                   PEMHGNWVREPLKTYANYSPELLVGWVVGVPLVSAIIILILVRQMNRPLRRLQNAANEY
FT                   SKSGTAPYLDTNHGPLEIRQVNQAFNRMVYTLEQTERERRIMLAGISHDLRTPLTRIRL
FT                   TAEMLPDEFLREGLVYDVDDMDAILNQFISYMRDGSDEELKDTNINILLQELVVQFKPL
FT                   DIRFNMQDVPIIPARSLSLKRLIANLINNAKRYGAEPIELSAKVENEHILITVADHGEG
FT                   IPEDQIEELMQPFVRGNSARTIQGSGLGLAIVKRIVDIHQGEIQIHNREQGGLEVIISL
FT                   PIPKPAPEENTTHNPLEKIKQTLSERF"
FT   gene            complement(271928..272692)
FT                   /gene="ompR"
FT                   /locus_tag="ABAYE0259"
FT   CDS_pept        complement(271928..272692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="ABAYE0259"
FT                   /product="two-component response regulator"
FT                   /function="1.8.1 : phosphorous metabolism"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.2.2 : activator"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85240"
FT                   /db_xref="GOA:B0V8Q5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85240.1"
FT                   /translation="MSLVVPAEHPETVHNETDRVERILVVDDDVRLRTLLQRFLEDKGF
FT                   VVKTAHDASQMDRLLQRELFSLIVLDFMLPVEDGLSICRRLRQSNIDTPIIMLTARGSD
FT                   SDRIAGLEAGADDYLPKPFNPNELLARIRAVLRRQVREVPGAPSQQVEVVSFGPWSLDL
FT                   STRTLTREGQIVTLTTGEFAVLKALVQHPREPLTRDKLMNLARGREWGAMERSIDVQVS
FT                   RLRRLIEDNPARARYIQTVWGVGYVFVPDGAE"
FT   gene            273312..275696
FT                   /locus_tag="ABAYE0261"
FT   CDS_pept        273312..275696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85241"
FT                   /db_xref="GOA:B0V8Q6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85241.1"
FT                   /translation="MLLNFILVGSNTMTDLVQQLASELAVRPNQVEAAIRLIDEGASVP
FT                   FIARYRKEVTQGLDDTQLRQLDTRLAYLRDLYERREKVIQSLQEQNKLNDDLLARVNAA
FT                   ETKNALEEIYAPYRPKRTSKSFKAKEAGLGPIAEKIISEQIDPTEALAGFSHEDYPDVE
FT                   SQLDAIQHILIDDWAQNIPLTTELKATFAKTAVLKSTVASEEKKEVGKKFRDYFEFSEG
FT                   VNKLPSHRLLAMLRGRQENVLGLKVDGEDDAPLARIETEYNLDQVQPQTRQDFLKQTAK
FT                   LFWLGKVRPQIEHSLLTEKRLAAEAEAMQVFAENLRHLLLSAPAGSRTTLGVDPGIRTG
FT                   VKLAVVSEAGDVLAHSTIYPFAPKEDKEGSIAELARLCREYNVELIAIGNGTASRETEA
FT                   VVAEMMAANTDLKLTRVTVSEAGASVYSASELAAAELPELDVSIRGAVSIARRLQDPLA
FT                   ELVKIDPKSIGVGQYQHDVNQTGLAKTLDAVVEDCVNAVGVDVNTASPAILAYIAGLNK
FT                   AIAQQIVEYRKEHGRFDTRQALKNVPRLGERTFEQAAGFLRIQNGSEPLDASAVHPESY
FT                   GLVEKIVAAKATTVKDIIGNTEIIRQVKAEEFVDDKFGLPTIQDVLAELEKPGRDPRPE
FT                   FRTAKFREDITEVAQLTEGMQLEGVVTNVTNFGAFVDIGVHQDGLVHISELANEFVSDP
FT                   HKVVKPGQIVQVRVMQVDVERNRVNLSMRAEGAAPVKAQRPPRREQNNEQRSERKPQGK
FT                   RPQPRKDQVERPQRSKQEKPQEQKIGGFGALLLQAGIKGSK"
FT   gene            275986..278187
FT                   /locus_tag="ABAYE0262"
FT   CDS_pept        275986..278187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0262"
FT                   /product="putative sulfate permease"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85242"
FT                   /db_xref="GOA:B0V8Q7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85242.1"
FT                   /translation="MVVFMPALELKNRFHVNDLLSGVVVFLVALPLCLGIALASGAPII
FT                   SGIIAGIVGGIIVGLLSGSHISVSGPAAGLTAVILVQLDQLGGNYAAFLLCIVFAGILQ
FT                   ILFGVFKLGFFANFIPNNVILGLLAAIGAILIVTQLPYLFGLTDFSWKEVWTATPDTFI
FT                   QKFDAGAALIGLLSLFLILAWDSSPLKKLALPSALIAVVLAAVFNFVLISIGSSWAVQS
FT                   NNLIQLPNILQAPEEVLVFPDFSYLAEPLIYTGAITLAIVASLETLLNLEAADKLDPQK
FT                   RSSPPNRELWAQGAGNIVSGLIGGMPVTSVIVRSSVNANTGARSKCSTIIHGVLLLLAI
FT                   LFFVPLMNMIPLSALAAILIVTGFKLTHPKLFKQLYQKGWRQFLPFIITLVAILLTDLL
FT                   TGILVGLFTSSAFILYGNFNKGVRVYKEKHLHGIVTRIELPSQVTFLNRSALISALEHI
FT                   HKDQQLIIDATQCDSIDPDIYQVIQDYQNETAVKRQVDLKLIGFKQHYEEVDDAVLDIY
FT                   ISTRDLQRKLSPQQVITLLKEGNERFVKNERLQRDIYRQIRVTADEGQHPIAAVLGCMD
FT                   SRAPTEMIFDVGIGDLFSLRIAGNIAGQKVLGSLEFACQAKGSKVILVLGHTDCGAVTS
FT                   ACQLRLQQKQISDVKEMPHIQYVLGPLMHSVESVYDIMQPRELNKTFVNQVTAMNVHYN
FT                   IQYIINNSTVLKDLLDRGEIAIVGAIYDVKTGHVEFLDA"
FT   gene            complement(278255..279145)
FT                   /gene="acr1"
FT                   /locus_tag="ABAYE0263"
FT   CDS_pept        complement(278255..279145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acr1"
FT                   /locus_tag="ABAYE0263"
FT                   /product="fatty acyl-CoA reductase (hexadecanal
FT                   dehydrogenase,acylating)"
FT                   /function="1.1.2 : fatty acids"
FT                   /function="1.8 : metabolism of other compounds"
FT                   /EC_number="1.2.1.42"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85243"
FT                   /db_xref="GOA:B0V8Q8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85243.1"
FT                   /translation="MNKKLEALFQEKVQGKVILVTGASSGIGLTISNKLADAGAHVLLV
FT                   ARTQETLEEVKADIESRGGQASIFPCDLNDMEMIDQVSKEILASVDHIDILINNAGRSI
FT                   RRAVHESYDRFHDFERTMQLNYFGAVRLVLNILPHMIQRKDGQIINISSIGVLANATRF
FT                   SAYVASKAALDAFSRCLSAEVHAHKIAITSIYMPLVRTPMIAPTKIYKYVPTLSPEQAA
FT                   DLIAYAIVKRPKRIATNLGRLASMTYSVAPGINNMFMSIGFRLFPSSDAAKGKKAEKLN
FT                   WVQKAYARIFPGEHW"
FT   gene            complement(279419..280696)
FT                   /gene="metY"
FT                   /locus_tag="ABAYE0264"
FT   CDS_pept        complement(279419..280696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="ABAYE0264"
FT                   /product="homocysteine synthase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.9 : methionine"
FT                   /EC_number="2.5.1.49"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85244"
FT                   /db_xref="GOA:B0V8Q9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85244.1"
FT                   /translation="MTYKDETLAIHAGYTPEATTKAVAVPIYQTTSYAFDNTQHGADLF
FT                   DLKVQGNIYTRIMNPTTAVLEQRLAALEGGIGALALASGMAAITYAIQTITEAGDNIAS
FT                   VSTLYGGTYNLFAHTLPKQGIEVRFFDYQKPKSLRNLIDDKTKLVFVESIGNPLGNIID
FT                   LEEISKIAHEYGVPVVVDNTVATPALLKPFQYGADIVIHSLTKYIGGHGNSIGGAIIDS
FT                   GKFPWGKYPERFKVLNTPDPSYHGVNYVEALGEAAYIARARVVPLRNTGAAISPLSVFL
FT                   ILQGLETLNLRMERHTENAQRIAEYLQNHPKVKWVNYAGLKDHPQHQLAQKYVKGKPSA
FT                   ILSFGVQDGREGGTRFIDALQLFTRLVNIGDAKSLACYPATTTHRQLNEQELKAAGVSE
FT                   DMVRLSIGIEHVDDLIADLEQALSSV"
FT   gene            280994..282655
FT                   /locus_tag="ABAYE0265"
FT   CDS_pept        280994..282655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0265"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /function="4 : transport"
FT                   /function="4.3.A.1 : The ATP-binding Cassette (ABC)
FT                   Superfamily + ABC-type Uptake Permeases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85245"
FT                   /db_xref="GOA:B0V8R0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85245.1"
FT                   /translation="MAQYIYTMNRVSKMVPPKREILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDKDFSGEARAQPGIKIGYLEQEPPLDPTKDVRGNVEDGVREALDALERL
FT                   DQVFAEYADPDADFDALAKEQEKLESIIHAWDAHNLNNQLEIAADALNLPAWDADVTKL
FT                   SGGERRRVALCRLLLSKPDMLLLDEPTNHLDAESVSWLERFLKDFPGTIVAITHDRYFL
FT                   DNVAEWILELDRGHGIPYQGNYTSWLEQKNARLEQEQKQEESFAKALKKELEWVRQNAK
FT                   GQQKKNKARMERFEELNSREFQQRNETSEIYIPPGPRLGNKVVEVENISKSFGDRLLYE
FT                   NLSFTVPPAAIVGIVGPNGAGKTTLFRMMTGEQKPDTGTVTLGDSVKVAYVGQIRDTLD
FT                   DNKTVWEEVSGGLDILKVGDYEIASRAYIGRFNFKGQDQQKRVGELSGGERNRLQLAKI
FT                   LQQGANVILLDEPSNDLDVETLRALEDAILVFPGTVMVVSHDRWFLDRIATHILSFEDE
FT                   QPEFYTGNYTEFEAYRRAKLGDDAQPHRKKYKKISG"
FT   gene            282834..283427
FT                   /locus_tag="ABAYE0266"
FT   CDS_pept        282834..283427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0266"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85246"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85246.1"
FT                   /translation="MKKIKLYTIALGVAVATQLTGCLSVKSYVDPAYKSVTYSDIKRPV
FT                   QPIPVVLTTEFQRNGTVIPKASKELQSAVERSLRATGIFSPTAQPNGGTQAKLYVTANN
FT                   VADLGEAAGKGVLTGLTFGAVGNAIADKYEFKFNYVDVQGKQISQRYPHMILTTVGNKK
FT                   APIENVQPMSINEAFNKVVDDVVIRFSSDLQKQQ"
FT   gene            complement(283527..284225)
FT                   /locus_tag="ABAYE0267"
FT   CDS_pept        complement(283527..284225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0267"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85247"
FT                   /db_xref="GOA:B0V8R2"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85247.1"
FT                   /translation="MFMYKTLTTCLLVTCLGLSGCATSILSTALPNETTEVQTTILKTD
FT                   QIIALGQAVKNQQEQGVVFIGQDFNYLMTEGSSEFLNIIKNIPVNQRTLIIPSPLLLEM
FT                   DDPTHFHGELKFQYNIPTSKLSDQQKENLKNLGFKNHFMVMENQTQLLYPYAIIRFKGQ
FT                   IYQTSPTLKVQQTIPTPYPIALQQKDEITKKHPFKRVTRMALYPLAMAFDIVTVAPSLI
FT                   LSDLRGDFTK"
FT   gene            284332..284766
FT                   /locus_tag="ABAYE0268"
FT   CDS_pept        284332..284766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0268"
FT                   /product="putative Component of the czc cation-efflux
FT                   system (CzcI)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10198000"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85248"
FT                   /db_xref="GOA:B0V8R3"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85248.1"
FT                   /translation="MLRAISNSHGVLLPRSAIFMSVLFCLLIFQSLWNIAAAFCAHENQ
FT                   EKALHHFGHHAALNVYQTSSHTHVEHTETLDAAHKAPLNLQDHHDHLPTCFHVVMTEVA
FT                   KQAQTPVLHVHELSQIYHWSNSYQSPHLNALKPPPVLTPL"
FT   gene            284821..286236
FT                   /gene="czcC"
FT                   /locus_tag="ABAYE0269"
FT   CDS_pept        284821..286236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="ABAYE0269"
FT                   /product="Cation efflux system protein"
FT                   /function="4.2.A.4 : The Cation Diffusion Facilitator (CDF)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7766206, 10198000; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85249"
FT                   /db_xref="GOA:B0V8R4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8R4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85249.1"
FT                   /translation="MSSIFLNRVSHPDLLSCNVKITLKKVVTISSLSIVMLLAGQMANA
FT                   ATDFQQGSYTQKAAFSFEQALARAQSYQIQQGVWQAQQQMAEAQLKQSRLWANPSLSIE
FT                   QTGLQSDQEKELAIGISQPLDIFGQRKAAQHLAKVEMSKVDLAEQRYKAELELIVKYFW
FT                   SQVALLELEKSLIGEQLAVSQENLSASEKRYQAGSIAQVDVDRVRMSHLENQRLYQQVD
FT                   LKLQVAKQQLANLWGGDSNQFQLSQSSNQLWVLAADVESGQDRQNNLLERSFQLDALAQ
FT                   QATIQQLKAKARPQPTVTLGVNNTRSPEQRTENQIRLGVEIPLNLFNRQQYGIKIAQAK
FT                   QELSQRQQSFYRQQNQADIETLMSELKGLHIQFKQLNDQQVPLAVQVQQKTLQGFRLGK
FT                   FAVTDVQQATMQLQDVRLRKVELLKQAWQNSIEIQSLRLGLEPEQIMAKDALMQLNQRA
FT                   WQQAQTFPTQAGE"
FT   gene            286194..287456
FT                   /gene="czcB"
FT                   /locus_tag="ABAYE0270"
FT   CDS_pept        286194..287456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="ABAYE0270"
FT                   /product="RND divalent metal cation efflux membrane fusion
FT                   protein"
FT                   /function="4 : transport"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /function="4.8.A.1 : The Membrane Fusion Protein (MFP)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85250"
FT                   /db_xref="GOA:B0V8P6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8P6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85250.1"
FT                   /translation="MATSSNFSNSGRRIIMSANLKKNSQWLWVGVIAAITAILIGLLVL
FT                   NSKNKSNSSEPSEGHGHAEEEGEEHHDEGEKPLLLTAQQMQEQNLKIEQAELGEVPQLQ
FT                   TYPAKLVVNTDRQAHVSPSFSGRVEAVYVELGQQVKKGQALASLLVPDLVDQQANLQIA
FT                   QSNLELARQDYERERSLWSQGISAKQDYQRAYNAYQQAQIQVKASRSRLSAFGAGSGSA
FT                   GRYTLTAPIAGIVSNKDIVVGENVQLADQLFIINQLDQLWLEFILPSNANINVQPNQQI
FT                   EFKSLQTGNTFSAQVQSLITEADAQTGRLQVRAKVLANSSELRPNLMVNVELNAGSTQK
FT                   VTRVKAQAVQQVEGKDVIFTPKIVKTGFEFEPVTVQLGQRSKDGQWVEVVKGINPSQRY
FT                   IAEGSFLLKSELEKGEAEHGH"
FT   gene            287446..290604
FT                   /gene="czcA"
FT                   /locus_tag="ABAYE0271"
FT   CDS_pept        287446..290604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="ABAYE0271"
FT                   /product="RND divalent metal cation efflux transporter"
FT                   /function="4 : transport"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85251"
FT                   /db_xref="GOA:B0V8P7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8P7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85251.1"
FT                   /translation="MDINKPELPKPEGLFDRVIQFAIQNAIWVMLFVLAWIGVGIWSYQ
FT                   KLPIDAVPDITNTQVQINTQANGYTALEVEQRITYPIENAMAGIPNLEQTRSISRYGLS
FT                   QVTIIFKDGTDIYWARQLINQRLQEADGQLPESVDPIMSPVSTGLGEIYQWVVKAKSGA
FT                   KKADGTAYTAMDLREIQDWIVRPQLQRVKGVAEINSIGGYNKTYIVSPDLKRLQQLQIS
FT                   INEFQTALQENNENRGAGFIEENGEQLTVRVPGMLSSVEDIQNITVSTKNGLPIRVADV
FT                   ANVSIGHDLRTGAATYNGEETVLGIAMMMMGENSRTVAQAVDTKIKEIQSTLPKGVEIE
FT                   TVYDRTSLVNKAIATVQKNLVEGAILVIVILFIFLGNFRAALITACVIPLSMLFTLTGM
FT                   AEQNISANLMSLGALDFGIIVDGAVVIVENCIRRLAEAQHALHRPLTRSERFKEVFLAA
FT                   KQARRPLIFGQMIILVVYLPIFALSGVEAKMFHPMAMTVVMALLGAMILSVTFVPAAVA
FT                   LFVTGEVKEKETRWMQLLKQKYQNILDQAYQLKIVVVSFALSILVLTGVLATQMGSEFA
FT                   PQLSEGDFALQQMRSPSTGLEQSLRMQENTEKLILKNFPEVKAVFARTGTAEVATDVMP
FT                   PNISDAVILLKPHDQWPNPKETLSELRSRMEAFLATLPGNNSEFSQPIELRFNELISGI
FT                   RSDIGVKIFGDDMQVLNEQAQALAQKVQKISGATAVKVEQTSGLPVLSVEINRPLAAQY
FT                   GLSAKAIQDIVAASVGGQNVGQILQGDRRFDFEIRLEDQQRTIQNLAQLPIQLPNGGLI
FT                   QLQDVAKVERTSGLNQVGRENGKRRVIITANVEGRDLGSFVQELRATLAKEQLPAGYWL
FT                   EYGGQFENLASAAARMKIVVPLALAMIFILLMAVFHNVKESLLVFSGVPFALSGGLIAL
FT                   WLRDIPLSMSAGVGFIALSGVAVLNGLVMLSFIKELREKFDIQTATWNGAILRLRPVLM
FT                   TACVASLGFIPMALATGTGAEVQRPLATVVIGGIISSTILTLVLLPVIYRWMNEDKTKS
FT                   VEHS"
FT   gene            290737..291693
FT                   /gene="czcD"
FT                   /locus_tag="ABAYE0272"
FT   CDS_pept        290737..291693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="ABAYE0272"
FT                   /product="cation efflux system protein"
FT                   /function="4 : transport"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /function="4.2.A.4 : The Cation Diffusion Facilitator (CDF)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85252"
FT                   /db_xref="GOA:B0V8P8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8P8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85252.1"
FT                   /translation="MGGHHGHDHSHAVVTEGNAKKLTIALALTTTFLIVEVIAGLITQS
FT                   LALLSDAAHMFTDAAALAIALVAIQISKRPADNKRTFGYQRFEILAALFNALMLFVVAI
FT                   YILYEAYIRFSQPPEIQSVGMLIVATIGLVINLISMKILMSSANNSLNVKGAYLEVLSD
FT                   ALGSVGVIIGAIIIYFTNWYWIDTLIAVLIGFWVLPRTWVLLKQSINILLEGVPEEVDI
FT                   EKLRADLLSLNGVESIHQLKVWAITSKNIHLTVHLFAPEADRNKLYQDAVEMLSHEHGI
FT                   GEVTLQIEDDAEINCQHIAQHASHEHNDNDKTHSHQH"
FT   gene            complement(291712..292050)
FT                   /locus_tag="ABAYE0273"
FT   CDS_pept        complement(291712..292050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85253"
FT                   /db_xref="GOA:B0V8P9"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8P9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85253.1"
FT                   /translation="MQYRCPQCQSVKIMPVSQGVNSAKPVVPKSLVILVPAIFVLLLLV
FT                   VISIFMWIFGNGAGSSLQIATVVAFVVTVGAGFMFWRDLPDFKLSMQAFMQSQKHWKCR
FT                   DCNHEWEI"
FT   gene            292324..293271
FT                   /locus_tag="ABAYE0274"
FT   CDS_pept        292324..293271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85254"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85254.1"
FT                   /translation="MGQEDDNKSKPTTTSTVSGNPDPIKLSFSRRLLHKTLQHAQDAVG
FT                   FASDTTRNLAEVADAALDALDQVTSHTKRGVVGMTNLAAGTVRDMVSETSETARQVALI
FT                   MARTFLGKSTLNLYLPEMLLNSQIRKRIDRSEIDDIKVQCGNDRFQVEIDGHYHRFLYR
FT                   LSLDFRVLECRIGQEKFLRLRQMDESLDVQIRHGGTLSNWAVRRIGRVGFEVINMLPIP
FT                   SLINHLIRDIPGIQRDGHRMWFIDLEQAGFIDFINNRSWMVEKLLNLTDFSILPGLNIL
FT                   RESRELVQQLVDQFEIKGLRVQSGRLEVQVGIAN"
FT   gene            complement(293364..293439)
FT                   /locus_tag="ABAYEtRNA70"
FT   tRNA            complement(293364..293439)
FT                   /locus_tag="ABAYEtRNA70"
FT                   /product="tRNA-Glu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(293468..293543)
FT                   /locus_tag="ABAYEtRNA69"
FT   tRNA            complement(293468..293543)
FT                   /locus_tag="ABAYEtRNA69"
FT                   /product="tRNA-Glu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(293678..294637)
FT                   /locus_tag="ABAYE0275"
FT   CDS_pept        complement(293678..294637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85255"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85255.1"
FT                   /translation="MLRDWLYIIYRCRFKFILKNNSLYTMKIIFIHGMNQQNYTAHRLK
FT                   EHWLKVFKLGLKQLHCRVNLRDLHIHMPFYGDLMTKYQLSNQLDLNTLLPKTFNFHLPI
FT                   HLHHQPSTPKEHTPFIPHLPLSPDQPAQSLSERLYLTSQLVKDRVLKEMVVLLNNFPKL
FT                   HESLIQQFLIETYMYLSNPDFMYEVHQRILKQMHDDEDCIVVAHSLGSVIAYHLLSDPS
FT                   YQFSVQRFITLASPLSFRVIQSKLPTPIERPKCLKGDWYNFYSKDDFLTAFPLSEAPFN
FT                   FTPPIINQEIFTFANQPHEIVGYLQHHAVVKTIIEPFQ"
FT   gene            complement(294681..296108)
FT                   /locus_tag="ABAYE0276"
FT   CDS_pept        complement(294681..296108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0276"
FT                   /product="putative APC family, S-methylmethionine
FT                   transporter (MmuP)"
FT                   /function="1.5.1.9 : methionine"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85256"
FT                   /db_xref="GOA:B0V8Q2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8Q2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85256.1"
FT                   /translation="MCNMQPSDKQLDAQHQNSTAPLKRAMSTRHLVMLSLGGAIGTGLF
FT                   LGSGEVISQTGPIGAIIAYILGGAIAYMVMLCLGELAVHMPVSGSFGAYARKYISPSTG
FT                   YMISWMYWLTWTATLGTEFTAAALLMQEWFPQISMWIWTLIFAVTIFGLNISSTRVFAE
FT                   SEFWLALVKVITVIAFIVLGLLAIFGLIPFHGAQTAPLFSNLTAQGWFPHGFLPIFTTM
FT                   LIVNFAFSGTELIGVAAGETKDPAQNVPKAINAAIWRLLIFFVGTIIVISALLPFQLAG
FT                   LGGDNVSNSPFVTVFNYIGIPYADDIIRFVIITALLSAANSGLYAASRMMWSLSEQKLL
FT                   PGVFATLSKSGTPIVALVVTMFGAIPGLLSEQFAPETIFKNLLGVAAFTMVIVWMSICL
FT                   SQFNFRRQWYRSGHTVSDLKYAAPLFPIVPILGFLFCFITCLSMAADPEMRAGFIGCLI
FT                   FTALCYLSYFIFYRNKA"
FT   gene            complement(296230..296305)
FT                   /locus_tag="ABAYEtRNA68"
FT   tRNA            complement(296230..296305)
FT                   /locus_tag="ABAYEtRNA68"
FT                   /product="tRNA-Glu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(296331..296406)
FT                   /locus_tag="ABAYEtRNA67"
FT   tRNA            complement(296331..296406)
FT                   /locus_tag="ABAYEtRNA67"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(296464..297972)
FT                   /gene="gltX"
FT                   /locus_tag="ABAYE0277"
FT   CDS_pept        complement(296464..297972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="ABAYE0277"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.17"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85257"
FT                   /db_xref="GOA:B0V8Q3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8Q3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85257.1"
FT                   /translation="MKVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTD
FT                   QLRSTPESEKMILDSLRWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAF
FT                   YCFATAEELDQMRAEQQARGETPKYDGRGLKLSQEEVARRLEAGEPHVIRMKVPEEGVC
FT                   KFNDLLRGEVEIPWAQVDMQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPK
FT                   HQLLYQYFGWEMPTLCHMPLLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMG
FT                   WSMPDEREVFTLQDMMDNFDIQRVSLGGPIFDVEKLNWLNGQWIKGLTPGQLLDRLLTW
FT                   KSDRSTLEDIAAAIQPRINLLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQF
FT                   AIWRLESQFTWNNDTVSQTLMDLANQMGIKLRDFMPTFFIAIAGSTSSTPVMQSMVTLG
FT                   PDLTFARLRHALEIVGAPSKKEVKNWEKLNESLKLPKNEATSEA"
FT   gene            complement(298089..298388)
FT                   /locus_tag="ABAYE0278"
FT   CDS_pept        complement(298089..298388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0278"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85258"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85258.1"
FT                   /translation="MKIHYGKALSLGLVLSFASQLSTAAVLKDTPSKSLSDKQSSLIEK
FT                   ALDQQKRNTIVLPSTDDELKVLNTIRVTPTQNFLAAQHERFSRFVQAIFQPHTS"
FT   gene            298785..299786
FT                   /gene="sbp"
FT                   /locus_tag="ABAYE0279"
FT   CDS_pept        298785..299786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="ABAYE0279"
FT                   /product="sulfate transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /function="4.3.A.1.p : ABC superfamily, periplasmic binding
FT                   component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85259"
FT                   /db_xref="GOA:B0V8N6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85259.1"
FT                   /translation="MKRIAIIAVATYMGLAVSAVQAATTFLNVSYDPTREFYQEYNQAF
FT                   GKFWKQRTGQDVDFKQSHGGSGKQARAVATGLEADVVTLALANDIDEIVKAGFIQPNWQ
FT                   KEFPNNSAPYTSTVVFLVRKGNPKNIRDWNDLTKPGVEIITPNPKTGGAPRWIYLSAWG
FT                   YALKQPGGNDAKAKELVKKLYHNVKVLDSGARGSLTTFAERGIGDVLLSWENEALLATK
FT                   GLDKDKYEIVYPSISILAEPSVAIVDKTVDKDGNRTLAKGYLNFLYSPLGQELAAKHYF
FT                   RPRNPQVAAKYAAQFPKIKLFTINDVFGGWAKAQKTHFANGAIFDQIYDVKQ"
FT   gene            300009..300932
FT                   /gene="mraW"
FT                   /locus_tag="ABAYE0280"
FT   CDS_pept        300009..300932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ABAYE0280"
FT                   /product="S-adenosylmethionine methyltransferase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /function="3.1.1.2 : methylation"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85260"
FT                   /db_xref="GOA:B0V8N7"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8N7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85260.1"
FT                   /translation="MSHISVLLFETVESLLADRTTGVYIDATFGRGGHTRLLLSKLDEN
FT                   ARVYAFDKDPQALEVAAALAQEDPRFTIIHASFADIKEKMQEIGVQSVDGIMADLGVSS
FT                   PQLDQAERGFSFMQDGPLDMRMDNSKGLTAAEWLLEVEEEDLANIIYQYGEERYSRRIA
FT                   RAIKQAGKLDTTAQLAEIVKTAHPKWEKHKHPATRTFQAIRIAINKELDDIEVFLPQAV
FT                   DLLKPKGRLSVISFHSLEDRLIKQFIQKESTLAEDSGWGMPQQQVDTRRLKKISRVRAS
FT                   EEEVKANPRSRSAWLRVAERLEQKGA"
FT   gene            300932..301264
FT                   /gene="ftsL"
FT                   /locus_tag="ABAYE0281"
FT   CDS_pept        300932..301264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ABAYE0281"
FT                   /product="cell division protein (in growth at septum)"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /function="5.1 : cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85261"
FT                   /db_xref="GOA:B0V8N8"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85261.1"
FT                   /translation="MKSSDEIETTENKVVKKVVVYAVMVALVFISAMMVVFQVFEYRHD
FT                   YRELSSYMRERDDLNAEWGRLLIEQQTFGATAQIGTRAVTQLRMFSPPAAETVVISLPM
FT                   TSEQNK"
FT   gene            301276..303108
FT                   /gene="ftsI"
FT                   /locus_tag="ABAYE0282"
FT   CDS_pept        301276..303108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ABAYE0282"
FT                   /product="septum formation, penicillin binding protein 3,
FT                   peptidoglycan synthetase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /function="5.1 : cell division"
FT                   /EC_number="2.4.1.129"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85262"
FT                   /db_xref="GOA:B0V8N9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85262.1"
FT                   /translation="MVDKRTKQTRKKQQSISEKPSLAFDMWRFYLLWAVVLLCFVVLIA
FT                   RAFYVQVINKDFLQNKANANILRTERIEAMRGVISDRHGVPLAISSPIMKIVIDPRDYF
FT                   ETKHLYDQITAELKQDPNNRKLKRQLPDKNLNLDELADVVGVDRADLKKQMNARPRSRY
FT                   LVLKKEVPPQQADLIMKGNFQGVYAEKTYKRYYPQPQPNAQIIGLTNSEGQGIEGLEMQ
FT                   LNKQLSGVDGEQKIIRDKRGNRLKVSEVIREGEPGENITLSIDSRLQYIMYRELTAAGV
FT                   ANNARSATAIAVDVKTGEILAMTSWPSYNPNDKNGLSNKDAMRNRGAIDMFEPGSTMKP
FT                   FTISAALETGQYTPNTIVNTSPGSMRLGWHTIRDTHNYGALTVSGVIIKSSNVGSAKIA
FT                   LSLPKETLPSFFNRVGFGKRSAVRFPGESSGLVLPVNKLNSSQIGTMAYGYGLNATILQ
FT                   LAQGYAMLANHGVKMPLSLHKLDQPPKGEQVLNPKIADQVLLMLEQVTMPGGTAKQANI
FT                   PGYRVGGKTGTAHKLRADGKGYSNNEYRALFAGVAPISDPRLAVIVVVENPQGRYYGGL
FT                   VAAPVFARIMQESLRLMNVPLDKPLNTPENPIRR"
FT   gene            303112..304611
FT                   /gene="murE"
FT                   /locus_tag="ABAYE0283"
FT   CDS_pept        303112..304611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ABAYE0283"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate-2,
FT                   6-diaminopimelate ligase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /EC_number="6.3.2.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85263"
FT                   /db_xref="GOA:A0A0R4J6I7"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6I7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85263.1"
FT                   /translation="MTVSFQEIHPIEIDAQWPQQPFHGFSLDSRKVETGQIFIALTSYS
FT                   QPEKTRTFAEAALANGALAVISETELGVANEWVCSDVRQRMGDWQKRYLQQADVVKPLR
FT                   IIAVTGTNGKTTISRLIAELISSQQQRCAVMGTTGNGILPNLTPSTHTTLDALQLQNAL
FT                   HDYAKQGATFASLEASSHGLEQGRLNGCDIEIAVYSNLSRDHLDYHGTLEAYAEAKARL
FT                   FQFNSLKVAVINLDDAHADLMIKSAQNNPAQPKILTYSLTQNTADYYITDLSYSLAGAT
FT                   FNLVSQQGSFAVESPLLGHFNVENLIAALIAAEQAGFDLQALVNFVPKLIGAPGRMQVI
FT                   RDDERLFVVDYAHTPDALIQVLKTLKRHVSNQLWAVFGCGGDRDRGKRPLMTQAALDGA
FT                   NPVILTSDNPRTEDPEQIFADMKQGINFSGHRMHEIHDRREAIKFVAEQAQAGDIVVIA
FT                   GKGHENYQEINGVRHWFDDVVEVRSAIDAQHHTVDAAYPAQ"
FT   gene            304620..306020
FT                   /gene="murF"
FT                   /locus_tag="ABAYE0284"
FT   CDS_pept        304620..306020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ABAYE0284"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase (UDP-MurNAc-pentapeptide synthetase)
FT                   (D-alanyl-D-alanine-adding enzyme)"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /EC_number="6.3.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85264"
FT                   /db_xref="GOA:A0A0R4J6Z4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6Z4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85264.1"
FT                   /translation="MHTSTTSTVPLEPWTAQQLQQATQGYWHKDQIPQTEIKRILTDSR
FT                   HAESGDAFLALKGERFDAHNFVAQVVANGCQVAIVERPIDAEIAQLVVADTRLALGQLG
FT                   AYRREQNAQLKVIALTGSSGKTTTKEMLGSILSRLAPTLITRGNLNNDLGVPMMLLELR
FT                   KEHQYAVMELGANHQGEIDYTSKIVQPHVAGILNIGTAHLGEFGGRDGICRAKSEIYRH
FT                   ILPQGVAIVPQQDDFTAEIREAAKSHQIMSFGAGGDVFATEIELLPQSANFQLHTPQGS
FT                   SFVRLPFAGEHNVQNATAAVAFALALGVSLEDIVKGLEQAQGAKGRLNFIQKTPHLFID
FT                   DTYNANPTSMRAAAQVLLQQNGIKVMVMGDIGELGDSSWQEHHDLGRDLAELPLDHIVA
FT                   VGQFASAALEGAGLHSTKLKAFQTQAEALPFLINLIQTHQPQSMSFLFKGSRFTHMETL
FT                   MADLMEKL"
FT   gene            306021..307139
FT                   /gene="mraY"
FT                   /locus_tag="ABAYE0285"
FT   CDS_pept        306021..307139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ABAYE0285"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /EC_number="2.7.8.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85265"
FT                   /db_xref="GOA:B0V8P2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8P2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85265.1"
FT                   /translation="MLLWLFEQLAGYHSSFQVVRYLTLRSLLSVLTSLTIGLVLGPIMI
FT                   RKLQALKYGQAVSSFAPENHAKKMGTPTMGGILILLSIGISTLLWADLSNPYVWIVLGV
FT                   MVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSVASLGAGIALYLIATQQSNAEYTAN
FT                   MLDLLIPFFKNLSIPLSIVPLGLAFIVFTYLVINGASNAVNLTDGLDGLAIMPVVMVAT
FT                   GLGVFAYLSGDIRFANYLHIPYVKYTSELVVICSAMIGAGLAFLWYNAHPAQVFMGDVG
FT                   ALALGAMLGTIAVMVRQEIVFAIMGGVFVMEAVSVFLQIGSLRMRNKRVFLMAPLHHHY
FT                   EKQGWKETQVVIRFWIITIMLVVLGLMTLKLR"
FT   gene            307200..307532
FT                   /locus_tag="ABAYE0286"
FT   CDS_pept        307200..307532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85266"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8P3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85266.1"
FT                   /translation="MTKVAGLDQLSVINQKVVGEGEVLPQVVLKDGSQVQTGTVATMLH
FT                   NIELYNAGQRGQIEEELKIAIPTLIKVGLFDLFEVDEWIKGTNAGRTFVGMHAKAYLQQ
FT                   KEQENN"
FT   gene            307535..308359
FT                   /gene="rrm"
FT                   /locus_tag="ABAYE0287"
FT   CDS_pept        307535..308359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrm"
FT                   /locus_tag="ABAYE0287"
FT                   /product="23S ribosomal RNA G745 methyltransferase"
FT                   /function="2.2.6 : rRNA, stable RNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.1.1.51"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85267"
FT                   /db_xref="GOA:B0V8P4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8P4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85267.1"
FT                   /translation="MTTQNLMCPVCRQRLELVSKTWRCEQGHSYDIAKQGYVNLHVVQH
FT                   KHSKNPGDTPESVDARRAFLQGGYYQPLQQAVVHLLKQLKAKTVLDIGCGEGYYTSAMQ
FT                   QVVEQCIGVDIAKNAVQRAAKLNDKVTWVVGTGATLPVIDQSMDVCTSLFSPIPQTEIL
FT                   RVLKDDGYLIVVTPATDHLYAMREALFEQVNPHTPQKFVEQLQDLFELKEQQVIDAPLV
FT                   LDQQALKNLIAMTPYAYKASPERRMQLEQKAHLQVTASFQIYLFQKRNKKAI"
FT   gene            complement(308377..310932)
FT                   /locus_tag="ABAYE0288"
FT   CDS_pept        complement(308377..310932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0288"
FT                   /product="putative penicillin binding protein (PonA)"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85268"
FT                   /db_xref="GOA:B0V8P5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8P5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85268.1"
FT                   /translation="MKKLSSLGFVRPIFLIIIIILVSLPMGFYGMYLYIAPALPEMSSL
FT                   KKAPLLKPLQVYTADNQLIAEYGGKLSIPVEYKQIPPNFIHAFLAAEDSSFFEHSGISF
FT                   KGLGRALSESVTGSDVQTGGSTITMQVAKNYYLSPERTLKRKLTEIFLARKIEQNLSKE
FT                   DILSLYVNKIFLGKNAYGIAAAAKIYYNKSINELSIAQMAMIAGLPKAPSKYNPVVNPE
FT                   RALERRNWILGRMLQLGYISQTEYQKAVAEPINLNMPNRDLNNIHPYAGEMVRSELVKH
FT                   FGEQAIDSGYKVYTTINAKRQAIAEKAVQDGLEAYDRRHGWRGAEAHDKPLSEFRAYAN
FT                   TYPAQVTKVNSSSFEALMQDGSTVTVQWSGMSWARPYRNANSVGAAPSRASQIVKVKDI
FT                   VRLRPNEAKTAWSLVQVPKVQGQLIAINPNDGSIEAIVGGYNFYQSKFNRALQGWRQPG
FT                   STIKPFLYALALERGMTPYSMVNDSPITIGKWTPKNSDGRYLGMIPLRRALYLSRNTVS
FT                   VRLLQTVGIERTRQLFMDFGLQEDQIPRNYTIALGTPQVLPIQMATGYATFANGGYRVQ
FT                   PHFIQRIEDAYGKVIYEAKPEYACIPCINAPETTDDAQVTTPDDQVVEVTNKELEQKEK
FT                   TTKQLNLKQTDKNNSQYRQAQRILKSSSAYDMANILRDVIEHGTGRAALKIGRSDLGGK
FT                   TGTTNDAKDAWFAGFNGKLVTVTWVGFDQPTTLGRREYGGIAALPIWINFMGQALQGTP
FT                   AAWVRLEKDAQAPISRDKQEVTAEVGDKKTYRAAPPLARPLYRPAPPQPKTTNNDFDDL
FT                   PGEEIVIPSKTTPPAMKPSQGAAPKREKDELENLINQIE"
FT   gene            311130..312152
FT                   /locus_tag="ABAYE0290"
FT   CDS_pept        311130..312152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0290"
FT                   /product="putative membrane protein (ComM)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85269"
FT                   /db_xref="GOA:B0V8M3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8M3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85269.1"
FT                   /translation="MGVDISSTSVKLLELSVKNGKYWVESYALMPLPENSVVEKNILNP
FT                   EAVAEALERAMNLANPQTTHAAIAVPTSTVIHKTIEMDADMSDDEREVQIRVDAEQYIP
FT                   FPLDEVSLDFEVLPDRLANPNRVNVLLVATRTENVETRVEVLELADLNPKLADVESYAV
FT                   ERAFSVFADSLPMGANTIGILDIGHTMTTLSVMQNGKIIYTREQVFGGKQLTLEIQSRY
FT                   GLSLEEASRAKKDRSLPDDYEIEVLDPFLDAVVQQAARSLQFFFSSSQFNEIDHILLAG
FT                   GNANIPGLAKLLQQKLGYRVTIANPFLQMGFSPQVDVQKIENDASSLMVACGLALRSFD
FT                   "
FT   gene            312152..312793
FT                   /locus_tag="ABAYE0291"
FT   CDS_pept        312152..312793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0291"
FT                   /product="putative membrane protein (ComN)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85270"
FT                   /db_xref="GOA:B0V8M4"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8M4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85270.1"
FT                   /translation="MATINLLPWREELREQRKKQFITLCFGVVVLGITTVFGGWFYFDH
FT                   KLDDQEQANQLIMSTNQNLDQQLKTLNGLQEQRDAIIERMKLIQGLQSQRPVVVRLVDE
FT                   LVRVTPSAMYLTKFSRTGDKFTIEGKAESPNTVAELLRNLEASPWYRNAFMNSFLANEE
FT                   KKDKSASSLLPRVEDHYGSFVVTVDLGEMGVTTTDDSAKPSTGESVGVAK"
FT   gene            312790..313530
FT                   /locus_tag="ABAYE0292"
FT   CDS_pept        312790..313530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0292"
FT                   /product="putative membrane protein (ComO)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85271"
FT                   /db_xref="GOA:B0V8M5"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8M5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85271.1"
FT                   /translation="MSQDELQELSLEQLSAKKKKFNLDKFLQQFNTLDMNNYGSWPISV
FT                   KITCWIFIFFAVLALGYFIVIQPKLQAIDNAQAQESNLLNEFREKDSKLRNLQQYQVQL
FT                   QEMQANFNQQLEQLPKETEIPSLVEDINLTGVNSGLKFKNIRLEDEVKQEIFIEQPIAI
FT                   EATGDYHAFGAFVSSIAALPRIVTMHDFTVDVSPAKDNKSDIPVLNYSIKAKTYRYVGA
FT                   TDTSEQTGKAPAASASTNTTVQPK"
FT   gene            313538..314068
FT                   /locus_tag="ABAYE0293"
FT   CDS_pept        313538..314068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0293"
FT                   /product="putative lipoprotein (ComL)"
FT                   /function="1.6.10 : lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85272"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8M6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85272.1"
FT                   /translation="MMKIKQITLCVLASVVLVGCDSRIDAVNQEMANIRNQPPLPIEPA
FT                   PIFTPVPQFNYAAHQLKSPFMPSSLAAELKIMAGKRVYPNFSRAPQPLESYALEALNMK
FT                   GSMRNNRGQILALIQTPDQQIERVQVGNYMGMNQGRITHISPTQIDLVEIVPDGREGYV
FT                   ERPRTLVLIGPAP"
FT   gene            314131..316296
FT                   /locus_tag="ABAYE0294"
FT   CDS_pept        314131..316296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0294"
FT                   /product="putative outer membrane protein (ComQ)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85273"
FT                   /db_xref="GOA:B0V8M7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8M7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85273.1"
FT                   /translation="MNHVFRQFSMGAVAIAIMQAASAQVSMTNIVPMQIAGQGTEIRVM
FT                   FNGLPPQPQAYQLENPSRLILDFDKVQQGLKQSKISVATNEASSVDVTSDDQRSRLTVN
FT                   LKDAGAFTTRVEGNTFILKINSAQTSNKPLPVVSAQPQGVSNIGFQRGSQGEGLVVVDL
FT                   LGSNTPVDVQQQGSKVVIRTIGTKIPTHLARRLNVNDFATPVSSIDAYNDKGVGVITIQ
FT                   SSGSYEYMAYQAENKLTISLKRPQDKNVTSLYKTPNYSGNKLSLDFQDIEVRRVLQLLA
FT                   DFTGINMVAADSVQGNITLRLKDVPWDQALDIILKTKNLDKRRNGNVIWIAPVAELIKA
FT                   EEEEAKAVAQSVKLAPLQTEYIQLKYAKAGDIMGLITQGSNNSNGLQHTSGGGTSTSTN
FT                   LNTGVDSLGNNVGSLLSPRGTITQDDRTNTLIINDTAQSIDQIRKMIDLLDVQVKQVMV
FT                   EARIVRASTSFTKELGVKWGILSQGITNNNNLLVGGSETTLWNLREPKKDETTGGYKYT
FT                   IERPDNLNVDLGVSNPAGSIAFGLISMSDFMLDLELSALQADGYGEVISTPKVMTADKQ
FT                   TAKVATGQQVPYQSTTNSAAGSTATTSFKDALLSLNVTPSITPDGKIQMKLDISKDSVA
FT                   GAAPNGELILNKNNINTNVLVDNGETVILGGVFEQTTMNSQTKVPFFGDIPVVGRLFRK
FT                   DVKSDDKQELLIFVTPRIVNDTLARNH"
FT   gene            316335..316877
FT                   /gene="aroK"
FT                   /locus_tag="ABAYE0295"
FT   CDS_pept        316335..316877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="ABAYE0295"
FT                   /product="shikimate-kinase"
FT                   /function="1.5.1.13 : phenylalanine"
FT                   /function="1.5.1.14 : tyrosine"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /function="1.5.1.20 : chorismate"
FT                   /function="1.5.3.14 : enterochelin (enterobactin)"
FT                   /EC_number="2.7.1.71"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85274"
FT                   /db_xref="GOA:B0V8M8"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8M8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85274.1"
FT                   /translation="MPSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIE
FT                   RKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGI
FT                   VVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAA
FT                   RDLAQKILQLILSNKLK"
FT   gene            316906..317988
FT                   /gene="aroB"
FT                   /locus_tag="ABAYE0296"
FT   CDS_pept        316906..317988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="ABAYE0296"
FT                   /product="3-dehydroquinate synthase"
FT                   /function="1.5.1.13 : phenylalanine"
FT                   /function="1.5.1.14 : tyrosine"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /function="1.5.1.20 : chorismate"
FT                   /function="1.5.3.11 : menaquinone, ubiquinone"
FT                   /function="1.5.3.14 : enterochelin (enterobactin)"
FT                   /EC_number="4.2.3.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85275"
FT                   /db_xref="GOA:B0V8M9"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8M9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85275.1"
FT                   /translation="MQTLHVELGERRYPIFIGSQLDPKQLLEPYIHGQQVMIVSNVTVA
FT                   PLYLSHYQEALESLGKTVATCILPDGEKYKDIQHLNLIFDALLEAGFNRDCTVLALGGG
FT                   VIGDMAGFASACFQRGVYFVQVPTTLLSQVDSSVGGKTGINHPLGKNMLGAFQQPQVVL
FT                   ADMAQLNTLPERELSAGLAEVIKYALLGDEDFLVWLEENMDGLVARDADLLAEAVYRSC
FT                   AHKARIVANDEKEQGERALLNLGHTFGHAIESYLGYGTWLHGEAVATGMVMAADLSQRL
FT                   GWISNEDVARTKKIIQRANLPISCPQIPLDDFLGYMAHDKKVLNGQLRLVLLKQLGQAV
FT                   ITKDFDVELMKQAILANQHG"
FT   gene            318004..318879
FT                   /locus_tag="ABAYE0297"
FT   CDS_pept        318004..318879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85276"
FT                   /db_xref="GOA:B0V8N0"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85276.1"
FT                   /translation="MTVSRTLWQNVQQYIWLVGGIVCLFLAFIFWVITDNKKLVEVEKS
FT                   ADSDAPVQIQPEKVATTPNLGALADEVRPLDLTTRTVASGEHEPEFRGTKFINENKKQW
FT                   TLELFRASDEDIIKNFLKSRTDRNKFIYFRLSGEQQAEQYVLAYGTFKRSEDAVQQLTQ
FT                   INLQLPDSVKPQPQQFSSYAPLVNDLGADEMKGGNNQLYEVRLRPAALPRIDESLLMSV
FT                   PASSTLNTQPKPTSTNSATKTTIVRRDAAGNVVDVQQSNSNIDQPNKPAQTRINENQPK
FT                   NATNEGTRGN"
FT   gene            319334..323815
FT                   /gene="gltB"
FT                   /locus_tag="ABAYE0298"
FT   CDS_pept        319334..323815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ABAYE0298"
FT                   /product="glutamate synthase large chain precursor"
FT                   /function="1.5.1.1 : glutamate"
FT                   /EC_number="1.4.1.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85277"
FT                   /db_xref="GOA:B0V8N1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85277.1"
FT                   /translation="MHMPSPNTVAPAQGLYQPDEFKDNCGFGLIAHMKGESSHHLVETA
FT                   IHSLSCMTHRGGIAADGKTGDGCGLLLAMPKQFFRDEAKKLSDITLSEIFAVGTVFLNI
FT                   DPALAQHSKNILTKEIESEGLRVLAWRIVPTNNDALGEIALQSLPAFEQVIVNCPMGVT
FT                   EVEFNRKLFLARRRAEQQLQNDPLFYVTTLCSTVISYKGLMMPAAIAEFYTDLADERLK
FT                   SHIVVFHQRFSTNTLPRWPLAQPFRYLAHNGEINTITANRNWALARTPKFENPLLPGLT
FT                   ELNPIVNRTGSDSSSLDNMLEILVGGGMDLFRALRMLVPPAWQNVETLDADLRAFYEFN
FT                   SKHMEAWDGPAGLVIQDGRHAICMLDRNGLRPARWVITKNDYITLASEIGVWGYEPEDV
FT                   VSKGRVGPGQILVVDTLTGKVLDTKDVSNHLKNMRPYREWLRDHAIRLNANPELEEQLV
FT                   DKGLTGDALKAAQKMFMVTFEERDQLLRPIAESGQEAVGSMGDDTPMAVLSRQVRHVTD
FT                   YFRQQFAQVTNPPIDPLRESIVMSLETCLGREQNVFEQGPEHADRIIISSPVLSNSKMQ
FT                   QIRSIERAGYEAVDIDLNYAETEGLQAAITRICEESAQAVRDGKTLIVLTDKNIRQGYL
FT                   PANAALATGAVHHHLIKTGLRTDANIMVETGFARDPHQFAVLLGFGATAIYPYLAYDVI
FT                   NDLIAKGELLGDPIHAQANFRKGIEKGLLKVLSKMGISTVASYRGGQLFEAVGLSSEVV
FT                   DQCFLGVPSRIQGATFVDLENDQKKLAVTAWSNRKPIDQGGLLKFVFGKEYHAFNPDVI
FT                   NSLHKAVRSGKYEDFKEYAELVNNRPIATIRDLFKLKTTNPIPVEQVESVEAILPRFDS
FT                   AGMSLGALSPEAHEAIAIAMNTIGGRSNSGEGGEDPARYGTIRNSKIKQIASGRFGVTP
FT                   AYLTSAEVLQIKVAQGAKPGEGGQLPGGKVNGLIARLRYSVPGVTLISPPPHHDIYSIE
FT                   DLSQLIFDLKQVNPKAMVSVKLVSEPGVGTIAAGVAKAYADFITISGYDGGTAASPLSS
FT                   IHHAGSPWELGLSEAHQALRVNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGSTP
FT                   MIALGCKYLRICHLNNCATGVATQQDHLRQEHYIGEPQMLINFFHFIAEETREWLAALG
FT                   VASLKDLIGRVDLLEVLPGETEKHAHLDLSALLTSHPAAEGKAQYCEVEGNAPFDKGVL
FT                   AERMVEEMLPAIESSAGGQFNFNVVNCDRSIGARVSGEIARRYGNLGMEAHPVVMNLTG
FT                   TAGQSLGVWNAGGLHIRLEGDANDYVGKGMAGGRISIFPPKGSPFQTQNTAIIGNTCLY
FT                   GATGGKLFAAGTAGERFAVRNSGAFAVIEGAGDHCCEYMTGGVVTVLGKVGHNFGAGMT
FT                   GGFAYVLDLDNDFVDYYNHELIDLTRISTESMEDHKEFLLRIIDEHIKETGSAWAYKIR
FT                   NEFDFYSRKFWLVKPKAANLQSLLKTTQADPQ"
FT   gene            323885..325306
FT                   /gene="gltD"
FT                   /locus_tag="ABAYE0299"
FT   CDS_pept        323885..325306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ABAYE0299"
FT                   /product="glutamate synthase small chain"
FT                   /function="1.5.1.1 : glutamate"
FT                   /EC_number="1.4.1.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85278"
FT                   /db_xref="GOA:B0V8N2"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85278.1"
FT                   /translation="MAERLNNDFQFLDVPRQDPEKKDITVRKAEFVEIYKPFTSETVTN
FT                   QTHRCLGCGNPYCEWKCPVHNYIPNWLKLIAEGQIFQAAELCHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGNAEKYINDTAFALGWRPDMSHVKWTGKKVAIIGAGPAGLG
FT                   CADILARGGVKPVVFDKRPEIGGLLTFGIPEFKMEKDVMKRRREIFTGMGIEFRLNTEI
FT                   GKDVTIDELLAEYDAVFMGMGTYTYMKGGFPGEDLDGVYDALDFLISNVNRCQGWEKDP
FT                   SEYISMDGKKVIVLGGGDTAMDCNRTSLRQGAHDVTCAYRRDESNMPGSAREVKNAYEE
FT                   GVKFLFNRQPIEIVGENGKVTGVKVVTTQMGEPDSRGRRSPEPIPGSEEVLPADAVLLA
FT                   FGFRPSPADWFGSVNINLDGSGRVVAPEQQEFKFQTSNPKIFAGGDMVRGSDLVVTAIW
FT                   EGRQAAEGILDYLGV"
FT   gene            325473..326369
FT                   /locus_tag="ABAYE0300"
FT   CDS_pept        325473..326369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85279"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85279.1"
FT                   /translation="MLNMNIAGMTAEKSYLNRRKALGITVRRLEFNPQAIKRYYFANSP
FT                   LMSHFLTALSSTFPVGEQFFVNSVRNVRDKVSDPQLQAQIAAFIGQEAMHSKAHGEFNE
FT                   AWRRDDYNLDRFQNWLNERDKYLRTISPKLQLALTCAFEHFTALLGGYILQHPELLKTL
FT                   DQDALKLWVWHAIEEIEHRSVAFDVYQQVYGDDRIRRLLMRSVTTGFASLAFYGTTRLF
FT                   WQDKWKSLPKIGGNLFGLYLLAKMLIQLTPEYFAYYKKDFHPSQKDYGHMVDYWKSYLA
FT                   DEYQMTSFQEEKNPRPS"
FT   gene            326500..327090
FT                   /locus_tag="ABAYE0301"
FT   CDS_pept        326500..327090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0301"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85280"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8N4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85280.1"
FT                   /translation="MKTFKQLAIATTLASTLLFSGCGYNTLQVKDEAVTAAWSEVQNQY
FT                   QRRADLVPNLVNVVKGYAKHEEQVLTEVTQARANVAGLKVDKEVLEDPALLEKYQQAQS
FT                   QLTGALSRLIAVSENYPDLKANTQFQELQVQLEGTENRIAVARNRYITTVQDYNAYVRQ
FT                   FPQAVTAKVIGMHPKANFSAEASAQQAPKVSFD"
FT   gene            327112..328194
FT                   /locus_tag="ABAYE0302"
FT   CDS_pept        327112..328194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0302"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85281"
FT                   /db_xref="GOA:B0V8L4"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85281.1"
FT                   /translation="MRNTILLQSKQIRVFVITLIVLCCGVLFQNAAWSENNIATATDET
FT                   DTVVAGKIIQQQQAQASKPQINSQAASSVTPQTQVANDMADGESIRGLPTLNQPVIDQA
FT                   NVLSETEKQQLSQKILNLYQQGKAQIGIVIVPTTGQEDIFDYALRVGEKWQLGSSKRDN
FT                   GLLIAVAINDHRIQILTGYGLEGVLPDIVASRIIRNQITPYFKQAQYAQGLNAGLDEIG
FT                   RILNLDPEVAQQAAQDLKERQHQAAEEQQAKQTTLTMALFILVAGVVGSFIVGRPLSAS
FT                   TAGVAAAVAGFVNGAGVVMSLLLGFGIFFLLITSIAQLILQAILSGAGGGGRGGGFGGG
FT                   GGGYGGGGGRFGGGGASGSW"
FT   gene            328188..328748
FT                   /locus_tag="ABAYE0303"
FT   CDS_pept        328188..328748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85282"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85282.1"
FT                   /translation="MVTTSETTQIITQPKIEESVEPSLKRWFKHFCYLPASSRYFSKQD
FT                   KQAIAEAVQQAEHGHVGEIQVVIEGHIPCSQAYRQNTRLRAQQLFAELGVWDTELNSGV
FT                   LLYLNLCERTVEIIFDRGIRNATTEQIWQQICKSIVEQLQQKQYQKAVVTGVQQIGEVM
FT                   SRFYDENMPDQLNELGNAPIIIN"
FT   gene            329094..329567
FT                   /locus_tag="ABAYE0304"
FT   CDS_pept        329094..329567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0304"
FT                   /product="putative fimbrial protein precursor (Pilin)"
FT                   /function="6.5 : Pilus"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85283"
FT                   /db_xref="GOA:B0V8L6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85283.1"
FT                   /translation="MNAQKGFTLIELMIVVAIIGILAAIAIPQYQTYIAKSQVSRAVSE
FT                   SGSLKTVIEDCLNNGKTTVGEAAGECAIGATGSNILDGAAQSGETLAAGTGVPQVTLAN
FT                   TGAATIVATFGNSASTALKSTPTTVTWTRTTDGTWTCESTAAEKYNSSACPAA"
FT   gene            329812..331440
FT                   /locus_tag="ABAYE0306"
FT   CDS_pept        329812..331440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0306"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85284"
FT                   /db_xref="GOA:B0V8L7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85284.1"
FT                   /translation="MQVFFLFLAAILLGFAWLSPFHYNPWVMFSSEMSTFAAGLSVLAV
FT                   LFYQNIKIPRAQLLLLPFTLIPVVQWAFGLVFDFSTALLSSLYLLGFWFMVLAGYNLSL
FT                   DQKKRDQIFSGFSLLIIITSLFTSLIAIFQWLNIESHLIYTLHLIGNRPYGNFGQPNNM
FT                   ATFLIIGLLGCLYLYEKHKVTLWLLLPSALIILFTIALSQSRTSWIVFPFLLIYWMVKQ
FT                   FGKQKRFRFVQGLLWCLAFFLIAGLILPYITQFIEFSTNTEITETSSFVARAGSGHERI
FT                   GMWIQILHAIAQQPWLGYGWSQTSVAVVDSIQYGTVHVWFNSAHNVLLDIIIWNGIPIG
FT                   IVIIAYFACWFVWLNQQAKETISIIAIMMVCTVLIHAMLEFPQRYAYFLLTCGFLLGII
FT                   QAQTPVLKGIVLNKQVLRLIWGISVILLVAIWRDYNVYVTNSNLLFKNKQPNAEILGSN
FT                   QIFILTQFEQRLKWIEMKPETTLSDADLAVWGNFVKNKATPYNLRKYAQLLAYNGKVEQ
FT                   AEQQIFILQHLYRQQITLAELLKNK"
FT   gene            complement(331483..331908)
FT                   /gene="bfrB"
FT                   /locus_tag="ABAYE0307"
FT   CDS_pept        complement(331483..331908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfrB"
FT                   /locus_tag="ABAYE0307"
FT                   /product="bacterioferritin"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85285"
FT                   /db_xref="GOA:B0V8L8"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85285.1"
FT                   /translation="MLYHHLTAINQYFLHSRMFNDWGIEQLGSAEYKESIRQMKHADKI
FT                   IERILFLEGLPNLQHLGKLYIGQHTEEVLQCDIRKVKENIEAIQKAVALAETEQDYVTR
FT                   DLVQEILEKEEEYWDWLDTQIDLIGSVGIENYIQSQM"
FT   gene            complement(332192..332401)
FT                   /locus_tag="ABAYE0308"
FT   CDS_pept        complement(332192..332401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0308"
FT                   /product="putative regulatory or redox component complexing
FT                   with Bfr, in iron storage and mobility (Bfd)"
FT                   /function="3.1.4 : regulation level unknown"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85286"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85286.1"
FT                   /translation="MGITPMYVCLCRGITDQDIKDAIENGAESYREIRDLLDLGTCCGR
FT                   CAPEARAIISEELAEIAARISVAA"
FT   gene            complement(332596..332979)
FT                   /locus_tag="ABAYE0309"
FT   CDS_pept        complement(332596..332979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85287"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8M0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85287.1"
FT                   /translation="MSRQVIHTENAPAAIGTYSQAILVGNTLYLSGQIGLDPYSMELVD
FT                   GIEAQIRRVFDNLKAVCEAAGGTLADIAKLNIFLTDLSNFQLVNQIMGEYFAQPYPARA
FT                   ALGVASLPKGALVEMDGIVIINQ"
FT   gene            complement(333100..335205)
FT                   /locus_tag="ABAYE0310"
FT   CDS_pept        complement(333100..335205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0310"
FT                   /product="putative bifunctional protein (SpoT) [Includes:
FT                   guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase;
FT                   (p)ppGpp synthetase II]"
FT                   /function="5.5 : adaptation to stress"
FT                   /EC_number="3.1.7.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85288"
FT                   /db_xref="GOA:B0V8M1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8M1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85288.1"
FT                   /translation="MPGEEVSQAKQQLKLIIDPYLSVSEVEKVLAACDFGDLAHTGITR
FT                   KSGEPYILHPIAVSCILANMRLDPETLMAALLHDVIEDTQYTKDDIIERFGQTVAELVD
FT                   GVTKLSQSSDKEYNKAASFRKILQATLQDPRVIIIKLADRYHNMTTLGALRPDKRARIA
FT                   QETFDIFVPMARLVGMNEMADNLENLCYQNLDLDMFDNVQNALLQTKPERCKYQSIWEQ
FT                   NLAELLHNYHIQGRIKKKNNNIELLRHFVKNEMDLQELTHSHAFEIVLQSIADCDRLVA
FT                   ALKENFQVIQYQDHIRRPLPGGNQSLMIKLKGEKTTLSLTIQTELMRKAARFGVVLGEN
FT                   APQTCRSAIQASMQNLNTLIDGECAKTTFNDLLDYLHQEKIWVYTPHGQLHELPQGATV
FT                   VDFAYSASLFLGNHAVGAKVDGEIKPLSTPLVSGQVIEIITDVLATPNPDWLSFINTQK
FT                   ARRALQHVLKDQDIEEQRLVGAQALSRALKLFNRSINDLSDADWLDLLQWRHIDNKDAL
FT                   FEQIAVGDLLPQLVANHLFANDKHPRAENSDRLIQGTEGIDVKYAHCCNPILGDPIQGH
FT                   LTRRGLIVHRIRCHNLLHEQHLHPENIMPLQWKADDVDDVRFTAYLAIYMAMNDEQVSD
FT                   LIYQCRKNNAGVEMVHSNEQRTFVNIVVNNRKHIAKVIRDLRMHYGFPRIERLDAPAPQ
FT                   MEISKVS"
FT   gene            complement(335414..335692)
FT                   /gene="rpoZ"
FT                   /locus_tag="ABAYE0311"
FT   CDS_pept        complement(335414..335692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ABAYE0311"
FT                   /product="RNA polymerase, omega subunit"
FT                   /function="2.2.2 : transcription related"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85289"
FT                   /db_xref="GOA:B0V8M2"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8M2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85289.1"
FT                   /translation="MARVTVEDCLDHVDNRFELVLVASKRARQLARQGMEPTVEWDNDK
FT                   PTVVALREIAVGHVTKEILKQREQDYQTSSLDLALSTNSLNLEGFSF"
FT   gene            complement(335765..336394)
FT                   /gene="gmk"
FT                   /locus_tag="ABAYE0312"
FT   CDS_pept        complement(335765..336394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="ABAYE0312"
FT                   /product="guanylate kinase"
FT                   /function="1.5.2.3 : purine ribonucleotide biosynthesis"
FT                   /EC_number="2.7.4.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85290"
FT                   /db_xref="GOA:A0A0R4J797"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J797"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85290.1"
FT                   /translation="MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGE
FT                   LDGVHYHFTTKDEFLDQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQG
FT                   AEQVRKLFPESKQIFILPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYI
FT                   IINDDFNKALHELEAVITANRLVLSQQAKRHQNLIQDLITPQPKQE"
FT   gene            336517..337467
FT                   /gene="ispH"
FT                   /locus_tag="ABAYE0313"
FT   CDS_pept        336517..337467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ABAYE0313"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase (also involved in penicillin tolerance and
FT                   control of the stringent response. Seems to directly or
FT                   indirectly interact with relA to maintain it in an inactive
FT                   form during normal growth.)"
FT                   /function="3.1.4 : regulation level unknown"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /EC_number="1.17.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85291"
FT                   /db_xref="GOA:B0V8K4"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8K4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85291.1"
FT                   /translation="MEIVLANPRGFCAGVDRAIAIVNRALECFNPPIYVRHEVVHNKFV
FT                   VDDLRQRGAVFVDELDQVPDDSIVIFSAHGVSKAVQQEAERRGLKVFDATCPLVTKVHI
FT                   EVTKYAREGTEAILIGHEGHPEVEGTMGQYDKLKGGDIYLVEDEADVAALEVRHPEKLA
FT                   FVTQTTLSIDDTAKVIDALRAKFPNIQGPRKDDICYATQNRQDAVRDLAEKCDVVLVVG
FT                   SPNSSNSNRLRELAERMGKAAYLVDNADQLEQSWFNDTCKIGVTAGASAPEILIKQVIQ
FT                   RLQDWGAQAPKELEGREENITFSLPKELRIHVTQA"
FT   gene            337637..338110
FT                   /locus_tag="ABAYE0314"
FT   CDS_pept        337637..338110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0314"
FT                   /product="putative Fimbrial protein precursor; putative
FT                   type IV pilin protein"
FT                   /function="6.5 : Pilus"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85292"
FT                   /db_xref="GOA:B0V8K5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85292.1"
FT                   /translation="MRGIIPQEGFTLVELMVTIAVMAIIALMAAPSMSNLLESKRLDAN
FT                   QRDLINTLSEAKSQAILGRQNVSVNLNSTASNTPTSLNWQTASNNTLELKNIAADGTQS
FT                   SLTTSTLAFNANGVVANITQDTLLSICNFRINKKKVIILTKLGTLVFKAEETC"
FT   gene            338104..338664
FT                   /locus_tag="ABAYE0315"
FT   CDS_pept        338104..338664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0315"
FT                   /product="putative type IV fimbrial biogenesis protein"
FT                   /function="6.5 : Pilus"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85293"
FT                   /db_xref="GOA:B0V8K6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85293.1"
FT                   /translation="MLMHHYKQKAQAGVGLLEVLVALILLAIGVLGYVALQLRAMDASS
FT                   EALSKSQAILVMRGLAENIRTNSTQASQYPTFVRSYSNYTSDTPAPTSCFNSLCTASQL
FT                   AQFDAYQAARNANQLGMRITMSNCPGVTNTMVQQRQCLFVFWGKTAPVITTNGTNTSVD
FT                   VSSCMSNNGVYVNNSTCLMMEAY"
FT   gene            338665..339666
FT                   /gene="comB"
FT                   /locus_tag="ABAYE0316"
FT   CDS_pept        338665..339666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comB"
FT                   /locus_tag="ABAYE0316"
FT                   /product="pilin like competence factor"
FT                   /function="6.5 : Pilus"
FT                   /function="1.6.13 : Fimbria, pili, curli"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10763755; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85294"
FT                   /db_xref="GOA:B0V8K7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85294.1"
FT                   /translation="MAQSFISNKEQGFTLIELIVALALGLILVAAATQLFIGGLLSSRL
FT                   QKANAEIQDSGIFGLEYMARDIRLLNYGNVVNPQLTDTTPWGGIVLTGSTATNANNINF
FT                   IPKVDTNTYIPEALLSRGAGDTVSTVNNHWKGLSNIQNSSNAEVQSDQLTIQFIAPTNM
FT                   TNCEGVNVLAGDLIVQRYFLRVDNNGSSQQDYALACDANTPAVSATAQPDIVNGLGDAG
FT                   QIILPRIDHFHVLLGAKNAAGNFAYYTIPQYRVAAQAARDASPAVAAPRILSIQISVLA
FT                   RSTNNAQNKAIDPNQSFLMLDQNVHAADNRTRFLRRVYSVTIALRNAMGETI"
FT   gene            339663..340481
FT                   /locus_tag="ABAYE0317"
FT   CDS_pept        339663..340481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0317"
FT                   /product="putative type IV fimbrial biogenesis protein"
FT                   /function="6.5 : Pilus"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85295"
FT                   /db_xref="GOA:B0V8K8"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85295.1"
FT                   /translation="MTHLNYKNIKGRSKETGATLIVVLIILLIVISVGVLAIRVAIVSL
FT                   KVATNSQVGQLNFQSSDTPLELIVQMNPTTLTNITNVIGAALKAHESNPGAEYNFCYKP
FT                   TSTSVSFAQTRGASLLRAGSANNAVVEDGGVAGFCDLTSDYGSNRQAVVTQVAVSIPTD
FT                   AMADIPGSNLPRDINLSEGTQLPKSMLSTQRIRVITTAFLPAYASTSLETLQSDCLSTS
FT                   SAKISDNFDSALTDKQTLADCLANHNVPFSTQVQEFNYTNKLTEITAPGS"
FT   gene            340481..344347
FT                   /locus_tag="ABAYE0318"
FT   CDS_pept        340481..344347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0318"
FT                   /product="putative competence factor involved in DNA
FT                   binding and uptake (ComC)"
FT                   /function="5.11 : DNA uptake"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85296"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85296.1"
FT                   /translation="MGNIMKLKLKNFKPNNLWYAVCSSSMIFTWLMTSSVVQASDLQIY
FT                   ASPTAGKKTIVMMLDTSGSMTNNSYGENRLAMLKNGMNAFLASNNPVLNDTRVGLGNFS
FT                   ANGDSRSGQILVAAAPLGDASTLNTVGSQRYKLKQAVANLTAGGSTPSAHAYAEAAAYL
FT                   MGTTTYSETNYAIRKDSYIKRVRRSDNRTEYSYCTNYRDSQIDTANLWQPCRSNSYWSS
FT                   WSTNNPGVDNATAYDTSSDWTYYYTYYYTTFNYAVANADSGIPKSKSNDTASNPNIVVD
FT                   RNATNSNAVYQSPLPAVANRQSCDGQGIYFLSDGEPNNTTNTRSASVMSTALGSTFGAD
FT                   FNCSGGLSNTTADSGWACMGEFAKRLFDKTKNPAGVSIQTAFVGFGSDFSSLNSSDVKN
FT                   ACRLSSRTQSDRKGDDACSPNQSTNAVAAPGYGNGGFFPTQSSQGVTDSVIAFINNLDK
FT                   VPLEPLTTGAISVPYDALNPKNLQEYGYLRAFEPNPANTYLTWRGNLKKYHVVLSGANA
FT                   GAFEANSGGLVYNASGAFRTGTKDYWNSSTYTDGGKVFLGGSYANVPLPIAGQPETRDA
FT                   EGNITKYYYAVQSKIRNLFTDVSAVAADGSLTKISTSGTNLLKIPAAPPEETNPFDTVA
FT                   NTASYVLGKFDPSTGQNILKAFPISLKLKILNYLGYSTDINATTLPSSLVTSNEPYLSM
FT                   GGSIHSLPVQLTYNGTLDDNGNLTSAREQSILYGTMEGGLHIVDASSGIEQMVFVPADI
FT                   LNDSVASKALVVGQSDASAPAHGMDGAWVSDPAYNITTVGSGSSAVSKVTAKQMNIYGG
FT                   MRMGGSSYYGLDVLSPTSPKLLFRIGADQNDYSRMGQSWSKPVLANIRYNGSIRRVLIV
FT                   GGGYDQCYEKPNITLTDACFTNGKAKGNAVYIIDAKTGQRLWWTSDTGSNTDNANMKHS
FT                   IVSRISTLDRDADGLVDHLYFGDLGGQIFRVDLNNNQTKTNSTYSSFGVRVVRLANLAT
FT                   NDSTYDGTNDYTGGNAPRFYEPPTVTIHDYGIHTFITVGIASGDRSTPLDVYPLTGREG
FT                   MTPASALSGRPVNNVYGIIDRDFVKKNLMSLTDNQLETKDITRTGLRKNPQILRTGETR
FT                   VAQIFFPTTGVGKGGWYRSLSSTSDGTEKANNSFRIKGGLKAFEEPMAITGNLIILVYD
FT                   PQGTGIVAADPCLPRVVGETDRQTYCLPFGACLNSDGSIDQNKENHSGFETQTGTNCPV
FT                   GASECNKNVIGSGIRSVTFVPTEDNPPTTNSCGKLKLSGNEQGTGQWQCTSHLVPTRWY
FT                   ERYR"
FT   gene            344358..344840
FT                   /gene="comE"
FT                   /locus_tag="ABAYE0319"
FT   CDS_pept        344358..344840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comE"
FT                   /locus_tag="ABAYE0319"
FT                   /product="Pilin like competence factor"
FT                   /function="1.6.13 : Fimbria, pili, curli"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9515934; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85297"
FT                   /db_xref="GOA:B0V8L0"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85297.1"
FT                   /translation="MNKYYILRFNQGFTLIELMVVIVIVAIFASIAIPSYQSYSRRATA
FT                   SAAKSEILKLAEQLEQHKSRNFTYRGFTTTSITLPRGGYTIQITDDTTTGNLLTNAAAN
FT                   GQTWVIKATTTDSRNFNFIAKNSGIRCQSLTVTAVDNDCGGTTTCNTCETNSEVWQ"
FT   gene            344831..345262
FT                   /gene="comF"
FT                   /locus_tag="ABAYE0320"
FT   CDS_pept        344831..345262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="ABAYE0320"
FT                   /product="pilin like competence factor"
FT                   /function="1.6.13 : Fimbria, pili, curli"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9515934; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85298"
FT                   /db_xref="GOA:B0V8L1"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85298.1"
FT                   /translation="MAVKNGFSLIEIMVVVAIVAILAAIATPSYLQYLRKGHRTAVQSE
FT                   MMNIAQTLESQKIVNNRYPSDATIQSIYGSNVSPIQGQALYKLAFATLNDSTWVLTAIP
FT                   ISTSSQAGDGIICLNDQGQKFWAKGATVCALSASSSWTE"
FT   gene            345409..345660
FT                   /gene="rpsP"
FT                   /locus_tag="ABAYE0321"
FT   CDS_pept        345409..345660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="ABAYE0321"
FT                   /product="30S ribosomal protein S16"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85299"
FT                   /db_xref="GOA:B0V8L2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8L2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85299.1"
FT                   /translation="MVVIRLARGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQG
FT                   QAEKLRLDADRFAHWVSQGAQPSERVASLAAQAKKATA"
FT   gene            345680..346228
FT                   /gene="rimM"
FT                   /locus_tag="ABAYE0322"
FT   CDS_pept        345680..346228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="ABAYE0322"
FT                   /product="16S rRNA processing protein"
FT                   /function="2.2.6 : rRNA, stable RNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85300"
FT                   /db_xref="GOA:B0V8L3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8L3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85300.1"
FT                   /translation="MTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPW
FT                   YIETKAGWQIVDVKRWKPHGKGLVVALKGVSDRTGAESLVGANIWIAKSQLPKADVDEY
FT                   YWSDLKGLTVLGLDDDEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDV
FT                   VQRVDLEAGRIYVNWGVDY"
FT   gene            346274..347014
FT                   /gene="trmD"
FT                   /locus_tag="ABAYE0323"
FT   CDS_pept        346274..347014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="ABAYE0323"
FT                   /product="tRNA (guanine-1-)-methyltransferase."
FT                   /function="2.2.5 : tRNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.1.1.31"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85301"
FT                   /db_xref="GOA:B0V8J1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8J1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85301.1"
FT                   /translation="MFFAVITLFPEMFDAITAYGISGRAAKRDIVQVTCINPRDFAEGN
FT                   YRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASRAGCVHVPVVYMSPQGKTLNEQAVQ
FT                   QFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNV
FT                   MSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLE
FT                   RRPELIEQVTLTKQQKKWLSDEQG"
FT   gene            347222..347590
FT                   /gene="rplS"
FT                   /locus_tag="ABAYE0324"
FT   CDS_pept        347222..347590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="ABAYE0324"
FT                   /product="50S ribosomal protein L19"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85302"
FT                   /db_xref="GOA:B0V8J2"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V8J2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85302.1"
FT                   /translation="MSGKHPLVQAIENSQLKTDLPEFAPGDTVVVQVKVKEGDRERLQA
FT                   FEGVVIAKKNRGLNSAFTVRKISSGVGVERVFQTHSPVVAKIEVKRRGDVRRAKLYYLR
FT                   DLSGKAARIREKLPARKA"
FT   gene            complement(347642..348616)
FT                   /locus_tag="ABAYE0325"
FT   CDS_pept        complement(347642..348616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0325"
FT                   /product="lipase"
FT                   /function="1.1.2 : fatty acids"
FT                   /function="1.7.6 : glycerol metabolism"
FT                   /function="1.8 : metabolism of other compounds"
FT                   /EC_number="3.1.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85303"
FT                   /db_xref="GOA:B0V8J3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85303.1"
FT                   /translation="MKRNLIFFCAAILSGLSVSATHATNAEQVKSSFVYSTYAQTKYPL
FT                   VFNHGMAGFNRVGTDTLGLDYWYQILPDLARNGGNVWATRVSPFNSTEVRGEQLAQQVE
FT                   EIIAITGKPKVNLIGHSHGGPTIRYVAGIMPEKVASLTTIGAPHKGSPMADVILNVEGT
FT                   PLSGLATLVNWFSAAITWAGGLDPNSYPHDSLAGAHSLSTQGSAQFNSQFPMGVPTTSC
FT                   GEGAYQEKGIYMYSFSGNKALTNPLDPFDIALTGSSLVVDPFGDNDGLVSRCSAKFGKT
FT                   IRDDYNWNHLDEVNQVMGIRSIFAADPVSVYRQHANRLKLQGL"
FT   gene            complement(348698..349729)
FT                   /gene="lifO"
FT                   /locus_tag="ABAYE0326"
FT   CDS_pept        complement(348698..349729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lifO"
FT                   /locus_tag="ABAYE0326"
FT                   /product="lipase chaperone (Lipase foldase) (Lipase helper
FT                   protein) (Lipase activator protein) (Lipase modulator)"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85304"
FT                   /db_xref="GOA:B0V8J4"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85304.1"
FT                   /translation="MQRMQKKIWWCVLGFFILSLIACVYWLSPNSENTSPQPNQDEARL
FT                   VATSQSTLNSPLNENTYLSKSQQDTQVNCQLKINSSQHLVVNSQTRDCFEYFITQYGES
FT                   NLQQVKTHFEKFIQDQYLEPARSQIIDLWTRYLKYREQLAQIQPPQSKQQDQNYFQKIF
FT                   SSIQDIRKRFFSASEIEGLFSTEDIYQNYTLDRMKILEDSSLSEIEKAKKLKERFEQLP
FT                   EDWQENLQELSKLDDLHTLTKQIKARNGSAEELRQMRTALVGAEATQRLETLDIQRNAW
FT                   QQRVTGYLNQRDEVLHSNMSDSAKKQAIQQLRQQQFSSSQEQLRLRTFETVHDQGGELP
FT                   FNY"
FT   gene            349883..350788
FT                   /gene="truB"
FT                   /locus_tag="ABAYE0327"
FT   CDS_pept        349883..350788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="ABAYE0327"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85305"
FT                   /db_xref="GOA:B0V8J5"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85305.1"
FT                   /translation="MTTKNQKISRRHISGVFLLNKPLGLSSNAALQKVRWLYRAQKAGH
FT                   TGALDPLATGLLPICLGEATKFSHYLLDSTKRYQTTVRLGQTTTTGDVEGDILQERPIP
FT                   VLSKELIEQTLEKFRGDIQQVPPMYSALKKEGKPLYELARKGIEIEREARPVTIYALEL
FT                   IEFTENSITLDVTCSKGTYIRVLGEDIGEALGCGGHLTMLHRIQTGHFELIPSYTIEYL
FT                   ESLTEEQREALLLPVYAPIDHFLKIQVPEGREKYFCNGLESNIDHSAEAEVLVFSGERC
FT                   LGLAEITDKKRLVPKRILNL"
FT   gene            350814..351584
FT                   /locus_tag="ABAYE0328"
FT   CDS_pept        350814..351584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0328"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85306"
FT                   /db_xref="GOA:B0V8J6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85306.1"
FT                   /translation="MEWDVILSLIFFAFTAGAIDAAVGGGGLIQIPGIMSTFPNMSTAT
FT                   VIGTNKVSSIFGTASAAYTFAKKVKLQWKLLAVIAICALISSFAGAACLSLIPQSVLRP
FT                   FVFVMLIVIAIYTLVKKNFGQVHTEQKITTKMLVLAGIGSLAIGFYDGIFGPGTGSFFI
FT                   FFFIRFLQVDFLHASALSKIGNFMTNLAALSFLIPTGHAILHIGLMMAAANVLGSIVGV
FT                   RTALKYGSGFVRIIFLILVSILICRLGYQMFVTG"
FT   gene            351794..352237
FT                   /locus_tag="ABAYE0329"
FT   CDS_pept        351794..352237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85307"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85307.1"
FT                   /translation="MNIFEALRESHENQRNLSEQLIQTHGLTEERKELFDALKNELYAH
FT                   SVAEDRYLYIPLMFDDVGLDITRHALSEHHEMDELVEQLEKTDMSSPSWLATAKQLSEK
FT                   VHHHLKEEEHKFFQQAGKILKDSEKETLGNKYLKEYKKYKKQQ"
FT   gene            complement(352245..353105)
FT                   /locus_tag="ABAYE0330"
FT   CDS_pept        complement(352245..353105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0330"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85308"
FT                   /db_xref="GOA:B0V8J8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85308.1"
FT                   /translation="MQNLPIIAVLYMILSMVSYQISASFAKQLIAALDPLTVTILRLCF
FT                   AAVIVAVMFRSWKIWSRLPYLKWRDLLMYCASLGLMNILFYTSLGKLPQGIAVGLEFIG
FT                   PLGLALVSIKQKSEYIWVAFAMLGIALMVPWQDPTQHHFSYVGAACALGAGLCWAFYIY
FT                   FGQKVVTQNIGMHALTIGITVSALTLLPIGIWYNGPALLDTQYWGKALLIAVLATAIPY
FT                   ALDLMALKQLNKLTYGTLTSLAPALAALTGFLLLHEEISMLQWVALACVMLASIGVTLR
FT                   SKTAS"
FT   gene            complement(353196..354080)
FT                   /locus_tag="ABAYE0331"
FT   CDS_pept        complement(353196..354080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0331"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85309"
FT                   /db_xref="GOA:B0V8J9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85309.1"
FT                   /translation="MSSPSQKSQLHALGFLILAMLSVQSSASLAKVLFQNFPVLTVSAM
FT                   RLCIGAFILAFIFQIWKINFSQVRWKAILSYGFALAGMNALFYLSLERLPIGIAVAFEF
FT                   IGPLSVALYHAKQKYDFVWVTFAIIGLILLFPFNQAHSLDWIGVLFAMSAGACWALYII
FT                   AGQKPSGISSNHTVCLGMTVGACILLPITFFSGSIGQVIELPYFFYFIGLAVLASALPF
FT                   SLEMLALRNLTPLSFGTLMSLEPAVAALSGFIFLGEYLLWNQWLALATIITASVGCTIT
FT                   TQRARQQREKTVG"
FT   gene            complement(354179..355411)
FT                   /gene="serA"
FT                   /locus_tag="ABAYE0332"
FT   CDS_pept        complement(354179..355411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="ABAYE0332"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1.11 : serine"
FT                   /EC_number="1.1.1.95"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85310"
FT                   /db_xref="GOA:B0V8K0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85310.1"
FT                   /translation="MSQHLSLPKDKIRFLLLEGVHQNAVDTLNAAGYTNIDYRKTALEG
FT                   EALKEAIKDAHFIGIRSRTQLTEEVFEAANKLIAVGCFCIGTNQVDLKAAMARGIPVFN
FT                   APYSNTRSVAELVLAETILLLRRVPEKSAACHRGGWDKSAVGSFETRGKTLGIVGYGSI
FT                   GSQLSVLAESMGMHVIYYDAVTKLPMGNARQVGSLDELLATADVVTLHVPDVPSTRNFF
FT                   TKEQFAKMKEGAIFLNAARGTCVVIEDLADAIKSGHLAGAAVDVFPKEPKANGEEFQSP
FT                   LRGLDNVILTPHVGGSTMEAQANIGLEVAEKFVAYSDKGMTLSAVNFPEIALPLTAGQH
FT                   RLLHIHKNVPGVLSKINNLFAEQGINISGQSLMTKGDIGYLVMDVDASASQEALDMLHE
FT                   VEGTIRVRVLF"
FT   gene            355800..357209
FT                   /locus_tag="ABAYE0333"
FT   CDS_pept        355800..357209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0333"
FT                   /product="putative FAD/FMN-containing dehydrogenase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85311"
FT                   /db_xref="GOA:B0V8K1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85311.1"
FT                   /translation="MNAPVALTPELLTQLTAIVGENRIKTDADSLENWGKDHTKHFNPN
FT                   PSVIVFPSTTEQVQEVVKLANQFNIAITPSGGRTGLSAGAVATNGEIVISMDKMNQILE
FT                   FFPADRMVRVQAGVVTEQLQNYAEEQGMYYPVDFASAGSSQIGGNIGTNAGGIKVIKYG
FT                   MTRNWVLGLTVVTGKGDILRLNKGMIKNATGYALQHLFIGGEGTLGLVTEAEIKLERQP
FT                   QNLQVLVLGVPDFDAVMPVLHAFQKDIDLTAFEFFGELAMQKVLDRGHVQRPFETQCPF
FT                   YVLLEFEAPYEPIIDKAMEIFEHCMEQGWVLDGVMSQSLDQVESLWRLREDISESIAPF
FT                   IPYKNDISVLITHVPAFIREIDAIVQENYPDFEICWFGHIGDGNLHLNILKPENLTKDE
FT                   FFAKCQVVNKYVFDTVKKYDGSISAEHGVGMTKKPYLEYSRSAEEIEYMKALKKVFDPK
FT                   GIMNPGKLFDL"
FT   gene            357296..357673
FT                   /locus_tag="ABAYE0334"
FT   CDS_pept        357296..357673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0334"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85312"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8K2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85312.1"
FT                   /translation="MMKMQRLFLISALCAGLMTGCATTSKLIPFVGSETPMQQVLKTQP
FT                   EIVKEHNNTSVQQVFNRVESPTVSRITVIQTGLMDDSVSAIRTEYLFKLVDEKWQLQNK
FT                   QKSYQCARGKGSKGFQMQLCS"
FT   gene            complement(357718..358059)
FT                   /locus_tag="ABAYE0335"
FT   CDS_pept        complement(357718..358059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85313"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7X8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85313.1"
FT                   /translation="MQQPNPEKTMLTIIAEIRTQSGGQHRQNVLNAFQKIIPTVLAEDG
FT                   CHGYEPLVDHISNASFQNKDPDIIVMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDV
FT                   KIKILESGV"
FT   gene            complement(358046..358633)
FT                   /gene="mdaB"
FT                   /locus_tag="ABAYE0336"
FT   CDS_pept        complement(358046..358633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdaB"
FT                   /locus_tag="ABAYE0336"
FT                   /product="modulator of drug activity, similar to electron
FT                   transfer flavoprotein-NAD/FAD/quinone oxidoreductase"
FT                   /function="1.4.3 : electron carrier"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85314"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85314.1"
FT                   /translation="MSNILVINGAKQFAHSNGELNDTLTTLATNHLTELGHEVKVTRAD
FT                   SDYNAEAEVEKYLWADVVIYQMPGWWMGAPWTVKKYIDDVFTTGHGSLYANDGRSRSDA
FT                   SKKYGSGGLIHDKKYMLSLTWNAPMEAFDDADQFFHGVGVDGVYLPFHKANQFLGMSTL
FT                   PTFIVNDVIKMPDVDSYVEAYKAHLNTLFAAA"
FT   gene            358843..359223
FT                   /locus_tag="ABAYE0337"
FT   CDS_pept        358843..359223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0337"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85315"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7Y0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85315.1"
FT                   /translation="MVELSMKKIGLLMMCNLLILSACTPNTNPPTPQANSPIQAVLLDQ
FT                   PNLLNNASNLSISQQMNALEDPSNAQVTILQTEPSEDAVSKTRTEYLLKKDQTVWKIVN
FT                   KKQSYQCTKGEEAADFQVNPCP"
FT   gene            359593..360822
FT                   /gene="mdfA"
FT                   /locus_tag="ABAYE0338"
FT   CDS_pept        359593..360822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdfA"
FT                   /locus_tag="ABAYE0338"
FT                   /product="multidrug/chloramphenicol efflux transport
FT                   protein (MFS superfamily)"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85316"
FT                   /db_xref="GOA:B0V7Y1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7Y1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85316.1"
FT                   /translation="MKNIQTTALNRTTLMFPLALVLFEFAVYIGNDLIQPAMLAITEDF
FT                   GVSATWAPSSMSFYLLGGASVAWLLGPLSDRLGRKKVLLSGVLFFALCCFLILLTRQIE
FT                   HFLTLRFLQGIGLSVISAVGYAAIQENFAERDAIKVMALMANISLLAPLLGPVLGAFLI
FT                   DYVSWHWGFVAIALLALLSWVGLKKQMPSHKVSVTKQPFSYLFDDFKKVFSNRQFLGLT
FT                   LALPLVGMPLMLWIALSPIILVDELKLTSVQYGLAQFPVFLGLIVGNIVLIKIIDRLAL
FT                   GKTVLIGLPIMLTGTLILILGVVWQAYLIPCLLIGMTLICFGEGISFSVLYRFALMSSE
FT                   VSKGTVAAAVSMLLMTSFFAMIELVRYLYTQFHLWAFVLSAFAFIALWFTQPRLALKRE
FT                   MQERVAQDLH"
FT   gene            complement(360860..363010)
FT                   /locus_tag="ABAYE0339"
FT   CDS_pept        complement(360860..363010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0339"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85317"
FT                   /db_xref="GOA:B0V8I4"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8I4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85317.1"
FT                   /translation="MNNLTQLFNRFKTNSILIYCLQILIVLTGTTLGLLWLGHNELIVP
FT                   VTLGAIAAALTDFDDRLSLRLRNLLYVCLLFFTVSTILGFLAPYKFLFILYLSISSACF
FT                   ILLGALGQRYATISFGTILLSIYSMFGLGEYAHWYQQPTYFVYGALWYGLTSILFFILK
FT                   PTLPLQDKLSQIFEEISALLQAKARLFDPDNKENVEQLLFELSLQNTQVAQSLNQIRSS
FT                   LLTRLKASRVSNKSIYWLNLYFFARDIHEQATSNYLHYEHIQQNFSRSDLIFRFQKNLR
FT                   LQAQACHDLAQCILHNQQYQSSQESQIGLNHLESSLKDWIQQHPQNFEVKNLKLIFNNL
FT                   KGMHEQFEQLQYAQPLNETLSQNKQEHLNLLDDDIQGFSDLVLKIRQQLTPQSALFRHA
FT                   VRIAVVFAAGYAISLLPFAQHGYWILLTSLFVCQITYFATKSRLKLRTIGTLLGVLLGI
FT                   PILYFVPSIEGQLILTIICGVSFFYLRQKKYALATLMATLMVLLIFNLKGAGYSIILPR
FT                   LIDTLLGCFIAWLAVNFIWPDWNFRNIPNNIKKSSQATFDYFNMIVEQYQHGKNQDIEY
FT                   RRIRRAAHNAQIELSNMISSLSAEPNPNPELIHYAFRYLVYSHSQLSYVAALGSQRQKI
FT                   DDQQVLQLLLDCQQILKQSLFEQASVNFSFLEQTLKQIQSLITHEHFSENYTLVLKQMS
FT                   LLLETLPELISLKGKLLEHEIK"
FT   gene            complement(363203..363820)
FT                   /gene="sodC"
FT                   /locus_tag="ABAYE0340"
FT   CDS_pept        complement(363203..363820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="ABAYE0340"
FT                   /product="superoxide dismutase precursor (Cu-Zn)"
FT                   /function="5.6.2 : Detoxification (xenobiotic metabolism)"
FT                   /EC_number="1.15.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8626323; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85318"
FT                   /db_xref="GOA:B0V8I5"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8I5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85318.1"
FT                   /translation="MNKKIRFIVIRISIMPVFNKIGAVCALTALLTVGCSTVSKTVSDT
FT                   AHALTTMHTKKVVDVNEVTANGIGKKIGTISFQDSDKGLIITPALADLPSGTRGFHIHE
FT                   NPSCAPAVKDGKPGAALAAGSHYNPNQAPHHGTPTTGHLGDLPALVVDNTGVATTAVIA
FT                   PRLKLADIQGRAIMIHAGGDNYSDSPLPLGGGGARIACGVIK"
FT   gene            complement(363894..365012)
FT                   /locus_tag="ABAYE0342"
FT   CDS_pept        complement(363894..365012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0342"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85319"
FT                   /db_xref="GOA:B0V8I6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8I6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85319.1"
FT                   /translation="MHPYAPTLQRVLLFGLFFILIFLGFNILKYFIVPVLWAAIIAYMT
FT                   WPIYLRIQHFFGENRNNLNATVMISLVILIVGVPFTCAIFILQHEGRNLYFDLQRQVFS
FT                   GHLSVPDFIRNLPFIGKEISRTLNEINTDPNSTIQNIAAWVQSHLSYGRVLLNEISKNI
FT                   VKLCFAILSLFFFYRDGHTILTQVSKALEMVIGPRIHHYLDTISETTRAVVYGVGLTAI
FT                   AQAVLAGLSYFVAGVPNPMVLTIATFLLALIPFGTPVSYLGVGLWLFSQGQTMEAIGVI
FT                   LWGVLIVSSSDNVIRPLVISGATQIPFLLIMFGVLGGIASFGLVGLFIGPVILAVLLAI
FT                   WREWLHETIDPEPMPKTTMIYDSDDDLPPSKN"
FT   gene            complement(365135..365779)
FT                   /locus_tag="ABAYE0343"
FT   CDS_pept        complement(365135..365779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0343"
FT                   /product="putative partition-related protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85320"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8I7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85320.1"
FT                   /translation="MKTILIANQKGGCGKTMTAITLATALAQKGYKVALADSDNQKSSL
FT                   QWLKQRPDNVAVIQSLDWRQEKSIGDAPKNLDYLIIDAPGALSGDHAEQLVSEAHAIIT
FT                   PLQPSFFDIDSTRRFLKHLQDIKRIRKGKVQILLLANRVKPNSASSKDIQQFFEKIEHE
FT                   PIAWIAERSAYGSLAMQGLSVFDKPQKNFIAIQSQWQPLLNKLIEDKSEWF"
FT   gene            365956..366408
FT                   /locus_tag="ABAYE0344"
FT   CDS_pept        365956..366408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85321"
FT                   /db_xref="InterPro:IPR019287"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8I8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85321.1"
FT                   /translation="MLIGAGIGIIITTLILSNTRNGRIKAEYEQYIAELELEHQQALAQ
FT                   AQKRSVNTSRAVLKGKMAEQFAPVLPEFQYLPSDAKFMGDPVDYIIFDGYTDFRDGDGT
FT                   ADDIQIILLDVKSGGARLTKGQQAIAQAIKEGKVRFETLRIDFEDQ"
FT   gene            366530..367108
FT                   /locus_tag="ABAYE0345"
FT   CDS_pept        366530..367108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0345"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85322"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8I9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85322.1"
FT                   /translation="MRYKAMKKQRLMIALLATLGMGSAFASTSSEYNIANGLLPVEKDQ
FT                   SISVLQPFQGNFRILGSKIYHNDEQAKFSPIDYAVSWGLFAQPEIARHISVKQYDRYLN
FT                   WKIAKLPVPAEQAMQMVSNMHIIPANPEIAQQIKQVKRGDLVYLKGDLVEIKDKDLVWK
FT                   SSLTPTDTGDGACELFRVQSIHWVEKQNI"
FT   gene            complement(367158..367700)
FT                   /locus_tag="ABAYE0346"
FT   CDS_pept        complement(367158..367700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0346"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85323"
FT                   /db_xref="UniProtKB/TrEMBL:B0V8J0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85323.1"
FT                   /translation="MKAMLKKTPHIILMSLLSSSLLLTACKKADEPAKTEQPHTSSSTD
FT                   QVLEKLNERPVKKFPATADDAHDIALLEDYDHRFTEMSDEMETELEKMHEAGTLTTEFE
FT                   QKRTLDNVRSALTMLKDLDLKTEQGRYIQGLLYQYWENQEKNFSDKQASKDEQVKQLAD
FT                   YLQAQNQLKYWKASQQH"
FT   gene            complement(367707..368501)
FT                   /locus_tag="ABAYE0347"
FT   CDS_pept        complement(367707..368501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85324"
FT                   /db_xref="GOA:B0V7W6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85324.1"
FT                   /translation="MTQSLHPVAQKGFSSAAELYQQVRPNYPVEIVSWLQDRLQIHENS
FT                   TVIDLGSGTGKFLPYLKQTLANIIAVEPIGEMLQQLQQAYPDIKTLQAFSHNIPVNDQQ
FT                   IDAVICAQSFHWFDNIETLIEIHRVLKPQGHLGLVWNQRDESTDWVKALADFLLPLEGD
FT                   TPRYHSERWKKVFEEQDLFTFDNLNTFSQSQHGTVEQVVSKRLLSTSFIAAMTEKDQLQ
FT                   LKAKFEKIVYDFTGLGPQDQIDFPYITYAYHFQKNTSSNHRE"
FT   gene            368629..369906
FT                   /locus_tag="ABAYE0348"
FT   CDS_pept        368629..369906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85325"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85325.1"
FT                   /translation="MDKQIIFEDEHIRAIFLQGDSNTLVLSFGDLITRASGLSINAEKS
FT                   LIKYQYSVIGVMPKQKSWFPKASMVELAKVILPIIQRFKNIVGYGGSMGGYAAIKYSNL
FT                   LNMNRIIAFVPQYSIDPEQVEDRRYAEFFDAVANKDMQIQPQDVDASREYIIVYDPYFS
FT                   IDREHYLKIKEILPSLHTIHLPFTGHEALSVLASSSLLHDFIEHEFDETYFYQQVRKIK
FT                   KQSKFYYRNVLANVLTYHDSMLLKILRQNDFQLDERYLDNPLKQAVTRSLIKTKQATEQ
FT                   DFQKLGIKIQYRQQAENHKKGLKNQFEAILVFNLINLKLETYAVDVVLANPLYLIPIVA
FT                   EHTGVVQIELNNELYLLGMNDRKIIKLFKQGDALTSDMSPFVIKQYSDFFALSYKQLNL
FT                   NCDEQGVCDYVEGSVQPSQQFVLTSY"
FT   gene            370320..371753
FT                   /locus_tag="ABAYE0349"
FT   CDS_pept        370320..371753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0349"
FT                   /product="putative APC family, S-methylmethionine
FT                   transporter (MmuP)"
FT                   /function="1.5.1.9 : methionine"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85326"
FT                   /db_xref="GOA:B0V7W8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85326.1"
FT                   /translation="MQSLNYRNNDASQHGSSAPLKRAMSTRHLVMISLGGAIGTGLFLG
FT                   SGDVISQAGPIGAIISYFLGGLIAYTVMLCLGELAVHVPESGSFGEYARRYIGPGTGYM
FT                   ITWLYWLTWTATLGTEFTAAALLVQEWFPSTSVWAWTLFFGALVFFLNVSSTRLFAESE
FT                   FWLALVKVITIICFIGLGLLAIFGFIPYQGHETAPLFSNLTAHGWFPNGLFPIFATMLI
FT                   VNFAFSGTELIGVAAGEAENPAKTVPKAINAAIWRLLIFFVGTIVVISSLLPYHLAGLS
FT                   ANDVSSSPFVTVFNYIGIPYAEDIIRFVIITALLSAANSGLFAASRMMWSLSAKNQLPK
FT                   IFAKLTPSGTPIIAIIVTMFGAIPGLLSEQFAPETIFKNLLGVAAFTMVVVWIAICISQ
FT                   FNFRRQWYKSGKTVKDLRFAAPLFPLTPIVGGLFCIVTCISMVFDPSMQVGFICCIIFI
FT                   LLCYVSYFIFYRKKDIAQN"
FT   gene            372789..374060
FT                   /gene="gdh"
FT                   /locus_tag="ABAYE0351"
FT   CDS_pept        372789..374060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="ABAYE0351"
FT                   /product="glutamate dehydrogenase (NAD(P)+) oxidoreductase
FT                   protein"
FT                   /function="1.5.1.1 : glutamate"
FT                   /EC_number="1.4.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85327"
FT                   /db_xref="GOA:B0V7W9"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85327.1"
FT                   /translation="MSDLSYVNEHSDAWQTYLAQIDRVAPYLEHLADYIDTLKRPKRAL
FT                   IVDVPIVMDDGSIQHFEGYRVQHNLSRGPGKGGVRYHPNVDLNEVMALSAWMTIKTAVL
FT                   NLPFGGAKGGIRVDPRKLSNRELERLTRRYTTEIGHIIGPQKDIPAPDVGTNANIMGWM
FT                   MDTYSTSQGHTVTGVVTGKPVHLGGSLGRVKATGRGVFVTGREVAAKINLPIEGAKVAV
FT                   QGFGNVGSEAAFLFVESKAKITHVQDHTGTIFNADGIDLVALRDHVNANQGVGGFAGAQ
FT                   TIADEDFWTAEVDIIIPAALEGQITVERAEKLKAKLILEGANGPTYPKAEDVLVERGIV
FT                   VVPDVVCNAGGVTVSYFEWVQDMASYFWSEEEINERLDKLMVQAMDDVWNTANKNACTL
FT                   RTAAYILACERILKARKERGIFPG"
FT   gene            374205..375419
FT                   /gene="astC"
FT                   /locus_tag="ABAYE0352"
FT   CDS_pept        374205..375419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astC"
FT                   /locus_tag="ABAYE0352"
FT                   /product="succinylornithine transaminase (also has
FT                   acetylornitine transaminase activity, PLP-dependent)
FT                   (carbon starvation protein C)"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="2.6.1.-"
FT                   /EC_number="2.6.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85328"
FT                   /db_xref="GOA:A0A0R4J7A6"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7A6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85328.1"
FT                   /translation="MEQPISVTRSNFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYID
FT                   FAGGIAVNALGHAHPVAVNALTEQAKKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFC
FT                   NSGAEANEAALKLARKVGLDSGVAGKSGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPL
FT                   PNGISHVAYNDLEAAKAVINEQTCAVIVEPVQGEGGVIPADIEFLKGLRELCDQFGALL
FT                   IFDEVQTGVGRTGALYAYMNYGVIPDVLTTAKALGGGFPVGAMLTTDKFAPHFSVGTHG
FT                   TTYGGNPLASAVAGAVFEFINTPEVLEGVKHRHQYFLDALNTLNAEYQVFDEIRGQGLL
FT                   IGCVLKAEYAGKAKDITTWAGEEGLLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRAL
FT                   AKLAK"
FT   gene            375438..376469
FT                   /gene="astA"
FT                   /locus_tag="ABAYE0353"
FT   CDS_pept        375438..376469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astA"
FT                   /locus_tag="ABAYE0353"
FT                   /product="arginine succinyltransferase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="2.3.1.109"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85329"
FT                   /db_xref="GOA:A0A0R4J7C4"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7C4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85329.1"
FT                   /translation="MMIVRHAEFRDLEDIYKLAGKSGVGLTSLPQNMDTLSARISRTRN
FT                   TLNGNVHKSEQGYLFVLEDTEAQRVIGVSAIEVAVGLIEPWYNFHVGTQVHASKALNVY
FT                   KSLPTLFLSNDRTGSSELCTLFLDPERRENQNGKFLSKIRFMFIAAFKQYFEKKLIAEM
FT                   RGYSDENGCSPFWDAIGHHFFNMDFSTADYLSGIGQKVFIAELMPRFPVYVDLLPKDAQ
FT                   EVIGKMHPHTLPAYHVLESEGLRYQGYVDIFDAGPTIEANIDELRAVKESQLLNVKITN
FT                   EATVGKTQYLVANDNYHDYRAMLLKLDLVDNTLNLTHEQAEKLGVQEGHAVRVLSLNPM
FT                   EVS"
FT   gene            376469..377938
FT                   /gene="astD"
FT                   /locus_tag="ABAYE0354"
FT   CDS_pept        376469..377938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="ABAYE0354"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="1.2.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85330"
FT                   /db_xref="GOA:B0V7X2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7X2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85330.1"
FT                   /translation="MSNSLFINGVWLQGSGTTFVKTNPVDNQTVWSGAEATASDVEKAC
FT                   QAARTAFPAWARLPFAERVTIVEKFAALLEENKKHLAEVISQETSKPFWETLTEVQSMI
FT                   GKVAISIRAYHQRTGESSTEMADGVASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLA
FT                   GNTVVFKPSELTPWTAEETVKLWQQAGLPNGVMNLVQGGRTTGEALAASHEIDGLLFTG
FT                   SANTGYHLHKQMAGAPEKILALEMGGNNALIIDEIVDVDAVVNLAIQSAFVSAGQRCTC
FT                   ARRILVKNGAQGDAFIQRFVEVAKNLKVGRWNDEQQPFMGGVISSAAATNMMNAQQKLL
FT                   ELGAKSLLPMTRPQEDSSLLTPGIIDVTGVAGIPDEEYFGPLTTIQRYDSFDEALKIAN
FT                   ATRFGLSVGLVSPKRELFDDLLIEARAGIVNWNKPLTGASSAAPFGGVGASGNHRASAF
FT                   YAADYCAWPMASLESESLTLPEKLSPGIVLP"
FT   gene            377956..379299
FT                   /gene="astB"
FT                   /locus_tag="ABAYE0355"
FT   CDS_pept        377956..379299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astB"
FT                   /locus_tag="ABAYE0355"
FT                   /product="succinylarginine dihydrolase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85331"
FT                   /db_xref="GOA:B0V7X3"
FT                   /db_xref="InterPro:IPR007079"
FT                   /db_xref="InterPro:IPR037031"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V7X3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85331.1"
FT                   /translation="MKGYEVNFDGLVGPTHHYAGLSFGNEASTKNRNNLSNPKLAAKQG
FT                   LLKMKALADMGMKQGVLAPHERPHVPMLRRLGFTGDDISVVAQAMRYSPELLSSLSSAS
FT                   PMWTANAATVSPSADSQDERVHFTAANLNNKFHRSIEAETTSQVLQAIFKNERHFVHHE
FT                   ALPQVALFGDEGAANHNRLGGDYAKRGVQVFVYGQQHLNNGLPGPKRYPARQTREASEA
FT                   IARLHRLDEAHTVFVQQNPDVIDQGVFHNDVIAVSNQQVLFHHQHAFLNQDQAFAEIRQ
FT                   KMASIGEDFISIEVPENRVTVDDAVATYLFNSQILTRPDGGMTIVVPEESRQNAAVWSY
FT                   LNDMIQMGTPIDAIQVYDLRESMRNGGGPACLRLRVALNETELNAVNPKVLMNDQLFMT
FT                   LNQWVDKHYRDRLAQEDLADPHLLMESRMALDELTKILGLGSVYPFQK"
FT   gene            379312..380286
FT                   /gene="astE"
FT                   /locus_tag="ABAYE0356"
FT   CDS_pept        379312..380286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astE"
FT                   /locus_tag="ABAYE0356"
FT                   /product="succinylglutamate desuccinylase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85332"
FT                   /db_xref="GOA:B0V7X4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016681"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V7X4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85332.1"
FT                   /translation="MQDFLALTLQGEQPATREGKQANFSWRWLGEGLLECTPHAQYDKA
FT                   VVLSAGVHGNETAPIELLSHLCTDLFAGRLKLAVRLLLVLGNPYAMRQGKRYVHDDVNR
FT                   MFCGGYKNLPVTEESKRAEVLEQTVATFFQESSSQAKRYHYDLHTAIRASLLPTFALFP
FT                   YQTHGYDADLTASLEAADLDALVYHNALGKTFTHFTSENFKAASATLELGKALPFGQND
FT                   LSQFASIDEVIRNVVSEQALPVRNKPKIRVFQVSDSLIKKDEEFHMNLSAEAPNFSTFT
FT                   KGEIIATQPSGNYVVEQDQVWILFPNPNVKIGLRAGLVLTETI"
FT   gene            complement(380348..381154)
FT                   /locus_tag="ABAYE0357"
FT   CDS_pept        complement(380348..381154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0357"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85333"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7X5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85333.1"
FT                   /translation="MKYLTKRVYSLKDIAMKMMKTAIVTASVLASASIFAQSAGVNAGA
FT                   SAQVNVQPGGLVSGVANTVKNTAHTVGNTAKHAGHVAADTTVKATKKTTGKVTELSSKA
FT                   ATGTKHVASEAVTGTKHFATEAATGTKNLATKAATGTKNLAVEAKADTKAHLDAVKTKV
FT                   AEKQADQKEFTAEKQADAQARVDAVKARVAQNQAEQKEFIADTKADAQAKLNTAQPAHG
FT                   VNAQTGVNVGVNVAGINANANVNAGAQASTQKGEKKSFIKGLFGTN"
FT   gene            381700..382011
FT                   /locus_tag="ABAYE0358"
FT   CDS_pept        381700..382011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0358"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85334"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7X6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85334.1"
FT                   /translation="MMKIIASLLVIVGLIAVVLYFKPTSGASDVFNSALHETNSPQPDT
FT                   SSSLSKLKEPTQPKNVSLNSNHSQSVSADAVPFYDTKSDPSIQPIDPEKDPANEIKAK"
FT   gene            382017..383402
FT                   /locus_tag="ABAYE0359"
FT   CDS_pept        382017..383402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0359"
FT                   /product="putative alkaline protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85335"
FT                   /db_xref="GOA:B0V7X7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7X7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85335.1"
FT                   /translation="MLVEKLRRKIMQSKTLFLLGLCTIFSTTVSALPLDYKGAKQRLSQ
FT                   AAKQKVFQGKIDLDALVSNDSNDLIVEYNIPSSSVPSGLERRSYIATNKKNLQTRFNRA
FT                   GGVQVLRDYNNLPLAFYRISNREALVSLLNDPNVKAVYPNRINRTTTTESLPLINQPQA
FT                   NTNGFTGEGSSVAVLDTGVNYLHSDFGCTAVNTPSSTCRVVYSFDSAPDDGTLDDDGHG
FT                   SNVSAIVSKVATKTKIIGIDVFRKVRSQGKWVSTAYDSDILAGINWAVNNAQTYNIKAV
FT                   NLSLGVPGVKYTSECSDSSYGTAFANARAAGVVPVVASGNDAFPDGISSPACVAGAVRV
FT                   GAVYDSNIGGVSWGNPVKCSDPTTAADKVACFSNGGSLVTLLAPGAMITAGGYTMGGTS
FT                   QATPHVAGAIALLRANSVSPTESIDQTISRLKATGKPITDSRTGLVFPRIDLLAATNGL
FT                   TVN"
FT   gene            complement(383501..383932)
FT                   /locus_tag="ABAYE0360"
FT   CDS_pept        complement(383501..383932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0360"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85336"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7V5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85336.1"
FT                   /translation="MNSQKLLFSTLCCLALTACATTAPLSSYPQAQVLEQDTNIEAYPT
FT                   TTGNVAKLIKHDKQACMIEFTGYLGGGQVTEHWIFNNKGLISAQSFTEQYPDSSGILSQ
FT                   ATNSTTKSSTTFNIQDPEIQNNFKKLQSNFSKDNLAKCD"
FT   gene            complement(384027..384446)
FT                   /locus_tag="ABAYE0361"
FT   CDS_pept        complement(384027..384446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0361"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85337"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7V6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85337.1"
FT                   /translation="MKAIKILCITSSILVSSSLFAETPQPQQVNEATSKTMPYGDNPSL
FT                   GRVLLYKTGKGIQNLGDSIQGASEKTSNKISEKWKDTKEFTAEKAEVVQQKADTAKVFT
FT                   EQKIEQAKQNITSSRNGENIPIEQGELSKSSTTAN"
FT   gene            complement(384595..385440)
FT                   /locus_tag="ABAYE0362"
FT   CDS_pept        complement(384595..385440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0362"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85338"
FT                   /db_xref="GOA:B0V7V7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7V7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85338.1"
FT                   /translation="MFQTVVECGTMAKASMQLHCVPSNITTRIKQLEEELGAPLFYREG
FT                   KALKLTPSGEIFLDYCHKILALCDEAKRSIHPDAPPSGPLRIGAIESSATTRLPNLLAK
FT                   YHQRFPEVSIQIITGTWKQLLVDISQHKLDGAIVAGNIEFPMLNKLGIYQEDMVLIASH
FT                   SLGEIHCQEDLIGKEIFMWTEGCPYRAALEEWLKLKNISLPITSITSYATIIGCVSAGS
FT                   GVALVPKSIYEQYKNLAHIQSYKFEYLAFMQNHFFWHKNVSNHKARDMFIELIKTEFSL
FT                   "
FT   gene            385570..386472
FT                   /locus_tag="ABAYE0363"
FT   CDS_pept        385570..386472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0363"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85339"
FT                   /db_xref="GOA:B0V7V8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7V8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85339.1"
FT                   /translation="MAISLAAETQPPAFKLYLCIAVTVFCWGYSPIGVHSALHSYTPQH
FT                   IALLRFLIASFFLLLLVMKKGIQPLNWKDVPALAVLGFFSVTLHHLLINTGQQYVTAVA
FT                   SSILSQSIPLFTFIISALLFKEQINFKQWLCILLGLCGAVLVVSGDHGFGVPSPYSLLI
FT                   VLAAIAWGLYFNLYKKFALNYDALSMMCYIIWFGTIPLLFYSTHLPHEILHATWQANMS
FT                   VVLLGIFPSAMAYVLWGYVLKNMPLTIASNFLYCSPIVAMSLAVLFLNEKPSMMVLLGG
FT                   VIIVGSLVWMNWGNRRTIE"
FT   gene            386508..386792
FT                   /locus_tag="ABAYE0364"
FT   CDS_pept        386508..386792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85340"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7V9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85340.1"
FT                   /translation="MIVVTLTYKKPLAEVDAVLKQHIAFLDHYYEQKKFLASGRRENRV
FT                   GGVILVLSSSIQEAEEIMKNDPFYIHDVADYDFMWFEPSKSLEEIKKYI"
FT   gene            complement(386866..387933)
FT                   /locus_tag="ABAYE0365"
FT   CDS_pept        complement(386866..387933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85341"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85341.1"
FT                   /translation="MLDYRVRSWSLLNLVNDIRERRLVPDAYFQRDLVWREIHKKDFIE
FT                   TILLGLPFPQLFISKGKVDLVEMKTVSCIVDGQQRTNAIIEFIDNRFSVSDKFFRDLDD
FT                   IERTNFLKYEIAVIELDLENDDPQVQEIFQRINRTANSLRGIEKQASQYATSDFMLTAK
FT                   LLSDQIDLTAENNEYFKEDPRIPSDYYDWAKQQKVTRSQDLFTSNNLFTPLEISRKNHL
FT                   SYVLNLIASIEGGIFHRNEKTNEYLELYSENFQSKDDVVKLIEKTSSIYLKLKFSKKSY
FT                   WLNKANFFSLFYALAKNINEGKNINIEKLKENLDIFYSNLPDEYKISATEGVNNLRERR
FT                   TRDHYLNEIINNSLL"
FT   gene            complement(387938..388570)
FT                   /locus_tag="ABAYE0366"
FT   CDS_pept        complement(387938..388570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85342"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85342.1"
FT                   /translation="MDAKYYFETIKNDLAIGKDRYDIARKIFTSFPDYTAIKYDQHSVE
FT                   FEIKNEVSNHFHIPFHSIQLCGSAKTGKSLYKHHDFDKTKSDFDLAIISPELYTKYFEV
FT                   AFKQTQAFKDATTFPRKKKWNKELQRHINVNVKDEFLSYLNIGYFRPDLMPKSKDRTEW
FT                   FSFFNHLSEKYIQYFSNINAGIYLSQTFFENKQFAALDKSLEFNFED"
FT   gene            complement(388614..390683)
FT                   /gene="glyS"
FT                   /locus_tag="ABAYE0367"
FT   CDS_pept        complement(388614..390683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ABAYE0367"
FT                   /product="glycyl-tRNA synthetase, beta chain"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85343"
FT                   /db_xref="GOA:B0V7W2"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V7W2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85343.1"
FT                   /translation="MSKHTVLFELGCEELPPKSLKTLRDALQAETVKGLNEAGLNFASV
FT                   EAYAAPRRLALKIVDVDAAQADTQKRFDGPAVQAAYDAEGKPTKALEGFMRGQGITVEQ
FT                   LSTFQAGKVEKVCYLKDVKGQSLDTLLPQILQTALDNLPIAKRMRSAASRTEFVRPVKW
FT                   VVLLKDDQVIEATIQDHKAGNVTYGHRFHAPEAVTLAHANDYLAALEKAYVVANFEKRQ
FT                   ATIQEQVKKLADEVNATAIVPADLLDEVTSLVEWPVALRATFEERYLAVPQEALITTMQ
FT                   DNQKYFCLINAEGKLQPYFITVSNIESKDPTQIIEGNEKVVRPRLSDAEFFFLQDQKQP
FT                   LASRKEKLANMVFQAQLGTLWDKSTRIAKLAVALSSITGANPADAEKAALLAKCDLTSE
FT                   LVGEFPELQGIAGTYYARIEGENTEVSEALGEQYLPKFAGDVLPKTKTGTTIALSDRLD
FT                   TLVGIFGIGQAPTGSKDPFALRRSAIGILRLIIENELDVTIEELVNLALQGYGDIVKDH
FT                   DKTRADAVAFLEGRYRAKYEDQGVAVDVLQAVQALAPKSPLDFDKRVNAVNHFRTLPEA
FT                   AALAAANKRVANILAKEATPEGSVVEANLVEDAEKALFAELQAVTPVVEPLLAAKDYTA
FT                   ALSKLAALRAPIDAFFDGVMVMADDAGLKANRLRLLAQLRNLFTAVADVSVLQG"
FT   gene            complement(390683..391660)
FT                   /gene="glyQ"
FT                   /locus_tag="ABAYE0368"
FT   CDS_pept        complement(390683..391660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="ABAYE0368"
FT                   /product="glycyl-tRNA synthetase, alpha chain"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85344"
FT                   /db_xref="GOA:A0A0R4J7U0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7U0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85344.1"
FT                   /translation="MSRAISHIDTFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTA
FT                   TFLRALGPETWNAAYVQPSRRPKDGRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSL
FT                   KAIGIDTLTHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWTKGQFGTVTYGDVFHQNEVEQSTYNFEYAPVDKLF
FT                   ELFDFYESEANRLMEAKLPLPAYEQVVKASHTFNLLDARGAISVTERQRYILRVRTLAR
FT                   AIAQSYVQARAELGFPMAEPHLRDEVLAQLKAQAESEAAKAEKN"
FT   gene            392003..393214
FT                   /locus_tag="ABAYE0369"
FT   CDS_pept        392003..393214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0369"
FT                   /product="Tetracycline resistance protein, class A
FT                   (TETA(A))"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85345"
FT                   /db_xref="GOA:B0V7W4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85345.1"
FT                   /translation="MPDFSIGRFMNRSLFIIFATIALDAIGIGLIFPILPLLLQDMTHS
FT                   THISIYMGILASLYAAMQFIFSPLLGALSDRWGRRPVLLISLAGSAVNYLFLTFSHSLI
FT                   LLLVGRIIAGITSANMAVASAYIVDVLHENNRAKYFGLINAMFGAGFIIGPVLGGFLSE
FT                   YGLRLPFFAAAILTGLNLLSAYFVLPESRKVTLENKQLSTLNPFKIFAGISSIRGVLPL
FT                   ITTFFIFSAIGEVYGVCWALWGHDTFQWSGFWVGLSLGAFGLCQMLVQALIPSHASRLL
FT                   GNRNAVLAGIACSCFALAVMAFAQSGWMIFAIMPIFALGSMGTPSLQALASQKVSADQQ
FT                   GQFQGVIASTVSMASMIAPMFFSTLYFQFQEKWPGAIWLSVILIYLLTLPIILYSTRPV
FT                   VQQR"
FT   gene            393387..394649
FT                   /locus_tag="ABAYE0370"
FT   CDS_pept        393387..394649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85346"
FT                   /db_xref="GOA:B0V7W5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B0V7W5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85346.1"
FT                   /translation="MSDRIREKLQILADAAKYDVSCSSSGSDRKNKNKGLGDASHSGIC
FT                   HSYTEDGRCVSLLKILFSNVCIFDCAYCVSRRSNDVQRAAFTVQEVVDLTINFYRRNYI
FT                   EGLFLSSGIFKSADHTMERMLQVVKKLRLEENFNGYIHLKTIPGASPELIHEAGLYADR
FT                   MSINLEMPTEIGLKTFAPEKSHQEVQKDLGLVRDRLIQLKDERQIIKHVPKYVPAGQTT
FT                   QMVVGAHQESDQDVLFMADKHYKEFKLKRVYFSGYIPINTENNYLPAVGSAPPVLRENR
FT                   LYQSDWLMRFYGFEVNEIVNEKHPNLDLDVDPKLSWALRHPEQFPVDLNRADYQMILRV
FT                   PGIGVKSAKKIVQARRFGKIHIDLLKKLGVAYQRAKFFIRCEDSPKFQKELSSSFIRQQ
FT                   ILTQGSSKYVQQLSPQLSLGF"
FT   gene            394652..395449
FT                   /locus_tag="ABAYE0371"
FT   CDS_pept        394652..395449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85347"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:B0V701"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85347.1"
FT                   /translation="MFNEEVAYYFDGSMVGLLSCVFRAFQFKELQVRLCLNDTAQHGLF
FT                   ADKIEVVNNEQHAERVWAALQKKLSSSSLKQFYFAYLSESLDAYQHLFNYCIYVFSSHV
FT                   SIEKDYSHPSVLAITQWTKKVGREKHRMEAFIRFKKTKDELFLSLVRPDFNVLPLIQPH
FT                   FKRRYQDQRWLIYDEQRKFGLYYDLREIHEVSLEASDVDRNLKNGMSQSFQLELDEQEV
FT                   LYDQLWKDYFKSVNITERQNIKLHVQYLPKRYWRYLNEKLIEY"
FT   gene            395582..396682
FT                   /locus_tag="ABAYE0372"
FT   CDS_pept        395582..396682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0372"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85348"
FT                   /db_xref="GOA:B0V702"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:B0V702"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85348.1"
FT                   /translation="MSVIQPEWLQILKPNFKVLPLKERLLCGVGALCGLAISSLISWYV
FT                   LGGINAWYIAPMGASSVLLFAVPTSPLAQPWNVIVGNTLAGIIGVACAQWIPDLTTAFS
FT                   VAVGLAIFLMMTTDSLHPPSGAVAITAVLGGAAIHKLGFYFVFYPVLLNSLLLLGFAVF
FT                   FNRLIGRHYPVTAHLNERSKDPTPTQKVSIQPKDIEYALEHHTELLDISQYDLEKIILE
FT                   AQEHANERMVNQYTCQDIMSRDVIKLHENDDIHQALDKFKQVNLMSLPVVNADNHLVGT
FT                   LALYEVVEWFKGATDPRNSWQHYVRQIMSRRVVTVLPTQPIQDLVPYFVEKSFNYIPVV
FT                   EERKLIGIISRADMIAALQQQLNRKL"
FT   gene            complement(396752..397006)
FT                   /locus_tag="ABAYE0373"
FT   CDS_pept        complement(396752..397006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85349"
FT                   /db_xref="GOA:B0V703"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B0V703"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85349.1"
FT                   /translation="MANSGLYRSNRQSMIAGVMGGIAERFGWNANLLRIIFVLVSIMSA
FT                   AFPGILVYLVLWLVIPKKQPEQVQGYQQPVRTVREEQIH"
FT   gene            397251..397907
FT                   /locus_tag="ABAYE0374"
FT   CDS_pept        397251..397907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0374"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85350"
FT                   /db_xref="UniProtKB/TrEMBL:B0V704"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85350.1"
FT                   /translation="MMYMSLKWSSLLMKHLGVAAILCMGLSACDVNHADSKDHSAVATT
FT                   SRHEDSLIKSTTKVKTLDDAAGRTFLPEGIPDQSSKLSEADQQYAGRYHTRISCEDNFA
FT                   DCETGEAEYILNLLPDGTAYWNVVHFGRVGSKDGSKSAVINQLCPSLKWKVEPATHELT
FT                   IQCPLSDVNFYFDIDAKQRLVVNLEKLFYSDFGKNREFLEQNYFVPTKAYVLDKE"
FT   gene            complement(397979..399802)
FT                   /locus_tag="ABAYE0375"
FT   CDS_pept        complement(397979..399802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0375"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85351"
FT                   /db_xref="GOA:B0V705"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0V705"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85351.1"
FT                   /translation="MPAYKAPLHDIRFLMNEVLDYPAHYKTLSNGESADPDTVDMILEG
FT                   AADYCENVLSPLNQSGDEEGCHFDNGEVKTPKGFKEAYDQFVMGGWQGLSYPEEFGGQG
FT                   LPMSLNLIKSEMMGTANWSFTMYPGLSSGCMNTILQFGTDEQKQTYMPKLVEGTWSGTM
FT                   CLTEPQCGTDLGQVKTKAEPQADGTYKISGTKIFISAGEHDLTENIIHIVLARLPDAPA
FT                   GTRGISLFIVPKFIPTADGGVGERNTVSCGSIEHKMGIRASATAVLNFDNATGYLIGEV
FT                   NKGLHAMFTFMNTARIGTAVQGIAHAELSFQGALPYAKERMSMRALSGKKDPDKVADAI
FT                   IHHADVRRMLLTQKAIAEGGRSMIYYAAQLADKMTDALTRGDQAAFEDYDDKLGFYTPI
FT                   LKGFLTELGLEAANHGMQVYGGHGYIKEWGMEQIVRDARISTLYEGTTGVQALDLIGRK
FT                   VLLSSKGKVVREYTAEILKFCAAHARNKYLRRFAWDLTKLCAQWNTLTVRIMLAARKDR
FT                   DIVSSASVDFLMFSGYVMMAYFWAQQAVVASEKLEAGNGQETPEFYKAKIKVADFYFDR
FT                   LLPRAQGHAESMVTTSRTLTSLPAEHFSFDY"
FT   gene            400060..402363
FT                   /locus_tag="ABAYE0376"
FT   CDS_pept        400060..402363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0376"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85352"
FT                   /db_xref="UniProtKB/TrEMBL:B0V706"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85352.1"
FT                   /translation="MHLKYLSLCLFSLGLTACAQHGVRSQVASASLEQKAIQSVNAMYE
FT                   YPSYDYRGNFKITVDPSQIKQNVKAENTAKLDAELQKKVDQYLREQKVALSKAQKQTLY
FT                   AAIANEQGDLGLTSSARSEKINTVLFNLLNDLQFSYDGSIHYRQKMGSFNLTARYEKPT
FT                   LLVQAKLPMVLDLENYKFYINYFGLMPYLVNKDNQNNLAYVDFSKYKAFFKNVDKKKFI
FT                   EYLKASSAVSYRLAEPQNLQRVSLTEADRKAGAVERIRLKTTVEQLLLEVDLFGQVNEK
FT                   YLQKSVLGLDEEKLAETLAAEIAASDAKKGTPDKEEQKVSSDDAAAVSQQLYSLVNAHL
FT                   GNTSTSEDEEVESASSEEASDVAVAETEQTSENEEVVALTEDQCIELKSLKKPVALGDI
FT                   NYCQIYGIDVLDQSDTSIQKAQIKSRQDALKQIFEAYNQNQFINDEAFKALWLKHKDEI
FT                   EQALPKQRNPITIDVALDDKGRAVNMDYDVDYTPAEFKHRFNIKADMQILNYGKATSID
FT                   QQQLKQAKSVAEASKGSMLENFIKGFSEKLGQSDVSEHPVGTHSDVQDLDANLAVLADK
FT                   TYDATHAYDKTYKAVFIAKLTAEKPSYIKYYSVQQLQEIAEVYAYWFSDEDTYNPQGKA
FT                   LERITALQKKHHLEQDDQFDHELGRAVDHIVLTTIQGKTGREAWQKLQKQYKQPGQLFS
FT                   KQYQLEFEKQNGVSAEEKHLLSETADILGNVYVAARKKQLSEKTIQNLKPEHNEFIDYE
FT                   IFREVYKQMVTAKK"
FT   gene            complement(402409..403197)
FT                   /gene="aroE"
FT                   /locus_tag="ABAYE0377"
FT   CDS_pept        complement(402409..403197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="ABAYE0377"
FT                   /product="dehydroshikimate reductase, NAD(P)-binding"
FT                   /function="1.5.1.20 : chorismate"
FT                   /EC_number="1.1.1.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85353"
FT                   /db_xref="GOA:B0V707"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V707"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85353.1"
FT                   /translation="MTKQFAVIGNPIEQSRSPELHHAFAEKTGVDLNYQKRLAPLDGFE
FT                   SSMRSFFAEGGSGMNVTVPFKEQAFALCDVLTERAQIAKAVNTLWMENGKLHGDNTDGQ
FT                   GLVAAIQALEWNLENTTILILGAGGATRGVIYPLVQAGAQKIVIANRTLARAEQLVDDL
FT                   KTAVPQAQLQAISLNDLEGDFDIVINATSTSLSGDALQLPEKLQFKYAYEMAYGKPSSF
FT                   IDQAKQRNVPYAEGFGMLVGQAIEAFYIWNGVRPQLKDFL"
FT   gene            complement(403371..404375)
FT                   /gene="hemF"
FT                   /locus_tag="ABAYE0378"
FT   CDS_pept        complement(403371..404375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="ABAYE0378"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /function="1.5.3.12 : heme, porphyrine"
FT                   /EC_number="1.3.3.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85354"
FT                   /db_xref="GOA:B0V708"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:B0V708"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85354.1"
FT                   /translation="MDLCFDVSNLFRSSLRVIMQHPTSTDIQRVREFLLDLQARICAGL
FT                   EQQEKAGGGTAEFIIDDWERPEGGGGRSRVLQNGTVIEKGGVMFSHINISKLPASATER
FT                   HPQIAGAKAQALGVSLVIHPKNPNIPTSHANVRLFVAEREDQDPIWWFGGGFDLTPFYP
FT                   DDQDVLNWHQAAYDLCKPFGDNVYAEHKKWCDDYFYLKHRDEQRGVGGLFFDDLNCWDF
FT                   ETCFKYIQAVGNGYLNAILPIFEKHREQPYTEAQREFQLYRRGRYVEYNLVYDRGTLFG
FT                   LQTGGRIESILVSLPNLAAWSYRPEWDEDSPEKRLTDYYLKPRDWLGLEEKVA"
FT   gene            complement(404449..405051)
FT                   /gene="ribA"
FT                   /locus_tag="ABAYE0379"
FT   CDS_pept        complement(404449..405051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="ABAYE0379"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85355"
FT                   /db_xref="GOA:B0V709"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V709"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85355.1"
FT                   /translation="MPIEFIATSKLPTAFGEFNISVFQDPVTGEEHVALSKGLENPPTG
FT                   PVLVRVHSECLTGDAFASLKCDCGPQLQATQKLINEAGQGVILYLRQEGRGIGLTNKIR
FT                   AYALQDQGHDTVDANLLLNLPADARRYDMCSIMLDHLKVKEVKLITNNPLKIQALKDQG
FT                   INVVDRVPLTVGRNPFNEQYLKTKRERMDHLYQKDDF"
FT   gene            405346..407259
FT                   /gene="dxs"
FT                   /locus_tag="ABAYE0381"
FT   CDS_pept        405346..407259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="ABAYE0381"
FT                   /product="1-deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85356"
FT                   /db_xref="GOA:B0V710"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V710"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85356.1"
FT                   /translation="MPHMLYTEIPTQRPVTPLLDAIDHPQQLRQLEHSQLLQVADELRQ
FT                   YILYAAGQSGGHFGANLGVVELTVALHYCFNTPNDRLVWDVGHQAYPHKILTGRREQIT
FT                   TIRAKNGLAAFPAREESVFDTFGVGHSSTAISAGLGMSLARRYQKDPCEVVCIVGDGAM
FT                   TAGMAFEAMNDAVAHDADLIVVLNDNDMSISCSTGGFAKHLAAIWEKGHLVNVNEHGEA
FT                   YIQPHPKWTYNSRLHQSATDAADNLFKAIGFDYFGPFDGHDVTQLVQVFNALKKRKGPR
FT                   LVHVYTKKGKGFAPAEADPITYHAIGKINAASGGKTPPKYSDVFGEWLCDEAAQDERLL
FT                   AITPAMCEGSGMVKFAKQFPQRFFDVAIAEQHAVTLAAGMACEGLKPVVAIYSTFLQRG
FT                   YDQLIHDVALQNLDVTFGIDRAGLVGEDGPTHAGAYDYAYMRTVPNMVIMAPKDENECR
FT                   QMLHTAYAYNGPAAVRYPRGAGVGVEIQKEMTVLELGKAEIVAEIKANSDEQITVLAFG
FT                   SRVMVALEAAEQFAQKHDVSVCIVNMRFVKPLDEQMIRDLAEHTHLFVTVEEHAIMGGA
FT                   GSAVNEFMAQEQIVKPIINLGLPDSFLHQATHNQMLQDCGLDAKGILNSIERAWLKVNQ
FT                   VV"
FT   gene            407382..408212
FT                   /gene="suhB"
FT                   /locus_tag="ABAYE0382"
FT   CDS_pept        407382..408212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="ABAYE0382"
FT                   /product="inositol-1-monophosphatase (IMPase)
FT                   (Inositol-1-phosphatase) (I-1-Pase)"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.3.2 : covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85357"
FT                   /db_xref="GOA:B0V6Y9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85357.1"
FT                   /translation="MEPMVVMAARAAQTVGQELLKAHQNRHKLDLQVEEKGIDGPVTRV
FT                   DRYLEQLTIDTLRKSYKNHSFLGEEFGLQEGKGHDADWCWVIDPLDGTQNFINGFPHFC
FT                   ISIAVQHKGVTQHGVIYDPVRDELFSASRGRGAVMNQRRIRVNVKDSLENTFLAVGHPY
FT                   RAKRAGEIVSYAEQHFASLLAVTQAGAQIRRGGSAALDLAYVAAGRFDGFFELGLKPWD
FT                   IAAGELIIKEAGGVVVDARGGNDSLENGQVIACSLKMLKPLMQTVVPAWGKAAK"
FT   gene            408610..410469
FT                   /locus_tag="ABAYE0383"
FT   CDS_pept        408610..410469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0383"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85358"
FT                   /db_xref="GOA:B0V6Z0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85358.1"
FT                   /translation="MELSMSKTFAEFSLHETLQQALEGLGFTNPTPVQEQSIPAALEGK
FT                   DLLVSSQTGSGKTAAFLLPTLHNLAGQDTFVPFKERMKAVTQPSILVLCPTRELAQQVS
FT                   QDAIAFVRHMKGVRIAAIMGGMPFGKQIQQLKGAQVVVATPGRLLDLVNRRQLKLDKVD
FT                   ALIVDEADRMLDLGFSEDLEAISDLAANRGQTLMFSATFADRIIRLAERMMNEPERIAI
FT                   ETGHSTNTDITQTLHWTDGFEHKKKLLTHWLADETLDQAVVFASTQEDTDMLAEELAEA
FT                   GHSVVALHGAMPQTVRNRRLRSIREGRAKILVATDVAARGLDVPTISHVINFGLPMKHE
FT                   DYVHRIGRTGRAGRTGQAITLATYRERGKIRALEDYLEARLNVSEIEGLEPSPPPARPR
FT                   REGGRGGNGGRDGRRGGGFGGGRRFEGEGNFKRREGGRDDRPRRSFDDKPRGERPAFGG
FT                   EDRPRREFNSDRPRREGGFEDRPKRSFGGEDRPRREFNSDRPRREGGFEDRPKRSFGGE
FT                   DRPRREFNSDRPRREGGFNDKPRFDSNDDNRGNRVDYKPRRENGFGDRPQRSFGGEDRP
FT                   RREGGFGDRPKRSFGGEDRPRRAVREEHFNQESRGERRRKFDR"
FT   gene            410873..411691
FT                   /gene="ttg2A"
FT                   /locus_tag="ABAYE0385"
FT   CDS_pept        410873..411691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttg2A"
FT                   /locus_tag="ABAYE0385"
FT                   /product="toluene tolerance efflux transporter (ABC
FT                   superfamily, atp_bind)"
FT                   /function="4.3.A.1.a : ABC superfamily ATP binding
FT                   cytoplasmic component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85359"
FT                   /db_xref="GOA:B0V6Z1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85359.1"
FT                   /translation="MNNKTPLSTQSLIEVKNLSFNRGERVIYDNISLNIRRGQITAIMG
FT                   PSGTGKTTLLRLIGGQLVPDHGEVLLDGKDIAQMSRQELFAARARMGMLFQSGALFTDM
FT                   SVYENVAFPIRAHTKLSENLIAELVALKLESVGLRGTEQLMPTELSGGMNRRVALARAI
FT                   ALDPDLIMYDEPFAGQDPIVMGVLTRLIRSLREALDLTTIIVSHDVAETLSIADYIYVV
FT                   AEGRIQGEGTPEQLKAHASPFVKQFLTGSVEGPVEYQFSHQAYLDNEVRP"
FT   gene            411688..412467
FT                   /gene="ttg2B"
FT                   /locus_tag="ABAYE0386"
FT   CDS_pept        411688..412467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttg2B"
FT                   /locus_tag="ABAYE0386"
FT                   /product="toluene tolerance efflux transporter (ABC
FT                   superfamily, membrane)"
FT                   /function="4.3.A.1.m : ABC superfamily, membrane component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85360"
FT                   /db_xref="GOA:B0V6Z2"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85360.1"
FT                   /translation="MNTIAWLGRLVIERIRGIGAAAHMLLQIIFSFPTKGGFGRFVYQM
FT                   HRVGVMSLLIIAVSGLFIGAVLGLQMYSILVTFGAESMLGTAISLTLLRELASVVAALL
FT                   FAGRAGSALTAEIGSMKQSEQLASMEMIGVDPLKQIVSPRLWAGIVSLPMLTVIFAAIG
FT                   IIGGKMVGVDFLGADEGSFWSGMQNTVRFGHDIFNGTIIKSIVFALICTWVAVYQGYAC
FT                   DPTPEGIATAMTRTVVYSSLCVLGFDFVLTAVMFGGI"
FT   gene            412467..413147
FT                   /gene="ttg2C"
FT                   /locus_tag="ABAYE0387"
FT   CDS_pept        412467..413147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttg2C"
FT                   /locus_tag="ABAYE0387"
FT                   /product="toluene tolerance efflux transporter (ABC
FT                   superfamily, peri-bind)"
FT                   /function="4.3.A.1.p : ABC superfamily, periplasmic binding
FT                   component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85361"
FT                   /db_xref="GOA:B0V6Z3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85361.1"
FT                   /translation="MKSRTSELAVGIFVIIFGIALFFLAMKVSGLVGTNLSDGYTMKAQ
FT                   FDNVNGLKPRAKVTMSGVTIGRVDSITLDPVTRLATVTFDLDGKLTSFNAEQLKEVQKN
FT                   ALDELRYSSDYTQATPAQQKTMEQQLISNMNSITSIDEDAYIMVATNGLLGEKYLKIVP
FT                   GGGLNYLKRGDTISNTQGTMDLEDLISKFITGGGAGKVAAGSSSAEEKAPASTDSSAQP
FT                   SFVE"
FT   gene            413156..413815
FT                   /locus_tag="ABAYE0388"
FT   CDS_pept        413156..413815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0388"
FT                   /product="putative toluene tolerance protein (Ttg2D)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85362"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85362.1"
FT                   /translation="MKEWFQVNTLFKQTLTASILSTMIAGTAFAAPSEAPPDFIKRVAD
FT                   GLISRLKADHAKLQNNPALVKTIVRQNLDPYVDSQAFTRIVMGTYATNQYSTAAQRAQF
FT                   ETNFRNTLIENYGSAFAKYTNQTYTMRPYKATAGKNPVVTLDFNHNGEKIPVSFQLADK
FT                   GSQWKIRNINVSGIDLGLQFRNQFAATVKRNGGDLNKAIATFQPDADAAVNQNKQK"
FT   gene            413827..414114
FT                   /locus_tag="ABAYE0389"
FT   CDS_pept        413827..414114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0389"
FT                   /product="putative toluene-tolerance protein (Ttg2E)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85363"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85363.1"
FT                   /translation="MVQYLNQELVVSGKIDFENAEQQYQAGLAIIKKQTSFPLIVDLKQ
FT                   LEHGNTLALAVLVQWLRQTPQKSGLHFKNVPEKMLKIIQACHLQEDLHLV"
FT   gene            complement(414184..415269)
FT                   /gene="corA"
FT                   /locus_tag="ABAYE0390"
FT   CDS_pept        complement(414184..415269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="ABAYE0390"
FT                   /product="magnesium and cobalt transport protein"
FT                   /function="4.9.A.17 : The Metal Ion Transporter (MIT)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85364"
FT                   /db_xref="GOA:B0V6Z6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85364.1"
FT                   /translation="MFFGKSLSKIHPSISIRLRKEKRHMLEAFYATERGSLEDATINGG
FT                   FDLHPELVWLDLIAPSQEEQQWVLDAYNQNLPTLKSLEDISSSARFYRDDDGILHISTY
FT                   FLTKNKNYQVDGDAEDSSHMLAMVQTVAFILHKDRLFTLRGEKLVAFRAFRARARRNDY
FT                   EMDYKDPTWILLGLLEAKLDELADILEDIHKDLEKYSTEVLNNHQREQILDLDDMITRL
FT                   AQQEDMLGKAQLCLIDLRRVLTFLSRPRALGSHIYDADIRELSEDVRSLVEHDAFLFQK
FT                   VRFLLDTTSGFINTEQNDTIRRFSILPSMLAPPMLIASIYGMNTDVLPFAHGTTSFIIV
FT                   LLIIIGFFIGPIIYFRWKKWI"
FT   gene            415355..415936
FT                   /locus_tag="ABAYE0391"
FT   CDS_pept        415355..415936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0391"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85365"
FT                   /db_xref="GOA:B0V6Z7"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85365.1"
FT                   /translation="MNSICIFCGSSLGSNPIFQQIAQLTGEAIAKQGKTLVYGGGRSGL
FT                   MGVVADSALQAGGQVIGVIPRALVDRELAHPGLTKLYVVENMHERKTKMADLSDGFIAL
FT                   PGGAGTLEEIFEQWTWAQLGIHQKPCAFLNVAGFYEDLLKMIQGTVDNGFSQARFVDKL
FT                   IVSDKIEDILQQFEQYQAPAPKWTNADVQP"
FT   gene            415951..416352
FT                   /locus_tag="ABAYE0392"
FT   CDS_pept        415951..416352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85366"
FT                   /db_xref="GOA:B0V6Z8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85366.1"
FT                   /translation="MKTITVAAAVILNEQNELLLVRKRNTQAFMQVGGKLEPNEAPESA
FT                   IQREILEEIGSPCVIEQFIGRFETAAANEPDHTLISHLYLVRLKQSPQIAAEIAEMKWV
FT                   KFNDSETKLAPLTKEIVIPWCEQNLSITL"
FT   gene            complement(416355..416996)
FT                   /locus_tag="ABAYE0393"
FT   CDS_pept        complement(416355..416996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0393"
FT                   /product="putative DNA transformation protein (ComF)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85367"
FT                   /db_xref="GOA:B0V6Z9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Z9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85367.1"
FT                   /translation="MHMFKFLNPQYLFQLLSPCLLCEIGTREKYSLCKECWEQLPWLKQ
FT                   TIQRNDQSVLVACHYAYPINRIIQQFKYEQKLHYQTLLAEVLQQLKFPKVQAIVPMPIS
FT                   KQRLTERGFNQSLLLANLLSKQLKIPVWQPVQRLNEHSQKGLSRLERFENIEQQFVALT
FT                   QEKRRYRRVLIIDDVITTGSSIHALSQALKQLGCTSIHASCLAAASSTSY"
FT   gene            complement(416983..419028)
FT                   /gene="recG"
FT                   /locus_tag="ABAYE0394"
FT   CDS_pept        complement(416983..419028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ABAYE0394"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="2.1.1 : DNA replication"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85368"
FT                   /db_xref="GOA:B0V700"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B0V700"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85368.1"
FT                   /translation="MTSVHQLQGVGSASAALLEKLNIFTTDDLLFHLPRDYEDRSTIIP
FT                   MNQLVVGRSYLLEGEVKSVDFPPGKRKSMAALIQDEFGKVTLRFYHIYKNLTDKIKPGN
FT                   RLRIFGEVRVGARGLELYHPEIQLINEHTPLPKTQLTAIYPSTDGLTQAKLREYVKQAL
FT                   KHHSDALPELLPKQYTNGYALKEALHYIHEPPVDANMIQLAQGSHPAQQRLIFEELVAH
FT                   QISLLTRRAYIRQIASPAFPSSKVLAKKLLEALPFQMTNAQKRVSKEILNDLKQHQPML
FT                   RLVQGDVGAGKTLVAAVAACHALEADWQVALMAPTEILAEQHYLNFKRWFEPLGITVAW
FT                   LSGKQKGKARAHAEQQIKEGHAELIVGTHALFQDNVEFAKLGLVIIDEQHRFGVDQRLA
FT                   LRNKGAEQLTPHQLVMTATPIPRTLAMSAYGDLDTSIIDELPPGRTPIQTVTIPLDRRE
FT                   EVLQRIASNCREGKQAYWVCTLVEQSETLDAQAAEATYQEMKERFPELNIGLVHGKMKA
FT                   DEKQAVMQAFKNNELQLLIATTVIEVGVDVPNASIMVIENAERLGLSQLHQLRGRVGRG
FT                   AKASFCVLLYKPPLSQNGQERLSILRESNDGFVIAEKDLELRGPGELLGTKQTGDMGFR
FT                   VARLERDDHLLSQAHYVAQQVLKDYPEQADALLKRWLPEAPRYAYV"
FT   gene            419049..419864
FT                   /locus_tag="ABAYE0395"
FT   CDS_pept        419049..419864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85369"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6X8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85369.1"
FT                   /translation="MHILFIGYGKTSQRVAKQLFEKGHQITTISRSEKTDPYGTHLVQD
FT                   IFTLDLSEIAPVDVVYILLSPDDSTVEGYQHTYVDSIEPIRQALKSHPVKRLIVVSSTR
FT                   VYGENSGETIDDHSEIHPNDAQGHILHNMELLWQKYFPSQCVIVRPTGIYGASIDRLKR
FT                   MAEHTQTYPNIHYSNRIHIDDLARFLVFLADFEKPHKSYLVANNAPVPLHEVLLWFQSQ
FT                   LDLPLLTLDSAHVSGKKIYAKHLFETGFQLEHPICFNDYLLCLNAHGTN"
FT   gene            419917..420930
FT                   /locus_tag="ABAYE0396"
FT   CDS_pept        419917..420930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0396"
FT                   /product="putative RND type efflux pump involved in
FT                   aminoglycoside resistance (adeT)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85370"
FT                   /db_xref="GOA:B0V6X9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85370.1"
FT                   /translation="MPIKIKRLKVKKFCLALFLSVTSVTSWAGDQVWCAYDPAGTQGDI
FT                   TRRLNDIRLYAQQYQVKFKVVSYQKEQQAIQAFDEGKCSGLAASNFNTYQYNHFMGSTS
FT                   GIGLIPNNRTARNLLQLLNHPTIEKRLINKDYEAVGMIPVGTANMVMKTKKISKVAQLR
FT                   GQRIGVLANNPPQQALVRSVGAQPVYVDLSNAIAQFQQNKIDIMPAPVYGLLPYNLQKD
FT                   FGPDTQVINFPLAYFGVNIIIKPQAYPANFGRKIRAWFVQNSQLLTNRAIQWENHLPAY
FT                   YWVDVSFYEKQSYDIMVAKIRNQYVRSGYYDAYFVELMKRLRCIDDPRYFECPMSR"
FT   gene            complement(420974..423547)
FT                   /gene="plsB"
FT                   /locus_tag="ABAYE0397"
FT   CDS_pept        complement(420974..423547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="ABAYE0397"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /function="1.6.1 : phospholipid"
FT                   /EC_number="2.3.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85371"
FT                   /db_xref="GOA:B0V6Y0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85371.1"
FT                   /translation="MSKSGFGQMYRRLSSKLLDLVVTPHVLGEVPTEPVSATTETEAKT
FT                   ERQKVVCYVLQNHSRSNALVVDGETRRLNLKPALDPLVIGTHQEKASVLFLQHNDENNL
FT                   LNPPPHAFPPRLIKLIEVLQANPELDIELVPVTVLWGRSPDKEDSWFKLLFSDTWATPS
FT                   TVKQLVNIGLHGRQSYLEFHEPQSLRDLVEYAQKHYPNLSPATYIVSTLNDYLDRQREV
FT                   VLGPDLSDRRNVMQSVLKSRDVQEAIRRESIRGKISMLEAERRAIGYVNEIVSDYSHSA
FT                   VRFADLALTRLWTQLYDGVEVHNFSTVRELAKDYEIVYTPCHRSHIDYLLLSYVIYKRG
FT                   LMVPYIAAGDNLNLPFVGQLLRGGGAFFIRRSFRGNGLYTSVFKEYLYSILSRNTPLEY
FT                   FIEGGRSRTGRLLPPKTGMLAMTVHSHLRGRAKPIVFVPTYIGYERLMEGSTYVGEMQG
FT                   KPKEAESIFGILKTLRKIERIFGKVHVNFGEPVFLDDLLKQHNAENVYIEKNDDPVPPA
FT                   VSEAVNSSANAILENINRAVVINPVSLLSIILLATPKHTLDEEICIKQLEAYRNLASNF
FT                   PYDQRTEVTPLSGKEIIAYGLKLKLIKRVQHALGDIIAIEDNQAVLLTYFRNNILHAFV
FT                   LPSLIASLVEHNGKISLADLSNVIYTLYPFLKAELFLKWKSSELKEQIEQYADALVQSN
FT                   LIQQDDEGNLISSAPNTEEHNQLVVLATPVKQSLERYYMTLALITQRGSGNISAKQVEE
FT                   LSHLLGQRLSVLYEFNSPEFFDKALFQSFIKVLTQQNYIRTNDQGQIEFDDNFRQMAAG
FT                   AQLVLDEVTLQMLQHITTFTDEELKEALEAMASQQAKRRLKRKKA"
FT   gene            423823..424695
FT                   /gene="tesB"
FT                   /locus_tag="ABAYE0398"
FT   CDS_pept        423823..424695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ABAYE0398"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85372"
FT                   /db_xref="GOA:B0V6Y1"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85372.1"
FT                   /translation="MNALTQELVELLTLEKLEENIYRGISRNLVGKRVFGGQVLGQALR
FT                   AASYTTDRPAHSLHAYFLYGGDINAPIIYEVDRLRDGKSFVSRQVRAIQHGRVIFSAMV
FT                   SFANPEEGLNYQHPEPDYPAPEALKSESELKEGILNFVPENVRASFMRERHVEIRPIDP
FT                   VNPFQPQPEAPFNAHYIRTHDRIPKQLDDISLHQAIVAFYSDFTLMTTALRPHGLSYIS
FT                   PSLQCASIDHAIYFHRPLRADEWMLYDMEATVSAASRGLNFGRMWQNGQLVCSTVQEGL
FT                   MRLREIETQ"
FT   gene            424829..426067
FT                   /locus_tag="ABAYE0399"
FT   CDS_pept        424829..426067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0399"
FT                   /product="putative Proton/sodium-glutamate symport protein"
FT                   /function="4 : transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85373"
FT                   /db_xref="GOA:B0V6Y2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85373.1"
FT                   /translation="MNLNTQILIAAILGLAFGFLLTMYPDTAFVKHSLYGLGILSSVFI
FT                   GLLKMLLVPLIFSSIVVGVSNLQAGGQLGPVWKITFLCCITTTTLALILGISCAHLFEV
FT                   GRGVDISIFQASMQSYQTPDSLNPATFFTNFIQNTLINPFKAFSDGNVLAVVVFALFVG
FT                   VALVHGGERFKSIRVLSHQFFEMMMMLVGWVMKLAPLGIFALLAKLMATEDISVLSRLA
FT                   EFAAVVTGTTIFHGAVVLPLLLWIFGRMSPWTFFKGTRTALITAFATSSSSATMPLSMK
FT                   CAQENLGVRPQTAGFVIPLGTQLNMDGTALYEAAAALFVANLVGLDLNLTQQIVVCLTA
FT                   MIASLGAPGIPSAGMVTMIMVLQSVGLPAEAIAILLPIDRLLDTVRTVVNVQGDMMISV
FT                   VVDRYTKDKDISI"
FT   gene            complement(426110..427060)
FT                   /locus_tag="ABAYE0400"
FT   CDS_pept        complement(426110..427060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85374"
FT                   /db_xref="GOA:B0V6Y3"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85374.1"
FT                   /translation="MMKLLSFLKNKALGSSIDYKILPRKVKFDWKDTPIDWIPNQPFAS
FT                   YFINEINNILPAGEFWFCRLYNKVLPRITDEKLKQDVQAFIRQEAMHANAHTSANKEYL
FT                   SARNIDIQRNLDIMNYLFTTALADKPFDKEVPQFLQEQWDLFRLGVIATVEHMTCVLGK
FT                   YALYNKRWEELGADPEMVDLVKWHGSEEIEHRTVAFDLYRHLGGGYIPRYYLSLAVIVL
FT                   VLGLWVDGAAHIMKQDPRFADAAKSRFFAAWVALEWYKISRKDNQVLPNPIWLIAQQID
FT                   YLMPWYDPVKEGSTEDAVSYLSQSPAAKRAELQAA"
FT   gene            complement(427184..427960)
FT                   /locus_tag="ABAYE0401"
FT   CDS_pept        complement(427184..427960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0401"
FT                   /product="putative GTPase, involved in coordination of cell
FT                   cycle (EngB)"
FT                   /function="5.2 : cell cycle physiology"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85375"
FT                   /db_xref="GOA:B0V6Y4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85375.1"
FT                   /translation="MRRSEKSKDTKARLAPKQKISYEKKPDPAITAYAVQSLNWLRQAE
FT                   FLMSAPKLALCVEDSGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFS
FT                   LGNPDQRLVDLPGYGYAAVPEDMKRVWQKELENYLIHRKSLQGLVLLMDIRHPLQHFDM
FT                   MMLEWAYSRHLFVHILLTKADKLNRGPANKVLLEVKQQLKKMKLDFSIQLFSSLNKLGL
FT                   EELASVMAGRLHFTLEQQPEFDVNAIPEASNEDAEE"
FT   gene            complement(428069..428515)
FT                   /locus_tag="ABAYE0402"
FT   CDS_pept        complement(428069..428515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85376"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85376.1"
FT                   /translation="MVIMQLNKFTDYALRILMYVARPSDAPYTIAEIAQDLYVSQNHLV
FT                   KVVHFMGKQEWIITIRGKGGGIRLNPKALDLKLGTIVRILQGDHQIVECNTPPCVLRSH
FT                   CGLKGILDQALESFYQSLDQYTLGEVLQQPKSASDHSPIAFLQI"
FT   gene            complement(428592..429356)
FT                   /locus_tag="ABAYE0403"
FT   CDS_pept        complement(428592..429356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0403"
FT                   /product="putative flavohemoprotein (Hemoglobin-like
FT                   protein) (Flavohemoglobin)"
FT                   /EC_number="1.5.1.34"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85377"
FT                   /db_xref="GOA:B0V6Y6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85377.1"
FT                   /translation="MTPQQIELVKSTVPVLREHGVTLTTYFYKRMLNNNPELKNVFNLD
FT                   DQTSLRQPRALAAAVLAYAENIENPTVLAKAVERITTKHVSLDIQPDQYAIVGDNLLHS
FT                   ISEVLNVPFESELIEAWKQAYLQLADILIGVEKQKYEQLESLKGGWAGWRSFEITQIDP
FT                   LESGKRFTLKATDHEDVLTSPANAFISVKVQVPNQQLEQPKAFKFTEAQEDNTYHFDVQ
FT                   PEEDHTEFSVSNILLEHYRVGDQVQVSAPLTL"
FT   gene            complement(429502..431049)
FT                   /locus_tag="ABAYE0404"
FT   CDS_pept        complement(429502..431049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0404"
FT                   /product="putative enzyme contains P-loop containing
FT                   nucleotide triphosphate hydrolase domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85378"
FT                   /db_xref="GOA:B0V6Y7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85378.1"
FT                   /translation="MGTPIVIAKNINDTSKEIVLLSQFANRHGLIAGATGTGKTVTLKV
FT                   LAESFSRIGVPVFLADAKGDVSSLAKAGEASDKFNERLKLLQIDSVPFAANPVVFWDLF
FT                   GQQGHPIRTTISEIGPILLARILNLNDTQEGVLSAVFRIADDQGLLLVDFKDLKAMITF
FT                   VSEHAAEFKAEYGNLSPASLGAIQRNLLALADQGGEQFFGEPALNILDFIQTDANGHGY
FT                   INILAADKLMNTPKLYATFLLWMLSELFEQLPEVGDMDKPKLVFFFDEAHLLFDNASQA
FT                   LQEKIEQVVRLIRSKGVGIYFITQNPLDLPESVLGQLGNRVQHALRAFTPKDQKAVKTA
FT                   ADTFRSNPDFKVDEAITELGVGEALISCLDEQGTPQIVERGWVMPPYSSFTPITPEERQ
FT                   TLISQSIIAGVYEQAVDRDSAYEMLQNKVAEREQQKQDAELAKQQAKEQETLAKQQAKE
FT                   QERLAREQQKEEERAARERAKLTQDIVGTFAKSAARSLGGSTGQKLVRGLLGSLFGK"
FT   gene            complement(431093..432283)
FT                   /locus_tag="ABAYE0405"
FT   CDS_pept        complement(431093..432283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0405"
FT                   /product="putative cystathionine beta-lyase, PLP-dependent
FT                   (beta-cystathionase) (MetC)"
FT                   /function="1.5.1.9 : Methionine"
FT                   /EC_number="4.4.1.8"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85379"
FT                   /db_xref="GOA:B0V6Y8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Y8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85379.1"
FT                   /translation="MKKHNNFQTQLIHAPRKAPQFIETVQPPLFRASTIIFKSTSHLFD
FT                   RHWTDPYDYSYGTHGTPTTFTLGDNIAQIEGGLYCLLAPSGLSAINLVNSAVLATGDEV
FT                   WVPDNIYGPNLEHLNYLKDQYGINVQVYNPIDVSSFHPSDKTKLLWLEAAGSVTLEFPD
FT                   LKALVKKAKAHGVLTALDNTWGAGLAFNAFDFSDEHLSVDLTIHALTKYPSGGGDILMG
FT                   SVVTRDEELHHRLFRMHAILGISVSGDDTAQIQRSLAHMSLRYEQQSNNAKTLLTWLKE
FT                   QSQFAQVLHPSDKASPGHQYWQEICSTGRSAGLVSVVFKSDYDISAVRRFCDALKLFKL
FT                   GFSWGGPVSLVMLYDLKMMRKLENTHLQQGLLVRFCIGLEDPQDLIQDIENALKQM"
FT   gene            432394..433179
FT                   /locus_tag="ABAYE0406"
FT   CDS_pept        432394..433179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85380"
FT                   /db_xref="GOA:B0V6W6"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6W6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85380.1"
FT                   /translation="MALFLQRSNQHSNNNRFKRMKSHLRVHYFQHIAGEGFGSCYSFLK
FT                   AHHATITATEFFALPVDLPLEIEALPHIEDVDLLLIMGGTMSVNDEANYPWLKIEKRWI
FT                   RRYLAAGKPAIGLCLGGQLIANALGAAVSRNRYQELGWSTVQRVPNLPKESFLLPEKIN
FT                   VMQWHSETFEIPKGAIHLAENSVCRNQMYQIGSNVLGFQFHPEMTPKVLNLLLENEQEL
FT                   SIFKGEYVQSLDELHHCDIQKFEQGNQLLNRAIEFVVNQ"
FT   gene            433416..433742
FT                   /gene="rpsJ"
FT                   /locus_tag="ABAYE0407"
FT   CDS_pept        433416..433742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="ABAYE0407"
FT                   /product="30S ribosomal protein S10"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85381"
FT                   /db_xref="GOA:B0V6W7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6W7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85381.1"
FT                   /translation="MEFTGMSNQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPI
FT                   PMPTRIERFNVLTSPHVNKDARDQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQ
FT                   IALG"
FT   gene            433800..434438
FT                   /gene="rplC"
FT                   /locus_tag="ABAYE0408"
FT   CDS_pept        433800..434438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="ABAYE0408"
FT                   /product="50S ribosomal protein L3"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85382"
FT                   /db_xref="GOA:B0V6W8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6W8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85382.1"
FT                   /translation="MAIGLVGRKCGMTRIFTDAGVSVPVTVIEVDPNRITQIKTLETDG
FT                   YQAVQVTTGERRESRVTNAQKGHFAKAGVAAGRLVKEFRVTEAELEGREVGGTIGVDLF
FT                   TVGQIVDVTGQSKGKGFQGGVKRWNFRTQDATHGNSVSHRVLGSTGQNQTPGRVFKGKK
FT                   MAGHLGDERVTVQGLEIVSVDTERSVLVVKGAIPGATGGDVIVRPTIKA"
FT   gene            434450..435052
FT                   /gene="rplD"
FT                   /locus_tag="ABAYE0409"
FT   CDS_pept        434450..435052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="ABAYE0409"
FT                   /product="50S ribosomal protein L4, regulates expression of
FT                   S10 operon"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="3.1.2 : transcriptional level"
FT                   /function="3.1.3.1 : translation attenuation and
FT                   efficiency"
FT                   /function="3.3.1 : operon"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85383"
FT                   /db_xref="GOA:B0V6W9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6W9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85383.1"
FT                   /translation="MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAH
FT                   KSRADVSGGGKKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAM
FT                   QCILAELVRQDRLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNL
FT                   PHVDVVDATAIDPVSLIAFDKVVMSVAAAKKIEVELG"
FT   gene            435049..435369
FT                   /gene="rplW"
FT                   /locus_tag="ABAYE0410"
FT   CDS_pept        435049..435369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="ABAYE0410"
FT                   /product="50S ribosomal protein L23"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85384"
FT                   /db_xref="GOA:B0V6X0"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85384.1"
FT                   /translation="MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKA
FT                   VEKLFGVEVVKVNTTITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESA
FT                   AE"
FT   gene            435381..436205
FT                   /gene="rplB"
FT                   /locus_tag="ABAYE0411"
FT   CDS_pept        435381..436205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="ABAYE0411"
FT                   /product="50S ribosomal protein L2"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85385"
FT                   /db_xref="GOA:B0V6X1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85385.1"
FT                   /translation="MPIQKCKPTSPGRRFVEKVVHDHLHKGAPYAPLVEAKKRTGGRNN
FT                   NGHITTRHVGGGHKQHYRIVDFKRNKDGVPAVVERIEYDPNRTAHIALLKYADGERRYI
FT                   IAPKGLRAGDKVQSGNDAPIRPGNCLPLRNMPIGSTLHNVELKIGKGAQLARSAGASVQ
FT                   LLGRDGSYAIIRLRSGEMRKVHVECRAVIGEVSNQENNLRSLGKAGAARWRGVRPTVRG
FT                   MAMNPIDHPHGGGEGRNKGIQPVSPWGQKAKGYKTRTNKRTTKMIIRDRRVK"
FT   gene            436219..436494
FT                   /gene="rpsS"
FT                   /locus_tag="ABAYE0412"
FT   CDS_pept        436219..436494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="ABAYE0412"
FT                   /product="30S ribosomal protein S19"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85386"
FT                   /db_xref="GOA:B0V6X2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85386.1"
FT                   /translation="MPRSLKKGPFVDAHLFAKVEAAVASNSRKPIKTWSRRSMILPDFV
FT                   GLTISVHNGRNHVPVIVTEHMVGHKLGEFAPTRTYRGHGVDKKSKR"
FT   gene            436503..436835
FT                   /gene="rplV"
FT                   /locus_tag="ABAYE0413"
FT   CDS_pept        436503..436835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="ABAYE0413"
FT                   /product="50S ribosomal protein L22"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85387"
FT                   /db_xref="GOA:B0V6X3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85387.1"
FT                   /translation="MMEVTAKLRGAAISAQKARLVADLIRGKSVAHALNILNFSNKKAA
FT                   VLVKKALESAIANAEHNNSLDVDDLKVSTIYVDEGMSLKRIMPRAKGRADRITKRTCHI
FT                   TVKVGV"
FT   gene            436837..437589
FT                   /gene="rpsC"
FT                   /locus_tag="ABAYE0414"
FT   CDS_pept        436837..437589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="ABAYE0414"
FT                   /product="30S ribosomal protein S3"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85388"
FT                   /db_xref="GOA:B0V6X4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85388.1"
FT                   /translation="MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTK
FT                   KLKNAMVSNILIERPSGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSIN
FT                   EIDRPDLDARLVAEAIASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEE
FT                   RPAKRGRGRGEGQERRGRRGDRAADKGE"
FT   gene            437593..438006
FT                   /gene="rplP"
FT                   /locus_tag="ABAYE0415"
FT   CDS_pept        437593..438006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="ABAYE0415"
FT                   /product="50S ribosomal protein L16"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85389"
FT                   /db_xref="GOA:B0V6X5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85389.1"
FT                   /translation="MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTAR
FT                   QIEAARRTISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPGKILY
FT                   EIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM"
FT   gene            438006..438203
FT                   /gene="rpmC"
FT                   /locus_tag="ABAYE0416"
FT   CDS_pept        438006..438203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="ABAYE0416"
FT                   /product="50S ribosomal protein L29"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85390"
FT                   /db_xref="GOA:B0V6X6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85390.1"
FT                   /translation="MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQV
FT                   ARKTIARIKTLLTEKQGNGQ"
FT   gene            438200..438457
FT                   /gene="rpsQ"
FT                   /locus_tag="ABAYE0417"
FT   CDS_pept        438200..438457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="ABAYE0417"
FT                   /product="30S ribosomal protein S17"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85391"
FT                   /db_xref="GOA:B0V6X7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6X7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85391.1"
FT                   /translation="MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKL
FT                   HAHDENNVAKIGDVVTIKESRPISKTKAWTLVEVVEAAAE"
FT   gene            438550..438918
FT                   /gene="rplN"
FT                   /locus_tag="ABAYE0418"
FT   CDS_pept        438550..438918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="ABAYE0418"
FT                   /product="50S ribosomal protein L14"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85392"
FT                   /db_xref="GOA:B0V6V5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6V5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85392.1"
FT                   /translation="MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKE
FT                   AIPRARVKKGDVMNAVVVRTKFGIRRPDGSVIRFDDNAAVILNNNKAPIATRIFGPVTR
FT                   ELRTEQFMKIISLAPEVL"
FT   gene            438928..439245
FT                   /gene="rplX"
FT                   /locus_tag="ABAYE0419"
FT   CDS_pept        438928..439245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="ABAYE0419"
FT                   /product="50S ribosomal protein L24"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85393"
FT                   /db_xref="GOA:B0V6V6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6V6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85393.1"
FT                   /translation="MAKIKKGDQVIVIAGKEKGKQGTVLSVSEDRVKVEGLNLVKKHQK
FT                   PNRVTGAEGGIVTQEASLHISNVAILNATTQKADRVGYQVIDGVKTRVYKSTGESVAVA
FT                   K"
FT   gene            439261..439797
FT                   /gene="rplE"
FT                   /locus_tag="ABAYE0420"
FT   CDS_pept        439261..439797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="ABAYE0420"
FT                   /product="50S ribosomal protein L5"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85394"
FT                   /db_xref="GOA:B0V6V7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6V7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85394.1"
FT                   /translation="MARLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAAT
FT                   DKKLLDGAVADMQLIAGQKPVVTLARKSIAGFKIRDGWPIGCKVTLRGDQMYEFLDRLI
FT                   SIAIPRIRDFRGFSAKSFDGRGNYSMGLKEQIVFPEIDFDKIDRIRGMDITITTTARTD
FT                   DEGRALMRAFGFPFK"
FT   gene            439807..440112
FT                   /gene="rpsN"
FT                   /locus_tag="ABAYE0421"
FT   CDS_pept        439807..440112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="ABAYE0421"
FT                   /product="30S ribosomal protein S14"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85395"
FT                   /db_xref="GOA:B0V6V8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6V8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85395.1"
FT                   /translation="MAKKGMINRELKREKTVAKYAAKRAELKATIANVNASDEERFEAM
FT                   LKLQALPRNASPVRLRNRCGLTGRPHGYFRKFGLSRNKLRDTVMQGDVPGVVKASW"
FT   gene            440124..440519
FT                   /gene="rpsH"
FT                   /locus_tag="ABAYE0422"
FT   CDS_pept        440124..440519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="ABAYE0422"
FT                   /product="30S ribosomal protein S8"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85396"
FT                   /db_xref="GOA:B0V6V9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6V9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85396.1"
FT                   /translation="MSMQDTVADMLTRVRNAQMAKKQTVSMPSSKLKVAIANVLQQEGY
FT                   ISNVEVAQEETKSTLTITLKYFEGKPVIEMVKRVSRPGLRQYRGKDKLPSVKQGLGIAI
FT                   VSTSKGIMTDRAARAAGIGGEVIAFVS"
FT   gene            440533..441066
FT                   /gene="rplF"
FT                   /locus_tag="ABAYE0423"
FT   CDS_pept        440533..441066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="ABAYE0423"
FT                   /product="50S ribosomal protein L6"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85397"
FT                   /db_xref="GOA:B0V6W0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6W0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85397.1"
FT                   /translation="MSRVAKAPVTVPNGVTVTQNGRQVEVKGSKGTLSFNLHALVELKQ
FT                   EEGKLQLAPAKESKDAWMQAGTARAVLNNLVKGVSEGFERKLQLVGVGYKAAVKGTVVN
FT                   LNLGYSHPIDYALPEGVTAETPTATEIILKSANKQLLGQVAAEIRAYRSPEPYKGKGVR
FT                   YSDEVILRKEAKKK"
FT   gene            441081..441431
FT                   /gene="rplR"
FT                   /locus_tag="ABAYE0424"
FT   CDS_pept        441081..441431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="ABAYE0424"
FT                   /product="50S ribosomal protein L18"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85398"
FT                   /db_xref="GOA:B0V6W1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6W1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85398.1"
FT                   /translation="MNEKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADG
FT                   GKVLAQASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRIKA
FT                   LADAAREGGLEF"
FT   gene            441434..441931
FT                   /gene="rpsE"
FT                   /locus_tag="ABAYE0425"
FT   CDS_pept        441434..441931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="ABAYE0425"
FT                   /product="30S ribosomal protein S5"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85399"
FT                   /db_xref="GOA:B0V6W2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6W2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85399.1"
FT                   /translation="MAKVEQNEGLVEKLVAVDRVAKVVKGGRIFSFTALTVVGDGNGRV
FT                   GFGRGKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGV
FT                   IAGGAMRAVLEAAGVHNVLAKCYGSTNAANVVNATFKGLRDMTSPEKVAAKRGKSVEEI
FT                   QG"
FT   gene            441938..442114
FT                   /gene="rpmD"
FT                   /locus_tag="ABAYE0426"
FT   CDS_pept        441938..442114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="ABAYE0426"
FT                   /product="50S ribosomal protein L30"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85400"
FT                   /db_xref="GOA:B0V6W3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6W3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85400.1"
FT                   /translation="MKTIKVTQTKSSSHRLKNHKLCLQGLGLRRIGHTVEVQDTPSNRG
FT                   MINKVYYMVSVEE"
FT   gene            442118..442558
FT                   /gene="rplO"
FT                   /locus_tag="ABAYE0427"
FT   CDS_pept        442118..442558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="ABAYE0427"
FT                   /product="50S ribosomal protein L15"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85401"
FT                   /db_xref="GOA:B0V6W4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6W4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85401.1"
FT                   /translation="MTLRLNELAPAEGAKREHRRLGRGIGSGVGKTGGRGIKGQKSRKS
FT                   GGVRPGFEGGQTAIYRRLPKFGFTSQIALKTAEVRLSELSKVEGDIVSLETLKAANVVR
FT                   RDQIRARIVLSGEITRAFTVQGVALTKGAKAAIEAAGGKVEE"
FT   gene            442565..443923
FT                   /gene="secY"
FT                   /locus_tag="ABAYE0428"
FT   CDS_pept        442565..443923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="ABAYE0428"
FT                   /product="secretion protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85402"
FT                   /db_xref="GOA:B0V6W5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6W5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85402.1"
FT                   /translation="MSMSPSSSGHVNMMKGQPFHVKYREIIRRMSFLIGALLVFRLGAH
FT                   IPVPGINNAALENLFHANQGTILGLFNMFSGGALERMSILALGIMPYISASIIVQLMST
FT                   VIPSLEALKKEGEQGKRKINQYTRQGTLLLAVVQAVGMCAGLIGQGITLSSGLAFYIPA
FT                   VTSLVAGTMFLMWLGEQITERGIGNGISMIIFAGIVAGLPKLIMQSVSSVDNGQTSLIG
FT                   LVIFGLLSLGVLAAIVFIEKAQRRIPVNYAQKQQGRRIFTAQQTHLPLKINMAGVIPAI
FT                   FASSLLLFPASLGQWVGSADPNAGLIKRSLQDLALVLSPGQPLYLVLFGALIIFFCYFY
FT                   TALVFSPKEVSENLKRSGAYVPGIRPGEQTARYLDHILNRLTFIGAIYITVICLMPMIL
FT                   QSSFGIPFYLGGTSLLIVVVVVMDFMAQLQAHLTSHQYDNQTLMRKTTAHPKG"
FT   gene            443944..444060
FT                   /gene="rpmJ"
FT                   /locus_tag="ABAYE0429"
FT   CDS_pept        443944..444060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="ABAYE0429"
FT                   /product="50S ribosomal protein L36"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85403"
FT                   /db_xref="GOA:B0V6U3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6U3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85403.1"
FT                   /translation="MKVQASVKKICGSCKVIRRNGVIRVICSAEPRHKQRQG"
FT   gene            444168..444524
FT                   /gene="rpsM"
FT                   /locus_tag="ABAYE0430"
FT   CDS_pept        444168..444524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="ABAYE0430"
FT                   /product="30S ribosomal protein S13"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85404"
FT                   /db_xref="GOA:B0V6U4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6U4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85404.1"
FT                   /translation="MARIAGVNIPDNKHAVISLTYIFGIGRHTAKNILAAVGITETTKI
FT                   RELDDAQLDAIRAEVAKVPTEGDLRREISMNIKRLMDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            444544..444930
FT                   /gene="rpsK"
FT                   /locus_tag="ABAYE0431"
FT   CDS_pept        444544..444930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="ABAYE0431"
FT                   /product="30S ribosomal protein S11"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85405"
FT                   /db_xref="GOA:B0V6U5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6U5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85405.1"
FT                   /translation="MAKDTRTRKKVTRTVSEGVAHIHASFNNTIVTITDRQGNALAWAT
FT                   SGGQGFRGSRKSTPFAAQVAAEVAGKAALDYGLKNLDVLVKGPGPGRESAVRALGAVGY
FT                   KINSITDVTPIPHNGCRPPKKRRV"
FT   gene            444943..445569
FT                   /gene="rpsD"
FT                   /locus_tag="ABAYE0432"
FT   CDS_pept        444943..445569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="ABAYE0432"
FT                   /product="30S ribosomal protein S4"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85406"
FT                   /db_xref="GOA:B0V6U6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6U6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85406.1"
FT                   /translation="MARYIGPKCKLSRREGTDLQLKSGVKPFDVKTKKANKAPGQHGQA
FT                   RGGKQSEYSLQLREKQKVRRIYGVLERQFSNYYKEAARVKGATGENLLKLLESRLDNVV
FT                   YRMGFGSTRAEARQLVSHRSITLNGRRVNIASIQVKAGDVIAVHEGAKQQLRIKNAIEL
FT                   AAQRGIPAWIEVDHSKLEGTFKAAPDRSDLPAEINESLIVELYSK"
FT   gene            445587..446594
FT                   /gene="rpoA"
FT                   /locus_tag="ABAYE0433"
FT   CDS_pept        445587..446594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="ABAYE0433"
FT                   /product="RNA polymerase, alpha subunit"
FT                   /function="2.2.2 : transcription related"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85407"
FT                   /db_xref="GOA:B0V6U7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6U7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85407.1"
FT                   /translation="MTRTANEFLTPQAIKVEAVSGTSAKVILEPLERGFGHTLGNALRR
FT                   ILLSSLPGAAVVEVEIEGVEHEYSTLEGLQQDIVELLLNLKGLSIKLFDQNEAYLTLEK
FT                   QGPGDITAADLRLPHNVEVVNPEHLIGTLSATGSLKMRLKVSQGRGYETSDSRFPEGET
FT                   RPVGRLQLDASYSPIKRVSYTVENARVEQRTDLDKLVIDLETNGTVDPEEAIRKAATIL
FT                   QQQIAIFVDLQKDQTPVAQEPREEVDPILLRPVDDLELTVRSANCLKAENIYYIGDLVQ
FT                   RTEVELLKTPNLGKKSLTEIKDVLASKGLQLGMRLENWPPASLRMDDRFAYRSR"
FT   gene            446613..446990
FT                   /gene="rplQ"
FT                   /locus_tag="ABAYE0434"
FT   CDS_pept        446613..446990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="ABAYE0434"
FT                   /product="50S ribosomal protein L17"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85408"
FT                   /db_xref="GOA:B0V6U8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6U8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85408.1"
FT                   /translation="MRHRNSGVKLGRTSSHRKAMFQNLANSLFEHELIKTTLPKAKELR
FT                   RVAEPLITLAKNDTVANRRLAFARTRNAATVGKLFTVLGPRYKERNGGYLRVLKAGFRA
FT                   GDAAPMAYVELVDREVNTSAE"
FT   gene            447171..448661
FT                   /locus_tag="ABAYE0435"
FT   CDS_pept        447171..448661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0435"
FT                   /product="putative monooxygenase, flavin-binding family"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85409"
FT                   /db_xref="GOA:B0V6U9"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6U9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85409.1"
FT                   /translation="MEKQVDVLIIGAGISGIGVAAHLSKNSPQRQFEILERRESFGGTW
FT                   DLFRYPGIRSDSDMSTFGFNFKPWRKANVLADGASIKGYLGEVIDEFKLKEKIHFGHRV
FT                   LSANYDSASKKWHVIVEDNKKKQQTWVANFVVGCTGYYNYDQGYAPTFPNQEAFKGQLI
FT                   HPQHWPENLDYKGKKVVIIGSGATAITLVPAMSKGGAGHVTMLQRSPTYIASVPSIDFI
FT                   YEKTRRFMSEEAAYKFTRARNIGMQRAIYALSQKHPKTVRRLLLKAIEMQLKGKVDMKH
FT                   FTPSYNPWDQRLCVVPDGDLFKILREGKASVETDQIEKFTETGIQLKSGKHLDADIIVS
FT                   ATGLQVQIMGGVQATIDGEPVKSSEHMLYNGVMLSDVPNMAMIIGYVNASWTLKVDIAA
FT                   DYICRLLNYMDKNNYDEVIPSGDKSVMEEDTVMGSLSSGYISRAADVIPKQGKQAPWQV
FT                   TNNYLEDRKSLKNAKFDDGVLRFHKHSEVTTRKPKLVS"
FT   gene            complement(448711..449883)
FT                   /gene="fadE"
FT                   /locus_tag="ABAYE0436"
FT   CDS_pept        complement(448711..449883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="ABAYE0436"
FT                   /product="acyl coenzyme A dehydrogenase"
FT                   /EC_number="1.3.99.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85410"
FT                   /db_xref="GOA:B0V6V0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6V0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85410.1"
FT                   /translation="MQSGAIRPIPNMLPRHLFNEEHEAFRETVRKFYEKEVVPNIEKYE
FT                   KQQHVDRDLWNKAGALGLLCTTMPEQYGGSGVDRLYSMILIEEQAYAMDSSTGFSLHSD
FT                   IVANYINNFGNEEQKQKWLPKMATGETVTAIAMTEPGTGSDLQAVRTTAVLDGDEYVIN
FT                   GSKIFITNGYLCDMAIVVCKTGNSDKGSANLSLIIVEADRAGFTKGKPLNKIGMKGQDT
FT                   CELFFDNVRVPKENLLGMEGMGFIMLMKELAWERMLVAIICQAGAEAAFAHTVQYTKDR
FT                   KAFGKPIGAFQNTRFKLAELRTEIDFCRTYLDRCMELQLDEKLSVEAAAAAKYKISDMF
FT                   SKVVDECLQLHGGYGYMLEYPIARAYIDHRANRIYAGTNEIMKELISRTL"
FT   gene            450071..450328
FT                   /locus_tag="ABAYE0437"
FT   CDS_pept        450071..450328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85411"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6V1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85411.1"
FT                   /translation="MSEEMTLEERKVIYRARRGLKEIDVYFDPYVKNYYLKADPAEKAL
FT                   FAELVEQEDPDLLDWFMEVSEPPRTELRDFIYKLKHYVHG"
FT   gene            450335..450724
FT                   /locus_tag="ABAYE0438"
FT   CDS_pept        450335..450724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85412"
FT                   /db_xref="GOA:B0V6V2"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6V2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85412.1"
FT                   /translation="MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISL
FT                   LFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTISRVKILKIIDYQIFIVIYFEGHKT
FT                   LTSIIWFDQMSLAEWKKLKTLEKLY"
FT   gene            451494..452579
FT                   /locus_tag="ABAYE0439"
FT   CDS_pept        451494..452579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0439"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85413"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6V3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85413.1"
FT                   /translation="MSKVQKICQGLAVSFLAASVLSGCSYVVKSGANVALGFTEKHVVP
FT                   PILAMQDAEMVCNTGSALTPAIMSTKGMGADPTRVAVLMYAASGVCAENQALEQELRYL
FT                   RASKAGQVTEAQDARIAQKRWAAIAAERQYAGYKLFADRWESKYKYHLGDSCPTMRSDI
FT                   DQTVYLLGMISGLQAVTNDINSGGSVNVPKDIAAIVERGMVCLDNQKFWGAPNATRAVI
FT                   WTLLPGANEGKPDPYETLKQSVQIGEQKGVRLSHALYAVAAQASGDDAKIRDALKTYAA
FT                   SQADDKPVNPNFKLIDSMAGLIVRGISDRYWTEHTGVRTGDDGMSHFWDEKNEGSAELD
FT                   ELFDGGAASEAPADTKTAPAQ"
FT   gene            452657..453223
FT                   /locus_tag="ABAYE0440"
FT   CDS_pept        452657..453223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0440"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85414"
FT                   /db_xref="GOA:B0V6V4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023826"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85414.1"
FT                   /translation="MKDHVLNKKVLLVAGCISVSACLQVFPDYFIYWRESLLGEFWRLW
FT                   TAHWVHVGWIHFLLNMMAFACLPFIFPHTKVWHILSLLFLLPPFISLVFYFYLPNIDAY
FT                   AGLSGVLHGLYTAVALVYLQYRKERNFAFLVLGLIVAKLIWENTFGQTGTAQLIGSPVL
FT                   TEAHLYGAIGGAIFGGCYWLIQRFK"
FT   gene            453411..455606
FT                   /locus_tag="ABAYE0441"
FT   CDS_pept        453411..455606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0441"
FT                   /product="putative integral membrane protein, transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85415"
FT                   /db_xref="GOA:B0V6T6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85415.1"
FT                   /translation="MQEYQEKRSGLGLLGYIWNEWISTFIILILLLMTLIIGTGEMIHG
FT                   QLLRIGERLYGDPATGMQYSFLRAEPEKPTCDRHPNIDAQVKEQMKANASDDFASFFGA
FT                   ASESDVRASLLAAQQQCEEKYQAYDKTIKYIEANPGVRTYRAIETGFFGIFKFGTENRA
FT                   ILLVFMVLISAITASLKYHHIGLRNPATKIDYKVYSLFMLIGNALLSFSVISQYRSVIN
FT                   SGVTPTYETVTIYWIWMILFVVLTLISLYQLFVSPPPKREGGNIGLALLSVPLYAYMAL
FT                   ITGIVFTFFMDYPMGQGIYLGLLVEFSGIFLNLALFIWAGMLLTQTRVMDLFLNVLRPW
FT                   NLAPETLTWLILIAAAVPTAYTGASGIFVIAAGAIIYKEVWNAGARRQYALAVSAMSGS
FT                   LGVVVRPCLLVVLIAMLDSRHVTSDELFGHGIYVFWLTAFIFLGVSLLLAEEKFRVNSP
FT                   KVALPGMARAFVPVIPYILITVVVLAFYKYALDTGMNEFTAPVILPLVLIAMILYDKMV
FT                   MPKEAPALNIHEAIVREHEKKSPFLQTHDPHSSQFRLGFGGALRFATSETVGHIGALII
FT                   LMALSASVGGLIERSEVVELLPTHLGSIYISLACIALLLAIIGMCTDPFGAVILVAATI
FT                   APVAYENGIHPIHFWMIVLVAFEFGYVTPPVALNHLLTRLSVGDDEVNAADAEAKEKYT
FT                   SFYYRYERWLLPIIVLFSSLVLVTYAPLILKLFGWYK"
FT   gene            complement(455754..456185)
FT                   /locus_tag="ABAYE0442"
FT   CDS_pept        complement(455754..456185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0442"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85416"
FT                   /db_xref="GOA:B0V6T7"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85416.1"
FT                   /translation="MPLQRKQNSKLLWILIGGLSILVVLFFAAQWFFKKTETSAPMVDP
FT                   QPASVPAPEKTTKPSESSEPVVQTQTANSQQLVNEDVLKQPIPAQESLAKEEVSKLNDI
FT                   HRQLQDQEATLKAQHADADQLIKLKEEQVKLLEAQVKQQ"
FT   gene            complement(456197..456424)
FT                   /locus_tag="ABAYE0443"
FT   CDS_pept        complement(456197..456424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85417"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85417.1"
FT                   /translation="MVRVIKMKKRFIAGAKCPKCEAIDRIVMLTTTEDEWIECIECGYS
FT                   ENRPTHIDEPETPAIPDEIGVIQFKPRRSD"
FT   gene            complement(456447..458501)
FT                   /gene="prlC"
FT                   /locus_tag="ABAYE0444"
FT   CDS_pept        complement(456447..458501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="ABAYE0444"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85418"
FT                   /db_xref="GOA:B0V6T9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85418.1"
FT                   /translation="MWLLAMTLQQATLPTPRFDQITLDNLKQDIQQAIQAGQEFLNTLT
FT                   AAPSETDQQLAVLEQIDALENNLSESWGVLSHLNAVMNNAETREVYQSLLPALSEYYTQ
FT                   LGQHTALYQTYQLIHDGQSYSTLSPAQQSAIRLALRDFKLSGVALEGEDKKRYAEISAR
FT                   LSQLSSDFSNHVLDATQAYFKPLTEDELKGLPESNVELLKQYGKQRELDQAVATLDFPA
FT                   YFAIMTYADDRALREELYKAYVTRASDQSEQTEFDNSKIMEEILSLRQEMAKLLGFNNY
FT                   AEYSLASKMAPDVKTVHDFLVDLAEHARTPALQEVAELQAIAKQDGIDELKPWDTTYYS
FT                   EKLKQQQFNLSQEALKPYFPAPKVIQGLFQIVQRLYGINIVEREAPVWHPDARYFELED
FT                   QGEVVGGFFFDLYARTGKRGGAWMSGFRSRMQTVHGLQKPICYMVCNFTPPVGNQPALL
FT                   THDEVITLFHEFGHGLHHMLTEVDNISVAGTHGVAWDAVELPSQFMEFWSWDKESLDVL
FT                   SEHIESKQTLPQELLDALLNARFFQSGMQTLRQLEFALFDLTIHTKTPALNSEQIQQTL
FT                   NDIRKQYAVVPTVDYNRFQHSFSHIFAGGYAAGYYSYKWAEVLASDAFDRFENEGIFNT
FT                   QTGKEFRQAILAVGGKDTALEAFVNFRGREPKIDALLRHQGWTNDNKTA"
FT   gene            complement(458635..461067)
FT                   /gene="rnr"
FT                   /locus_tag="ABAYE0445"
FT   CDS_pept        complement(458635..461067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="ABAYE0445"
FT                   /product="exoribonuclease R"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.4 : RNA degradation"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85419"
FT                   /db_xref="GOA:B0V6U0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6U0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85419.1"
FT                   /translation="MKPNDMTKNWVDPEAKAEAERYDNPIPSRTLILDTLEQLQTPQSH
FT                   AELVDHFHIQDQKSIEALSHRLSAMVRDGQLMKDGFKFQLVADQPTYEATVYINSKGLG
FT                   TAHIDGQDDLLLPERELRLVFNGDRVRVRQTSVDRKGKPWGFITEVIQHRVKQLIGKMS
FT                   VHDGEYFIQPNNPNQHQPIPLEKELVEHAKANVGDMLRVAIDTYPTREEFATAHIIQSM
FT                   ADKADTEIIIPQTILEFGLPYEFPDEVIKEAESFKEPAEQDREGRVDLRDLALVTIDGE
FT                   DARDFDDAVYAEKRPGGGYRVVVAIADVSHYVRLDSALNEEAEERGTSVYFPHFVLPML
FT                   PEALSNGLCSLNPHVDRLCMVCDLKLSRTGRVTGYEFYPAVMHSKARLTYTQVGQYFEG
FT                   ATDAIPKDRDIHKSLNTLFQLYQILKNLRVDRHAMEFETIETYMTFDELGGIKEILPRT
FT                   RNDAHKLIEECMLLANVAAAEYALEHDIPMLYRVHEAPEFSRIQKVKDFVKLLGLPFPD
FT                   QPTQADYQKVIEATKDRIDAPSIHAVLLRSMMQAYYGAKNAGHYGLAYEAYTHFTSPIR
FT                   RYPDLLLHRAIKAHLKQKPYPLSGAALDDAGEHFSQTERRADEASRSVTTWLKCHYMQQ
FT                   HLGDEFIGIVSAVTEFGLFVTLKDLYVDGMIHISQLGDDFFIYDQASQNLIGQNRGQVF
FT                   GLGDEVKIQVAGVNLEERKIDFQLIKQVTHAGRVVRSRAPRTTKTSTQATEEVFGKPSV
FT                   STDGEKPVRKKKEKGKPSSYSKKSGKKTSTKAEAKPEKVKKKAKPKKKKSNAKSKAD"
FT   gene            461314..461404
FT                   /locus_tag="ABAYEtRNA5"
FT   tRNA            461314..461404
FT                   /locus_tag="ABAYEtRNA5"
FT                   /product="tRNA-Ser"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            461415..461491
FT                   /locus_tag="ABAYEtRNA6"
FT   tRNA            461415..461491
FT                   /locus_tag="ABAYEtRNA6"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            461531..461607
FT                   /locus_tag="ABAYEtRNA7"
FT   tRNA            461531..461607
FT                   /locus_tag="ABAYEtRNA7"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            461715..462308
FT                   /locus_tag="ABAYE0447"
FT   CDS_pept        461715..462308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0447"
FT                   /product="conserved hypothetical protein;putative
FT                   HAD-superfamily subfamily IB, PSPase-like"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85420"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6U1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85420.1"
FT                   /translation="MNLALFDFDGTITHNDTFSLFLKFSLSKKTQILGGIRLAPYIAGY
FT                   KLGWVTDKTIRTKLCQVGYIGYDAASLICKGQEFAKKVIPSCIRENALERILWHKQQGD
FT                   QVVVVSASLSVYLESWCKSLDLDVICNQLEIDNGILTGYFIDGDCGYLEKVNRIKNKYD
FT                   LTQYSIIYAYGDTPNDYAMLELAHRKYYKWQEIN"
FT   gene            complement(462368..464791)
FT                   /locus_tag="ABAYE0448"
FT   CDS_pept        complement(462368..464791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85421"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6U2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85421.1"
FT                   /translation="MFLLKNLVSSISKVTQDLGNIVSITPVVNTGSSVNVNVSDINIAN
FT                   VSTTGLLSNVISTVTDTVSHTTTDLVSNVVGTVTGTVGSTNPIDTVTNIIGGVTGGITG
FT                   NPLEVVTDIIGGVTGGVVGGTSPISPVIDVVQGGIDILQGVESLKTEIINTGIETVADA
FT                   VIGVLPQAEHPVSEIADLGTLTFETSRDTVNGALEVVSDLVGGDIQGATESATGILDTL
FT                   ITNGTTATGIVTGVVGSVTDVIGGVTGGVDGNPLEVITDIIGGVTGGVDGNPLEVITDI
FT                   IGGVAGGVGGDNPLGVVTDIIGGVTGGIIGGGTSPISPVIDVVQGGIDILQGVESLKTE
FT                   IINTGIDTVADTIIGVLPQAEHPVSEIADLGTLTFETSRDTVNGALEVVSDLVGGDIQG
FT                   ATENATGILGTLIQNGSTATGIVTDILGGVTGTIGGVTGGIGGDNPLGVVTDIIGGVTG
FT                   GIGGDNPLGVVTDIIGGVTGGIGGDNPLGVVTDIIGGVTGGIGGDNPLGVVTDIIGGVT
FT                   GGIGGDNPLGVVTDIIGGVTGGIIGGGTSPISPVIDVVQGGIDILQGVESLKTEIINTG
FT                   IDTVADTIIGILPQAEHPVSEIADLGTLTFETSRDTVNGALEVVSDLVGGDIQGATESA
FT                   TGILDTLITNGTTATGLVTEIIGGVTGTIGGVTGGDSPLGLVTDLLGGLTGSVGGDSPL
FT                   GVVTDLLGGLTGSVGGDSPLGVVTDLLGGLTGGITGGTDNPIGIVTDIVGSLTGGVTGE
FT                   GSLDVISNLLGGLTGGSLLGGVTSTVSSVTNTTHTIVPTSLLTDNFLENSFNTV"
FT   gene            465383..465459
FT                   /locus_tag="ABAYEtRNA8"
FT   tRNA            465383..465459
FT                   /locus_tag="ABAYEtRNA8"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(465582..466307)
FT                   /locus_tag="ABAYE0449"
FT   CDS_pept        complement(465582..466307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85422"
FT                   /db_xref="GOA:B0V6S4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85422.1"
FT                   /translation="MLLLSLFVEFVMSFFAKLFGFKQKTTAQEDVALKAAQELEPSNET
FT                   SFIELIKNRRSIYAIGNNLSQLNDEIEKLIQEAIRHSPSAFNSQSSRAVILFGQSHHKF
FT                   WNTVLEVLKTIIPAEAVSGTEQKIQSFAAGAGTVLFYEDQSVIKSLQEQFELYADNFPI
FT                   WSEHSTAIAQFAVWNVLAEQNIGASLQHYNPIIDEKINTSFNIPAEWKLRAQLVFGSIE
FT                   GAAGEKAFIDDESRFKTFG"
FT   gene            466496..466996
FT                   /locus_tag="ABAYE0450"
FT   CDS_pept        466496..466996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85423"
FT                   /db_xref="GOA:B0V6S5"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85423.1"
FT                   /translation="MMTEQKSALSLRYYLNLEESQDGFGLVTFGKKQFTRFLTPVISIA
FT                   IIIWGLYLGFSGVGRYYVALGVFFLVMQGLMRYWLLPMMFKRQFVRYQFGKSEQGIDLY
FT                   QDYFELYAAGRKQAVQYSEVQTFAKGKLTYMLELKNKTVIIVPKRAFAQASDQTIFENT
FT                   FKK"
FT   gene            467036..467677
FT                   /locus_tag="ABAYE0451"
FT   CDS_pept        467036..467677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85424"
FT                   /db_xref="GOA:B0V6S6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85424.1"
FT                   /translation="MKTRPSKIVCVGRSYADHVKELNNAMPGRPVLFIKPPSSLIGLDE
FT                   GISWNPAWGSCHFECEFVLRIDQPLKGETDPQKVLQAIGAVTLGLDLTLRDLQNELKDK
FT                   GQPWERAKAFDGSCVLADWVDVSEITNWEETRFNFHINDELRQDGNTALLMFNIAYLLV
FT                   DINQVFSLEPGDVIMTGTPAGVGPLNAGDQLKMTLKGATQDFVWETFVKA"
FT   gene            complement(467754..468593)
FT                   /locus_tag="ABAYE0452"
FT   CDS_pept        complement(467754..468593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0452"
FT                   /product="putative HTH-type transcriptional regulator (AraC
FT                   family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85425"
FT                   /db_xref="GOA:B0V6S7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85425.1"
FT                   /translation="MKNRQYISNFRQFSKMKKSAQRVQDFQEIPAHNAIPDLLWFRVRN
FT                   APAETVYPQHAHAWGEFIYAFSGVLEVNIDQINYLTPPPYGIWLPPYTKHSGINRNEVT
FT                   HATLYVHESLCQKLPQKAGILLTSPLVPALLDHLRQNPQDETQVEYIRLLQVLLDQLIQ
FT                   AELVGSYLPTTDHPALAKILNDLHQCPADNSTLQELAERINMTERTLARYSQKELGMSL
FT                   HEWRQRLKVMKAMTMLNQGKTIESIAFDLGYASASAFIYMFKRWMGFTPDQFRKLYQ"
FT   gene            468654..469568
FT                   /locus_tag="ABAYE0453"
FT   CDS_pept        468654..469568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0453"
FT                   /product="putative membrane protein"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85426"
FT                   /db_xref="GOA:B0V6S8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85426.1"
FT                   /translation="MEERKNLDTRASALMVLLCMVLGLQQVVLKIAAPDISPIMQIALR
FT                   SGLSAVLVLPLLWRDHSIHLFSYRQCKAGALVALFFSLEFYFVTQALKFTSTSHTVVLL
FT                   YTAPIFVALGLHWKFPTERLNRAQWGGIALAFMGIILTFYPTTTATNAPALAQVLLGDL
FT                   YALMAGLAWALSTIIVRLSPLAQAPATQTLFYQLFGCFVLLLLIAFLTNQTTIHFTTLA
FT                   ILSLSFQTLIVSFASLLLWFWLLRNYLASRLGIFSFLTPLFGVLFSILLLEEKLEIKFI
FT                   FGSILVLSGIVIMSLKQGKANSS"
FT   gene            complement(469589..470836)
FT                   /locus_tag="ABAYE0454"
FT   CDS_pept        complement(469589..470836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0454"
FT                   /product="putative ribonuclease (Rbn)"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85427"
FT                   /db_xref="GOA:B0V6S9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85427.1"
FT                   /translation="MLERFLKKLPFYNKTWFQFILFVIKRFEADRCREQAGSLTYTTLF
FT                   AVVPMLTVFLVIISSIKALEPARQQLQHLIYSNFLPKSTIAFDKALNAFTEKSSNLTVI
FT                   GVLFLFVTTVLMLTSIETVFNRIWRVKETRSGIVGFMRYWTIISLGPIILGSAFVISST
FT                   VASMNLLSNNFTGYQLDGAFLLWLISFVLTILGFFILYWTIPNRTVPLYAAAIAACLSA
FT                   ALFETLKNLFSFVMSNFTSYEIIYGAFAAVPIFLLWVFLSWNIVLLGVEVSFALTAFHS
FT                   GKEQKRHPVLMLLDILELFYKKQKLGESVSDKEALEILGRGEVGRWPAYVLLLEEQNLV
FT                   KRTDKDEYVLVRNLSQVDFWSFFTALPYPLPLRQDVSNVHDDDEWMEKIGPALVESNDY
FT                   LAAKLSIPLSTIFEEK"
FT   gene            471094..471717
FT                   /gene="wrbA"
FT                   /locus_tag="ABAYE0455"
FT   CDS_pept        471094..471717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="ABAYE0455"
FT                   /product="tryptophan repressor binding protein"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /function="3.1.4 : regulation level unknown"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85428"
FT                   /db_xref="GOA:B0V6T0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85428.1"
FT                   /translation="MFFLTKFVKPMQPYILVLYYSKYGSTKEMAHLIANGVESAGVNVK
FT                   IRTVPNIATVVTEAEPSIPEEGDIYCTLEELANCAGLALGSPTRFGNMASEMKYFWDQT
FT                   TSLWLNGALHNKPACVFTSSGSMHGGQESTLLTMLPPLFHHGMMILGLPNSIPALSNTK
FT                   TGGTPYGASHVSGPRHDQSLSQDEKVLCEAQGKRLGEIVKKLHS"
FT   gene            complement(471770..472414)
FT                   /gene="xpt"
FT                   /locus_tag="ABAYE0456"
FT   CDS_pept        complement(471770..472414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="ABAYE0456"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85429"
FT                   /db_xref="GOA:B0V6T1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85429.1"
FT                   /translation="MHFFGCFLKYAFALKSIRLEDSPVHALEQKILTEGIVLSDQVLKV
FT                   DAFLNHQIDPVLMQQIGKEFAARFKDAGITKIITIEASGIAPAIMAGLELGVPVIFARK
FT                   YQSLTLKDDLYRAKVFSFTKQTESTIAISNKHINSSDKALVIDDFLANGQAALGLIDLI
FT                   HQANAEVVGVGIVIEKSFQPGRDLLLEKGYRVESLARVQSLADGTVTFVKE"
FT   gene            complement(472418..473131)
FT                   /locus_tag="ABAYE0457"
FT   CDS_pept        complement(472418..473131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0457"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85430"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85430.1"
FT                   /translation="MATKFLKSFSIATGISTTLLIASFSSHALAMSPFQANYQFTYNNK
FT                   GMGSATRALSQQGNNWTYQFTAKAGGIASASETSKFSFANGKIGSQSFSRTSKILIHNN
FT                   TMSINFNPGHKTISTKKDDKARSFAWQAGVLDELNAELQIREDLKNGSLKSSYPLADAK
FT                   EVENRRFVKQGNEKIKTSYGTFDTVKVVLQHKKPERSTIFWLAPKLDYLPVKVSHIDGK
FT                   TSYGLLLTSYTGKTN"
FT   gene            complement(473289..474002)
FT                   /locus_tag="ABAYE0458"
FT   CDS_pept        complement(473289..474002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85431"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85431.1"
FT                   /translation="MCGFFSKSSSGSSFMQTLFSSLVKRLHKVYRKAEAFIEEERDFTL
FT                   SQTFLNATLERYVTNNVEFLDDLHADLYHDWLRLYATMHVKGLETTLSVDLKLIQMEFN
FT                   KEQQLIVFEQISNTQIVEAKYKNFWQKIAVKAAIFYYHKILKKDPLGMILERFDVAQEK
FT                   DDLIFLDLNRWFAKKASIIETLGKVHINYARVREAELVVFGNVNLAALLFRDQDDDSED
FT                   ELEDTEITPIQQKDV"
FT   gene            474158..475075
FT                   /locus_tag="ABAYE0459"
FT   CDS_pept        474158..475075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0459"
FT                   /product="conserved hypothetical protein; putative
FT                   tonB-domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85432"
FT                   /db_xref="GOA:B0V6T4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6T4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85432.1"
FT                   /translation="MGKRHLYAFKIMLKKRSLSIEPFYYWWQDRVFIAAIILAILLHIF
FT                   VLLIHFAMPAPSEQSTKEIAISIRPTEDVIKHADFLAQADQQGSGAFREAHRMSSNSPA
FT                   PMPSDASTGEAQLETLEKVQQQRELKFEEKVLMTVLSWQKQAEESQRKKALEQLQSQFQ
FT                   AKAAMVASLEAQYLQRQQDFSRQQKIKTVDGIQAKKDASAAYLDKFREKVELYGNRYYP
FT                   EEAKQQQLKGEVRLMVILNAQGGIRAIRLLESSGHPVLDEAAKASVRRGAPFGRFDANM
FT                   KDISELRIIRTWRFDPAEAEFEVH"
FT   gene            complement(475165..475641)
FT                   /locus_tag="ABAYE0460"
FT   CDS_pept        complement(475165..475641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85433"
FT                   /db_xref="GOA:B0V6T5"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6T5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85433.1"
FT                   /translation="MKISLSLQQDFRSPELELKRAQLKKIIETTLRHVGYKEDCEIGIA
FT                   CVDLEESHQLNLQYREKDKPTNVLSFPSDIPEEVLPMLDALPLGDLVICIPVVLQEALE
FT                   QKKTAQNHFAHLLVHGVLHLLGYDHETSDEDAEEMEGLEIEILAKLNIANPYQE"
FT   gene            complement(475651..476739)
FT                   /gene="phoL"
FT                   /locus_tag="ABAYE0461"
FT   CDS_pept        complement(475651..476739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoL"
FT                   /locus_tag="ABAYE0461"
FT                   /product="phosphate starvation-inducible protein
FT                   (PhoH-like)"
FT                   /function="1.8.1 : phosphorous metabolism"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85434"
FT                   /db_xref="GOA:B0V6R3"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85434.1"
FT                   /translation="MTAAIRRTVTFPEISMERLKSILGAYNGHLKQIEQRLDVKITHRG
FT                   DVFYIDGEIDAVGRAEALLQRLYEETEASQQISADLLHLLIQSSQTERNFELVGEEMDE
FT                   HDAPMDVYFQTRKGRINPRGANQKRYVQRILQSDISFGVGPAGTGKTYLAVAAAVDMLE
FT                   RNEIQRILLVRPAVEAGEKLGFLPGDLTQKIDPYLRPLYDALYEMLGFEKVAKLIERQV
FT                   IEVAPLAYMRGRTLNHSFVILDEAQNTTPEQMKMFLTRLGFGSRAVITGDITQVDLPRG
FT                   QQSGLAHALRVLENIKEIHITRFHSRDVVRHQLVQKIVEAYEGWDGEQQRLNAEARAER
FT                   KARQEALIAENDTAADLQHQDA"
FT   gene            complement(476777..478228)
FT                   /locus_tag="ABAYE0462"
FT   CDS_pept        complement(476777..478228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0462"
FT                   /product="putative tRNA-i(6)A37 modification enzyme (MiaB)"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85435"
FT                   /db_xref="GOA:B0V6R4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6R4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85435.1"
FT                   /translation="MTVQTFIPNGAKAASENTVTQPTHTTDVSIKKLYIETQGCQMNEY
FT                   DSHRMADLLGDSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKLKEQNPDL
FT                   VIGVGGCVASQEGDNIQKRAPYVDMIFGPQTLHRLPQMLDQHHAQVEKPKKEKIKLVDI
FT                   SFPDIEKFDFLPEPRVEGFKAFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDVLAEIAG
FT                   LAEKGVREISLLGQNVNGYRGETFEGGICTFPELLRLVAEIPGIGRLRYTTSHPLEFSD
FT                   ELIQCYEDLPQMVSHLHLPVQSGSNDVLKAMKRNHTIDVYIDKIAKLRKIRPDMHLSSD
FT                   FIIGFPGETDENFAETLQFIKDLDFDHSYSFVYSKRPGTPASDLPDTTPEHVKKERLAQ
FT                   VQQVIKQSSIEKTDAMLGKIERVLIEKVSDQDPNILVGTADNTRLVTFVGDASWVGRFA
FT                   EIEITEIKTLNLVYGELLNLEPDVA"
FT   gene            478475..480460
FT                   /locus_tag="ABAYE0463"
FT   CDS_pept        478475..480460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0463"
FT                   /product="putative lytic murein transglycosylase, soluble
FT                   (Slt)"
FT                   /function="1.7.34 : peptidoglycan (murein) turnover,
FT                   recycling"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85436"
FT                   /db_xref="GOA:B0V6R5"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85436.1"
FT                   /translation="MRPGKKSSSNKSRVMKNKYAHRSWLGAVCLLGCSLSYAAEEQFND
FT                   ALNAANSGNTALLDQYQLAMQNDVLGYYPEYWKLNTNLGFQSPTSIVSFAQRYPQSAMA
FT                   EKLAADYVEEKVKQADFASAQPILPYVSNPDQAENCALAQVRAKSGDALVFAKYKDVWL
FT                   ATESQPESCIGLGRMMLSSPLMSTQDKQQRLWVQLRAGLSGQALATAQTLGLNLSLAQL
FT                   NQIQANPLNYLWSAPKTNDVDYAYLIFALGRLANNDLGNAFANVQRVAQGTPESVQKYL
FT                   YRTVAYIGGTTVMKNNFNREVLQYFDASYGYPLSPEEAEIYARQAIRFSAWESLIRAID
FT                   SMSVSQKQEDRWQYWLARATEQRGDSNSKNTAQRIYKKLAETGDDYHNLLAKDRLGVRY
FT                   NHQPYNDEPTASDLRRLDQNIHFNRAFTLRRINANPTYTNREWNWAVRQAYLQHDDGLL
FT                   LAAAKRAHDMGWYDRAIYAADRTTNKHNDTYRYVTPHKTNVVSHSYNAGIDPAWAYGLM
FT                   RQESRFVTSARSHVGAGGLMQIMPDTAKLIARQMGETYNPAALSEMNTNIRYGTFYLSM
FT                   IQGQLSNNPVLATAGYNAGPNRARRWQPDYQPIEADQYTETIPLLETRDYVKHVMTNAT
FT                   HYGVILGQGAQSLIQRMKVIPTRSSP"
FT   gene            480518..481180
FT                   /locus_tag="ABAYE0464"
FT   CDS_pept        480518..481180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0464"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85437"
FT                   /db_xref="GOA:B0V6R6"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85437.1"
FT                   /translation="MKYRDLGLQSISQLAWWIICASVGLLSSVLHAEPVNVQGYVMHVQ
FT                   MTPAVCALDPSKQKQRKCLEGYSLTITGLMPETTRTDCSTQSSATLSPLQAKVVARVMP
FT                   DNNARVQLWRSVGGCVPMNASQYFRTIINFAERLKIPANLTSSTNVEMQQSTLRQQFTK
FT                   LNPSLPQNGIRFTCQLSRSDVVLTEVKVCYTVNGQYKQCSNHVVSNCPSEITIKGSY"
FT   gene            481392..482378
FT                   /gene="mdh"
FT                   /locus_tag="ABAYE0465"
FT   CDS_pept        481392..482378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="ABAYE0465"
FT                   /product="malate dehydrogenase"
FT                   /function="1.3.4 : tricarboxylic acid cycle"
FT                   /EC_number="1.1.1.37"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85438"
FT                   /db_xref="GOA:B0V6R7"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V6R7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85438.1"
FT                   /translation="MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPV
FT                   EKAQQALKGVMMELDDCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLL
FT                   KVNGEIFIGQGQALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHN
FT                   RALTQVAQKAGVAVADIEKLTVWGNHSPTMYADYRFATANGESLKDKINDPAWNKDVFL
FT                   PTVGKRGAAIIEARGLSSAASAANAAIDHMRDWALGTNGKWVTMGVPSDGSYGIPEGVM
FT                   FGFPVTTENGEYKIVQGLEIDEFSRERINFTLNELEEERAAIADMVK"
FT   gene            482542..482787
FT                   /locus_tag="ABAYE0466"
FT   CDS_pept        482542..482787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85439"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85439.1"
FT                   /translation="MFEQQPTLQLLFEQLGLDSDDASIENFIRTHQLPAEQKLHEASFW
FT                   SQGQSDFLKSHWEKDDEWIVVIDELNEQLHEDSVKK"
FT   gene            complement(482836..483363)
FT                   /locus_tag="ABAYE0467"
FT   CDS_pept        complement(482836..483363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85440"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85440.1"
FT                   /translation="MSIETKAIVSRIGETDQLYLTENTPELALERAELRMQLVTLSRVR
FT                   QEQIHFLQEAIVLLEQARMEYEEMPMSLYLNLSLHLAKAYMLYFELNKEKRFALIAQQI
FT                   LKPLAHHQHGDIYFFLAYASAAQQESALTRHWLTKYLSTAQCDLELLHEHPIFNPVRHE
FT                   PWYKNLIKLRTH"
FT   gene            complement(483431..484036)
FT                   /locus_tag="ABAYE0468"
FT   CDS_pept        complement(483431..484036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85441"
FT                   /db_xref="GOA:B0V6S0"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85441.1"
FT                   /translation="MHSQPLPDCWNLDQILDDLNAHGFAIVNQAYSPEYHTQVAKECSH
FT                   HFDEFREAGIQNGVVSTIRSDHILWINESLPVAEQHVETLTSFCQHLNQAFFLGIKEVE
FT                   AHFACYNPGEFYALHRDNPQQKNDRIMSTVYYLHPQWQDDWGGQLRLQDKNNIWHIITP
FT                   EPNRLVIFQSNLLHEVLVSKQQRLSITAWLRSGNSIWV"
FT   gene            484154..485011
FT                   /locus_tag="ABAYE0469"
FT   CDS_pept        484154..485011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85442"
FT                   /db_xref="GOA:B0V6S1"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85442.1"
FT                   /translation="MNYRHHFHAGNFADVMKHVLLLQLLNRLNAKDKPYRYIDTHGGAG
FT                   KYDLSQAPAQKSGEFLTGIHRLVQLSDMEKRQAPEAIQQYLKLVEELRAQEGKGSYPGS
FT                   PWFALQGMREIDKATIFEMQRDVFQQLRHNIHDKRAGLHERDAYEGLLAVIPPKEKRGL
FT                   VMIDPPYELERKDFPQLVELLQSAYKKWPTGVFAVWYPIKDRAMIERFEKKMFKTGIRR
FT                   QLICEICVWPDDTPVGLNGCGLLVINPPWQFSEQADQALQWLFPHLRMQETGGHAAVRW
FT                   LVGE"
FT   gene            485053..485886
FT                   /gene="pssA"
FT                   /locus_tag="ABAYE0470"
FT   CDS_pept        485053..485886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="ABAYE0470"
FT                   /product="phosphatidylserine synthase"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /EC_number="2.7.8.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85443"
FT                   /db_xref="GOA:B0V6S2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85443.1"
FT                   /translation="MTNAPKPEQDLTHNEHSFDGITFEVVEEEDNPEGQKVKRRGIYLW
FT                   PNLITTAALLSGFYSIIASMNGEFAQAIYAIFLAALFDGLDGRVARAIGAQSAFGEQYD
FT                   SLSDLLAFGVAPAMLMYSWSLHDLGRIGLACCFVYTACAAFRLARFNVQIGVVDKRYFI
FT                   GIASPLAAIIIISLVWVARDYPFIFDLRDIAIQTINAVIMVVVGLLMISNIKYYSFKQM
FT                   DRKRVPFVVMLPVVLIFAAITYNIPMGILIVSIIYALSGFVTTLLAKKNNETIKT"
FT   gene            485893..486972
FT                   /locus_tag="ABAYE0471"
FT   CDS_pept        485893..486972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85444"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6S3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85444.1"
FT                   /translation="MRFSMPKLISEKNQLQQLSLNSNGGVVYQPARGFFKVVYQGLILP
FT                   NLPAPLRYFNYISLIGQPRIPLCYNANGIVTSAVDTATVLVSNSLHSVGHLKTYSIRRQ
FT                   CQLNPSRYQFDKTDLIEWQIPRVQLRRIDSEMSCDLIVQTPSDISNSSALQWGISDYWS
FT                   ILCHCEGEILYKGQKYEVNGLGRFKHARALHLPFLSLCFYTCQIINLNETTQVTLSQIR
FT                   NQWNIILFSRLDIQELGTQPLTFTEDVNFHIHRVYPKVETPHGREMYLPREFSWQCKKN
FT                   GKVIFELYGESRGDYKFGLAAGYIGSFRYQLSWNDQCLQGEGGYCEYIDCRPLRWQEKN
FT                   QNEKMLDKLLLLQPCLYKK"
FT   gene            487461..488915
FT                   /locus_tag="ABAYE_16s_5"
FT   rRNA            487461..488915
FT                   /locus_tag="ABAYE_16s_5"
FT                   /product="ribosomal RNA 16s"
FT   gene            489030..489106
FT                   /locus_tag="ABAYEtRNA9"
FT   tRNA            489030..489106
FT                   /locus_tag="ABAYEtRNA9"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            489162..489237
FT                   /locus_tag="ABAYEtRNA10"
FT   tRNA            489162..489237
FT                   /locus_tag="ABAYEtRNA10"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            489578..492479
FT                   /locus_tag="ABAYE_23s_5"
FT   rRNA            489578..492479
FT                   /locus_tag="ABAYE_23s_5"
FT                   /product="ribosomal RNA 23s"
FT   gene            492655..492769
FT                   /locus_tag="ABAYE_5s_5"
FT   rRNA            492655..492769
FT                   /locus_tag="ABAYE_5s_5"
FT                   /product="ribosomal RNA 5s"
FT   gene            492979..493329
FT                   /locus_tag="ABAYE0474"
FT   CDS_pept        492979..493329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85445"
FT                   /db_xref="GOA:B0V673"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B0V673"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85445.1"
FT                   /translation="MEYKGSCHCGQVKFAAEGELTEALSCNCSICQKKGSLLWFLPTNQ
FT                   VTVTLDSPDILANYTFNKHVINHHFCKNCGIHPYAQGIDAQGNSIFAINVRCIDDIDLE
FT                   KIKINYFDGRSV"
FT   gene            493310..493912
FT                   /locus_tag="ABAYE0475"
FT   CDS_pept        493310..493912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85446"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:B0V674"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85446.1"
FT                   /translation="MMGVLFNNYKVYSMMTKKQLTSKQIDMLLELLKNRFEKNIHRHKE
FT                   IDWANVRAKLIKSPDKLWTLQEMENTGGEPDVVAYNKQKDEYLFVDCSAETPKGRRSLC
FT                   YDREALESRKDHPPKNSAIDLVQEIGAELLTEEQYHQLQQLGEFDLKTSSWLATPEEIR
FT                   KLGGALFADRRYGRVFIYHNGAQSYYAARGFRCCLRV"
FT   gene            493989..495212
FT                   /locus_tag="ABAYE0476"
FT   CDS_pept        493989..495212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0476"
FT                   /product="putative acyl coenzyme A dehydrogenase"
FT                   /EC_number="1.3.99.13"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85447"
FT                   /db_xref="GOA:B0V6Q8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Q8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85447.1"
FT                   /translation="MVNMTRYVLELNKNIRTFLKMQLNPIYYNEQHIAFADNVRRFVQK
FT                   EMTPFVNEWDEAETFPRELYKKAAEIGLLGLGFSEEYGGIPDADPFYSLLAGIEMAKAG
FT                   SGGVHISLMVHTIGAPPIQYFGSEELKARVLPGIISGEKISALAITEPGGGSDVAALQT
FT                   KAVRDGDYYIVSGEKTFITSGIRADYYTVAVRTDPTKTGAEGISMLLIDAHSEGITKTP
FT                   LKKMGWWASDTAHLHFDQVRVPVSNLLGKENAGFKVIMNNFNMERFFLGVVAYGYALVC
FT                   YEEALEWAQQRKTFGKRLIDHQVVRHKLVDMATQLTSTRALLEETAWKMTQLKLQGPEL
FT                   VAQISMLKNVATRTMQFCADAAVQTLGGMGFMRGTKSERIYREVKVNMIGGGAEEIMKD
FT                   LISKQLGY"
FT   gene            complement(495244..495891)
FT                   /locus_tag="ABAYE0477"
FT   CDS_pept        complement(495244..495891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0477"
FT                   /product="putative transcriptional regulator (TetR family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85448"
FT                   /db_xref="GOA:B0V6Q9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6Q9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85448.1"
FT                   /translation="MKISTIDFLIKEQTEHMIATSIEQIPNIPCFDDSPRGRLLHGAAY
FT                   LFHKQGYDKTTVRELAQFIGIQSGSLFHHFKSKDDILAHVMEQTIIYNLARLNDAATQS
FT                   TDPEQQLRALIKAELISITGDTGAAMAVLVYEWFALSKEKQDYLLKMRNEYEQIWLDII
FT                   EKLRTQGKVKHDAFIWRRLIGGAISWTVTWYKSEGKVKIDELTEMVWEMALK"
FT   gene            496018..497835
FT                   /locus_tag="ABAYE0478"
FT   CDS_pept        496018..497835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85449"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85449.1"
FT                   /translation="MRNRMANNQQDDHRVVKIGCASGFWGDTNTAAFQLVHLTDINYLV
FT                   FDYLSEITMSIMAKAKMVEPKHGYALDFVSRVMAPLLKKIAEKKIKVISNAGGVNPLAC
FT                   RDALQKIIKEYGLDLKVAVVLGDDLLPKHEQLKSQNIQEMFSGEALPEQVASSNAYLGA
FT                   VAIRDALDLGADIVITGRVVDSAVVLAPLLHEYQWSLDDYDKLAQGSLAGHVIECGAQC
FT                   TGGNFTDWQLVQGFDNMGFPVVEVSEDGSFVVTKPQGTGGLVSTATVAEQIVYEIDNPQ
FT                   AYLLPDVIADFSHVHLEQVGEHRVRVMGAKGQAPTTQYKVSATYPDGYRVLVSFLIAGR
FT                   EAPQKAQVIADAILTKCERVLAMRSVPPFSEKSVEILGIESTYGDHAKTLNSREVVVKI
FT                   AVKHMFKEACMFFASEIAQASTGMAPALAGIVGGRPKASPVIKLFSFLIDKNQVNVEID
FT                   FDGQRHAVEIPQGVSTEQLLTLTAGENAVYQGDEIEVPLIEIAHARSGDKGNHSNIGVI
FT                   ARKADYLPWIRAALTEQSVASYMQHVLDAEKGRVIRYELPGLNALNFMLENALGGGGVA
FT                   SLRIDPQGKAFAQQLLDMPVKVPAHLLEK"
FT   gene            497841..498767
FT                   /locus_tag="ABAYE0479"
FT   CDS_pept        497841..498767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0479"
FT                   /product="putative dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85450"
FT                   /db_xref="GOA:B0V6R1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85450.1"
FT                   /translation="MDETKMSYQSIFRPDAFANKVIIVTGGGSGIGRCTAHELAALGAQ
FT                   VVITGRKIEKLEKVSQEIIEDGGLVHFIVCDNREEEQVKNMIAEVIEKFGKLDGLVNNA
FT                   GGQFPSALENISANGFDAVVRNNLHATFYLMREAYNQWMAKHGGSIVNMTADMWGGMPG
FT                   MGHSGAARSGVDNLTKTASVEWGKSGVRVNAVAPGWIVSSGMDNYSGDFAKVIIPSLAG
FT                   NVPLKRMGTESEVSSAICYLLSDAAAFVSGVTLRIDGAASQGTRMYPLAEATNSQSYNG
FT                   FHRAFIPEIFKKDKTAKVEQSNNSGSE"
FT   gene            498778..500391
FT                   /locus_tag="ABAYE0480"
FT   CDS_pept        498778..500391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0480"
FT                   /product="putative propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85451"
FT                   /db_xref="GOA:B0V6R2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B0V6R2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85451.1"
FT                   /translation="MTILQSEITVGSEQYQKNKEALLAQLNEVRAIQQKSIDKSYAAKP
FT                   KFDKKGKILPHERVRLLLDADSPFVELCGLVGYNMHDDKDGSEAGGGVIAGIGFVSGVR
FT                   CLVSASNSAIKGGTMSPMGVQKTLRLQKIALEQKLPLITLTESGGANLNYAAEVFTYGG
FT                   MTFANQARLSAAGIPQLAVVHGNATAGGAYQPGLSDYVIVVRKQTEMLLAGPPLLLAAT
FT                   GEVATVEELGGAEMHAQVAGTAEYLAENDADGIRLAREIFEHLNWKEQIKPVDVTYKEP
FT                   RYDTEELLGVIPSDPKQPFDMKEVVARIIDDSDFLEFKQEYDDLTVCGWAKIGGLHIGI
FT                   ITNNGPITPQGAVKAAQFIHLCEQTNRPLLFLHNTTGFMVGTDAEQNGIIKHGSKLIQA
FT                   VANCTVPKISIVVAGSYGAGNYAMCGRSLSPDFIFAWPNSHVAVMGAAQAGKVLRIVAE
FT                   GKQKASGQEPNPQMLDFLEQSTAMKLEQQSTALFNTAMLHDDGIIDPRDTRKLLIFLLE
FT                   TIYEAQQRDLNPTRFGVSRF"
FT   gene            500434..501591
FT                   /locus_tag="ABAYE0481"
FT   CDS_pept        500434..501591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0481"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.13"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85452"
FT                   /db_xref="GOA:B0V662"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0V662"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85452.1"
FT                   /translation="MKFTAEHEALRRTARQFVENELNPNIPEWEEAGRFPIHDVFKKMG
FT                   DLGLLGICKPEENGGLALDYSYNLVVAEEIGRAACGGVPLAIGVQTDMATPALARFGSK
FT                   ELRDEFLTPAIAGEYVASIAVSEVHAGSDVAAIKTTAKKDGDDYVINGSKMWITNSLQA
FT                   DFFCLLANTSDDKPHVNKSMIIVPAKTKGISFSEPLNKLGMRSTTTAQVYLDNVRVPQR
FT                   NLVGVEGMGFMMQMMQFQEERLWACANAIGGLENLIQKTIAYTKERTTFGQPLINNQYI
FT                   HFRFAELMTEVEALKALTYQACEQHIAGEDVTKLASMAKLKAGRLSREVADSCLQYWGG
FT                   NGFMWDNPASQLYRDGRLGSIGGGADEIMLGIICKLMDILPKKQK"
FT   gene            501602..502435
FT                   /locus_tag="ABAYE0482"
FT   CDS_pept        501602..502435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0482"
FT                   /product="conserved hypothetical protein; putative
FT                   enoyl-CoA hydratase/isomerase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85453"
FT                   /db_xref="GOA:B0V663"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B0V663"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85453.1"
FT                   /translation="MTLSASLHIDIDDSIQLEQDGSILYLWLNRPESRNAMNLNMVNAI
FT                   QQVFTAIRDDLSIRAVIIRGEGGTFCAGGDIKDMAALRVEATNVGSLQPYTNFNRRFGA
FT                   MLEQVEAAPQTVVVILESAVLGGGFGLACVSDVAISRDNAQFGLPETGLGVIPAQIAPF
FT                   VVKRIGLTQARRLALLGMRFEGHTALSVGVVHQIAHNEIELEQALQETIQQIKRAAPQA
FT                   SRVTKALLHRTLNEPLNQLLDDAAQQFAQAVGSAEGQEGTMAFIQKRLPNWADET"
FT   gene            502454..504394
FT                   /locus_tag="ABAYE0483"
FT   CDS_pept        502454..504394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0483"
FT                   /product="putative Acetyl-/propionyl-coenzyme A carboxylase
FT                   alpha chain [Includes: Biotin carboxylase ; Biotin carboxyl
FT                   carrier protein (BCCP)]."
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7909542; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85454"
FT                   /db_xref="GOA:B0V664"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B0V664"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85454.1"
FT                   /translation="MKFSKILVANRGEIAVRVMQTAKAMGYQTVAVYSDADRNARHVQE
FT                   ADEAVYIGASKVSESYLSIAKIIEACKKTGADAVHPGYGFLSENTDFAQACIDNQITFI
FT                   GPTASAIELMGSKRLSKIAMIEAGVPCVPGYEGDRQDLEYLATQAEQIGFPIMVKASAG
FT                   GGGRGMRLVQQASELFEALQTARSEAENAFGSGELILEKAVIAPRHVEIQVFGDTHGNY
FT                   VYLFERDCSIQRRHQKVVEEAPCPVMTPELRQKMGEAAVAAAKTCAYVGAGTVEFLLDA
FT                   SGAFYFLEMNTRLQVEHPVTELITGLDLVEWQLRVANGEQLPLKQQELTLNGHAIEVRL
FT                   YAEDPRQDFLPQTGKILRWKPAALPNVRIDHGMLATDEVSPFYDPMVAKVIAYGKTRED
FT                   AIRLLARAVDDSVLLGVNSNKQLLVNLLRHPVVVAGDTNTAFIQQHFKNDPSLHYQVLS
FT                   LETLAIAAALFSQSKGPAVWQTGLGVPLPLKLQTADQQIQLQLSSVNNTFTVELCEQTV
FT                   SIEVVEKTAEQLIYLLDGVRHRVQYVLDGDQLYLDRDNGNVAIRNVTYAAPEIADVAGD
FT                   GKIRAPMDGAVVNILVNKGDQVIKGQTLLVLEAMKIQQQIKSDVDGVVDEILGQQGQQV
FT                   KKRQMLFSIQI"
FT   gene            complement(504498..505154)
FT                   /locus_tag="ABAYE0484"
FT   CDS_pept        complement(504498..505154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85455"
FT                   /db_xref="GOA:B0V665"
FT                   /db_xref="UniProtKB/TrEMBL:B0V665"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85455.1"
FT                   /translation="MAFDLVQYFAEQIKIQKPQLLNQYPANEKNKLIDEVNILTLGKLI
FT                   SLWRQDDNKIYHEIKTADPLYIQEVARHLTTSKHNKSVLKNAELEQSISEILALQLTEL
FT                   NQLDETGGFGQSGLKELILGQVEHLSGQAEDWVWSTNHLTELIGSKPVEQEELSLDATM
FT                   KEFNQMVHQAQPHHEDLHVEEQPIETFIPGWSKIIAPLVALAILGYLYCMYTQLV"
FT   gene            complement(505172..505600)
FT                   /gene="sspB"
FT                   /locus_tag="ABAYE0485"
FT   CDS_pept        complement(505172..505600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="ABAYE0485"
FT                   /product="stringent starvation protein B"
FT                   /function="5.5.3 : starvation response"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85456"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:B0V666"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85456.1"
FT                   /translation="MSEQTIELTPTRPYLARAIYEWICDNQLTPYLLVDATQPHTDVPQ
FT                   QFVKDGQIVLNIVPHAVHQLLISNDAITFSARFGGVSKDIYVPIQAVLGIYARENGQGL
FT                   FFDPEEYANVAPVEDKLDSETQETSEPTKKKPTLRILD"
FT   gene            complement(505607..506260)
FT                   /gene="sspA"
FT                   /locus_tag="ABAYE0486"
FT   CDS_pept        complement(505607..506260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="ABAYE0486"
FT                   /product="stringent starvation protein A"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.2 : transcriptional level"
FT                   /function="3.3.3 : stimulon"
FT                   /function="5.5.3 : starvation response"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85457"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0V667"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85457.1"
FT                   /translation="MSVENTSIQGITLYSHADDFRSHWIRFLLAEKQIKYQLIVTDHED
FT                   EDLASLNPYNQLPMLVEQNLKLFSAPIIAEYLDDRYRQNKLYADAPMARAEQRQYIWRL
FT                   ENDWFKLADHMLRHADTLNIEQKQKAQKELRDTLISLTPLFQHFPYFMSENFSILDCML
FT                   APIFVRLNSMGIDLPKQQCRPIFLYCKRIFSRPSFVKSMTPQEKTRYNELLNME"
FT   gene            complement(506431..506817)
FT                   /gene="rpsI"
FT                   /locus_tag="ABAYE0487"
FT   CDS_pept        complement(506431..506817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="ABAYE0487"
FT                   /product="30S ribosomal protein S9"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85458"
FT                   /db_xref="GOA:A0A0R4J8C0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8C0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85458.1"
FT                   /translation="MATNYGTGRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMV
FT                   VRQPLELLEATEKYDLYITVKGGGIGGQAGAIRHGITRALIAADETLKPVLRQAGFVTR
FT                   DAREVERKKLGLRKARKRPQFSKR"
FT   gene            complement(506830..507258)
FT                   /gene="rplM"
FT                   /locus_tag="ABAYE0488"
FT   CDS_pept        complement(506830..507258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="ABAYE0488"
FT                   /product="50S ribosomal protein L13"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85459"
FT                   /db_xref="GOA:B0V669"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V669"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85459.1"
FT                   /translation="MKTLSAKPAEVQHDWFVVDATGKTLGRLATEIARRLRGKHKTSYT
FT                   PHVDTGDYIIVINAEQVQVTGNKALDKKYYRHTEFPGGLKETNFEKLVAHKPEEIFERA
FT                   VKGMLPKGPLGYAMIKKMKVYAGSEHPHAAQQPQVLDI"
FT   gene            507446..508414
FT                   /gene="pdxA"
FT                   /locus_tag="ABAYE0489"
FT   CDS_pept        507446..508414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="ABAYE0489"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase
FT                   (4-(phosphohydroxy)-L-threonine dehydrogenase)"
FT                   /function="1.5.3.6 : pyridoxine (vitamin B6)"
FT                   /EC_number="1.1.1.262"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85460"
FT                   /db_xref="GOA:B0V670"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B0V670"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85460.1"
FT                   /translation="MLPLYVTSGEPAGIGPDICLSLAKRVDERPVVVLADRNLLQQRAQ
FT                   KLGLDIKFLEYSGQAESSLQGELYIEHVPLETIVVDGQLNAANAAYVLEQLRRSADYAM
FT                   SGKSVGVATAPVQKSVINDAGILFSGHTEYYQEFAGVERVVMMLATKTLRVALATTHLP
FT                   LRDVADAITKERLHQVIDILLHDLKTKFKINDPRVLVCGLNPHAGEDGYLGREEIDTIN
FT                   PVLESYRSQGVKLSLSLPADTLFTPEHLKNADAVLAMYHDQGLPVLKSQGFGEAINITL
FT                   GLPFIRTSVDHGTALSLAGTGLAKSSSLNVAVDLALSLAAS"
FT   gene            508438..509250
FT                   /gene="ksgA"
FT                   /locus_tag="ABAYE0490"
FT   CDS_pept        508438..509250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="ABAYE0490"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase, kasugamycin resistance"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85461"
FT                   /db_xref="GOA:B0V671"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0V671"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85461.1"
FT                   /translation="MYQINALNPKDEGHKARKRFGQNFLHDQRVIAKIVRSVNPRTGDN
FT                   IVEIGPGLAALTSPLIGECDALTVVELDRDLAAGLPERVPHPERLTIVEADALKYDFSQ
FT                   LVKDGRPLRVVGNLPYNISTPLLFHLLEFGSQVKDMHFMLQKEVVERITAEPNTKEYGR
FT                   LSVMIQYYCQPTFLFEVPAGAFNPPPKVTSAVFRLVPYEQKPITAKDEKALARLVAHVF
FT                   TQRRKTLRNSLKGMLAEDGFEKAGVDPMARPETLTLAEFVALADQMVA"
FT   gene            509251..510090
FT                   /gene="apaH"
FT                   /locus_tag="ABAYE0491"
FT   CDS_pept        509251..510090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ABAYE0491"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase, symmetrical
FT                   (Diadenosine tetraphosphatase) (Ap4A hydrolase)
FT                   (Diadenosine 5',5'''-P1,P4-tetraphosphate
FT                   pyrophosphohydrolase)"
FT                   /function="1.7.33 : nucleotide and nucleoside conversions"
FT                   /EC_number="3.6.1.41"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85462"
FT                   /db_xref="GOA:A0A0R4J6R4"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6R4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85462.1"
FT                   /translation="MTKRYNYIIGDVQGCFEALKALLKEIRFDPDQDFIWFAGDLVARG
FT                   ENSIGALRFIKKLADRGAAATVLGNHDLTLIAGARGLKEIKEKDRTQDVIDAVDGDDLI
FT                   DWLRKQPLCLFPNEQTILTHAGVPCIWDAQKTAALAKEVEAVLAHDDLSVLDAFLAEMY
FT                   GSKPDLWTDDLTGNERLRCITNYLTRMRLTNAEGALEFSFKDTLDAPMPEGYLPWFEFP
FT                   SKAAQTHQIFFGHWAALEGRTISEHIQNVDGGCVWGKNLIAYRLEDQQAFSVSNPVM"
FT   gene            complement(510133..510582)
FT                   /locus_tag="ABAYE0492"
FT   CDS_pept        complement(510133..510582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0492"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85463"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:B0V652"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85463.1"
FT                   /translation="MIMGKFFVGALLLVGINTATFAADITGLWQTIDDKTGTPKAHVEI
FT                   RKEANGTYAGKIVKITPRPGYTPKEICDNCPAPYTNKPILGLDIATGLKQTDNSTYTGG
FT                   KILDPNTGKVYGLKAKLSANGKRLHMRGYLGVSALGRNQIWIRLE"
FT   gene            complement(510661..511335)
FT                   /locus_tag="ABAYE0493"
FT   CDS_pept        complement(510661..511335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0493"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85464"
FT                   /db_xref="GOA:B0V653"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:B0V653"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85464.1"
FT                   /translation="MFMILYGFLITLVGYLCAKPLNRRFPQVPLLVFGMFIVIGLLSIL
FT                   KVPYEEYRLYVNDLFSHLLGYVTVALAIPLAAMRYDDLPLKSVIGILCFASISAVALPM
FT                   GLAYLLHMSEPTILAFATRAVTTPIALNIATLLHAPETLVTLIVILSGVIGAAFSPFLL
FT                   KHIHDERASGLALGLAAHAIGTAQAWQRGPVAGRYAAFGMALNGVFTAIWLPTFMLSFG
FT                   IH"
FT   gene            complement(511346..511717)
FT                   /locus_tag="ABAYE0494"
FT   CDS_pept        complement(511346..511717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0494"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85465"
FT                   /db_xref="GOA:B0V654"
FT                   /db_xref="UniProtKB/TrEMBL:B0V654"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85465.1"
FT                   /translation="MDKIKSIDWAAWVGTLLLIIGFREGSVVVMRAFGHPELGNLVGLI
FT                   SLLIVLLIWRKFKKIPLRLVDTNNKVMKESGFAFLPICAGSLIMLVHMGKEIPLFLFVL
FT                   VVSTLIPLWVYAKMAKHWL"
FT   gene            complement(511760..513094)
FT                   /gene="hflX"
FT                   /locus_tag="ABAYE0495"
FT   CDS_pept        complement(511760..513094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="ABAYE0495"
FT                   /product="GTP-binding protein"
FT                   /function="1.2.3 : proteins/peptides/glycopeptides"
FT                   /function="8.1 : prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85466"
FT                   /db_xref="GOA:B0V655"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B0V655"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85466.1"
FT                   /translation="MEYVDRHQGGERTILVSVSVQLLDDLDAEEFALLAQSAGADILEH
FT                   IKVQRNKPDPKFFIGSGKVDEIAEQVQELEASLVIFDHALTPAQERNLEKILKCRVIDR
FT                   TGLILDIFAQRARTHEGKLQVELAQLKHLSTRLIRGWSADFEQQKGGIGLRGPGESQLE
FT                   TDRRLIRVRITQLKDKLEKVHQTRMQGRAARQKASIPTVSLVGYTNAGKSTLFNILAKS
FT                   DVYAADQLFATLDPTLRRLEWDGIGTVVLADTVGFVRNLQHDLVESFKATLEETLEATL
FT                   LLHVIDSSSHDMLDQIEAVEGVLKEIGADAPVLRVYNKIDLSGEEAKIIYSEPHVPDRV
FT                   YVSAHSGLGLDLLRQAVQECLMGQLQHFSLVLKPAYGKLRTQLYALNVIQSEHYDDEGL
FT                   LHIDIRIAPHKLEQLIRQAKLPIDEILGERASQFKRPLEEFEIKH"
FT   gene            513298..514107
FT                   /locus_tag="ABAYE0497"
FT   CDS_pept        513298..514107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0497"
FT                   /product="putative acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85467"
FT                   /db_xref="GOA:B0V656"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B0V656"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85467.1"
FT                   /translation="MTQTQSIVNSTLKKFSKIGLYGKKVTSATAAISEGFYLVYRHGLY
FT                   KDPNNPVNTRYVQYFCRRLCQVFNLEVQVHGTIPREPALWVSNHISWLDIAVLGSGARV
FT                   FFLAKAEIEKWPILGNLAKGGGTLFIKRGSGDSIKIREQITEFLKQNIPVLFFPEATTT
FT                   DGHSVKRVHGRLLGAAIEAQRPVQVCLICYVNRHGELDNVAPFIGEMSFVEHIQRVLEM
FT                   PKVTAHLLTLPPISVEGHDVKSLTQEVQEKMVEGLAQLHKKVLKPKS"
FT   gene            complement(514108..515739)
FT                   /locus_tag="ABAYE0498"
FT   CDS_pept        complement(514108..515739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0498"
FT                   /product="putative phospholipase D protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85468"
FT                   /db_xref="GOA:B0V657"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B0V657"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85468.1"
FT                   /translation="MIMAQSFHSKQLQTHQLAKGFLIKASIVVCSSFAVALTGCSTLPK
FT                   HSPEPIQYARDIDTSQTSLSKIITPLREKNPNLTGYHLLNDPLEALAARLRLIDKAEKT
FT                   LDLQYYIWDNDKVGALALHAIIRAADRGVKVRLLIDDNNAKKMEGVLLALSQHKNIEVK
FT                   LFNPYRFRKYRAMDMILDLKRINRRMHNKSFIADNQVALIGGRNMTNQYYNVSDSYQFS
FT                   DVDVMLVGAAVDDIVNSFDDYWNHEYAYSVQSIVSAQQHRLRYESLKQQLDAHYQQATV
FT                   QNFLDLTSRSHAFDKWLDSNIKFDWVKAEVVKDSPDKIRSKAKKEEHLNFQLINHLEKP
FT                   ESNVDLISAYFIPEKQGAKILSTLAKEGVEVRVLTNSFKANDVAVVHAFYGKYRKELLK
FT                   NGVQLYEFLPTPDKRDLNKNTDELATKAKVNMKGLSRSSLHTKLMALDEQVFIGSFNFD
FT                   PRSAYLNTEIGVILDSPSLAKTIHHTMDENLNKYAYKLKLDPDNHIYWQQETPKGPIIY
FT                   KKEPEMKWWQKAGMKLLSWLPLEGFM"
FT   gene            515840..516850
FT                   /locus_tag="ABAYE0499"
FT   CDS_pept        515840..516850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0499"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85469"
FT                   /db_xref="GOA:B0V658"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B0V658"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85469.1"
FT                   /translation="MWNPNSIIFCFYFIFSILALWGIIEAWVHQSRTETIHPFKAFVHL
FT                   LAFYLSYLLIPLWFFNLYAGWIGYYSIHETIFIFLLSGILIYARFIEPHMVRVDVHQYR
FT                   LNPDRRFAKPVKVALIADLHIGLFSGHERQLKIIVKKLNEQQPDLVVVAGDWTYEPEDK
FT                   LVQELSVLKDIKAPVYSVPGNHDEQYPGPPIQQLLKDALHYNDVMDIEGKIVEFDEFRL
FT                   IGIGDLWAGKTDMRSMPDLPQDKPWLILSHNPDTVDMVPKLPNRPLMLSGHTHGGQVEL
FT                   PWVTNYIMKKVSILGHKRGFYSHEHADVFVTVGTGMVGIPLRFRVPPTIDIIELV"
FT   gene            complement(516898..517377)
FT                   /locus_tag="ABAYE0500"
FT   CDS_pept        complement(516898..517377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0500"
FT                   /product="putative lipoprotein precursor"
FT                   /function="1.6.10 : lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85470"
FT                   /db_xref="GOA:B0V659"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B0V659"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85470.1"
FT                   /translation="MNTRSLKLSFIALLCIALAGCLSFGPLKYRQVKMLKKEGFVLTNE
FT                   GWTLGLPERLLFDFNDATLKQSHEAELTRLANQLNKYDLNKLKIVGHTDDVGNPEYNQK
FT                   LSEERAQSVANLFLTHGFKKENIYVIGRGSTQPYVPNTTNENRAINRRVAIVIIP"
FT   gene            complement(517392..518615)
FT                   /locus_tag="ABAYE0501"
FT   CDS_pept        complement(517392..518615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0501"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85471"
FT                   /db_xref="GOA:B0V660"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="UniProtKB/TrEMBL:B0V660"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85471.1"
FT                   /translation="MISKLYQSTSLHALFRKSQFTIFAITFFICSFTFVSISVFTMETY
FT                   AKQNLQLLSHTLLERIQPAVVFNDKITIEQILNEYTNDHSIRAIHIYDSEHHLIAQSFK
FT                   LSSQTSVLEKWFDHWFLNEPVHLTIYHHQQNVGELTLFGSSEKILQFLKMIMVGLAIAM
FT                   LFIVCALWWSVNLTYRQIMQAIYPLTNIAQIVSEQKAYNLRFPYNRIKEFQDLNTVFNE
FT                   LLEEIQIWDNQLQKENRKLSFQAHHDQLTLLPNRHYFYQILLDMFEDKDFDNKSALLFI
FT                   DNNNFKSINDQFGHLAGDEVLKEMAKRLQTRLRHQDFIARLGGDEFAVILHSITHADHL
FT                   ISIAENLLESCKEPLHLNDQTIYFSFSVGIALSQFASSPEDFIMQADQAMYKAKTSEQH
FT                   WFIYKPEN"
FT   gene            complement(518621..519124)
FT                   /locus_tag="ABAYE0502"
FT   CDS_pept        complement(518621..519124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0502"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85472"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:B0V661"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85472.1"
FT                   /translation="MWHSAKKVLFCILVVFATSGPAYANSKHNFYVLTLSILSYSKWEN
FT                   VSTPTLCVIDNASITSTFQSYIQQLSYNYRVQTVNAKDFSKSHCQAVYFSTTPPQQQQN
FT                   LIQNYPYRSLLSLSINNPECEVGSIFCLYNQNNYTTFKVNLDALSHSKVHIDPRVLLLA
FT                   KNAE"
FT   gene            519694..521148
FT                   /locus_tag="ABAYE_16s_6"
FT   rRNA            519694..521148
FT                   /locus_tag="ABAYE_16s_6"
FT                   /product="ribosomal RNA 16s"
FT   gene            521263..521339
FT                   /locus_tag="ABAYEtRNA11"
FT   tRNA            521263..521339
FT                   /locus_tag="ABAYEtRNA11"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            521395..521470
FT                   /locus_tag="ABAYEtRNA12"
FT   tRNA            521395..521470
FT                   /locus_tag="ABAYEtRNA12"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            521811..524712
FT                   /locus_tag="ABAYE_23s_6"
FT   rRNA            521811..524712
FT                   /locus_tag="ABAYE_23s_6"
FT                   /product="ribosomal RNA 23s"
FT   gene            524888..525002
FT                   /locus_tag="ABAYE_5s_6"
FT   rRNA            524888..525002
FT                   /locus_tag="ABAYE_5s_6"
FT                   /product="ribosomal RNA 5s"
FT   gene            complement(525214..526587)
FT                   /locus_tag="ABAYE0505"
FT   CDS_pept        complement(525214..526587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0505"
FT                   /product="putative pyridine nucleotide-disulfide
FT                   oxidoreductase, class I"
FT                   /EC_number="1.8.1.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85473"
FT                   /db_xref="GOA:B0V644"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0V644"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85473.1"
FT                   /translation="MFDLIIIGAGTAGISAYKEAVKYTNNLLIINDGPWDTTCARVGCM
FT                   PSKVLISTANRMHDIQNAQEVGLSASADINTDQVMEHVRTLRDRFTKATVKDVEQWPTE
FT                   HKISGKAHFIDAKTIEVNGKRYQSKSFILAVGSTPNYDQSWKQELGDRLITTDQIFELN
FT                   TLPKSIAIIGSGVIALEIAQAMHRLDVETTIFARSKRIGIFTSPKLQQLAQEELSKELN
FT                   FLFETLPHEVKSTSDGVILNYKIDEKEESIQTEYVLSATGRSSLLDTLKLENIDKSFKD
FT                   IKLLPVNAKTKQLDDYPIFIAGDAYTSTPLQHEAAHEGKKVVYNCLNYPQVNAVKTLTP
FT                   LGIVFSHPEMAIVGQSYKQLKDNGVDFVTGEASYERQGRAIVLGKNKGAIEVYIERESQ
FT                   KLLGAELFTEATEHMAHLLSWIIGEKLTLNDILEKPFYHPTLEEGLRTALKHARRQLK"
FT   gene            complement(526674..527879)
FT                   /locus_tag="ABAYE0506"
FT   CDS_pept        complement(526674..527879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85474"
FT                   /db_xref="UniProtKB/TrEMBL:B0V645"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85474.1"
FT                   /translation="MGIMMKLTQGVCGLTLAVFLSACGGGGDGYYNQNSDSGSTTTPTT
FT                   PSTDQELANSVLNSVKQEGKYLFGSYDLNNESLSKGYIDHALDTFAQGPLKLTLDIRKV
FT                   DLTKYNDHYREKCFINSTTDYRACYVFKGEEIKSLLTGYNDWDFDITADDLKNIKLASD
FT                   NISPNLQEYQSNTRIYIFENENKDKNFQDVTITGAFAYPFQQSWGLQQTKQKRFVLINS
FT                   TTSDYKITTTTMVQEPQTGQPNEKEVTTGAMSVYKDNTSTDGDLYVIQGGSGFNVLIND
FT                   NPNVPFAEPISFVVNSTPGNTNNATYRVRLGKNQVLSLPNITGIEGSRVENEAPTTNIQ
FT                   KFNGSIYLEGQNIFTFKQDLNGSTLDFKHVINGVSIEGQSTNQNGVVSTTLKSPFAQKF
FT                   TF"
FT   gene            complement(528219..528554)
FT                   /locus_tag="ABAYE0507"
FT   CDS_pept        complement(528219..528554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85475"
FT                   /db_xref="GOA:B0V646"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B0V646"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85475.1"
FT                   /translation="MSENVGFAGQIGPEHVGQVVEKGFKSIINNRPDMEGGPEQPTSAQ
FT                   IEEAARQAGLDYVYQPVVAGQITELDVRTFANHYNELPKPVLMFCRTGNRSNNLYQLAK
FT                   QMDLLDD"
FT   gene            528747..529214
FT                   /pseudo
FT                   /locus_tag="ABAYE0508"
FT   CDS_pept        528747..529214
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0508"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAM85476.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(529156..529602)
FT                   /locus_tag="ABAYE0509"
FT   CDS_pept        complement(529156..529602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0509"
FT                   /product="transposase of ISAba1, IS4 family (ORF 2)"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85477"
FT                   /db_xref="GOA:B0V4A7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0V4A7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85477.1"
FT                   /translation="MVGRVKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETLF
FT                   SCLKGRGFNLENTRLTDPRRVKKLIAVLAISFCWCYLTGEWQHDQKKAIKIKKHGRLSM
FT                   SLFRYGLDYVQMAIQRLIGFGKKEEFKEILAILRRQNPDRIRVL"
FT   gene            complement(529677..530246)
FT                   /locus_tag="ABAYE0510"
FT   CDS_pept        complement(529677..530246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0510"
FT                   /product="transposase of ISAba1, IS4 family (ORF 1)"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85478"
FT                   /db_xref="GOA:B0V4A8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0V4A8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85478.1"
FT                   /translation="MTHLNELYLILNKYLKWNKSHLKCFALIMLVIILKQTCNLSSASK
FT                   ALPIKCLPQSFYRRMQRFFAGQYFDYRQISQLIFNMFSFDQVQLTLDRTNWKWGKRNIN
FT                   ILMLAIVYRGIAIPILWTLLNKRGNSDTKERIALIQRFIAIFGKDRIVNVFADREFIGE
FT                   QWFTWLIEQDINFCIRVKKTSLSPII"
FT   gene            530308..530832
FT                   /pseudo
FT                   /locus_tag="ABAYE0511"
FT   CDS_pept        530308..530832
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0511"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAM85479.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            530833..531270
FT                   /gene="thi3"
FT                   /locus_tag="ABAYE0512"
FT   CDS_pept        530833..531270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thi3"
FT                   /locus_tag="ABAYE0512"
FT                   /product="thioredoxin C-3"
FT                   /function="1.6.15.2 : thioredoxin, glutaredoxin"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85480"
FT                   /db_xref="GOA:B0V651"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0V651"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85480.1"
FT                   /translation="MIIVCASCGAKNRVPEEKLTAQPSCGQCHQPLLPLAPIELNEQNF
FT                   SNYITNSDLPILIDLWAEWCGPCKMMAPHFAQVAKQNPRVIFAKINTEESPRLSQAFNV
FT                   RSIPTLVLMNKTTEVARMSGALRAPELQQWLDQQLQTNFGS"
FT   gene            531272..531694
FT                   /locus_tag="ABAYE0513"
FT   CDS_pept        531272..531694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0513"
FT                   /product="putative acyl-CoA thioester hydrolase"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85481"
FT                   /db_xref="GOA:B0V632"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B0V632"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85481.1"
FT                   /translation="MSEAYTKPEGILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIH
FT                   AERFSRGRCATISINQMTFLVPVKVGFVISCYTKILKVGNTSIQMQIEVWDSHDDSREP
FT                   IRITEGVFTFVAVDVKGNKRQIPEEAKQKFLASQES"
FT   gene            complement(531734..532228)
FT                   /locus_tag="ABAYE0514"
FT   CDS_pept        complement(531734..532228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85482"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0V633"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85482.1"
FT                   /translation="MSQSNRLLKLVKATSKFPKGIRSTLWSKAFGRIVPMVGTANIRYL
FT                   EVDVNHVTVRLENQKNMQNHIKGVHAAAMALLAETATGFLTGLHIPDNRILLIKSLHVD
FT                   YLKVVEGGLTATAILSTEQQKYIADHEKGELVIPVTVIDDAGNEPIQCQMLWAWLPKRK
FT                   K"
FT   gene            complement(532264..532752)
FT                   /locus_tag="ABAYE0515"
FT   CDS_pept        complement(532264..532752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85483"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V634"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85483.1"
FT                   /translation="MPSFDIVSELELFEVNHAVQNTQKEIATRFDFRGHDVSIELNEKN
FT                   KEIKISTESDFQCEQVYNMLENHFYKRKIDVQALDPQKATASGKNFVQVIKLKDGLDSD
FT                   TAKKINKAIKESGIKVQSSIQGDKIRVTDKKRDTLQQVMAFLREQQFGLPLQFNNFKD"
FT   gene            532820..533158
FT                   /locus_tag="ABAYE0516"
FT   CDS_pept        532820..533158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85484"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0V635"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85484.1"
FT                   /translation="MFTSKECTMIRKQEITTFEFPEKAVIWDVRDSSAYAEGHVKGAVS
FT                   RPINDLNADILNQVAADQPIYILCGGGSKAPRAAEKLEGLDASREYVVLMGGTRAARDA
FT                   GLPLEQGA"
FT   gene            complement(533210..535111)
FT                   /locus_tag="ABAYE0517"
FT   CDS_pept        complement(533210..535111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85485"
FT                   /db_xref="GOA:B0V636"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V636"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85485.1"
FT                   /translation="MVILSDLLNRMNKSNRIQTAELDWESIDGIEVPISKQFGDVYFSK
FT                   DNGLLETRHVFLNGNDLSERLANLQDFEYFSVGETGFGTGLNILALWQLWQQVRPNNHS
FT                   HLHAISVEKFPLSKADLIRALNVWDELKPLSKQLIEQYPLPLAGCHRLSFPEERFSIDL
FT                   WLGDAQDIFPSMVKTKAVNAWFLDGFAPSCNPDMWEQNVLNNIVRLSNYGTTFASFSVA
FT                   GVLKRGLKAHGIDISRPRGFGHKREMLKAIWKAPVSEEILFEPVSDTFHFTQQRIAIIG
FT                   AGIAGLSTAWAFAQRGHQVTLFERTAPLSGASGNPLALLNPKLCPIEQSHEHLMTLSWQ
FT                   HALNFYKNFQAFRPIQIQQMALKNAQDLLDLTNQYPADIVTQQTSSLESDYPHIILTEA
FT                   GAVSPHQLRDEILQHPGIELKIANITTLVSFENKVQLKSGNETTLEADHVVVCCARESA
FT                   ALFENYPLLKPIRGQVSWVDNSFATLPLHEAYSYGGYCMQLNTSELILGASFYPNRDDQ
FT                   EVLLDDHVHNFELIHSVFPHYAKQLPPVEQWQGRASVRAQSPDYFPVVGKMQNESRIST
FT                   FAGLGSKGFLFAPLCSEVLVAQILGEAYPVPKSLLQKLDAQRFQKKVKPKKPYFKSQ"
FT   gene            complement(535105..535632)
FT                   /locus_tag="ABAYE0518"
FT   CDS_pept        complement(535105..535632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0518"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85486"
FT                   /db_xref="GOA:B0V637"
FT                   /db_xref="UniProtKB/TrEMBL:B0V637"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85486.1"
FT                   /translation="MLMSNHLIKHFQKGKRMQLATKSFLGLCLICSTAGAVEPAATPAT
FT                   PPTAASTQNAKPAPTSATVAKPATTTAPTTTQPLTAEQIAKNKQQQDAKIKALVQDQAS
FT                   RLKQLEHANLEALAQNQELQLKNDNLSVQVQVLQSERSAQMFLYGAVTLAGGVLLGFFI
FT                   ASYVYTKRRRQW"
FT   gene            complement(535589..535891)
FT                   /locus_tag="ABAYE0519"
FT   CDS_pept        complement(535589..535891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85487"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0V638"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85487.1"
FT                   /translation="MPFFVLSCTDNEGTLEKRLAVRPQHIERLQKLDDEGRLVAAGAMP
FT                   KDPNDPQAGFYGSTMIVEFDTREALDEWLKEEPFLKEGIYSHVDVKPFNKAFPKG"
FT   gene            complement(535926..536540)
FT                   /locus_tag="ABAYE0520"
FT   CDS_pept        complement(535926..536540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0520"
FT                   /product="putative intracellular septation protein (IspZ)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85488"
FT                   /db_xref="GOA:B0V639"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:B0V639"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85488.1"
FT                   /translation="MKALLDFVPLIIFFYLYKTVDPADTQHPLLKLIGSAGGVDNNNIL
FT                   VATTGLIISMLVVYGALFIMQKFRLDKQQWIVLFMTVIFGGITLMLSDDFYIRLKAAIL
FT                   NLVFAGAFLVSPWFGKDRKPLIQRLFDPILALSEKGWKNLNFAWAAMFVVMSGLHVFFA
FT                   FLFHGGKYWGEFTAFGDMIVMFSFIIIQFIILRKHFKSPDA"
FT   gene            536585..537436
FT                   /locus_tag="ABAYE0521"
FT   CDS_pept        536585..537436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0521"
FT                   /product="putative phosphoesterase (PHP family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85489"
FT                   /db_xref="GOA:B0V640"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B0V640"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85489.1"
FT                   /translation="MQGIDLHTHSNISDGTLSPELLVQAAVDVKLHTLALTDHDTMDGL
FT                   QRARNAAQPHDLQIISGVEISSQWSRPSTKKSYGVHIVALNMQDEAPILEALEQQKRIR
FT                   AQRAVVICELLKKCIGFDIYQDVLDKVENQPDRITRTHIAKALVEKNVVSRPQQAFDRF
FT                   LKEGKRAFVKFEGLGLKETIEVIHNSKGFAVLAHPTRYDLSATNTRYLIEIFASCGGDA
FT                   VELPPPVDPLSTRQMIDRMLEQHHLAISIGSDFHGENMPWIKLGNTPKPTSNQQGIWER
FT                   FI"
FT   gene            complement(537444..538355)
FT                   /locus_tag="ABAYE0522"
FT   CDS_pept        complement(537444..538355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0522"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85490"
FT                   /db_xref="GOA:B0V641"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:B0V641"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85490.1"
FT                   /translation="MIVREQPSIFKVLFSWRGTILPKILPSLGVVMLISAIIGGVEYIN
FT                   LYRFPEIPLVGFTLIGVVLSIFLGFKNTACYDRWWEARKLWGVLIATSRHFDRDCRILT
FT                   QARRERVIQHVIVFANVLRDRLRRQTANPTELIQTSGMSQQALTQLYQQNNAPQYTLSL
FT                   IQWELLQALKEGEISDIIYAQMNKNVADLSVVQTGCDRIANTPIPFAYSVLLNRTVYFF
FT                   CFMLPFSLGSLLGLATPLLVGILAYTFLGLDALSTEIEEPFGTQSNDLPLDAMVRSIEI
FT                   ELLGTLGKPTPPPIQAQDNNLL"
FT   gene            complement(538417..539169)
FT                   /gene="radC"
FT                   /locus_tag="ABAYE0523"
FT   CDS_pept        complement(538417..539169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="ABAYE0523"
FT                   /product="DNA repair protein, associated with replication
FT                   forks"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85491"
FT                   /db_xref="GOA:B0V642"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B0V642"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85491.1"
FT                   /translation="MGKQNKFLSRILLGNMNTSIKNWPEQERPRERLLQQGPQSLSDSE
FT                   LLAIFLRSGSRQHSAVELARLLIQQFGSLNAVFDASYNELAQFNGIGATKYSQLLAVKE
FT                   LGRRYLDYHFSQTELSLHSSHLVLDYLRYELKGEKQEVFAVLCLDAELRKLHFKKLFFG
FT                   SVQHCAVSVNQTLRYALQQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRL
FT                   LDHFIISPEGSFSFAEQQLLNPTSIAVQ"
FT   gene            539237..540490
FT                   /gene="dfp"
FT                   /locus_tag="ABAYE0524"
FT   CDS_pept        539237..540490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="ABAYE0524"
FT                   /product="bifunctional protein [Includes:
FT                   4'-phosphopantothenoylcysteine decarboxylase;
FT                   phosphopantothenoylcysteine synthetase, FMN-binding]"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85492"
FT                   /db_xref="GOA:B0V643"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B0V643"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85492.1"
FT                   /translation="MSFDLSVIPHKNIVLAVTGGIAAYKSAILVRRLKDYGFDVRVVMT
FT                   HGAQAFITPLTFQALSGNPVHTELLDPEAEAGMGHIELARWADLLLVAPASCDTLAKFA
FT                   NGLADDLLSTLFLATKAPVWVAPAMNQQMWAAKATQRNLQTLVEDGVHVIMPDAGEQAC
FT                   GDVGLGRMPEPEEIARQVAGYFHQAQRAIAEKFGLLAGKRVVITAGPTREAIDPVRYIS
FT                   NHSTGKMGFALAAACYAAGAKVTLIAGPVSLDTPNGVQRVNVASARQMLDVSMESLETG
FT                   CDIFIATAAVADYRVAEVAEHKIKKAGDELNVSLVKNPDIVATIAAQEKRPFMVGFAAE
FT                   TQNVEEYAAGKLVAKKLDMIACNDVSRADIGFASDENAMTVFFAESYHMKKRELEKASK
FT                   QEISQQLVEAISDALRRK"
FT   gene            complement(540556..541521)
FT                   /gene="secF"
FT                   /locus_tag="ABAYE0525"
FT   CDS_pept        complement(540556..541521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ABAYE0525"
FT                   /product="preprotein translocase, IISP family, membrane
FT                   subunit"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85493"
FT                   /db_xref="GOA:B0V622"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B0V622"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85493.1"
FT                   /translation="MMTKVTQQPSKQYGRPDDAKIIPFMKIAKPAAIFSILITLASIFF
FT                   IATKGLNLGLDFTGGVSAELNYAQPANQAEVIQALDKAGFKDAVVQTLGSNKDLLVRMP
FT                   VQDIKVEDLNNAITKAVQLPNNAAEVHKVDSVGGQVGNELYVRSAGAVALALILMLIYV
FT                   TIRFEFKLAMGAVISLFHDIIIIIGAFALFQWPFDLTVLAAVLAVIGFSLNDNIVVSDR
FT                   IRENFRKIRGATPREIVDIALTETLRRTIHTSMTLLLVVLAMMFLGGDGLHWFSVAMFV
FT                   GVFVGTYSSIYIGTAFALWRGLNRQDFIVQVKPEFEDEIP"
FT   gene            complement(541530..543431)
FT                   /gene="secD"
FT                   /locus_tag="ABAYE0526"
FT   CDS_pept        complement(541530..543431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ABAYE0526"
FT                   /product="preprotein translocase, IISP family, part of the
FT                   channel"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85494"
FT                   /db_xref="GOA:B0V623"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B0V623"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85494.1"
FT                   /translation="MRYPAWKYLLILVVLVVSTLYALPSLYPDEPAVQISGAKAGTQID
FT                   QSVVQKAEQILKTANIASHDNTFTNNAALLRVSSSEAQLKAKEVLRRDLGDQYVVALNL
FT                   APTTPEWLQKIGAKPMKLGLDLRGGVHFLLEVDMDKAISQRMETSATDLRRQFRENKIK
FT                   FNNLALNNNVITVQFADNADRDAAMDFLRRNGNEYTQQALASTTGSILKLTYTDVRRQE
FT                   IQAYAVNQNLTTLRNRINELGVAEALVQSQGSNRIVVELPGVQDTAEAKRVLGRTANLE
FT                   FRLVSDLNDQYIDPYTGKYNGQPLPPGTEVFAYQSLDSGRQLLLQRNRILTGERVQNAS
FT                   SGFSQDSGGAEVNITLDSAGGKLMSDATRNAVGKRMAVLFIENKQKISYVTDPKTGAQT
FT                   EVRTPYTESVVINAATVQAVLGSTFRITGLSSPQEASELALMLRAGALAAPMYFVEERV
FT                   VGPSLGQENIDKGVLSTQIGFLLVAIWMVVFFRLFGLIANFALVFNLAMILTIMSWIGA
FT                   SLTLPGIAGIVITIGMAVDANVLICERIREEMLWGASPKQAIVAGYDRAYNTIFDSNLT
FT                   TFLVAFILFAIGTGPIKGFAVTLMIGIICSMFTAITVTRAIVQIIYGKRRNLKKLSI"
FT   gene            complement(543483..543812)
FT                   /locus_tag="ABAYE0527"
FT   CDS_pept        complement(543483..543812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0527"
FT                   /product="putative SecYEG protein translocase auxillary
FT                   subunit (YajC)"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85495"
FT                   /db_xref="GOA:B0V624"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B0V624"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85495.1"
FT                   /translation="MSLFISTAHAAPAAAQSPGLLPNILMIVVFVAIFYFLIWRPQAKR
FT                   AKEHRSLIESLGVGSEVVFAGGLMGKVTKLEGDYAVVELNRGVEVKIQRASVISVLPEG
FT                   TLNNL"
FT   gene            complement(543911..545044)
FT                   /gene="tgt"
FT                   /locus_tag="ABAYE0528"
FT   CDS_pept        complement(543911..545044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ABAYE0528"
FT                   /product="queuine tRNA-ribosyltransferase (tRNA-guanine
FT                   transglycosylase) (Guanine insertion enzyme)"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85496"
FT                   /db_xref="GOA:B0V625"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V625"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85496.1"
FT                   /translation="MKFEKLGQSGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRD
FT                   IEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKI
FT                   KEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSL
FT                   RWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPK
FT                   EEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVT
FT                   DGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQ
FT                   RLTEGMRDALDNGTFDEFVQDFYARRGLEVPPCPVDE"
FT   gene            complement(545220..545789)
FT                   /locus_tag="ABAYE0529"
FT   CDS_pept        complement(545220..545789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85497"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B0V626"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85497.1"
FT                   /translation="MTGLFIFLGIFVVLIAWGIHIRNNIVRYFNATKRAWAEVANFERQ
FT                   KVKTLEALETTLNQYTQFEKSTLEQVTALRQQILSLNVDHTDIAQLQQIEKMSKELIRS
FT                   LNVVVENYPELKADTLYGKMMDDIQEQNENVGAAISIFNRNVEVFNNQIEVFPNNIINT
FT                   MTLSKKTIRPFRDNLATDNFDYKPNF"
FT   gene            complement(545876..547024)
FT                   /locus_tag="ABAYE0530"
FT   CDS_pept        complement(545876..547024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0530"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85498"
FT                   /db_xref="GOA:B0V627"
FT                   /db_xref="UniProtKB/TrEMBL:B0V627"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85498.1"
FT                   /translation="MRFNPASIIKIKIVLVFLFISFNLKDNLELALYDNQLITLMPIDT
FT                   IQQTLHIRRKKNSQVFRNIARLWDAGQKSQTDQELLNALHPWGEDHNLRFVNTLSYLLS
FT                   ICSITTLLFGYFFHPHIQYIWSLLWAFLTGFLAYLLYEPQKPLTEVIHYLEQRMTALRY
FT                   GLKFQQLPAYLPIQAQPILVLSKLKQHFPLFNRGNEANEITEFASVTWNDGITDHQVLL
FT                   FKYHYVNNLPILQDQNSDKKIVKEIHKDLWGAFIFQMPALGIAASNQRSRFFEPYLSEW
FT                   QSSDILINQELSIFGTDQHQLAKEMSPSLTLKLHDFFQHFNGDLIYHHEEQILCYLGEQ
FT                   DLFQTTSKRSEIHDIPALRGHLRTMTMPQYEKFQQFMLNLIK"
FT   gene            complement(547058..548095)
FT                   /gene="queA"
FT                   /locus_tag="ABAYE0531"
FT   CDS_pept        complement(547058..548095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ABAYE0531"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase (Queuosine biosynthesis
FT                   protein )"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="5.-.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85499"
FT                   /db_xref="GOA:B0V628"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0V628"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85499.1"
FT                   /translation="MQLSDFSFELPDELIARYPLETRSASRLLHLDAKGQYHDHMFTDI
FT                   IDLFEEGDLLVLNDTKVMKARLKGKRATGGAIEILVERMLNHTTAYCHIKASNSPKAGA
FT                   ELFVGADNIPVIVRGRHENLFVVEFSQPILPVLEQYGQLPIPPYFNREAEEIDTERYQT
FT                   VFHNPEKIASVAAPTASLHFDEELLAELDQKGVKKTFVTLHVGAGTFMPVRTDDITNHV
FT                   MHSEWCDVPQETIDLILATKARGNKVIAVGTTATRALESAAQAHGGKIAAWTGDTQIFI
FT                   YPGYEFCIVDRLITNFHLPESTLLMLVSALSNRENILAAYEHAVKDRYRFFSYGDAMLI
FT                   DKLEV"
FT   gene            548277..548363
FT                   /locus_tag="ABAYEtRNA13"
FT   tRNA            548277..548363
FT                   /locus_tag="ABAYEtRNA13"
FT                   /product="tRNA-Leu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            548541..549608
FT                   /locus_tag="ABAYE0532"
FT   CDS_pept        548541..549608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0532"
FT                   /product="putative integrase/recombinase"
FT                   /function="8.1.4 : Integration, recombination"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85500"
FT                   /db_xref="GOA:B0V629"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0V629"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85500.1"
FT                   /translation="MSTSIYQRPNKKWKADVVLNGVRVTKTLEKKELAIRWAKETERDL
FT                   ILNDSTQKALNSKIVITMREALGRYSDEVSRFKATGKKEMQRIRYFQDNLPNTDWPLSC
FT                   YKGEFLKQWEDAVSKRTIKPLKPSTILRDYSTLSSFFNWCRKDKGWIESNPVENLRKPK
FT                   KPPHRERRTEVEELQRMLAALKYKPGTVPTTKMQEVGLIWLIAMATGMRSGEIVNRLPV
FT                   HVCLSKRYVQLDKTKNGTARKVPLDDFALQLWTLALKIDRKGSPKVFTVSDSSRDSLFR
FT                   KARKKAGLENSDLTFHDSRHEAASLMARRIKNALTLCKIFGWKDPKQALTYYNPTNDEI
FT                   LDELNQSSGLSRLLA"
FT   gene            complement(549636..549932)
FT                   /locus_tag="ABAYE0533"
FT   CDS_pept        complement(549636..549932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0533"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85501"
FT                   /db_xref="UniProtKB/TrEMBL:B0V630"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85501.1"
FT                   /translation="MTVSVDSLIEKMLLKLMKQIEAKPIIPIECQLWDEQDIANYFKYS
FT                   LDYTKRHIISNDNFPPSRELPTSATGDRTVSRWKATDVISFGMAFDKTNIKYS"
FT   gene            complement(549929..550150)
FT                   /locus_tag="ABAYE0534"
FT   CDS_pept        complement(549929..550150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0534"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85502"
FT                   /db_xref="UniProtKB/TrEMBL:B0V631"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85502.1"
FT                   /translation="MELVRPDHPIAHEAYETVKAMTCEYIKIVARTYSKTQTEAGYFIS
FT                   GIFPCTPDDGFNRKEWISTFEELQGVNK"
FT   gene            complement(550160..550897)
FT                   /locus_tag="ABAYE0535"
FT   CDS_pept        complement(550160..550897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0535"
FT                   /product="putative DNA exonuclease X"
FT                   /function="1.2.2 : DNA"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="2.1.5 : DNA degradation"
FT                   /EC_number="3.1.11.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85503"
FT                   /db_xref="GOA:B0V610"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0V610"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85503.1"
FT                   /translation="MTALIFDTETHKLHGDIIEAAAMEVVFPQISADILIIPTMFDFTK
FT                   RYKPSEPISLGAMAVHHIVDEDLVKCPSFKTFKWPKENIQYLIGHNIDYDIEAVKRAGA
FT                   DTTGIKSICTLAMARYLWPTLEAHNLTALAYHISRDRKSTRRGLKNAHSALNDCKTTYG
FT                   LLHTIVQEKNIKSFQELYLFSEKARIPTHIFYGKYKGSAIADLDMHALAFLARKTEDQY
FT                   LLKAIDYELFQRSNSDFTNELPW"
FT   gene            complement(550907..551260)
FT                   /locus_tag="ABAYE0536"
FT   CDS_pept        complement(550907..551260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0536"
FT                   /product="putative Single-strand binding protein
FT                   (Helix-destabilizing protein)"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="5.8 : SOS response"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85504"
FT                   /db_xref="GOA:B0V611"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B0V611"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85504.1"
FT                   /translation="MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTG
FT                   DWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEGSLHTRKWTDQNNQERYVTEVRAIT
FT                   FQSLDSLPQANPV"
FT   gene            complement(551248..551565)
FT                   /locus_tag="ABAYE0537"
FT   CDS_pept        complement(551248..551565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0537"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85505"
FT                   /db_xref="UniProtKB/TrEMBL:B0V612"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85505.1"
FT                   /translation="MSKYHCKCGGLILPDFESFQIGDEVNCMVETHKPIGNGMVSVNQR
FT                   AFVGTILKINGDEFKITSKRKQYTFFRGEFSPIDAPGPIEYFRLGKCRCELDQEQKPCA
FT                   E"
FT   gene            complement(551558..551728)
FT                   /locus_tag="ABAYE0538"
FT   CDS_pept        complement(551558..551728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0538"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85506"
FT                   /db_xref="UniProtKB/TrEMBL:B0V613"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85506.1"
FT                   /translation="MNHDEELVQFCRCRNKHLVKDRLRQPNKSTYGLMDLVCPRCKAQS
FT                   YYKVNEVKKNV"
FT   gene            complement(551718..552296)
FT                   /locus_tag="ABAYE0539"
FT   CDS_pept        complement(551718..552296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0539"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85507"
FT                   /db_xref="UniProtKB/TrEMBL:B0V614"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85507.1"
FT                   /translation="MPHNHRRAIMQNDSNVETTQAEIKPFPRQLISDMWDSNVTFDTIL
FT                   HIPTLLASSSEQVSDKFQEFLDDAYEEWQSSLLLEQCPALKSTLNEIRENNDIKHYAGE
FT                   VLQDFHRACGDFEFLIEIEIRIPFNFRFDKDGKYQSNSLGGSFRVQWILAKNMVDAAQY
FT                   AIKIAEELHSVEEAKARKEQGLEENSNES"
FT   gene            complement(552335..552667)
FT                   /locus_tag="ABAYE0540"
FT   CDS_pept        complement(552335..552667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0540"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85508"
FT                   /db_xref="UniProtKB/TrEMBL:B0V615"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85508.1"
FT                   /translation="MITNVWAELDPNELPFIDKEIGPEDFKTQYLCSWDPGHDITHQLK
FT                   DDQRNIDEAIFQVKTCINNLENSTSRLVRKNAKEVLQVIKQNLNWEKHPELNQKIHLLQ
FT                   SLLYRG"
FT   gene            complement(552664..555402)
FT                   /locus_tag="ABAYE0541"
FT   CDS_pept        complement(552664..555402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0541"
FT                   /product="conserved hypothetical protein; putative
FT                   Phage-related protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85509"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:B0V616"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85509.1"
FT                   /translation="MSDISRRIDDRLNQIFKFKRVGEWYRQGICPQCSRKECYTHAIKP
FT                   RVVKCSRLNNCGYEEHVKDICEDLFKDWSKEFPKTEVNPHAAADAYLRHGRGLDIAPLK
FT                   GLYTQDTFSNEQKYPGLYTGTVRFKLAEGIYWERFIDRPERFGRQKANFIGKYEGLSWS
FT                   TVDLDDLCNAPSFWITEGIFNAIALIQSGQPAIATMSTGNYPSVLLKQIADRCHELKKD
FT                   KPRLIWAFDNDKAGKDAIRKFHLRALQEKWASSAALPPHQVKGKNLDWNDLFMHDLLHS
FT                   EERAKYRHYGELLIAETAEQAGLLIYNFKEGRTKTFFFNHNFRLYWFNLDYDKYAKRMN
FT                   QIEEDPSFDALLDQQKREQALRDCAAVTEICNAQIDPLYFERNEVTGEAWYYFNVQSQW
FT                   AEKKTQFTPSQIGSRSKFKDATMEVMAGAMWTGTDQQLEFFMKRKTERLKEVKTTDYIG
FT                   YSSEYETYIFPKHAVHKGQVIPINEHDYFKIKRLELKSLAKSPVITLNPKKEFKPFWWK
FT                   DFYRVRGSKGLIALAWWTGTYFAEQIRSIHSSYPFIEIIGQAGAGKSRLIEFLWKLSGR
FT                   KEYEGFDANKSTNVAIYRNFAQISNLPVVLIEGDRNDAQGNSVKQAKFSWDELKDAFNG
FT                   RAIRSKGLKTAGNETYEPPFRGAIMISQNSAIAASEAILTRTLHLSFDRKGQSLETKRI
FT                   VDALDRIELEEACTYMTHCLRKENEILTTYQERLKSLEDQYHSVGITHTRIALCHAQIA
FT                   ALIEAIAEHVLNGYLDYEEVAPAQEMLMEMAQQRVDQLNGDCQEVEQFWEAFEYLQSGR
FT                   SAPFSLNHHDNDAQTIAINLNEVYKVAAQQYQKLPEITLMKNLLKSSQKFKFIESNRAV
FT                   SSSRFPTDAAKNLNADNEMSDRRRTVKCWIFSNPNYGAPQA"
FT   gene            complement(555496..555756)
FT                   /locus_tag="ABAYE0542"
FT   CDS_pept        complement(555496..555756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0542"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85510"
FT                   /db_xref="UniProtKB/TrEMBL:B0V617"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85510.1"
FT                   /translation="MIITINSTKLELLYSQVTINGDFRMNKSIDQTKQHTETTMVRWTK
FT                   DQLETIRNEAFQQRKAPAVFIREFLLENHPAFKPKKTDERL"
FT   gene            555777..556118
FT                   /locus_tag="ABAYE0543"
FT   CDS_pept        555777..556118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0543"
FT                   /product="conserved hypothetical protein; Putative
FT                   phage-related DNA-binding protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85511"
FT                   /db_xref="GOA:B0V618"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0V618"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85511.1"
FT                   /translation="MKNDDLSTRGSRLRDERKRLGFQNQEDLADILNVKKNSVVRYEKH
FT                   NAALDTDQLDLLEDHGFNIPYILWGRVELNSSDLEENESKLIQLYRQTREEMRPGLISI
FT                   VETYANQFK"
FT   gene            complement(556163..556378)
FT                   /locus_tag="ABAYE0544"
FT   CDS_pept        complement(556163..556378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0544"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85512"
FT                   /db_xref="UniProtKB/TrEMBL:B0V619"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85512.1"
FT                   /translation="MHSTLEINSHKKMTAEEILEEIEYPLENLENFLLAMTKMKVVERL
FT                   EEKEFSAIINTLHYQVSNIKRAVHTK"
FT   gene            complement(556503..557318)
FT                   /locus_tag="ABAYE0545"
FT   CDS_pept        complement(556503..557318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0545"
FT                   /product="hypothetical protein; putative phage-related
FT                   protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85513"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:B0V620"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85513.1"
FT                   /translation="MNTLTQLDDAVFIQDQQVKTDSLKVAEVFGKPHKDVLQKIRTLDS
FT                   SPDFNERNFSPVEYLDSKGESRPMYEMTKDGFIFLVMGFTGAAAAKIKEAYINTFNQMA
FT                   AVLYNNDGNHQQIHEGAVVQLKSGGPLYTISKIFYDQNGYMQNAEVIWHNKANLYRELL
FT                   PINCLTLESKNLIQNKTLEDFWASLHNFGVGKLNHSRNQNILALNLMQIYQCIEGLPPK
FT                   NQLSAILMHSSNPFPIYMQHNHAVSSAITNKTVKCWIFNTKQQQIPLLW"
FT   gene            complement(557426..557620)
FT                   /locus_tag="ABAYE0546"
FT   CDS_pept        complement(557426..557620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0546"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85514"
FT                   /db_xref="GOA:B0V621"
FT                   /db_xref="UniProtKB/TrEMBL:B0V621"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85514.1"
FT                   /translation="MKILAATYSHTQNNVKEHSPVYDLDAYEKRQRQFKRKKLLKNLFD
FT                   TAIFASAAGFTFSMLFWGA"
FT   gene            complement(557636..557728)
FT                   /locus_tag="ABAYE0547"
FT   CDS_pept        complement(557636..557728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0547"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85515"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85515.1"
FT                   /translation="MAGRFFCHGIPTPVQSVTITVGSFGVRFKT"
FT   gene            557930..558808
FT                   /locus_tag="ABAYE0548"
FT   CDS_pept        557930..558808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0548"
FT                   /product="hypothetical protein; putative NAD-dependent DNA
FT                   ligase"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85516"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:B0V600"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85516.1"
FT                   /translation="MELDLNRINYNANQSKLGNLFLGFFEGLFLDGRVRLQEIEALIKW
FT                   VEQYPDAVTVPHFEPLYQVLLKAAEDPQFLLANHQEVQTHLDLFKNSKYFKEHTCDVQR
FT                   LHGVLAGLACDSDYTDDEVLALNAWLDRYDYLKDDPIYKEIIVALNHVRILNRVSGDTK
FT                   EVLRLTLGKYIQLNNFGLPQVRVSSTEDNKNPDFYHGNVELIGKTICLTGASARYSKAE
FT                   WKKVIESQGGIFKDDLTKTVDYLVICNKGNPHWAHMSYGRKFEQALKWQKDGANIRILT
FT                   EDDFVKVLEEN"
FT   gene            558808..559089
FT                   /locus_tag="ABAYE0549"
FT   CDS_pept        558808..559089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0549"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85517"
FT                   /db_xref="UniProtKB/TrEMBL:B0V601"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85517.1"
FT                   /translation="MKKFLCLMICSLSFVGCSNEPEPQIMSAKFNSMEECLASIKSKTG
FT                   EALDPMTDKPEHVSGFLGKTGLQFNCEVKHTGTEGNYVDGWYQEKITN"
FT   gene            complement(559405..559623)
FT                   /locus_tag="ABAYE0550"
FT   CDS_pept        complement(559405..559623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0550"
FT                   /product="conserved hypothetical protein; putative phage
FT                   related protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85518"
FT                   /db_xref="GOA:B0V602"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:B0V602"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85518.1"
FT                   /translation="MENGASMTDKIDIAQELQLKQVQIQPKDFSRPSLTECEECGNDIP
FT                   IERQRYGSVTLCVECKNTQEKLSKRYY"
FT   gene            complement(559602..559841)
FT                   /locus_tag="ABAYE0551"
FT   CDS_pept        complement(559602..559841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0551"
FT                   /product="conserved hypothetical protein; putative phage
FT                   related protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85519"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:B0V603"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85519.1"
FT                   /translation="MARPRSRYKCPHCGEPFAIRSSDALSPLLRMFQAQCQNLNCGFTA
FT                   QGYMELKFQLSPPAQPNPEINLPTPDRTWKMEPA"
FT   gene            complement(559971..561284)
FT                   /locus_tag="ABAYE0552"
FT   CDS_pept        complement(559971..561284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0552"
FT                   /product="phage-related late control gene protein
FT                   (GPD-like)"
FT                   /function="8.1.3 : Regulation"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85520"
FT                   /db_xref="UniProtKB/TrEMBL:B0V604"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85520.1"
FT                   /translation="MFNQITNKLKDAAESYQSETEYPFPIYRLEVDGNDISPLVVDRLI
FT                   SLTIKDNRGLVVDSVDIDLDDSDGQLEIPPEGAIIQVWIGWSNTGLVDKGKYKVESVTH
FT                   RGAPDILSISAFSNDVSEGLKQKRERSFSSKTIQVIFETVGAEYALKTIVHDTLAKRVI
FT                   SYIAQNESDANLITRIADEHDAIATVKNGHLILLPRGASQTVSGLPLPTAQIFRSDGDG
FT                   HNYTTGTGTDRITGVKAYYYDTGKSKKLYVVIGDNEDNLKEIRYVHRDKKTAELAAQAE
FT                   YNRCKRASQKLSYTFAFGQPELIPEQEFVFTGLKPQIDDIVWLGTNVTHNLTDSGFTTN
FT                   VELEAQLPNADDVSTLFEPDKEGDKVLRKKNKKRTGRNYADYTGVIVFYRENGKDLKLT
FT                   SGDQSNPLKLIKIYKTKKTATIALKREQARIDKAKKVK"
FT   gene            complement(561285..561725)
FT                   /locus_tag="ABAYE0553"
FT   CDS_pept        complement(561285..561725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0553"
FT                   /product="phage-related protein; putative phage tail
FT                   protein (GPU_like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85521"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:B0V605"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85521.1"
FT                   /translation="MMMALGLFVFSLRTAAYQELQRVTSWRHPSNSRVGSTPAYQFTGK
FT                   GEDTITLKGEIYHELTNNRIVLDQVRRMADTGMAYTLIEGTGKIYGLVIIENMEETKTY
FT                   FFKDGAARKTEFTLTLKIVKEWKPTLIGTLLGMAGGVANRLI"
FT   gene            complement(561731..564181)
FT                   /locus_tag="ABAYE0554"
FT   CDS_pept        complement(561731..564181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0554"
FT                   /product="putative phage-related membrane protein"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85522"
FT                   /db_xref="GOA:B0V606"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:B0V606"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85522.1"
FT                   /translation="MADLKLEVLFNAVDKLSGPIKTIVGGSKTLSDAFKKTSSELKALE
FT                   AQQRKISGFRQLKEQSEKTAQAIEQNKETLKQLKTAMNIGAPTEQMVKDLARAEAAQKR
FT                   LKAAQKNQGTEMTALVRELNQAGISVDNLADDESELKNKIHLTTMEINKQKESLERHQK
FT                   AQKQYEQMQGRMAKASDLAKKGLMVAGAGAAAMAIPVHLAIDYESAMADVKKVVNFETP
FT                   QQFKIMGDDIIRLSTKLPMAAKDIAAIVAAGGQSGIAKNELLGFAESAVKMGVAFDISA
FT                   QESGQAMAEMRTAFKMSQTEVVSLADKINYLGNNTPAAAKGIMDIVQRIGPLGEVGGFA
FT                   SGSIAALGATIRGMGVAEEIAATGIKNMMLALVAGESATKGQRAAYKDLGLDAGQVAKD
FT                   MQIDAEATTLKVIKSISKLDKYKQAATLKELFGSESLGSIAPLLTNMEALEKNLSMVGD
FT                   KSKYAGSMQAEYAARAATTANNIQLAKNQVAGLAINIGNVLLPPINTMLGKFTAVMTVV
FT                   QDWASRNPALASTLVKIAVGGIAIIGIISALSLGVLALLGPLAMLKMTFSTLGIGFSAL
FT                   GAIFSPAGLVILGVIAAVAGAAYLIYKNWEPIKGFFVGIWNTVKTAFNGGITGVSALII
FT                   NWSPIGLFYAAFAKVLSWFGVELPAKFTGFGAMILTGLKNGIMSKIGEVKAALSGAVTG
FT                   VIDKARNILGIHSPSRVFMGIGDYTMQGMALGISQNHNLPVRATQQATQNVIGTGTTAK
FT                   VTPVTPIRAQRGGSYISNDTIQITIKAEHGQPVRETARALRAEMVRLQQEERDARRRFL
FT                   TDTE"
FT   gene            complement(564335..564676)
FT                   /locus_tag="ABAYE0555"
FT   CDS_pept        complement(564335..564676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0555"
FT                   /product="putative phage-related tail protein
FT                   (GPE+E'-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85523"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:B0V607"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85523.1"
FT                   /translation="MNQIDQAINQEQIKNPNEEVVTLEEPIRMGDQMITQVTIRKPGVK
FT                   ALSGTSLQAIYQHDVDALCKVLPRVTSPALTPQQIYQMDPVDFANLGGHLVTFLYPKAL
FT                   QKEIKAQTA"
FT   gene            complement(564743..565261)
FT                   /locus_tag="ABAYE0556"
FT   CDS_pept        complement(564743..565261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0556"
FT                   /product="phage-related major tail tube protein (FII-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85524"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:B0V608"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85524.1"
FT                   /translation="MALPPKLKNMNFFNEGNSYLGKVKTVTLPKLARKTEDYRGGGMNG
FT                   TVKVDLGMSDDGLVLESTYGGLDLLTLRQFGMEKIDGVYLRFAGAYQRDDDSEYDAVEV
FT                   VVKGRHEEIDGGESTPGEDTEHKVVTNCVYYKLTVNGVVEVEIDILGMKEVIGGVDRLE
FT                   KQRNILGII"
FT   gene            complement(565274..566449)
FT                   /locus_tag="ABAYE0557"
FT   CDS_pept        complement(565274..566449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0557"
FT                   /product="phage-related major tail sheath protein (
FT                   FI-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85525"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:B0V609"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85525.1"
FT                   /translation="MAIDQYHHGIRVLELNDGIRPIRTIATAIPGFVATADDADPLVFP
FT                   ENQAVLITNIQAAVAKAGKNGTLAKALQNMANQTNAICVVVRVPTAVDEAAQTANVVGT
FT                   VTAEGKYTGLKALLVAKSKLGVQPRILGAPGLDTQAVATELVVIAKKLRAMAYAYAWGC
FT                   KTKEEAVAYREAFAARELMIIWPNFVAFNTTTAQTETVPAVAVAMGLRAKIDNEIGWHK
FT                   TLSNVAVSGVTGIDADVTWDLQDPATDAGYLNSNEVTTLIQHEGFRFWGSRTCSDDPLF
FT                   AFENYTRTAQVLADTMAEAHMWANDLPLHGSLATDIIEGQKAKLRELTRNKYLIGGDAW
FT                   FDPEANTPDTLKVGKLATDYDYTPVPPLEDLTFRQRITDRYLANFAASVKA"
FT   gene            complement(566599..568551)
FT                   /locus_tag="ABAYE0558"
FT   CDS_pept        complement(566599..568551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0558"
FT                   /product="hypothetical protein; putative Phage-related tail
FT                   fibre protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85526"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Y7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85526.1"
FT                   /translation="MAALYHSLFTEKGLELLRESIQNGTKLGITHMSFGDGGGDLPIPD
FT                   ASFTQMINEVYRVQLNRLAPSRDNPNWLEADGVIPSAVGGFNIREVGLWAEDVMVAYAN
FT                   YPPTYKPSGDQGTAQIKTIRIVLQIDNTANFELKIDASVVMATLQSVEEAKLEAMNHAD
FT                   SLVKEQIRYVDNLNSLNDIENPQDKQIVYVTGMGEFEYSLTLMTWAPKQRSDNTILTAE
FT                   GRFQRDKNKDYLDLKDYIFLAEGKDWTKAIKQAETDAFNLKMGLKIPSGIFGYSEDITF
FT                   RCHTFGQGISNTWLQKLKPCSVIILGGSLRDLTVSPEGYLDNDQSDGIIADNSDRKLIL
FT                   NVLTEYHGGNGFVFKKGNLSRFIIRSRYNKGKGVLFTPDAPGDNKAAQLWLECTGNKRS
FT                   GFFMDHSLVNPSYNSGNHFGTIISQGNGADLVNDDKYDVVLSGNYNNLTIYTEYGAGCW
FT                   HKDTLKGSRIFYTNMSHINWKDEAGDSNEVSYIPSANGTRVIKYGKFQNVVVQNENGQY
FT                   SGKLTFTHTANNKFEYILGNSTADQNIYYPDKLFLRKGKGTFQPIFPRDNVVLNFGTIP
FT                   AGRSVEKSLSLLQLGLSSANNTVVVNPVGNIGAGLLWSCYIDSNDLDRVVIRLFNSNSI
FT                   DVTTADFPWKVSVFL"
FT   gene            complement(568563..569168)
FT                   /locus_tag="ABAYE0559"
FT   CDS_pept        complement(568563..569168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0559"
FT                   /product="putative phage tail protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85527"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Y8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85527.1"
FT                   /translation="MNLLPPNTTAFEKKIVETTSKTTELNTNLSSLIRIDDAPADFLSI
FT                   LAWQFSVDRWQDDWPDEVKRAQIKNSIKVHTYKGTNFALRSIVESFGYSLTVHEWWQES
FT                   PMNEPGTFQITIETNGRALTEKTSKTLVELLHDAKPLTRELKGIEINVINIEGETNVAC
FT                   GCYSGEDVTIYPKVDDPNSLIYPIFAFYEHETTSIYPK"
FT   gene            complement(569168..570070)
FT                   /locus_tag="ABAYE0560"
FT   CDS_pept        complement(569168..570070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0560"
FT                   /product="phage-related baseplate assembly protein
FT                   (GPJ-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85528"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Y9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85528.1"
FT                   /translation="MSVDFNSLPKPNFVDVIDYEAIFSERKEYFISLHPEDEQEDVRKT
FT                   LSRESEPVTKLLQENAYREMILRNQINEKALATQLAFAKGNDLDVWGANFDVKRLVITP
FT                   ADNSVTPPAPAVYEEDEDFRYRIQKKLDALSTAGPESAYEFHTLSADSRVSHVKCSSPA
FT                   PAHALLTILQRDTENNASTEELNKIVYNYVSAEKKRPTGDRVQVQSAEIVSYEIEAVLV
FT                   TKNVPETDPVLSAAQANTVAYTKEPKRIGKGVFFSDLYSILKVSGVERVELISPTAEIH
FT                   LNNFQAASCTAIRLSVRNE"
FT   gene            complement(570067..570414)
FT                   /locus_tag="ABAYE0561"
FT   CDS_pept        complement(570067..570414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0561"
FT                   /product="phage-related baseplate assembly protein
FT                   (GPW-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85529"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85529.1"
FT                   /translation="MMSRENGRKLETELDHIRQSVQDILTTPVGTRIMRREYGSLIYQL
FT                   IDSPFDEIATLQLYAATATALLRWEDRIILNSVSLVNDEEGSYFLDMDCSLVDSNKQAS
FT                   LSIPLSIGSAL"
FT   gene            complement(570411..571043)
FT                   /locus_tag="ABAYE0562"
FT   CDS_pept        complement(570411..571043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0562"
FT                   /product="phage-related baseplate protein (GPV-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85530"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85530.1"
FT                   /translation="MNADINRRLENLIRFGTIKTINPSKPIPLVTVDLDDIVTPEIRFF
FT                   NARSGNDSTWDPPSEGEEVIVVSPCGDIGPTSIVFYGLYNNEYPAPSDDLNKKIRVFAD
FT                   GCVIAYDVAAHHLSAVLPSGGKAIVTADGGVTVNGDTTINGNLQINGSTAMTGNHTVMG
FT                   SQLVQGSSHSTGAFSTEADVKAGDISLKNHKTSGVQPGDGESGGPIP"
FT   gene            complement(571116..571565)
FT                   /locus_tag="ABAYE0563"
FT   CDS_pept        complement(571116..571565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0563"
FT                   /product="phage-related tail completion protein (GPS-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85531"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85531.1"
FT                   /translation="MNNIQDLALYLQPLLDRLSPGERAKLAKNIGRDLRTSQRQRITAQ
FT                   QNPDGSSYTARRTRLRDQKGKIKRKMFSRIKSNTHLKVLSNSESIAVGFIGRINRIAKV
FT                   HQYGLRDRATRSAPDTVYPKRELLGFTDKEINLVESSFIKHINIK"
FT   gene            complement(571562..572089)
FT                   /locus_tag="ABAYE0564"
FT   CDS_pept        complement(571562..572089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0564"
FT                   /product="phage-related tail completion protein (GPR-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85532"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85532.1"
FT                   /translation="MKKPHALREYLLNAIPDLPQDPDRLLIFANDGKLMSTAANGYSFE
FT                   MAYTLDMIITDYAGDVDVFGVVLFTWIMDNQSELMANLNKVEEAITFEAELIDNSKYDL
FT                   HFKIPLTERVIVKKNAEGKFEISYPTEPQYTEFGPPTDFELIDKDGSTLATWRTADMQG
FT                   RSLDMPFPGKSP"
FT   gene            complement(572086..572928)
FT                   /locus_tag="ABAYE0565"
FT   CDS_pept        complement(572086..572928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0565"
FT                   /product="putative phage-related cell wall hydrolase"
FT                   /function="8.1.5 : Lysis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85533"
FT                   /db_xref="GOA:B0V5Z4"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85533.1"
FT                   /translation="MEYDMILKFGSKGDAVATLQKQLAKMGYKGVKDKPLSVDGHFGES
FT                   TEFAVIQLQRKFGLVADGKVGDKTRQALAGDSVSKFLKDEDYKKAAIRLKVPELVIRVF
FT                   GAVEGLGVGFLPNGKAKILFERHRMYFYLCQALGKTFANSQVKITPNIVNTLTGGYKGD
FT                   AAEYTRLSMAINIHKESALMSTSWGQFQIMGENWKDLGYSSVQEFVDQQQLNEGNQLEA
FT                   FIRFIEWKPGLLEALRKQDWDTVFTLYNGKNYKKLGYQAKFQKEWDHLEPIYREKTAA"
FT   gene            complement(572913..573182)
FT                   /locus_tag="ABAYE0566"
FT   CDS_pept        complement(572913..573182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0566"
FT                   /product="putative phage-related membrane protein"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85534"
FT                   /db_xref="GOA:B0V5Z5"
FT                   /db_xref="InterPro:IPR008473"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85534.1"
FT                   /translation="MIELLFQTVAVLAYLICGFRIATFSHGGNFHRGYSFFAATLIAAF
FT                   LGQSVHILFFKDPVTLWDAIFAILLAVLIWRTKGNVAKLIWSTT"
FT   gene            complement(573179..573547)
FT                   /locus_tag="ABAYE0567"
FT   CDS_pept        complement(573179..573547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0567"
FT                   /product="putative phage-related membrane protein"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85535"
FT                   /db_xref="GOA:B0V5Z6"
FT                   /db_xref="InterPro:IPR032637"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85535.1"
FT                   /translation="MGLRRFMPEPTTSTATIATLSAVSLLPFINGNALLGAVLGAAFIA
FT                   TFEKDLNAYQRIRNMLLATGIGYISAPLITEHTLLKADAVAALITSTLCLFILIKVVDW
FT                   VKTAKLSDILNIFRGGKS"
FT   gene            complement(573538..573747)
FT                   /locus_tag="ABAYE0568"
FT   CDS_pept        complement(573538..573747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0568"
FT                   /product="phage-related tail protein (GPX-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85536"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85536.1"
FT                   /translation="MKEIYAIQYDTVDAICWREYGRSTGVVERVLEANPHLSEFGPFIP
FT                   MGTKIQLPDIPTPQNKVQSVQLWD"
FT   gene            complement(573748..574251)
FT                   /locus_tag="ABAYE0569"
FT   CDS_pept        complement(573748..574251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0569"
FT                   /product="putative phage-related capsid completion protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85537"
FT                   /db_xref="GOA:B0V5Z8"
FT                   /db_xref="InterPro:IPR009225"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Z8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85537.1"
FT                   /translation="MFCFWLRSPPLTKPRIKMSGLIANGTFSNQDVVINSDPFFPSVSS
FT                   NHVREVLRLDSSVTNQRLISAIEAAVIHVNEQLESLLSKAPTLVEITTKQVNGKPIAAV
FT                   LYFRAVAAAAGAELCERYRSYDTTNNGSQKAEELTPTIDDYKRDLRFAIRDIKKVRRLN
FT                   VELV"
FT   gene            complement(574304..575050)
FT                   /locus_tag="ABAYE0570"
FT   CDS_pept        complement(574304..575050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0570"
FT                   /product="putative Phage small terminase subunit precursor"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85538"
FT                   /db_xref="GOA:B0V555"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:B0V555"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85538.1"
FT                   /translation="MLSPARRHRLQALAAKEAAKADEFGGVRPDASVYQLQLTELKNDI
FT                   HVLRSIQSQEKRAEAKKELIPKHMPYVLGVVQSGAKVEQDEVITTIMLWCFDCCLFEQG
FT                   LSIAEYALEQNLKMPDSFSRSTATIVAEEIGNAARIAYKQGEIFKINILEKAHKITTSF
FT                   DMPDEVRAKLLVALGRSYLQSDLYHLAVLFLKSAIAKHEKCGGKQDLQKAEKLLKEQSK
FT                   NSPEPMLNADGSQVVDDQGNLMFHPT"
FT   gene            complement(575061..576071)
FT                   /locus_tag="ABAYE0571"
FT   CDS_pept        complement(575061..576071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0571"
FT                   /product="phage-related capsid protein precursor
FT                   (GPN-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85539"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:B0V556"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85539.1"
FT                   /translation="MLISEKKMRNDTRKKFNHSLAKVAELNGVESAQVQFTVAPAPAQK
FT                   MEEKIQASSEFLQKINVVPVEAQTGEAIGLSVNSTIAGRTDTSGNGERNPTDPTGFGVD
FT                   KYECKQTNFDVAITYAKLDAWAPFADFHQRWTNAVAKAIGLDRIMIGFNGTSAAETTDR
FT                   VANPKLQDVNIGWLQKIRTNAPDRVMSAVTVGAAGTYKNLDALVVDAVNELIDEVHQDD
FT                   TDLVVICGRSLLADKNFPMVNDASDNTNVLAGQVLLSQKQIGGLPAARVPHFPDNALLI
FT                   TSFDNLSIYYQKDAKRRYIQEKPSKNRIEDYQSSNEAYVIEAYEKVALVEGITIQ"
FT   gene            complement(576103..576930)
FT                   /locus_tag="ABAYE0572"
FT   CDS_pept        complement(576103..576930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0572"
FT                   /product="phage-related capsid scaffolding protein
FT                   (GPO-like)"
FT                   /function="8.1 : Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85540"
FT                   /db_xref="GOA:B0V5X8"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5X8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85540.1"
FT                   /translation="MKKSKFFRVAVAGSTTDGRVIEATWIQQMAKNYSQDIYIALGNLE
FT                   HFRSINPDSTFGTYAKVIALKAEEVEINGAKKWALFAQVDAYDELIELHKRGQKLFTSI
FT                   EVNPNFADTGEAYLVGLAFTDTPASLGTQIMEFASKNPEANPFVGKKQDKNNLFTAAEE
FT                   ADLQFEDGQDAPAKGLFSKVLDWLKPQQEQQENQNKDQFKEVADSLEAIAKTFGENQTK
FT                   LKKVDTSYSELHNKHSKLEKEFNDLKAKLEGEENPSTPSAPENTGNFSEQIEC"
FT   gene            577062..578876
FT                   /locus_tag="ABAYE0573"
FT   CDS_pept        577062..578876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0573"
FT                   /product="phage-related terminase, ATPase subunit
FT                   (GPP-like)"
FT                   /function="8.1.1 : DNA packaging, phage assembly"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85541"
FT                   /db_xref="GOA:B0V5X9"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85541.1"
FT                   /translation="MLMYWLNEPMDKALNTPTNLTFDNRLTAKFLYWMGWRISSIAEFL
FT                   KENDKNVHAWKARDEWEKDAPAGRVAQALEAQLVKLIILEKKTPGDFKEIDLLMRQLER
FT                   MARIDKYSNGGNETDLNPKLKNRTSGPRKPTAKNQLTEEQIEKLCEDFDDGLFEYQKVW
FT                   YRAREQRNRAVLKSRQIGATFYFAREALIKAVTTGRNQIFLSASKAQAHGFKTYIKNFV
FT                   MQSIEIDLQGDPISITLPCGNTVQLIFLGTNAKTAQSYHGDLYFDEFFWVHGFATLKKV
FT                   ASAMAAQKQYKKTYFSTPSSKTHEAHAFWTGDAFNKGRTKENRVEIDTSHANLRDGALC
FT                   GDKMWRHIVNIQDAERQGCDLFDIEELIAENSPEEFANLYMCEFVDDGHSVFPLSVIQP
FT                   CMVDSWEVWSKDFKPLALRPFGNKPVWIGYDPAESGDSAGLVVIAPPEPDYPKFRLLEH
FT                   HQFKGMDFASQAQYIKKLTTKYNVKYIGLDKSGMGTGVAQLVLDFFPNLTTFNYSVDVK
FT                   TQLVMKAMDVINKERFEFDAGSTDVAMSIMAIRKTLTASQRQMTFEASRAENIGHADLA
FT                   FAIFHAFANEPLTLDDQTKSKKSSMEIY"
FT   gene            578876..579874
FT                   /locus_tag="ABAYE0574"
FT   CDS_pept        578876..579874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0574"
FT                   /product="phage-related portal vertex protein (GPQ-like)"
FT                   /function="8.1.1 : DNA packaging, phage assembly"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1837355; Product type h : extrachromosomal
FT                   origin"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85542"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Y0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85542.1"
FT                   /translation="MSDSKVQAFTFGDAEPVMNGRDLSQFYETWLCGNYYEPHISMNAL
FT                   AKSFKAMPYLSTAVFYKKNQLVSSFIPNKLIKSSEFERIAFDYLVFGNGYLQQIDNRLN
FT                   EPHHYDGLMAKYTRRMKRSNEFLQLLNGFEEHIFKPGTVCHIKGIDVDQEIYGTPEYIA
FT                   ALQSVWLNESATLFRRKYYNNGSHAGFILYMTDSGIDDDDVEGLKQAMKDSRGPGNFRN
FT                   LFLHAPGGKKDGLQLIPISELAAKDEFLNIKNVTRDDVLASQRTPPQLLGIIPSNAGGF
FT                   GSISEAREAYWYSEIVPLQNLFANTVNEWAGDQIIRFKEFSQLQFKQEKPQ"
FT   gene            581140..582474
FT                   /locus_tag="ABAYE0575"
FT   CDS_pept        581140..582474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0575"
FT                   /product="putative sensory transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85543"
FT                   /db_xref="GOA:B0V5Y1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Y1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85543.1"
FT                   /translation="MIISTFFKRAVPTNNDKICEAGMTQRLELHQVEQLTACKISLLLG
FT                   LNAEQNYIEQFFRFSLRLLKCQKALLTFNQEPYFWHHCPDGMTAISFKPSRHLKQCFAK
FT                   QQVIHHNHPSYQNLINYLKELNIECGRALAVHLVQPDQTSMGFAVFFDDDENCFEDDQI
FT                   QLLLDYCSSFMQQVELKFNYEELNELYEQQVALNSSKTKFFSIISHDLRAPFHGLLGFS
FT                   EVLAKERETLDESSIQNIADYLYDTSQSTYNLLESLLTWAMAEGGRFVYHPINFKLRQV
FT                   SNIVCDVLHTLALKKNIELVNAVSEDLKIYADINMMTSVIQNLVSNALKFTDVDGSGKV
FT                   FIEAKQVGTNVEITVRDTGLGMTEQQMANLFHPRITASFKGTAGEKGAGLGLSLCKRFV
FT                   EINQGKISVTSQKGVGTSFKVLLPSAQEVPEHHVEQQNTSEAKLV"
FT   gene            582543..585293
FT                   /gene="glnE"
FT                   /locus_tag="ABAYE0576"
FT   CDS_pept        582543..585293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="ABAYE0576"
FT                   /product="glutamine synthetase adenylyltransferase"
FT                   /function="1.8.3 : nitrogen metabolism"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /EC_number="2.7.7.42"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85544"
FT                   /db_xref="GOA:A0A0R4J8T3"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8T3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85544.1"
FT                   /translation="MNAEQLQKTLRASQYAEQVLGLHQAVLEQDYQIDQFAAPLSTEQI
FT                   YQLVDTTLDGIGDEITWMRALRILRSRLMFRWIWQDANQLTDVVTLTRELSDFADASIC
FT                   AAKAFARVALVAKHGEPLSYSGKVQDLIVVAMGKLGAQELNLSSDIDLIFAFDEQGETN
FT                   GRKCIDVQQFCILWGQKLIYLLEHITADGFVFRVDMRLRPWGDGSALAISHAALEKYLS
FT                   QHGREWERYAWIKARVVTGGKEGQDLLEMTRPFVFRRYVDYTAFAAMRDMKAMIEREVL
FT                   RRHIEDDIKLGAGGIREIEFIVQVFQLIYGGSKRELQDRQCLVSLEHIGEASLLEKQAV
FT                   LELEDAYLFLRRVEHAIQALNDQQTQLLPEEADLRQRIIDTLGFTSWNEFIDVLNEKRQ
FT                   KVKVQFKQLIEDTSSNAATENFGQLEQQLDEVLDDNAKNLIHEFWHGHALKKLPSNAVQ
FT                   RLKMFWPHLIEAILQSEQPQTALLRLMPLIESVMRRTVYLVMLIESKGALQRLVKMATV
FT                   SPWICEELTQYPVLLDEFLSMDFELPKRKDLEDSLRQQLLRIEIDQVEDQMRVLRLFKK
FT                   SNVLTVAASDVLAESPLMKVSDALTDIAEVSVNATLNLAYQTVAKRHGYPKDVEGKRCS
FT                   LDYKAFAVIGYGKVGGIELGYGSDLDLVFIHYLDEQADTDGTKSITGFEFAMRVAQKFM
FT                   SLMTTQTLDGRVYEIDTRLRPSGEAGLLVTSLKAYEHYQLKSAWLWEHQALVRARSIAG
FT                   DEALCQKFEIFRREILTQSRDEAYVREEVLKMRQKMKDHLGSSSEQKKHGIFHLKQDAG
FT                   GIVDIEFMAQYAVLAWSGTKPDLAHYSDNVRILEDAAKADCLSSEDATALIRAYLSERA
FT                   ESHRLALANQSMQVSAADWRSTRAVVCNLWQRLIDPTASVELDSE"
FT   gene            585306..586244
FT                   /gene="ilvE"
FT                   /locus_tag="ABAYE0577"
FT   CDS_pept        585306..586244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="ABAYE0577"
FT                   /product="branched-chain amino acid transferase"
FT                   /function="1.5.1.17 : alanine"
FT                   /function="1.5.1.18 : isoleucine/valine"
FT                   /function="1.5.1.19 : leucine"
FT                   /EC_number="2.6.1.42"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85545"
FT                   /db_xref="GOA:B0V5Y3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Y3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85545.1"
FT                   /translation="MECSMNLADRDGFIWQDGQLIDWRDAKIHVLTHTLHYSMGVFEGV
FT                   RAYETPKGTAIFRLQDHTKRLLNSAKIYQMKVPYDQAALEQAQIDVVRENKLASCYLRP
FT                   LIWIGSEKLGIAATNNTIHAAVAAWAWGAYLGDEAMAKGIRVKTSSFTHHHPNVTMCKA
FT                   KASGNYTLSILAHQEVAHSGYDEAMLMDPQGYVCQGSGENVFLIKDGVLHTPDIAGGAL
FT                   DGITRQTVMTIAKDLGYEVVERRITRDEFYIADEAFFTGTAAEVTPIREYDDRQIGAGC
FT                   RGPITTEIQKTFFDAVQGKNPKYEHWLTYVK"
FT   gene            586312..587202
FT                   /locus_tag="ABAYE0578"
FT   CDS_pept        586312..587202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABAYE0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABAYE0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAM85546"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:B0V5Y4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAM85546.1"
FT                   /translation="MHIVYVSDGKAGHRSQALGLFQAMQRQQANVTFEEVSINDLPVMS
FT                   LIKALFSSKKSLFQQAPDFIFGVGSHTHFRVWLLGKIFKKAKTIILMKPNLPTVWFNYA
FT                   VIPEHDGIPANNRVIVTRGALNPIRNEKRHQASRILIALGGSSKRHQWNQEKVLLSVQK
FT                   IVENNPDAEIILTTSRRTPAEFIDILRQQSFAQHLQIFPVEQTPQGWIFEEMQKAEAVW
FT                   VTEDSVSMVFEALT